4HRAA

Crystal structure of dot1l in complex with epz-5676
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
320
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPTSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVGKPVSYYLHTIDRTILENYFSSLKNPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent inhibition of DOT1L as treatment of MLL-fusion leukemia.
pubmed doi rcsb
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 88
structure length 320
sequence length 331
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4hraA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hraA02
1PRYA 1O54A 3FPEA 3GRZA 4U7TB 1FPQA 2BH2A 5EHGA 4YMGA 5KVAA 3EEYA 3UZUA 4AZTA 1TPYA 3C3PA 1JR4A 2YXDA 3AWIA 5EMKA 5HZMA 4PGHA 3G2QA 4RTJA 2PKWA 2O57A 5EVJA 3ER9A 3JWHA 4HRAA 2AOUB 3I9FA 3R9XB 5DLYA 3FPGA 3OU6A 4HTFB 2QY6A 4P7GA 3EEOA 4RYLA 1YFJA 3HA7A 5DX0A 1EJ0A 4PYIA 3FUWA 3BWYA 4AX8A 5EPEA 4E32A 1QAMA 3M4XA 5KQRA 1WXWA 4Z2YA 5DX8A 4YUYA 3EMBA 4MIKA 4BLWA 5G02A 2AN5A 4P58A 4U7PB 3THSA 5MHTA 3BUSA 4QDJA 4BP3A 3ER8A 1JG2A 3EVEA 1RI2A 2NXCA 5LSAA 3PLAE 1YZHA 4HG2A 1HMYA 2HNKA 3FRHA 5K01A 1XVAA 4X61A 4OBXA 4LWPA 3DLCA 1D2GA 4FSDA 3UA4A 5K03A 5FQOA 5HIJA 2V7EA 2XYQA 2P3OA 3PVCA 3SMQA 1NBIA 3UJ9A 4QTUB 4PYQA 5DTRA 1VBFA 5KYGA 1NV9A 5LQJA 3B3FA 4CKEA 1Q0TA 3KR1A 5IKMA 1AV6A 1XTPA 3C3YA 3G5TA 4R6WA 3HCDA 4XUCA 4V0RA 9MHTA 4Y30A 3MCTA 4F86A 3OE4A 3TQSA 3FUVA 3G89A 3P9KA 1JQ3A 3SM3A 5HILA 5EMLA 2Y1XA 1IXKA 1R8YA 3L8DA 5E2AA 4ER3A 1KPGA 1RI4A 3DR5A 3NTVA 5K0GA 4DCGA 3MB5A 4HSGA 2UYCA 3ID6C 4DMGA 5K8VA 3P9CA 2K4MA 3OCJA 3GXOA 4RV9A 3VC2A 4ER6A 3FPJA 3PX2A 2H1RA 3BGIA 4KDRA 1JTEA 3V97A 1X1CA 3LBYA 2JHPA 3M6UA 5FQNA 3TOSA 2AOWA 3U81A 4MTLA 5C9ZA 5HOQA 1YF3A 2AOTB 3HCFA 4QDKA 2PT6A 2ZW9A 4PINA 4PYMA 1F38A 3OE5A 3NJRA 5EKUA 4BY9E 1JTFA 1VL5A 4AZSA 4E2YA 2B9EA 4PCLA 3KQYA 4WVLA 3ME5A 1P1BA 2AVNA 5GOZA 1SKMA 1QZZA 2P1DA 1FJXA 2JH9A 3T0IA 1P39A 2E5WA 1SVUA 1B42A 2G8NA 5BW4A 2BR4A 2EJUA 2YX1A 4IV0A 4EK9A 4P7KA 2WA1A 3LKDA 4MQ4A 3LDGA 1X19A 4L7VA 1YB2A 1ZQ9A 3KQQA 3EVFA 3MGGA 1RJGA 3VC1A 5D1HA 4RVGA 4EQZA 4E2WA 4F84A 1JQEA 1N2XA 3M33A 3UBTA 2Z6QA 1XDSA 3R6TA 1BHJA 2QM3A 1FP2A 3GJYA 2NXJA 3ERCA 2OZVA 4GQBA 3EGEA 2PBFA 2XVAA 1Y8CA 2VDVE 3DOUA 5HFJA 4E2ZA 2HWKA 3E23A 5ERGB 3FUTA 4E70A 2PXCA 2ZBRA 3JWJA 4A6DA 2P7HA 3HM2A 2DPMA 4RVHA 3CCFA 3EVAA 5EEGA 3G8AA 3WSTA 1G60A 1I1NA 1I9GA 5U4XA 2IH4A 4FZVA 4RTPA 4RTQA 5EMMA 1HNNA 1NKVA 3BWBA 5K0EA 1JSXA 5DTMA 2GPYA 2ZULA 3G88A 3LCVB 1WG8A 3OU2A 3GIWA 3P97A 4DA4A 2AVDA 4FS8A 5EKXA 2F8LA 1R74A 2ZZKA 2ZZMA 5DRYA 3BKXA 1G55A 4XCXA 5CVDA 5EZSA 5F2KA 4AUKA 4C08A 3UA3A 2HR1A 1D2HA 2AN4A 3FZGA 3KQPA 3NW9A 4YV1A 4M7RA 4BLVA 5DT2A 5E1MA 3HCBA 3QV2A 4R05A 4ATNA 4AZWA 2YR0A 1WS6A 2P41A 3OZRA 1X1DA 5E9QA 4PYLA 1XXLA 3VYWA 2NYUA 1QAQA 1JSZA 2PXAA 3FTEA 2ZWVA 3EGVA 3TKYA 2I7CA 1SUIA 3GRYA 2IBTA 3K0BA 4XUDA 2BR3A 3P9IA 4B17A 1PJZA 2EG5A 1VIDA 2P35A 1NW5A 5F2NA 4O29A 3FPHA 3CJRA 3P8ZA 4OA8A 5K0NA 5LQUA 4RTOA 2EFJA 3GDHA 3SSMA 4LECA 2YXEA 3KPYA 4GOMD 3UWPA 5EHIA 4DKJA 1YUBA 4RX1A 2CKDA 4YUWA 3KPUA 3EPPA 3PS9A 4RTLA 1NW3A 3BGDA 3B7PA 3DUWA 3E7PA 5D1NA 4IV8A 1ORHA 4YV0A 4RWZA 1IM8A 1FBNA 1RI5A 3FYCA 2DULA 2ZBPA 1G8AA 2JJQA 5E8RA 5FHQA 3HEMA 2ZVJA 1R8XA 3BZBA 5E9JA 3SGLA 3G8BA 2Z6AA 2N47A 3AXSA 2BZGA 2UYQA 5F2OA 1AQJA 3GU3A 5FCDA 1Z3CA 2EX4A 2R3SA 3DMFA 3HNRA 4IWNA 3A7DA 2G1PA 5CCXA 2PX5A 5DSXA 3I64A 2HTEA 2A14A 5FA8A 5GM2A 4LWOA 3F4KA 3SVZA 4QPPA 3IV6A 3RIEA 1EAMA 5B1SA 3G2PA 3A26A 4GF5A 3TM5A 3JWIA 3BWMA 1SQFA 3GWZA 2PGXA 4PWYA 3MHTA 5IH3A 4GOOD 2PJDA 5T64A 5GINE 1KR5A 4YUZA 5BW5A 1SQGA 2I6GA 1BKYA 2VDWA 2CMGA 4WXHA 2FCAA 3B3GA 5KQSA 3OZSA 3KHKA 4POOA 2OB2A 4FT4A 4C05A 3LKZA 4C06A 2UZ4A 3CJTA 3A25A 1L9KA 4RTSA 3HA3A 2GA9A 3SXJA 3MTEA 2QRVA 2O05A 3FTFA 4PYJA 2IGTA 2OY0A 4QQKA 4OQDA 3EVDA 4NECA 1EIZA 2Y1WA 4EMSA 3DMGA 3DH0A 3FUXA 4GBED 4ER0A 2NXEA 3KU1A 2VP3A 3ELWA 4FT2A 3Q7EA 3UJBA 2CMHA 5K0JA 3GRVA 2C7RA 2IH2A 3DXYA 3EVBA 5GWXA 2ONYA 3A7EA 3NDJA 4CTJA 1NW7A 4CKCA 3OZTA 5HIMA 2LD4A 4R6XA 1N7IA 3HP7A 2Z6UA 5DX1A 3O7WA 1KPIA 5GM1A 3CBGA 1RJFA 5DM1A 5ICCA 3TM4A 5T67A 1XCLA 3B3JA 5EMJA 1ZHFA 3KPVA 1KHHA 3V8VA 2XVMA 1DCTA 5E1OA 5DTQA 1VLMA 1RI3A 1YZ3A 3R3HA 4GOLD 4R8RA 2PWYA 2OBFA 5DM2A 2JH8A 5LQNA 3VSEA 2AN3A 2KW5A 1X1AA 2PLWA 3B89A 3P2KA 3TRKA 5CVVA 2OXTA 4E31A 5FULA 2YQZA 3Q87B 3KQTA 2XYRA 3MERA 3NDIA 4KWCA 4CWAA 2C7QA 4MHTA 2ERCA 2OPBA 3KKZA 5EEHA 3REOA 4GOND 5DXJA 3DXZA 3EMDA 1QYRA 3OFJA 3TFWA 3PTAA 3M6WA 4OQEA 1EJ6A 3OPNA 2O06A 3SX0A 2G70A 4KVZA 3BGVA 3EVGA 1V39A 4YV2A 4EKIA 2ZIFA 3OFKA 2GAFA 5K0LA 3GO4A 5EOVA 4C04A 3P71T 1KYWA 3P2EA 3ORHA 5EC8A 3CC8A 1L3BA 2AOVA 3DULA 1KXZA 3DMHA 4KIFA 2ZCJA 3PX3A 1SG9A 1M0EA 2V74B 3O4FA 3LCCA 2QE6A 2IIPA 4LG1A 1JQDA 3UJAA 1VQ1A 2WK1A 3E05A 2AOXA 3LECA 5CM2Z 2PX2A 5DPMA 1KIAA 2P7IA 5ICEA 3UFBA 2PSSA 1RJEA 3LCUA 4UOEA 3I53A 3UJ8A 1EQAA 2QRVB 3LL7A 3M6VA 4CXMA 2BR5A 2AZTA 4K6MA 4DF3A 4QPNA 2EJTA 3P9NA 5DRTA 5FTWA 4EVIA 1NV8A 5BP7A 2XBMA 2PY6A 5DM0A 3LDUA 4ER5A 3T7TA 1R18A 4KIGA 2GLUA 3LX6A 5FA5A 3G2MA 3PB3A 3BKWA 