4HRSA

Crystal structure of h. volcanii small archaeal modifier protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
b'GRNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 2
publication title Crystal structure of the ubiquitin-like small archaeal modifier protein 2 from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii ds2
molecule tags Protein binding
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hrsA00
1DOIA 1SB3C 1CJEA 4YSYB 4USAA 5EE3A 1QOBA 1E0ZA 4ZHOA 1CZPA 3W5UB 1PDXA 1GPXA 1TKYA 1DGJA 1NVID 3AEEB 1I7HA 2WDVB 1FFUA 2BT6A 3AEFB 2LEKA 3L4PA 5GXGB 2K9XA 3ABVB 2PVGC 1NENB 2AX5A 1L6UA 4KX6B 3HVZA 2WDQB 1OFFA 2BS4B 1NEKB 3AEDB 3NVVA 1E10A 3CWIA 3BIID 1IUEA 2L52A 1QOAA 3AE1B 1RWSA 1EWYC 2W55A 4YT0B 2M56B 4P6VF 1R7SA 1B9RA 2WU5B 3AV8A 3W5VB 1V8CA 1JW9D 1XLQA 1DOXA 1F0ZA 1ZXIA 2W54A 4US9A 3RPFC 1YJJA 2CJNA 3AEAB 1YJIA 2JQRB 5EE1A 4A9AA 2QIEB 3DWGC 3NVYA 2DWQA 3NS1A 4C7YA 2WS3B 2ACZB 1KF6B 3AE2B 5G5HA 2EKIA 2M19A 3P4QB 4N59A 1JQ4A 5EE9A 3ZYYX 1XLOA 1E6EB 3EUB2 4N6EB 5C2TB 4N58A 2JX5A 3FAHA 1JALA 5AUIA 4ZOHC 3AMZA 3P4PB 3P4SB 3LXFA 3AEBB 1NYRA 3B2FA 1N5WA 2HTME 5C3JB 1JROA 1E7PB 2WLBA 4YTPB 4YSZB 2L83A 4WQMA 1QOGA 3NVWA 2CJOA 1WYGA 1FO4A 3SR6A 1NYQA 2QJLA 3B9JA 2WDRB 1TKGA 2K22A 1FM0D 1N60A 3P1MA 3WCQA 1XO3A 3SFEB 2CU3A 1PUTA 1TYGB 2FBWB 2PVOD 3DWMA 1YQ4B 2MJ3A 3AB5A 1VJKA 2BS3B 4HROA 4ITKA 1QLBB 3AH7A 1ROEA 5MPOA 1A70A 2E3TA 2WQYB 3AN1A 1KRHA 2W3RA 3VRAB 4YTNB 1V97A 1RYJA 3P4RB 2G1EA 1AYFA 3ETRA 5EE0A 1AWDA 3PO0A 3FC4A 2MJDA 1WRIA 3NRZA 3W9CB 3AE8B 4YXDB 2DBYA 1T3QA 1J7CA 2WP9B 2KAJA 4US8A 1YQ3B 1FRRA 1RFKA 1VLBA 3AE4B 4JWUC 1QF6A 3NVZA 4JX1C 2N0SB 1WGKA 2H89B 3AE3B 4YTMB 5H92C 2PIAA 1QT9A 2WU2B 3LB8C 1L6VA 1L0VB 3AE6B 3AM9A 1ZUD2 1WWTA 1XLNA 1VDVA 3AE5B 3AEGB 1PFDA 1E9MA 1WXQA 4C7ZA 2Q5WD 4LTUA 4WWMA 1FIQA 2MH7A 1J7BA 3AECB 1RM6C 2H88B 1FXAA 2B76B 1N63A 2BS2B 3AE9B 1N5XA 2K5PA 3VR8B 1JWAD 3HRDD 1QOFA 4FXCA 1ZOYB 3KWLA 1SIJA 1ZP0B 3VR9B 3HUIA 3SFDB 1FMAD 3CIRB 4IDIA 1N61A 2Y5CA 1DOYA 1FFVA 1XLPA 5AUKA 1UWMA 1JWBD 4HRSA 4ZHPA 1L5PA 3AE7B 1FXIA 3P63A 1FRDA 2PKOA 1TJEA 3B2GA 1NI3A 1TKEA 3VRBB 1SF0A 1J7AA 1JRPA 2KMMA 2OHFA 4C80A 4YSXB 1GAQB 2MJEA 4JWSC 5G5GA 1KFYB 1N62A 1OQQA 2W3SA 5H8YE 1OQRA
chains in the Genus database with same CATH superfamily
1SB3C 4WAAA 2C7HA 3JSVB 2VH2A 2C9WB 4HK2A 4KX6B 4ACFA 2HTHA 1HTQA 1EU3A 1GC7A 3T9LA 3BWUD 2RDGA 4IM0A 1R4NI 5L95C 4US9A 2K6QA 4NJ7A 2XBBC 4WWPA 1J0GA 3NS1A 2EKIA 5AZHA 3TEZA 2JZ3B 2D3GA 3R66C 1N5WA 3B9JA 3MJ5A 1WI0A