3DXXA 2JHCA 5DSTA 4E33A 1H1DA 3O31A 4ZTBA 4DM3A 2IH5A 4DQ0A 1AF7A 3UJDA 2PV0A 2ZIEA 3QOWA 1L3CA 3HA5A 5ICFA 2ORED 3K6RA 5LQRA 4BLUA 2XYVA 2C7OA 3IEIA 1VP9A 4AZVA 4HGYA 3KPWA 1OR8A 4QVGA 5E1BA 2ADMA 4RTNA 5KS2A 2B2CA 5FHRA 5T6BA 5HEKA 3TKAA 5GIPE 2ESRA 4IKPA 1L3IA 2ZTHA 5DWQA 3UJCA 8MHTA 2IDJA 1EG2A 3C6MA 1QAOA 3ANXA 3FYDA 4M36A 1N7JA 4YUVA 3HVHA 5E9WA 4ISCA 2G71A 1XJ5A 4PYKA 5K09A 3IYLW 4M38A 3SR4A 2PT9A 2PXXA 3KQVA 4EKGA 2OO3A 3SSOA 3MCZA 5JUWA 1D2CA 1O9GA 3LPMA 3NVMB 2P40A 3BXOA 1O9HA 2FK7A 3GCZA 3LGAA 3AJDA 1KPHA 2CWWA 1NW6A 3IHTA 1JG3A 4H0NA 1G6Q1 2IFTA 1NE2A 4FSXA 3LSTA 3A4TA 2VZ9A 5CVUA 5K0CA 5GIOE 3P2IA 2O07A 1SUSA 3I5UA 3THRA 2Q41A 1AQIA 3B5IA 1UIRA 4RSRA 1XDZA 4X63A 5LR6A 2B3TA 2H11A 1L1EA 2ZIGA 4PYOA 4CTKA 4PYNA 4Y2HA 4RTMA 5EGSA 5FADA 4PIPA 2GB4A 3GNLA 5EQJB 1YFLA 2HMYB 3DTNA 3G5LA 3D2LA 1UWVA 3C0KA 2ZFUA 3GRRA 2ZBQA 4R8SA 1M6EX 4PCAA 3JWGA 1ZKDA 2B25A 4X41A 5CVEA 5EZQA 5FWAA 4PIMA 5EIWA 4CKBA 2ZZNA 1VE3A 4PGGA 4GC9A 1NT2A 3E8SA 4GUAA 2OB1A 3I58A 2BM9A 3LHDA 3X0DA 3BWCA 4C03A 4RVDA 5HIIA 4QVKA 4X60A 4X1OA 2O0LA 3EVCA 4KW7A 2G72A 5CIYA 2VDUE 1ZGAA 5EG5A 4M37A 4DCMA 1WY7A 2QYOA 3GRUA 1BC5A 3HCAA 2YUIA 3FPFA 3NWEA 1VPTA 2ZLBA 5ICGA 4RTRA 3HTXA 2YVLA 3HVIA 3EGIA 3EVZA 4A6EA 1IY9A 4GC5A 3M70A 5E8JA 3KQSA 4OBWA 2JG3A 3PFGA 3NMUF 5EIFA 4GEKA 2NP7A 3FTDA 2PX8A 5GP1A 3MQ2A 1RJDA 2IBSA 1NW8A 5K05A 3DLIA 3CKKA 3ELUA 2YXLA 4C07A 5LQAA 2HV9A 4E30A 1I4WA 4E2XA 1MHTA 5CD1A 3TMAA 1F3LA 2IDKA 1M6YA 3HVJA 3HVKA 4QTTB 4PNEA 2AR0A 3KR2A 5E2BA 4RTKA 2VS1A 4KRGA 4F85A 5FWDA 2YTZA 4YUXA 2GS9A 4C4AA 2PVCA 4FGZA 1Q0SA 3A27A 1G38A 4HGZA 2IPXA 1DL5A 1P1CA 2OKCA 3ELYA 4ER7A 3M6XA 2UYHA 3RW9A 3R0QA 5DXAA 2I9KA 2AOUA 1INLA 3CGGA 2FPOA 1VP3A 3KPJA 3TPZA 1QANA 4HTFA 4DZRA 5M5BA 5CUQA 2NXNA 3TR6A 2ONZA 5HIKA 4QQNA 2GH1A 3GGDA 3UJ7A 4OX9Y 3AXTA 3UJ6A 1T43A 2B78A 3C6KA 3PT9A 3S68A 5LQCA 2NP6A 5FUBA 2P3QA 1MJFA 3KR9A 2PX4A 5C0OE 2FYTA 3LDFA 5DM4A 3MTIA 3KQMA 4OA5A 10MHA 5K0BA 2CL5A 5LQKA 1P91A 4PONA 3OU7A 4V0QA 3T7RA 4BP1A 3AY0A 3CJQA 3H2BA 3SSNA 1UFKA 2H00A 5CCBA 4P7JA 4HH4A 2BM8A 5K0FA 2OYRA 1TW3A 1DUSA 1ZGJA 2FRXA 4P7FA 5H02A 1XDUA 4RVFA 2R6ZA 4XUEA 5E1DA 4MWZA 1KP9A 1TW2A 3R24A 2I62A 3RODA 7MHTA 1RI1A 3QOXA 1KYZA 2C7PA 4JXJA 3KQWA 1R6AA 1XCJA 2AS0A 3CVOA 3LBFA 2JHAA 5BXYA 3NVKI 1X1BA 2FHPA 3HCCA 3FTCA 4FR0A 2UYOA 3PFHA 1JG4A 1R00A 3KR0A 3FUUA 3ELDA 3MAGA 3NWBA 4KDCA 1BOOA 1WZNA 5P8WA 4YMHA 2ZWAA 3HCEA 3T7SA 1JG1A 1WXXA 3TLJA 2PWPA 3BT7A 2ZSUA 3G7UA 1ZG3A 3DP7A 1FP1D 1NBHA 1U2ZA 3G2OA 2P8JA 4HC4A 2IP2A 5CVJA 1G8SA 1ORIA 2NNWB 3KQOA 3FRIA 4G56A 5JR3A 4FP9A 2WA2A 5C1IA 2P3LA 2AOTA 2FK8A
chains in the Genus database with same CATH superfamily
1PRYA 2IELA 1L8AA 4UFOA 4HAZA 1JVNA 3THYB 4AZTA 2RGXA 3F7NA 3OC6A 2R1ZA 3CB4A 2C4TA 3BA6A 4X4IA 821PA 4ZC1A 1FTYA 2VQDA 2NTYC 4H1UA 5GJWC 3W34A 4D8VA 4EHDA 3T7AA 2FWMX 3VNSA 4DWWA 4MQBA 2IVBA 3W8RA 2PTGA 2QY6A 3NR2A 4OYLA 4B4WA 3MMXA 3TBKA 4NJOA 4V1CB 1GZHB 5BXQC 1QIEA 1HE1C 1TK2A 3FUWA 1T8PA 3BK1A 4UCXA 4YASA 1JXMA 3KUDA 1BD4A 1QPZA 1GL9B 2EBFX 2GZMA 3RT1A 4OB7A 1POXA 4LSWA 4BNUA 2DXIA 2CEAA 2XRMA 3K70C 1IPEA 3VZRA 4IMRA 1MX1A 3ZTWA 1NBMD 4FMPA 5DWVA 4LJ6A 1IMJA 3ORFA 2I8AA 4BP3A 4UVIA 3WWCA 4YYZA 1QH9A 4FDAA 3VA7A 3EVEA 3W2TA 2Q62A 1KQPA 2YZMA 2BTQA 1RXCA 1L5HB 4IQGA 1TT5A 1T5TA 2HNKA 3HXPA 4GMGA 1TDJA 4AT1A 5F78A 1P2FA 1E6EA 2Y1LA 4W1RA 2RAFA 3CW9A 3DBVO 4B40A 2IYZA 4B44A 1E9DA 2B8WA 4LWPA 2FP4A 4MH0R 3IVRA 4A73A 4PU3C 1EUDB 1X9IA 2FSVA 3V2IA 1EVYA 2BGRA 2P3OA 3PVCA 4I8XA 1U0BB 1YDWA 2AMLA 2C61A 2DR3A 3CRRA 4HWOA 3RTAA 3T54A 4D81A 4K05A 2BTOA 2XVXA 4G1FA 3TGWA 4C7JA 3IBTA 4YMLA 1LLIA 4L4ZA 4M8KA 4P0QB 3KP1A 1W88B 1G17A 1Q0LA 1K0FA 1TCBA 2FY8A 4QRDA 2O8FA 4GMHA 5LN1A 1LGYA 4JFAA 1K6JA 2EWVA 4RZXA 2RI0A 4O4IF 4CL8A 2ZJ1A 1B6TA 1EX1A 1ZNWA 2D7JA 2WHPB 2WJPA 3IILA 4FYKA 4YO8A 1KKUA 2D7CA 2F8MA 4F2DA 2UYCA 2A7XA 3ID6C 4AJ9A 4YRNA 3QG5A 4N8EA 5BRNA 2DH6A 2GZDA 1DTEA 3JATB 1MJ5A 5I8ZA 5EHZA 3UAVA 3U44A 3A6JA 2ZI4A 3NGXA 1T5SA 2Y27A 1LPAB 4Q34A 4XR9A 1ZPQA 2XKBA 1E2FA 1C0PA 2B69A 4IHJA 4M9CA 2PRJA 4EJMA 1KYIA 1TGYA 3LL4A 1Y8RA 2G04A 2X2FA 3CEHA 3K1AA 3KQYA 2BHRA 3ADDA 2NUAB 1G21B 3SYLA 3R5TA 3U9SA 4FU0A 3TLYA 1QHIA 1TM2A 1DDOA 2VK2A 4GVLA 1J90A 1DRJA 2GMWA 3C43A 4J0DA 3T3PB 4EG5A 2C5GA 3F6BX 3IAM1 1ZVVA 2P0YA 3EBLA 3UMJA 3O4HA 4A8JA 3ZLTA 4FFBB 3AVOA 2IHNA 4J7XA 4DDWA 1W0JA 4ZT6A 2DE0X 3NV7A 3O2JA 2Z5VA 1UC9A 3MGGA 1S01A 4G36A 2DTDA 2REOA 2G0AA 1SWWA 2L69A 3OPYB 1NUTA 4HK4A 4ID9A 4J4BA 4M0UA 1Z3IX 3AR4A 4QEDA 2COKA 1DKQA 3H1TA 3I05A 1SXHA 1ORWA 1PJSA 5FUQA 1UEJA 1VYTA 5HFJA 3WV4A 2XGJA 1PT6A 4K8RB 5JI3E 5L3QB 2Q2OA 2YV2A 3ZI7A 1G0OA 4MWSA 4TN1A 2VP0A 5K3FB 3Q88A 1KF0A 1DQNA 1SQ0A 3DFMA 2Q6LA 1CJUC 1C80A 2PXLA 1E4YA 1TTQB 3L7JA 5SZJA 3RV4A 4LDZA 3TSAA 3GGPA 1HNNA 2N46A 1TCVA 1N36B 5LD2B 3UXYA 3ZHXA 4UQPA 2XE4A 1ONBA 1ZGHA 4WD3A 2GD1O 3GJRA 1I14A 4G1VA 3B5JA 4K6CA 3FFBA 4MXDA 1QYVA 1K7YA 5DRYA 2V0CA 1NJGA 3DQPA 3FI9A 4KXVA 1X6VA 1GU7A 5G4LA 1IK4A 3I73A 5FFNA 1XTBA 2BBTA 1JA1A 3CROL 1V95A 4M7RA 4F1JA 3O91A 5DT2A 1SA0A 2QVBA 2OWDA 2OG2A 3OZRA 2NYUA 4ALIA 3T3NA 1VGRA 4TYYA 2C54A 2FG7C 4WSOA 3EXEB 4JP3A 5TX7A 3MJSA 1KNXA 5K8CA 5KNCH 4UAGA 4MJ3A 5JG7A 1WTAA 4GI1A 3UG6A 5F3WB 2X22A 3A3OA 4R1LA 2I4TA 3KAKA 1YCHA 1ISMA 4URYR 1HT1E 2R6HA 2XOKD 3K30A 4HQ6A 3WBBA 5F2NA 1MPXA 1IOVA 2JLRA 3E3NA 5K0NA 4OLHA 3GDHA 3F9IA 4LNHA 1PR5A 5FLYA 5LMUB 1O0SA 4FN3A 2JD0A 2L42A 3FSGA 1LI7A 3FSRA 1YZYA 3ZDYB 5DBIA 4ZHQB 4QO8A 5MGNA 3WGLA 4RTLA 3BGDA 4R1UA 1SVLA 1XTRA 2H0RA 1QFSA 1PG5A 2IYRA 2P78A 3MUOA 4RVSA 1DQRA 1XD2A 3PE6A 5E8RA 4DCTA 4KUEA 5AVRA 2VQSA 1R8XA 4AZ3B 1ECBA 3AXSA 3Q3HA 1FMLA 3L77A 4XOUA 4UE6A 3EHEA 2XI4A 2AT1A 3GU3A 1QMPA 4UJ3A 1R0KA 1RJWA 5GV8A 1EDZA 1XAGA 3TLEA 2IOFK 2WTEA 1EDOA 4WHMA 3T94A 2G1PA 1JR3A 4N8DA 2QI9F 2RCYA 4Q3EA 4BO7A 2H8RA 3AEYA 5AOCA 4AIIA 2J0UB 2CXQA 4JYZA 2DPHA 2VTKA 3HBLA 4D9BA 3R7WA 4O33A 4NYJQ 4P0TA 4XE5A 5IF3A 3F7TA 4HADA 2DUUA 3P94A 1AGNA 2ZRIA 4BZWA 4F9EA 4CEJA 3BJZA 3ZXYA 3DOOA 1EM6A 4J0KA 2ZJFA 3IV9A 3KUCA 3DF9A 1VE1A 1W49A 2VDWA 2R11A 3BQNB 3CG0A 3UG7A 1I3LA 5KJEA 2A1UB 1IONA 3V4LA 3WI7A 2OB2A 4RJKA 3S55A 4JB0A 5FIUA 5JZMA 4UU1A 2ENUA 1N2JA 4I55A 3ROMA 2DQKA 4W9RA 1UBFA 1W8DA 2I2BA 4FD2A 4PYJA 3NXHA 4FX5A 3DMNA 4J2HA 3DE3X 4FFOA 4NECA 2QX9A 5DH9A 3GBPA 3VI3B 3R3WA 4GPEA 3KYJB 1CQXA 5K0JA 1XZIA 5EHXA 5I7UA 2AJLI 1MZPA 3MLBA 2FKNA 5KQLA 5HCUA 1CLUA 1J8YF 1KJYA 1JDUA 4Q47A 1V6AA 4CKCA 1ZR4A 3L1JA 1BRMA 3HB1A 2HRRA 2PBRA 4I08A 4UZFA 5C5IA 2I99A 1TUGA 4DEYA 3WB9A 4W5TA 3S5JA 3FOAA 3E53A 3M8KA 4K88A 5GM1A 4HB2A 2XIQA 3OIDA 3DV9A 2OE2A 2BWJA 2TMGA 2JAWA 4TS3A 4TV8F 4LYGA 3LT5A 1GXSB 3D8RA 4P5PA 5HG0A 4GQIA 1PHRA 1H23A 521PA 3R9IA 4AZ0A 4DWJA 4E1VA 2X6RA 2LYSA 4YP7A 5LQNA 2QK4A 3K8YA 3SYNA 4E31A 2OXTA 3EA4A 3O6VA 4NVRA 1OI2A 4TT8A 2QUIA 1DXQA 3AETB 3MMNA 1T3GA 6LDHA 2QE7D 3GJSA 1T4MA 3V00A 3VYTB 3Q6MA 3T7KA 4E88A 5F77A 2FRDC 1NOIA 3ZI0A 3GPIA 4G9BA 3G0HA 4KKXB 3I5AA 2XQIA 4NENA 3SS7X 4S2EA 5AHWA 5LDHA 2LYQA 2R63A 2IIQA 1UK6A 3PNMA 4FQ7A 5JWRA 4WK2B 4CW7A 3W9SA 3H6KA 4LJSA 1Z2DA 3JQ9C 2O38A 4JJKA 2Q6IA 3O73A 4LTDA 2YH2A 4B8YA 1NQUA 3BHNA 3LCCA 3GAAA 2X2PA 3RFTA 3TR0A 2ZYWX 5EQDA 1AUOA 1UPXA 2OBBA 3PQDA 1JEEA 2BP7B 4JELA 4TTIA 1BJTA 1CY8A 2JF0A 1SU6A 3NBZC 1E3OC 4WOPA 4HATA 3IIIA 2B4QA 1JEQA 1CUXA 2WUEA 4NR0A 4OMCA 4V2UA 2ORWA 2VNJA 4XM0A 2WAOA 1MH9A 3QVVA 1GY8A 1FFXA 2DHRA 1J0DA 2I5PO 1H2ZA 3STXA 4QPNA 4B7XA 2G67A 3KV3O 3W5DA 1P2TA 4KQWA 4ETIA 5BP7A 3MJHA 3A1DA 2A9JA 3QWGA 2R8BA 2YJ4A 3ETHA 3RVQA 1ORTA 5IM4A 5F1KA 2WLSA 1P9RA 1D8AA 3I1YA 1UBJS 2EARA 3MTJA 4R1SA 3T3EA 4YAGA 1B16A 2ISSD 4O6VA 4XLLA 2HC9A 3ZNNA 3DXXA 1LLQA 3EEQA 4MCXA 4RWEA 3RHZA 3MSCA 4DCUA 3QVGB 4GX1A 4L8YA 5LQMA 5BN5A 5FP0A 4F3NA 1PU2A 4KN6A 1GAXA 2Q3CA 1P5FA 1K86A 4NZYA 4JBNA 5J4HA 1ACMA 1JQLB 2PLFA 1Q7CA 3D59A 3KT0A 3MELA 3AEKB 5JSZA 1X7YB 3V6LA 3L5OA 3Q10A 3KPWA 4IIVA 1A3CA 2B98A 1MQSA 2CKMA 1PNTA 2VDNB 5FHRA 3KLPX 5KS2A 3ZIAD 5KYYA 1CY7A 1DJMA 5AHRA 5JS7A 1T1EA 1GSIA 1X94A 4LJLA 1EK1A 1F4VA 1OLUA 2NPIA 1PWEA 1RMTA 2ZAYA 4L02A 1BA2A 1Y63A 2P2CA 4MVJG 5F5LA 2VWHA 4QICA 5E9WA 4B46A 3RNOA 4YB8A 1KVRA 4J7CA 2UXDB 1DEXA 2ZSAA 3E8XA 3QRWA 2FF7A 4FHFA 3RB8A 2A9KA 5DI3A 5BYKA 4EKGA 1MAHA 5JUWA 2JJMA 2DBQA 4WGFA 2O0KA 1UJCA 3DOIA 5LM3A 3AFNA 2JIQA 1G2IA 1K5HA 3DMPA 5CHYA 4W5OA 4MV3A 2EJVA 3AJDA 3TQQA 2WSIA 2P2GA 3RYCB 3MILA 4DYHA 1NC1A 1V47A 1R5OA 4O02B 1SKYE 2IF0A 3UTCA 3S1SA 3R0IA 4KJZA 4YJGB 3H16A 1O6BA 3OCVA 4JLJA 4K6OA 1R50A 1ZWKA 4XKJA 3ZUGA 4A7PA 5BVGB 2AYXA 4EITA 3AYZB 1FU7A 2ATVA 4HGRA 4LE0A 5CJPA 3HH8A 3OX3A 3SJCA 2HSGA 1AT1A 3KB8A 4RTMA 3HSKA 4FDMA 5BWBA 5MFPA 3NRJA 2NV0A 3DZKA 3ITEA 1TRHA 3PTZA 1NF3A 1Z17A 2CVFA 2OMEA 1T15A 3UFDA 2HYDA 2V7BA 3FDJA 2FG6C 3H9JA 4E46A 3QXHA 4XPIB 2WB2A 4D4MA 3AB3A 3GJ0A 1GUDA 2W48A 4WBNF 2VJCA 1WE2A 5ELMA 4UMFA 1V7CA 2AG8A 3IQHX 4D9CA 5KEIA 2YHIB 2EZ4A 4K81B 5K99A 3ESYA 4KACA 1FSZA 3GROA 4WXEA 3TLKA 5LDDC 3DEZA 2ZIWB 1PIWA 3A10A 1IWPB 2XWPA 3E9NA 2H29A 2PX0A 1VFNA 3CEPB 2I03A 3PGLA 4H6WA 4NPHA 3UFXB 3B7WA 4AJ2A 3EVZA 3PCXA 4LNUB 5AKKA 5NULA 3VBEA 1S4MA 5AW1A 1E9FA 2K2QB 4OBWA 3K71B 3R77A 3H1BA 1M6VB 2OAGA 1GA1A 3DLIA 3ELUA 4OFZA 3D4NA 4DARA 1D4AA 4E2XA 3HYSA 3HN7A 2CZGA 4WI1A 1OMOA 4JBLA 1C3EA 2UZAA 3TZQA 4K8OA 4QL3A 2XDAA 2JFGA 3AU9A 3L0YA 4FXPA 4KQKA 3THYA 4C4AA 2W4QA 1AN9A 4H08A 3F46A 1IEVA 1DUIA 2Q1TA 2Q5CA 2QP3A 2GN9A 3C3CA 3H97A 4QHTA 1JVSA 2PPLA 1XP5A 4D8XA 4F2WA 2AHRA 4CF4A 2Q4RA 3COJA 1H6AA 1V16B 1G5RA 3K94A 5IAKA 4PX3A 1VP3A 1RZVA 4V1CA 2NXNA 1NBOA 1U0SY 5TC4A 4DLLA 3WLHA 3AXTA 4LHZA 1C4WA 4BDTA 5F7XA 3OIVA 1NFFA 3RVOA 3NTRA 2KPJA 1NMEA 4PE5B 4QYMA 4GLBA 3WRXC 3EH1A 4DIMA 3G1TA 4UEOA 4UHEA 2IGBA 5E4TA 1U1GA 1T1IA 2O50A 1E6CA 3AZOA 4ZKEA 1TKBA 2ZRBA 5KNCD 1RLTA 4H3HB 1RIIA 5JT1A 1L5HA 2EIXA 2DFLA 4KHPB 1JIKA 1DCMA 1Q22A 1Y98A 3QPDA 4Q24A 4KPUB 1JR2A 1TB4A 2Z9CA 3IAS6 4L85A 4YAFA 4C30A 1EUDA 3RQIA 2N0SA 1JHOA 1GQQA 1MAVA 2QAJA 2YRWA 3AG6A 3PRKE 4OOFA 1WU7A 4EFLA 3EPLA 3SK0A 1V2GA 4BDSA 1DC3A 1G8PA 2CD7A 4CIWA 6ABPA 1Q1AA 4DBLC 2IE8A 1L4LA 3LW7A 2WUGA 2QWXA 1AUXA 1ISPA 1W88A 3PUKA 2GJKA 2E4AA 3KQWA 4HAXA 2XZLA 4YT8A 3LBFA 1PQPA 2P9JA 3IPLA 4RLFA 4R0MA 4BPBA 1H5QA 3U3DA 1U2PA 2V9ZA 2IKQA 5JWHA 1VMIA 5DGCA 2AC2A 4LC0A 2GX6A 2RCNA 2WHPA 2A67A 1XTIA 1IQ0A 1QYIA 2PWPA 2JFPA 1O97C 3SCGA 2EZ8A 3JATA 3N0RA 4Z1MA 3HJUA 3CH4B 1KSHA 1LQUA 1XK7A 1GCIA 3CO5A 3O93A 3W4KA 5DMHA 4YRJA 4JLPA 5A7GA 4QJ5A 4BN4A 3QBVA 3LY9A 1KOFA 1EBUA 2QY9A 4YS6A 2FK8A 1RPEL 1OIWA 3LLUA 4JT2A 4U7TB 3QH4A 1L5VA 4YWJA 4ZVVA 3HJCA 4PO8A 1PQUA 3CCCA 5IC6A 5AW4A 3CUKA 1YKFA 3IMFA 2NUAA 4TXMA 1G21A 4PG7A 4HDMB 2O49A 2C7BA 4PHFA 1ZZ6A 1U4OA 3GJ3A 3EAQA 4QX6A 3FPAA 4AFNA 5HZMA 4I4TF 2PKWA 2V6BA 3D8BA 3QUCA 1WRBA 4RZSA 5L7YA 1D04A 4BKRA 3RWMB 1S3SA 1D8TA 4LRXA 4ME6A 1E5QA 1N0UA 3E82A 4R01A 4TTAA 4PZ0A 1OTYA 4S04A 4RYLA 4FFBA 3TLXA 6ADHA 2WJ3A 2AQKA 2WWFA 1U3TA 4AX8A 2HA6A 3TJRA 2IL1A 4AYWA 1GITA 3QY9A 2VPPA 4FYMA 2XUQA 3S3TA 2W0MA 3OPYA 2PR2A 4Z2YA 2B94A 3RR2A 4IRUB 3UJPA 1L8XA 3JVVA 1JXOA 3LWBA 4YBAA 4P33A 3IEMA 1AN0A 2ICAA 2QQEA 2BMJA 4AYXA 1YJ8A 3VX3A 4CT5A 3WGMA 5LSAA 3VV2A 1PJ4A 2W6ZA 5DBEX 2CYAA 5K3FA 4IIHA 2A88A 4Q05A 4G5GA 4QU9A 4M8IA 1JSCA 1W4AA 1OBVA 1DDGA 3KYDB 2FR1A 1D2GA 2WIAA 3H3FA 3SG0A 1Z7BA 4N01A 1K3FA 1J0EA 4LQ4A 3PQFA 1UJNA 4JLAA 5F35A 1L5FA 2YYYA 5KI6A 1J0AA 4CCWA 3KDSE 3QIAA 2CY0A 3EF0A 5A71A 4UAJA 3SIXA 1NJSA 2J41A 3X1ZA 1JDZA 2NQTA 3P9KA 1U9IA 2V6JA 3NAGA 5JJIA 1YVPA 1WETA 4LZNA 1ORRA 4MYCA 2BFFB 2NTEA 1AURA 4JYPA 1E4VA 2QLJA 1VL2A 2EKPA 2UKDA 3NTVA 2Q1WA 4H9GA 1DBVO 5E2AA 2BIFA 3GEMA 5FBHA 3OX4A 2ZJ7A 3OLCX 3K0AB 5BPFA 3BD8A 2FUCA 3P1JA 4K9KA 2WC1A 4Q1DA 3MLEA 4L0QA 3BAFA 4QHYA 3EXEA 3ZU2A 3V97A 1YQUA 5FQNA 3TOSA 2AOWA 2QP9X 2IXTA 3OIFA 2WPNA 5C9ZA 2H5EA 2O2CA 2NYRA 3KBBA 1FOEB 3OM9A 3DLPX 2H51A 1RYZA 4CI0B 4HFJA 3TIVA 2JH9A 2C88A 1CYDA 5EAIA 5KSYA 1F4PA 2EWWA 1OD6A 2DBYA 1UZAA 1AZLA 4IV0A 2Q8PA 4YCBA 3WGVA 3ZKAA 4N7MA 5B6IA 1Y9ZA 4BFWA 4L8VA 3CH5A 2FSIA 4IOKA 4ZP1A 3H7AA 2QP4A 3MLFA 2FDCA 1YB2A 3VQTA 4AZ3A 1D2EA 2Z30A 3T1YB 1WZIA 4AG5A 2R97A 1XZGA 2BH9A 2QN3A 3DB2A 3R6TA 4ZZ0A 4YQZA 3A4YA 4B2YA 1QRDA 2TMDA 2WSMA 2A9OA 3D6AA 4DSUA 3IUSA 3DOUA 3Q15C 3EIQA 4LCBA 5HF8A 2ORYA 1LU9A 2J0UA 3DVLA 4U7WA 3ZGVA 3RG2A 1JAZA 5BNZA 2O2ZA 3ORYA 4RM2A 4DDHA 4QREA 2CNOA 4Q3CA 2O3QA 3JQBC 5FF9A 2BGGA 5LBIA 4R31A 4U7FA 3ZDEA 5BQ5A 1CSEE 1RYFA 1QGED 2YN0A 3AHDA 1KGDA 5BUZA 4CMEC 3LPNA 3V9AA 3STUA 4WK0B 2ZUCA 4LJ7A 3QKSB 4ENSA 1WG8A 4B6JA 2A1UA 3M4YA 1C7FA 1D7AA 4C7XA 1NAIA 1ZN7A 3A0RB 1KEUA 2AKYA 1T9KA 4WKNA 5F1YA 5FOWA 5CB4F 5CVDA 4BVGA 1C9JA 3NUGA 2PNJA 1N4AA 2I6QA 1TD9A 4AJ1A 4FWTA 4K87A 1Q2UA 2BN4A 3TB4A 2J5KA 2Z56A 4OOEA 2GO1A 1LFDB 1CUIA 3ADBA 4F1WA 3SJBA 2RHDA 4LY0A 2H7CA 4W8OA 3Q40A 4B0OA 3CNHA 1AX9A 1CJVC 4L95C 1YACA 2YJNA 4D3ZA 4EFMA 1HR0B 1SUIA 2HM7A 1R3DA 1DT3A 1EVLA 2OENG 5EE9A 3OQBA 4HV4A 5ADVA 1I8TA 4HVLA 1AUPA 1M8FA 1IY2A 3CN7A 4KQJA 4LEIA 4WJKB 3VNQA 4C78A 1TJ5A 1NYTA 1N3IA 4Z5HA 1II8B 1W96A 4I6UA 1BYIA 2AEFA 3L0BA 1DW9A 3HGTA 1ZBDA 3LHIA 3I4CA 4CM9D 3GPCA 1GXSA 2C57A 5CW2A 1VE7A 2A1TS 2ZRDA 4RD4A 3UWPA 5KOJB 1GTSA 4IAOA 3UKDA 1OAOA 4EJ0A 1PEYA 3ROFA 1EP1B 2YNMD 3GC6A 1IZZA 4CFYA 4LOAA 1BXGB 1TADA 4A0HA 1FBNA 1GPJA 2ZBPA 1KDRA 3AETA 4KN8A 2PE5A 3V1LA 3HSYA 3UK1A 4JOQA 1FX1A 3I61A 1XZNA 4UW9A 4HUTA 5BR4A 2G5TA 1ZWLA 4JCCA 2B36A 4EJSC 1V6SA 4F5WA 1UWCA 4HVCA 5ALEA 5B4UA 3DMFA 5BSTA 2QR5A 2WHQA 3KV1A 5EWLB 1Q84A 1A7UA 1I4OA 3IT3A 4YPVA 3K6KA 3AR7A 4N5LA 4RK7A 3U3XA 3PDJA 1FFWA 3ZJYA 1UDRA 3EE6A 1L7OA 3L4BC 4CLHA 3NNDA 3LQ4A 3DFIA 4E7OA 2Q6OA 1NHGA 1KAGA 1SQFA 1XZ8A 3AY3A 3GWZA 4QAJA 3NKVA 5EZ6B 4EUKA 5F9HA 1ZGGA 3OLXA 5T64A 3ZHUA 1XAHA 2QZJA 4DTCA 3FLMA 2GJ9A 1SQGA 2BP7A 3RVJA 1HE2A 4GYKA 4WXHA 5D3MB 2QQGA 3QKIA 5EJ2A 5UKDA 4OAQA 3HLYA 4PPGA 4QSMA 2AI3A 4C05A 2ZAGA 3L7KA 3A25A 3C1UA 3LH5A 4RK1A 3PA6A 4XYMA 1LVHA 3O26A 3K09A 1N75A 2BL4A 4EI7A 1U3VA 2OY0A 4IWXA 4W7IA 1E3SA 2V7VA 3C8UA 5A02A 2VDKB 2E55A 2VDRB 2VQ3A 2Y1WA 4MB0A 3PNVA 6NULA 3CKMA 1CUHA 3A3NA 2LCVA 4LN1A 1H9CA 2BLLA 4IIBA 2ZT5A 4FWBA 4QYSA 4ZV7A 2IX3A 1DQZA 1K06A 5EJ9A 2G80A 2DG2A 4ZI7F 2B4YA 1A1SA 4HUQB 5HX7A 2BGKA 4HX5A 5JAPA 1KDTA 1X1EA 2FOXA 1Z08A 2ZBGA 1Z29A 3QVGA 1B8OA 1UBEA 2G1KA 3D6NB 4XA8A 5DM1A 3PJDA 5IDYA 1TQ2A 1L2TA 2JFQA 1EXMA 2XW6A 2C4NA 2GHIA 3HR7A 3OUUA 3P9PA 4HDSB 3TM4A 4BU0A 2YWBA 4MINA 4HPXB 1DRWA 2H2FA 3DBLB 3EY4A 3AEKA 3ONDA 3ZWDA 1X7YA 1XU7A 2C58A 2ISCA 3PF9A 2AIRA 5I9SA 4U5XA 1JHYA 1DE0A 2NUTB 3ZU6A 3CLRD 2XYRA 4LQLA 4E51A 2XJ3A 1KERA 1QV6A 3VTFA 4PVCA 5EEHA 2JIMA 5K2MA 3IDAA 4PLCA 2E85A 4YCSA 3LZCA 1K68A 1UC5B 5TR9A 4OQEA 2BUBA 2X8LA 1JWBB 1BWRA 3B48A 3QQPA 4OI1A 3FNHA 4OGGA 2W8BB 3VVMA 1YFZA 4YN3A 1GCOA 2H92A 1ATZA 1Y33E 1YGYA 2GBLC 1HTTA 2FDRA 1EK5A 2FPXA 2WYIA 3HB5X 1FS5A 4JP2A 4KXMA 2OFPA 3S2EA 4A6PA 1U4SA 3DEIA 4XIIA 4C6SA 1TCUA 4OFWA 2D5AA 4OBMA 1SKAA 3PXCX 1Q19A 3LVBA 2PRIA 4XLTA 5TVGA 2BFMA 4YJGA 2OBYA 4LJKA 3IPAA 3OUZA 1ZQ1A 3NALA 4OFBA 4KRYA 1A4XA 2ZB3A 4PC6A 4RESA 5CIQA 5BVGA 4R54A 2Y67A 3BHMA 3QYXA 3QFCA 5DPMA 1G9XA 3LIIA 5CFOA 2EKBA 3KOMA 2QSZA 1MCZA 1E8DA 1DHRA 1J99A 3RSHA 4QHSA 2OESA 1Z2AA 4BX8A 5CG2A 2IPMA 4NBRA 4C4PA 4NOKA 2AZTA 2WZCA 3PYLA 4GH5A 3S1AB 2J6HA 1VRCA 2A84A 4XPIA 2WBLC 3BFKA 1GEEA 5LWHA 2W2NA 5BWLA 3PDHA 3UAXA 5CFNA 1ZD8A 3PQ4A 3DAYA 1F06A 4WCDA 2YHIA 1A2BA 3T7TA 1VSTA 3C15C 2AW6A 2EKQA 3MT8A 4YRSA 2BBSA 3L2OB 3AL2A 2GSWA 5JDCC 2CF6A 1N0HA 5EE0A 4BFXA 5EJ5A 3K1JA 1M0WA 2H9IA 4LNUA 2QV0A 1H1DA 2QMYA 2O6HA 5F2EA 2I9PA 2P9ZA 1YR6A 2WJZB 1SAYA 1JZQA 3QFFA 3EXG2 2B0CA 3IJRA 1AKQA 4LY6A 2DAPA 3R5HA 4N5MA 3K6RA 2VQFB 4JLDA 1DLIA 1M6VA 1GA6A 3E58A 4CDMA 4FYXA 1QUFA 3TG2A 1WO8A 2FMIA 1CRZA 1WU8A 2G76A 2OYSA 1JEAA 4PSCA 3M6FA 5DN6A 5JHGB 1KI3A 3U1BA 4AY6A 3V1TC 5ILQA 3RTBA 3EEBA 3EVTA 1I7DA 3G5AA 1WVMA 3IRVA 3KIPA 2FZLA 5TRTA 1ENOA 3C3JA 4HS4A 4YUVA 2WEKA 3DE4X 1Q21A 1ULBA 1V16A 2O23A 1M2OB 3Q41A 4J1TC 4UU0A 5DK4A 1QWSA 2PX6A 5H3CA 2AQHA 5FOXA 3MM4A 3SSAA 3V46A 3O94A 3B9RA 1N0WA 3WRYA 1OBOA 4C5BA 4XWOA 2CZCA 3CKLA 5H4GA 1VG1A 1IJFA 1K7SN 1ZAKA 4A2PA 3K9WA 4NBLA 2DT5A 4ZYTA 3K9FC 3DZJA 2ZE7A 1JZTA 3T7IA 3KJFA 1NJ1A 3CGWA 3OTOB 2OGUA 1QK3A 4L0MA 3UO8B 1N2BA 1BW9B 3QVOA 4XFDA 4Y6QA 5MN6A 3DVSX 5C8DA 4B3SB 1A8SA 5KVSA 3TRHA 1P0IA 1ULAA 2J3QA 1T8UA 1L1EA 1XVTA 4RGBA 3A06A 4CMJA 1G6KA 4LZOA 4ZU6X 3TO5A 1YRLA 4KPUA 3LW8A 1YFLA 4HH1A 3A6GA 2FUG1 5B53A 4CETA 3ZHRA 2DSTA 4PEVA 5A7HA 2ZBQA 2ZYRA 4UTPA 2PFKA 2X8JB 2VT2A 5BV7A 4PIMA 4QEKA 1Z6YA 4X64B 4PF1A 1UXDA 2OB1A 3QVUA 5IARA 5EJ6A 2BSQA 1CHNA 1YZQA 2R7NA 3DEFA 5CLIA 2CLIB 3DB1A 1HLPA 3EVCA 4KW7A 1PGNA 2IEIA 2O3JA 4LQDA 2WTXA 4KYUA 3MHPA 1JQJC 4PX2A 1MORA 2VDQB 1L5QA 3ICVA 1P9WA 4UDXX 2C2BA 5KVQA 4EPYA 4BCCA 1I0LA 4F71A 1LC3A 3QBJA 1IY9A 1EM8B 1GAWA 2J9RA 3D4LA 4RD1A 3SEFA 2M1ZA 4BVLA 2HYIC 3AWDA 3E9RA 4HNQA 1OWOA 2NPFA 1RP1A 3LGXA 2F17A 4I9HA 4RD6A 5EKDA 1AKUA 3WWDA 3NHFA 1W76A 1YC2A 2AE1A 2X0KA 5LQAA 1YXMA 4Y2TA 5IMBA 3ROKA 1NERA 3VO1A 3WQSB 1IATA 1NP6A 2HA7A 1GRNA 3L82B 3M0EA 2C7VA 2YV1A 4DRZA 1A4IA 4DQUA 1GGVA 2ILVA 4Z4EA 4GWGA 2ZS9A 5GAJA 4IDFA 4HDMA 1PFWA 4IXWA 2PMBA 1B8NA 3HXLA 1D2MA 3DDZX 1EWKA 3LQ1A 4GI3A 3U40A 3UN1A 4DOMA 1U8XX 1YI8A 3WBFA 4BFVA 1TJ4A 1ZUNA 4LMBA 3BZUA 1INLA 1PDVA 2EYUA 1PR9A 1V3UA 3CBQA 5BPHA 4B79A 4BBAA 2ZJ5A 2HA5A 3RM3A 2Z3WA 2B78A 4W82A 3D8NA 5CTAA 1U04A 3T61A 3X1MA 3QI2A 3AVXA 2NYAA 3KOXA 5KREA 2HF9A 1EDDA 2PX4A 5F76A 1LI4A 3E7WA 3LDFA 1U6KA 5DM4A 2BLNA 2GRJA 2MWMA 2Y4NA 1GZ6A 2ZQ5A 1RWOA 3AUUA 3KQMA 1A7AA 1OXBB 4IVNA 1XN1A 2HHAA 3DO8A 4Z54A 5JMPA 1OLSA 4MEBA 5D5HA 3DSRA 1TYEB 1NOKA 2OTCA 4P7JA 3KYDA 4FFLA 3EZ7A 2HA0A 2B5OA 4MZXA 1D4ZA 2BCEA 1U31A 3NHRA 4QBIA 4YA6A 4XB6B 1M0SA 2ZYHA 2JFFA 4MW5A 3ZVNA 3DZHA 1KZHA 5FUWA 3S8MA 1OWLA 1NVVQ 2PL9A 3VU0A 1CYEA 4XSGA 2XRFA 4OB6A 4PAGA 2LE0A 2P5TB 1IHOA 4RHXA 2CXHA 1UMCB 2DKNA 1QGDA 2BJHA 2WICA 4S35A 3DHYA 4Q93A 2BFFA 4EJ2A 4DQDA 1U0NA 1H42A 3FB4A 2QA5A 2RAPA 3LT0A 2CXSA 1MDBA 1PLKA 1Y1TA 2XJ9A 3K0AA 3N75A 1R0RE 1PYDA 2GXUA 4QC2A 1T9ZA 1LPNA 2GJ4A 5F73A 4AKHA 1GQFA 3PXDA 1X9HA 1ZINA 1E9RA 1UBRS 2JHFA 2AKAB 2WU0A 3PSAA 1FFDA 2CXNA 2PCLA 1QHSA 3JYLA 3SIRA 5A4AA 1G19A 1L7XA 4D8UA 1ODJA 3G8YA 4JEUA 3PQ6A 1EXNA 2SECE 1YD7A 3VWSA 2AJBA 3AWIA 3BGWA 1POUA 3C8ZA 4K9DA 4RTJA 2PL1A 4Z99A 1HSOA 2OR3A 4ZI2A 1K6EA 1XZQA 2AC4A 5JJBA 1RC0A 2F62A 3VZSA 3EEOA 2GERA 1CY2A 3ETLA 3I9JA 5CK5A 2K6GA 5A3JA 4Q5IA 1EHIA 1TJNA 3QLUC 1ID8A 2JGFA 1GPLA 3SHTA 4UEWA 1XF9A 3R9XB 4ZRDA 1USUA 3A1CA 3WK8A 3HO6A 1JDBC 2EFHB 3F78A 3U26A 1G8FA 1SVWA 2OBLA 1PSDA 2Y68A 2HJGA 3CW2A 3OBBA 2VP2A 3BB1A 3SE7A 1FNMA 4DMRA 4W9NA 5JMWA 4TMTA 4Q3KA 3F47A 3BL6A 1HEUA 1WW2A 5T8KC 3TTYA 1OXUA 3E2PA 1EGQA 1NP7A 3JD4A 2VOJA 4FYIA 4KI0A 4NAUA 3UAZA 1G42A 2E48A 1ZUD1 2QXUA 4WPGA 2D62A 3MGBA 4R51A 3TNLA 3O1LA 4MA4A 4ESHA 1O9BA 1I2AA 5CT6A 3HU1A 1YT5A 4QWWA 3HI6A 2W2TA 2B2XA 1UKBA 5LQJA 4P2BA 1NV9A 3LUJA 1JH9A 2BKUA 3QKSA 4XIGS 5FR2A 1U3GA 1QOQB 1Z75A 1M8JA 4PPNA 5C31A 1Q0TA 4EG4A 2OL4A 3G5TA 1FUKA 1AXGA 2PG3A 3A6KA 3EWNA 1UXOA 2OORC 2XA9A 3B6MA 1OKKD 3SOZA 1BIFA 5G41A 3MWKA 4NCXA 4XD2A 1DAIA 3QKRA 4QOSA 4UCWA 4D41A 5IJZA 1OH8A 1B26A 4ZODA 3V34A 1WCYA 1KPGA 2O0JA 3PEWA 1HBJA 5AXAA 2NO4A 1UCFA 2ZE6A 5HNKA 1UK8A 2PD4A 3QFSA 1GSAA 1RM3A 1GVNB 3N8IA 1HL7A 2FUNB 3BGIA 3E9CA 1SURA 2W6ID 3PR1A 1YVUA 3HBNA 3LBYA 2WKRA 4Y2VA 3TX6A 4MA5A 3BGOS 1CZNA 1AS3A 1Y1RA 4OMUA 3KVRA 5HUJA 3IP6A 3HZIB 2IT1A 3VKUA 1II8A 4TLAA 4L8FA 1JTFA 4AZSA 4GWKA 1L5OA 4CNBA 1WSDA 1W5BA 4RY2A 2C96A 3KLBA 3V7WA 4KK3A 4R2WA 3PC3A 1RIOA 4U6QA 3RSGA 5KOJA 2RIRA 1RW4A 4AF8A 4B6FA 2VHZA 2W93A 4FBMA 4R71A 1QB8A 3B60A 3EASA 4K1LA 2BJWA 4W6ZA 1BXGA 1U2TA 3BOSA 4O2BB 3BB3A 4YRAA 5SZKB 5KTPA 1EBFA 2ACWA 3GELA 3LDGA 2PXUA 3OAAA 1VCIA 5BSEA 1ZQ9A 4RELA 4C4TA 1GUYA 2OXEA 1N5OX 5A3QA 2YJTD 2AXUA 2H63A 4RSMA 1KK1A 1HF0A 3HCPA 4PZUA 3HV2A 1Q1BA 5B3KA 1YKSA 2YMLA 5EWLA 3IAEA 5CD9A 3E23A 1JAIA 3H4MA 4R81A 4B34A 1E3IA 3CF6R 3STVA 3JWJA 1WIZA 3H8JA 1NM5A 3OEYA 3B13B 3ZLUA 2VZ0A 4HUJA 1XRMA 1WWKA 4GX2A 3FTNA 3IP5A 4NPCA 1JSXA 4CKZA 1EHYA 3CF0A 2XBUA 3MWJA 2Q49A 3FR8A 1A2KC 3LCVB 5D3MA 5JCOA 1YRWA 2AE2A 3GIWA 4AC9A 1Z4QA 2FW9A 3HACA 4JS0A 2GR9A 3OZWA 4XEHA 1USGA 3QTBA 1E9AA 2FLVA 3EAGA 1E6MA 5D8DA 2C9BA 2HPVA 2MYNA 2PU7A 4KTVE 1DFIA 2YS6A 3I28A 3SLRA 3TDNA 2AUNA 3G8CA 2ERYA 3O82A 4JC4A 2KWIA 4CL3A 5TEWA 5C4IA 1L4BA 5KOHB 3T95A 1K92A 4OXNA 4HXYA 1UBKS 1PCXA 4HUQA 1W5EA 4TXNA 4YECA 3S7ZA 4CEHB 3A9VA 1S3FA 2ZBEA 1BX1A 4M1YA 4ZPJA 5BMOA 1LW7A 3TSCA 2WKSA 3VOAA 3ZH2A 2AW3A 5IKOA 4CIVA 5EJ7A 4KVFA 4LVOA 3IAS1 1ATIA 1KYTA 3IALA 4HDSA 3M34A 5AK4A 1QE3A 4CE6A 3F4LA 4HYTA 2GESA 3ZX5A 2W6JA 5AQ1A 5JAOA 4KR3A 2DJIA 2N9UA 2PRYA 2XIJA 2QMHA 3A2NA 3DBLA 3N7UA 2XMQA 2WQ7A 1S8NA 1DO0A 3D02A 1UKYA 3JVEA 2HMVA 5J4VA 3ORSA 4AI6A 2I2WA 1DNPA 4OHKA 1ACJA 3SDZA 3GA0A 3VSCA 2Z2ZA 4IV8A 2NUTA 2B34A 4RWZA 3M9LA 4BNTA 1L6IA 4MCTA 4OK5A 1VIAA 4MV6A 1J4AA 3GH3A 4RVNA 4DNOA 5EWJB 3ZW8A 3U4IA 4DGQA 3BXZA 5TS3A 1JDSA 1CE8B 2PPVA 3PENA 1FRVA 2IQIA 4JVLA 3ZS9A 1VM6A 6AT1A 4EG8A 5BY2A 2EX4A 4H7JA 4GPAA 3EDMA 1IBMB 1SOUA 2W8BA 1QHNA 3I64A 3LS2A 1IWOA 1L4EA 1RBQA 4GXTA 4LDNA 1QZTA 3SDSA 5B64A 5K6AC 2FN8A 1RSZA 2XXJA 4LJYA 1VPVA 2FMUA 3MT0A 4NPAA 2PGOA 4MKGA 2QX4A 4ALJA 1G20E 3OMTA 1T3TA 1P9NA 4FGJA 4BNLA 1PBTA 3GRAA 1ZOPA 3HFRA 2YMPA 4B6OA 3J80A 4CG2A 2YICA 2DB3A 3VSDA 4IIUA 3SLKA 3LHFA 4JX9A 2GOYA 3L0ZA 5LOVB 2EC5A 1E2BA 1QV7A 2GM3A 4M7OA 2G9ZA 4WVFA 2HAEA 2WHRA 3VH3A 3TH5A 1O8BA 4LF9B 3S1AA 4DCOA 3FHCB 4FJ2A 3R4VA 4N0QA 4PNZA 4NMWA 2FSVC 1DAPA 2AA3A 2QUBA 3KNZA 5B55A 3TIXB 1CQIB 3EIHA 3KU1A 5HTKA 1IXRC 1CQZA 4EARA 4F11A 4L2IB 1YC5A 4XR4A 5L6LB 3BS4A 3OFND 2EX0A 3R74A 1DIGA 1MVLA 4K46A 4GKJB 4RMJA 4WACA 1N8SA 4H3VA 4JIMA 4DJAA 4FI3F 2I4NA 4LDAA 4R8KA 5LBTA 3HU3A 4EA7A 1IBKB 1KQFA 1NBME 3G82C 3NTXA 4TM7A 2R68A 2II6A 3DYIA 5LC1A 4EY5A 3KXDA 5B3AA 3L6DA 2YBEA 4WK6A 2BEKA 2RGRA 2GDJA 4A1OA 2ZUUA 2FE1A 1AG9A 5CK4A 2PLWA 1X1AA 2P9BA 3C4VA 1HQDA 2CNDA 4K0KB 3NWPA 2A9VA 4O3FA 1JDNA 3MBIA 2UVDA 2Y77A 2IXGA 2B1IA 3FWZA 3GHYA 4M7WA 2IYOA 3IUNA 4EG0A 3CH6A 1VA5A 2WV9A 3D6TB 3DWGA 3T7CA 4G23A 1EWYA 1IYZA 3TMKA 2EHDA 4CMAA 5LYJB 1M2OA 3ZZNA 2EJBA 3OOEA 1SNYA 2X58A 2QTBA 4OKSA 1ZM9A 4YV2A 5K0LA 2XODA 2Y2VA 1BVYF 4A8JC 3QI7A 3P71T 2J6BA 3GZTB 3DO6A 1X15A 1GRQA 2IPNA 4YRGA 3MZ0A 5A04A 4GPTA 1MNQA 3HJAA 4Y0NA 3UWDA 3D0OA 1JB9A 4Q2JA 1GP2A 5JYDA 2QZ4A 1BW9A 2XOKA 2QE6A 2P27A 2WK1A 3LYAA 1E1CB 3LECA 2Q6TA 2PX2A 2CXTA 4MKFA 3QU2A 2OR1L 3AR6A 2E7ZA 2ZR7A 2YWDA 4TN5A 4LZWA 3T3GA 3WR5A 3S8YA 5IDQA 1U1FA 2B99A 5TF4A 4JB8A 2RHJA 1JBKA 4BN0A 2J4CA 3EG5A 5TVKA 3U3ZA 4UBIA 3LL7A 4PX9A 4FNMA 3L7BA 4IX9A 4LXTA 3FPCA 5HS6A 2X8JA 1T4GA 3HCWA 4CLOA 4G5YA 3PRHA 1ZS9A 3GQBB 1QCYA 2JIBA 3A1FA 4RMHA 5DW3A 4LDRA 4QEZA 3WFJA 4ER5A 3FI0A 2FB9A 3N3AC 4DDKA 2ZI9A 1E0SA 5B4TA 1L4HA 2CK3A 1Q50A 3MRTA 3GT4A 3LQ2A 1F5SA 1R0LA 2P2LA 3BKWA 4OUKX 4KPFC 3RAGA 3W9BA 2VT6A 4F6CA 4CM8B 4MI6A 2OHGA 3WDMA 1EM8A 4I6JA 4UM9D 4U8HA 5FOVA 3RJTA 3C3EA 3S2ZA 3FR7A 5BMVB 1I3NA 3RI3A 2XMGA 2BEVB 3PLRA 3I12A 4G0VA 3EQZA 1YB4A 1URPA 3SZ3A 3TWOA 1ZHOA 5DHFA 2CBXA 2NIPA 2C7OA 2MSNA 2IZ5A 4JCYA 2O7VA 3STYA 1MAWA 1VP9A 2LNMA 3GZ4A 4UOQA 1QQTA 1OILA 5E1BA 3W1WA 4RTNA 2COEA 1QGOA 3HY4A 3IEXA 3L4EA 5HKOA 5B7NA 2O0MA 1S8FA 1RZ3A 3A32A 3UJCA 1P4AA 3W5SA 5L4NA 1RU3A 1V26A 2R6CA 2WP0A 4OFXA 4WNYA 3ZEAA 1CS0B 1JJVA 1DULA 4G4GA 4M36A 1N57A 2UVPB 3IQFA 4DCPA 1Z83A 2QLLA 1PR4A 2VUIB 1S96A 2WM9B 2XE8A 4IIYA 4FPXA 1LTHR 1XJ5A 2VNSA 2YWFA 1N9KA 4PYKA 5J5AA 1M5TA 2B2NA 3B7HA 1DAMA 4D0GA 4KXUA 4RV9A 4NH0A 3AI2A 2ZB8A 3NO4A 2P40A 1J6UA 1U7TA 1P75A 2PT7A 3HBAA 4HVAA 3I8SA 5AJUA 2C0PA 5IT9A 1GNPA 4Q1VA 621PA 5FOUA 4RNDB 2HXYA 3IPYA 2HSWA 2MINB 4CCSA 3GRPA 3EH2A 4ZT3A 2VZ9A 4HYYA 4RD0A 2HO5A 4BWVA 1S02A 3C3MA 4OHWA 2QMEA 1FYXA 1SOVA 3I5UA 5ENZA 2ATCA 1AQIA 1FYDA 2GK4A 2OK7A 4ANFA 1U5CA 1VLHA 1HDCA 1Y3CE 1DKPA 2HINA 2VXBA 4L5AA 4BQPA 5L7WA 3HXOA 1QHYA 1E4EB 1JHPA 1SELA 2XYGA 4FN5A 1QCZA 1DC6A 3H5RA 2NAFA 5FA6A 3OQMA 3ESZA 4YRDA 5BVHB 1OXTA 2J3KA 4LQCA 4MAAA 3RAPR 4POOA 4HXEB 3CCBA 1M6EX 2CNWA 1G63A 4FDVA 3TGLA 2O2XA 3X2FA 1GFWA 1OYWA 2AL7A 2P3SA 1UINA 3E0XA 4PXYA 2GN0A 5CLQA 4CDNA 3O90A 4CGZA 2F4VB 4MWDA 3ZWNA 1LV7A 1NVBA 2DHEA 3C41J 4RVDA 3VZBA 1WZ2A 1WQ3A 3A0UA 2XOXA 3F3MA 1NVKA 4YXFA 4QFBA 1UMCA 2ZUWA 4MI3A 4TLEA 3GCDA 2DECA 5GJCA 1B23P 3VDXA 1TQHA 1XYYA 4IDGA 4PLHA 2YWJA 2PUBA 3FKJA 4CIXA 1OWNA 1J21A 3UNXA 3RC8A 3CT6A 1F3OA 9ABPA 3Q12A 4PXSA 3TTSA 2JG3A 5J5VA 4YCCA 4D4KA 4LV8B 2WTUA 5FYQA 2OP1A 3VAZA 4L5YA 2UZ0A 1FZQA 4YLGA 1HNZB 3HKDB 3JRNA 3ZWMA 3FVWA 4LRYA 1O95C 4HRYA 4LCJA 4QTTB 3BD7A 1V5GA 5BSFA 1JRLA 3VH1A 1YRAA 4KMMA 4NAHA 2NQ8A 3KG2A 1ZEJA 4JI0B 1DL5A 1EVIA 1P1CA 3GUHA 4FTWA 5LB2A 2CJPA 5BNWA 2UYHA 2CSXA 1IUNA 1JVBA 4R9UC 4B3JA 3ECAA 5DCUA 1NDUA 3E3MA 2ALJA 2F00A 3I5MA 4OP2A 3WK9A 4B1FA 5B2EA 3GLFB 5H8WA 1E9CA 1ZNXA 1FSFA 1ZI9A 3L1KA 3QXCA 1WZCA 1L0BA 1WSBA 4O4IB 4E09A 1ZGZA 2VKTA 2F4NA 5H3LA 1FUYB 1QDUA 2JGNA 3ON5A 5JAUA 1EZ1A 2P1RA 3LIPA 4XVRA 2I2XB 4G3XA 4MVYA 4OA5A 5ESRA 2IZOA 4TM8A 1HDXA 1TJ3A 2C8LA 2SBTA 4I7EA 5K0BA 4BNWA 1E79D 3L5KA 2Y0BA 4D92A 1Y3FE 3S5UA 4BP1A 3H2BA 3G59A 4Z8XA 5EKSA 2B1JA 3VR2D 4PC2A 3QPAA 3HB4X 5A5GA 1E1MA 1JT2A 1V37A 1ZGJA 2XE7A 4P7FA 4UBJA 3W78A 3ZIAA 3WTCA 4MWZA 2IWRA 4ZA2A 4BUZA 3AL3A 5E7JA 3IESA 1R9JA 4ZT2A 1G8GA 1X8XA 1GZ3A 5AI4A 5SY4A 4DY4A 1D0IA 1F0KA 1U11A 2X13A 3L40A 3EG9B 3AESB 3CVOA 3IHLA 4G0PA 4Q6WA 3VDRA 1WEHA 2ECOA 4GL4A 3K73O 4I46A 4RHUA 1EK6A 1PJTA 1BOOA 2O0HA 1Q12A 2ZRQA 3H1FA 4G41A 3KT3A 1TEXA 1FC0A 1GGKA 1WXXA 3G5MA 3NWOA 3IR7A 4G1EB 5D86A 3FMFA 1XJCA 4HLQB 1TLFA 3SDBA 2NNWB 3P9RA 5HZGA 4U3JB 2P5YA 4PQRA 3FOFC 1ITZA 3BMCB 3CO0S 5BURA 1Q6YA 2VSNA 3L8HA 4Q01A 1TQ8A 1EFRD 1A5TA 4RDHA 3QKTA 5AWFC 4BIIA 5DHRA 7GPBA 2ZQYA 3WYEA 3EEYA 4GQMA 4X9XA 1VGVA 1TPYA 3ROEA 5FUXA 1F1BA 1P7PA 2H85A 1NG1A 5L9AA 5EMKA 1M34E 2Z8YA 1OH7A 3G2QA 3ND7A 2JCSA 2YCLA 3DV0B 5EVJA 1KQGA 1SCUB 5JS1A 3I9FA 2WIFA 3FNEA 1U6JA 4A9AA 3OU6A 4FFMA 4WN9B 3FVRA 4O2BA 5LMCA 1YFJA 2I1WA 4L9RA 3Q85A 1ZXXA 5I4KA 1KETA 5BWMA 3R3JA 2GNOA 3ZWQA 4LZLA 2Z8XA 1KI2A 5C80A 5JIBA 2C20A 1TLTA 3I3OA 5DDIP 5AI8A 1NVEA 2YW9A 4RCZA 3KZMA 2Q2NA 1DEKA 3L8FA 2AUMA 5IVPA 1E7RA 1O6ZA 3W9YA 1W46A 1U8UA 3ODPA 4EDFA 3Q6NA 2FX5A 2A7QA 3TEJA 3TTUA 1NRIA 4MUGA 4D8TA 2BKLA 2XA1A 5KCZA 1B00A 4F6LA 2GRUA 1X2EA 2FPIB 2PQ6A 2V5VA 4HD8A 4X61A 4XSVA 3WYFA 1AJEA 1CR2A 4YXWD 5FOSA 4XASA 4QDOA 4Q9DA 3FVVA 5CT4A 5CX1B 4TS9A 3N53A 1MB4A 1NF9A 2GN6A 2ILTA 4H1WA 3C4JA 5FH9A 3NH6A 2NVWA 4QRHA 3LO8A 3G9XA 4Y30A 1YIDA 3HP4A 3K2EA 3MCTA 2GKSA 2ODWA 2GK7A 4PRYA 3UC9A 4MW1A 1Y4AE 4MCAA 4ARZB 4HAUA 2ZRFA 3RFVA 1RPAA 1PV1A 2CBGA 3LZ6A 1GKIA 5I7FA 4AS1A 3N2NA 1KH1A 4BFZA 2GLTA 1QCCA 3TBHA 3TK1A 5KOHA 4TMXA 2BHLA 3P4XA 2H1RA 1THZA 4CEHA 2ETXA 2FQWA 3FNGA 3LJKA 1FP6A 3MBKA 1G41A 3PQEA 4IDHA 5SV2A 4F3CA 1UJ6A 3UXMA 1KJWA 2AHOA 4FHDA 4KLAA 1GR1A 1VL5A 2HZBA 2VAWA 5HUQA 3TFLA 1Z82A 1AKVA 1IK6A 2BPOA 1N1DA 4Q21A 4TWBA 5AKLA 2ZSFA 4N3BA 3IQXA 2E5WA 4EUSA 5KSZA 1T34A 1E6KA 1XZDA 1YI1A 3NP9A 2XECA 1F2UB 5A5DA 2OGWA 2O8EB 2YWHA 1PJ2A 2WF7A 4B9EA 2VCHA 1FTWA 1GGEA 1WKBA 5K0ZA 1HNWB 4PRLA 3CQ9A 1JR3E 3LYHA 5EWJA 3PXUA 3E48A 4UHFA 3VC1A 3UWMA 1CE8A 4K6KA 4RVGA 4RZ3A 4W8HA 2E6KA 4INAA 4YAJA 4FK8A 3K2IA 4BX2A 4E2WA 1OXSC 4F3YA 5I9LA 1JFLA 3ADOA 3IERA 4LTNA 4GQBA 4R7GA 4F21A 3QEAZ 4U9IS 1Y7HA 3E6AA 5IN4A 1FL9A 4E12A 2HWKA 1K7XB 4UM8B 3U3KA 2Q7OE 3DZGA 2ZBRA 5GTDA 1R63A 3KUXA 2ZSIA 4M1ZA 3LOQA 3PQ7A 3OWXA 1Y6GA 1E3JA 3FDZB 3NRBA 4D96A 4YC7A 1GG5A 3GJTA 3WJ7A 2OLJA 2PXPA 3JZMA 4CM4B 5BOSB 5I45A 4TV8B 1YQTA 3A3PA 4EO7A 4B5KA 3C1TA 4WECA 1HZJA 3OU2A 4DWVA 1U9CA 4Y42A 5C35A 5JYEA 4I8IA 2L17A 2FPLA 5LOVA 1ML4A 2ZZKA 3U9LA 3BKXA 4E15A 1RADA 2BZ1A 3EC1A 4OAPA 3R8CA 3GN1A 5DMXA 3AIMA 5AKHA 5A62A 2XWSA 2H4JA 3H5LA 4PBRA 3I2GA 4RIFA 2Q29A 2BUCA 2VAMA 3ABRB 1CQIA 3HCBA 1Z36A 4ZOCA 1VDZA 2MU1A 3TD9A 3OX2A 4IRMA 2REBA 4L2IA 3VYWA 2IYSA 1EUZA 2MJLA 4JL6A 5FL3A 1J9ZA 1E20A 1X87A 2ZXFA 2FLKA 4OHBA 2QUZA 1E0DA 5AUOB 1I4EB 3ODGA 2BR3A 4H4CA 4KEAA 1ODLA 4NNJA 2HQBA 1N3LA 1VIDA 4L51A 4MDYA 3UCEA 2ZPUA 1UJMA 4ZD6A 2CLKB 2GCNA 4O29A 3ITDA 2IHZA 3BSWA 3L43A 4IIDA 5EE3A 5EP4A 4LOKA 4RGQA 2WJHA 5LA6F 1T9HA 1GPDG 3LTNC 1R15A 2V58A 3EWIA 2IYPA 1RQPA 3HYCA 4G65A 4GOMD 4JQYA 4AN0A 3L02A 4EB3A 1J7KA 2GKOA 5IAGA 4CM6A 1YS4A 1WPRA 3RU9A 2YFYA 3B7PA 3MG9A 3ZY4A 1ENZA 2J5QA 1C29B 5GPBA 1THTA 4IIGA 4OQ4A 1O3YA 3C5HA 3R7DA 1H4SA 4KGVA 4ZYYA 4AS3A 5BSMA 4ZGGA 2UYQA 4NZOA 1EB8A 3FD8A 5LYJA 1DBQA 1MEOA 2R66A 3QP9A 3SEAA 1W0KD 2HKIA 2ZRNA 3DVRX 3EZLA 4WGGA 2VSOA 3WMWA 1CZOA 1T5OA 4ARVA 3FFWA 5FA8A 2HTEA 3SBXA 2VIIA 4RIEA 3RJZA 1X3LA 1HOXA 3JRWA 4M1SA 4M99A 4G1UC 2BFEB 3QNWA 4G5QA 1OU4A 1W35A 5EVCA 1QLJA 3C98A 2XGGA 3JWIA 3WIVA 3RFFA 3IDOA 2HFZA 4KUGA 2VPTA 3S8EA 5AIBA 1WVIA 1TCAA 2GGSA 3WDLA 2Y71A 4PG8A 1E1CA 1QFYA 1B0ZA 3AHHA 3ENVA 2HNBA 1G18A 2TMKA 3OLWA 4OGKA 7ADHA 3P7MA 1FLVA 1A4RA 1P72A 2BT4A 4QO7A 3HWRA 3VVBA 4EF5A 3LF1A 4D9EA 4LFBB 3OKFA 1CJTC 3ANSA 3QTTA 2AFHB 4QQKA 2FGKA 3W6UA 3HUUA 3F90A 1YR2A 2IDZA 1DP4A 2RDMA 3I6ZA 4PAQA 1RT9A 3K96A 4RQTA 3GQBA 1EINA 1Q0RA 3GFSA 5B3JA 3SN6A 2NXEA 1RM0A 5LD2C 2VP3A 3I2IA 1E96A 4B8WA 2HF8A 1CNMA 2C97A 2O4UX 5I01A 5AVTA 1OLXB 1ZYUA 5EP1A 4NEGA 4UQOA 2G06A 1BMQA 3PPYA 1NNEA 4R6XA 3PI6A 4JVOA 4O1IA 1UUFA 3JXCL 3RBXA 4CM8A 1U9IC 3RUDA 2PXDA 3KLOA 3O7WA 2ZEJA 1SG6A 3KD2A 4N1AA 5EP3A 5L3VA 1Y82A 3B1JA 1P80A 2BEVA 3ED1A 5LKAA 1T25A 2FN7A 3IAFA 4PFQA 4XDZA 1MB9A 1ZIDA 4Q3DA 3RSCA 2AUWA 4II2A 4IIJF 5CGQB 3I8XA 5DHQA 2B1RA 3ZXXA 4PVDA 2WM3A 2IE0A 2ZT6A 3P2KA 5IJAA 3RRFA 121PA 2CDNA 3N0TA 4HH0A 3WYBA 4ZEVA 1RXVA 3ETGA 3RK1A 3M2PA 2AB0A 1CZLA 1LQCA 3GLKA 3B9PA 3L4JA 4RF5A 2P91A 1NHWA 3QGMA 1CS0A 2FJPA 4CPDA 4WBNB 2UVPA 3KJQA 1HEYA 2N1BA 3PPWA 1HZZA 5AMXA 4BEVA 5HYVA 3CTMA 3IT1A 1UBHS 2QYSA 3PHGA 3WJAA 3QWHA 1W2GA 4M7PA 4JXZA 2BYTA 4N12A 4X8HA 1N5RA 1VLZA 3G5UA 1D2NA 3ACCA 4HMOA 5EXTA 1K3UB 1YJCA 2R87A 1JN0A 3P9ZA 4RMIA 3G13A 1RAIA 4Y2UA 4YLEA 3WK4A 3EDCA 2CJFA 2MINA 2W2LD 3IB3A 4J1SA 4N18A 1T8TA 3KSZO 2AG1A 2LCFA 3WIUA 1NU6A 3DMHA 4MGIR 5SICE 4BVFA 2GVZC 5DTJA 1NXTA 4PU7A 4KGXA 4AM8A 4QNRA 3MJTA 4KXXA 2CLSA 3N07A 4OHZA 3A2KA 1MP0A 3D1JA 2QMOA 2ZDGA 3OF2A 4L73A 3HO1A 4CM9A 2AWNA 4HN4B 3K0FB 3QFTA 2W2PA 4MW4A 2FQQA 1JA0A 1E4EA 1NJ8A 3COYA 5HBRA 1HM5A 3T12A 4DUPA 1J0BA 4ZTZB 3VH4A 3LBNA 2EBYA 5BVHA 3G1WA 3WIBA 4OM8A 2HSEA 3AUFA 4ZEWA 3VUEA 2F9FA 1TTPB 5FL7A 2V6MA 5EZYF 4O5OA 3OOHA 3T9BA 1CR1A 4LAFA 1ESDA 1OX5A 1Q44A 4ZOEA 3VDNB 3WV5A 1N7HA 4ZOAA 2IYYA 2PY6A 1ECFA 4L75A 2QPAA 1RXUA 3LDUA 5BSVA 1SY7A 2QVZX 1WZEA 2GFHA 5TMEA 3B52X 3C8HA 2EATA 3CEAA 1PZEA 3MWEB 3NIBA 5IUNC 3GUZA 2NVBA 2ZAMA 3A9CA 4UNIA 1L7AA 1L8QA 2H1IA 2Z1NA 2IU0A 3YASA 2DTXA 3NTUA 1U28A 4OYHA 4FKBA 4YBRA 5M7EA 3D9QX 1N6LA 2DY1A 3M2TA 4GBGA 5A4DA 2P4QA 5IMSA 2I80A 2NU6A 2VG8A 4LYYA 5CPBA 3ZDRA 4B33A 2XCJA 1TTTA 1F9EA 2GPWA 3U4HA 1RQ2A 3HKDA 2IYNA 1STOA 1SXJD 3CWCA 5ETJA 5DCYA 1ZCAA 1RAHA 3BQ9A 3GBFA 1QP7A 2K7ZA 3OZ7A 2XXAB 4G86A 1QFJA 1XHFA 2V97A 3ETEA 4MW0A 4TTJA 3OTIA 5ALUA 1FSPA 3FN4A 1M2VB 3KFLA 1OYOA 3C6MA 4YTEA 2O59A 1E7WA 1F4LA 2Z9BA 2AK2A 2C5BA 4ZCPA 3AB8A 2G71A 3N8DA 5JQWA 1XDGA 1EFVB 3SR4A 1LC0A 2O2JA 1FE8A 2ZB2A 4RXMA 2IITA 3GLFA 4WLFA 2MT9A 4FNAA 1RTKA 5HEKA 4KV7A 3GCZA 2UAGA 4G0XA 4JJ4A 1UDCA 2GNPA 1NBWB 3D2CA 4DFDA 1SPBS 4CI9A 5I8PA 2WVHA 4O4IA 5DVZA 1KPHA 1OROA 4XGQA 1B76A 2EP7A 4WXYB 2NO7A 5E7MA 2IU6A 1DC8A 3AL0C 4Q1AA 5FWNA 1IPHA 5JSUA 4HDQB 3E3OA 4JC0A 3F1KA 4KIWA 4TSKA 4V0SA 5JECA 1FMFA 1OXVA 2LKDA 5IBQA 1TUIA 4LYJA 1WF3A 3PCRB 1OZAA 1EWQA 3QQ6A 1QV9A 2GRMA 2R751 5ALSA 3ZQUA 2JHGA 3IL2A 1EFCA 4ZVLA 3A9YA 2JIZD 4RIIA 2ZUBA 1KNQA 5EQJB 3W79A 2FEMA 3DTNA 1S2IA 4LX0A 3DE7X 4M6WB 3GFBA 2CE2X 4Y2RA 2IOYA 3JWGA 4DZZA 3M1IA 1EJ2A 3ONFA 5HJEA 4F4FA 2GEDA 4I4TB 1GGJA 2BRUC 4YR7A 1GNVA 2IA5A 2IYXA 3I58A 4UVGA 1V1RB 1VJCA 3BWCA 3EC2A 1NR1A 5EESA 4JXKA 4I14A 3DZDA 4Q4JA 1U7UA 2WJYA 2G72A 1IWBB 3AESA 2I6TA 3EG9A 4M9XA 1VE5A 3BXPA 4MRNA 2PKEA 4FW9A 2FFQA 3IVAA 3HCAA 3ND5A 2Y0EA 1PRUA 3K8QA 3NETA 2XLCA 4XQEA 2WYVA 4H7KA 4YRQA 2HJHA 4PG4A 2YIJA 1Z6QA 1ZMRA 5LZ5A 5HKLA 4L4YA 4QTYA 2NU7A 8GPBA 2JLQA 4K9QA 3Q72A 1PX0A 4JK3A 3UT5A 5KCMA 1RAAA 2WSSA 4LHXA 2PS0A 4WCFA 5MDHA 3KQKA 1ZJZA 3TPFA 5I48A 1ZSYA 3CKKA 1MHTA 2HV9A 3DW3X 4E30A 2XVZA 3T8YA 1C5KA 4U3JA 3RK0A 2O8DB 1A98A 1F3LA 2IDKA 2YW2A 5EFZA 3BMCA 4L16A 3IAHA 3RS0A 3AGQA 2EJCA 2Q2WA 3BRSA 4C4RA 4YUXA 3VKFA 1I4LD 4YP1A 2YTZA 1Z07A 4F85A 4F9FA 2PVCA 1W29A 4F3TA 3L92A 3ENQA 1G6HA 4HGZA 4IDPA 2IHJA 4BFCA 3H9UA 2UUBB 3U3WA 3DV0A 4KO3S 4CEIA 3BD9A 3M6XA 1SCUA 2CEKA 3PHHA 2HRQA 5A9RA 1DBPA 2FPOA 3EXFB 2J9ZB 4ZC8A 3TPZA 1G1AA 2F48A 4NESA 1JHQA 4WN9A 4JR2A 4QQNA 3V2UA 1V3TA 2PANA 4R69A 3GLGB 3C6KA 3NT4A 4D4JA 1IHPA 2E4UA 2OO7A 4TUYF 2XCIA 2EL9A 2BFNA 4MAMA 2QUJA 2OM6A 3HLKA 3ZU3A 1JE1A 5ALMA 2JGLA 3D6MA 1HTWA 3DLTA 3P32A 3AUJB 3AR5A 3OOYA 3UK7A 4EIWA 1MD9A 4ERXA 5KVVA 1OA1A 1T3HA 1PUJA 2QTZA 3ZN2A 2BF7A 2Q4EA 3AO0B 1VSVA 3T7RA 4I5FA 1VLJA 1XU9A 2Q9BA 5DWDA 4AULA 5KC8A 2FPIA 3MYYA 4HN9A 4E4YA 1GTRA 1DKLA 5TIIA 1NRXA 1KSFX 1D0VA 1K4YA 2FWRA 3CF2A 5BNFA 1KDZA 1USKA 1PKEA 1HKHA 5CX1A 221PA 4CKBB 3DWEX 3JQCA 2JA2A 4B48A 4J2TA 4MNTA 4B3TB 2ZUFA 3GUVA 2PMWB 3F6YA 4LA4A 1JJBA 4XVCA 4E5MA 1U3WA 1Y6FA 1DARA 2J6CA 2F8TA 3H4IA 3TW0A 2YIMA 4IDEA 4PC3A 1KDVA 4BVEA 4F4CA 3OJFA 3S0JA 3PGMA 1L4FA 1TMOA 4IY1A 4ARZA 3ICPA 2C83A 1T1JA 4BHTA 3JS5A 2JEOA 5GOTA 2HQRA 1PK7A 2J3HA 3LMKA 1BKSB 4TKUB 4WLEA 4EDHA 1NTOA 2PXVA 5CH3A 3I04A 3ZVKA 1GRVA 2ZTLA 3D3NA 3L06A 1XZMA 1JHXA 7REQB 3W2HA 3FWYA 4WOBA 4M49A 3RTEA 4G63A 1FYWA 3V7NA 4HP8A 3NANA 2WA2A 4BYGA 1P0CA 2P3LA 1YIAA 4PSVA 2RKOA 1VG0B 4B47A 1E99A 4NFHA 2XV1A 1PJCA 2PUFA 1U1CA 3SP1A 5EHGA 3IQEA 2BMAA 4G37A 5EXEA 2FDXA 3T3HA 3MBOA 4KX5A 5AK3A 5DNAA 2W7TA 2QXYA 3GOQA 1J7JA 2O57A 4TYNA 4PR3A 1F2UA 1KBOA 1U0FA 2QENA 1SCJA 4JUDX 4IJWA 2FMHA 1YJAA 2IZ7A 4HRVA 4OV6B 2PA0A 4PYRA 4BNXA 4MVCA 5AXDA 2JK0A 2WVGA 2Z4SA 2OCDA 1J1ZA 1NR7A 3NXSA 4CM5A 5CB4B 1EJ0A 1OPXA 1I6WA 4PYIA 3GI1A 3IJ5A 4E32A 2YYZA 5ESWA 4ILKA 3QX7A 1QAMA 4OH1A 1M54A 3AQIA 4ZU1X 5KQRA 1OB2A 2IBTA 4ECAA 2P9HA 1P1JA 1BHO1 3CKYA 1R27A 3ZS8A 1QGUB 2BI7A 4REOA 5G02A 3UAGA 4UM9B 3I01A 5LYYA 4O25A 2X3UA 4CR7A 4D0SA 4BMSA 4MKIA 1F60A 1RI2A 5JCJD 3PLAE 3O4RA 3PDWA 1IUKA 2BEJA 1FQWA 4FUQA 3W0LB 1FY2A 2EP5A 1IXZA 2ACEA 3F2IA 4L4RA 4D6PA 3P5BA 3N1UA 4QXPA 1E1RD 3C1OA 4FSDA 4AF6A 1V9SA 2N75A 4Q6BA 1DCFA 4X45A 1MA3A 4TV8A 4UTZA 2B4TO 3KKLA 3COWA 3QEMB 4JIGA 4UEKA 2CHEA 4E4TA 4MUKA 1PV4A 1J33A 3HUEA 3AEQB 3KR1A 1RHQA 4QARA 5DSZA 5EY5B 1M3SA 1ZZCA 1T26A 2IU3A 1QJ4A 2C9MA 1JQ3A 1K75A 3TNYA 3AZPA 5LZ8A 2WPDD 1QX3A 2F6RA 3DVAB 3H5WA 3HJFA 2AUTA 4BO2A 4C6RA 1V25A 1RI4A 2GAJA 3KSAC 3AF0A 3ICCA 3UUWA 4EEZA 2GK3A 4B2LA 1LV8A 1BX0A 1TK3A 2ZBFA 3FPJA 3MPUA 1H6CA 1RPJA 4JUAA 3W2GA 1DIOB 3F74A 3UQYS 1KJQA 2R48A 1KFCB 3OX1A 1HWYA 1II9A 3M6UA 1D03A 4QUEA 5EUQB 3U81A 1QG6A 1ZD9A 2NZWA 1RPZA 1GNTA 2ZRAA 3EA0A 4H3KB 2QVCA 3NJRA 4MLCA 1H5UA 4MUYA 1WCIA 4ZPXA 4HSEA 3F73A 2BM1A 3O8LA 2JZCA 4AURA 1JU9A 2QU7A 4N5DA 5JO0A 1W30A 4NHOA 3GUCA 3W5AA 3IIMA 4M9SA 2ONJA 3UANA 3FAZA 2HSJA 1NN3A 1NQWA 2W43A 3IUEA 3MB8A 3D7RA 1QH1B 1HLFA 4RM3A 3KB1A 4OIMA 5EUCA 4KKVA 3V7YA 4MUJA 5LKRA 2AZXA 5TXGA 3WFIA 1TM5E 4TQUS 4NNPA 4P7KA 3EFHA 4MQ4A 4C5CA 3IPCA 3C5EA 1P31A 3UGQA 2RGNA 2XDQB 2YN4A 4MAFA 4MYHA 5AW7A 4AG3A 3ETDA 3TF5A 1U9JA 1K66A 5KSPA 4ZVKA 1E89A 5D1HA 3L7MA 2PZAA 3DGFC 3H2GA 5ALYA 2OP0A 3OA0A 4AJLA 4CF5A 4D4LA 2H31A 1BHJA 2QM3A 2DQ4A 3AKYA 1IY8A 1RIFA 3ZWWA 3EGEA 1GQ2A 3A9RA 4EPRA 4ZI7B 5A06A 1YS6A 5ALOA 3OJ0A 4D82A 5E9AA 5IZ4A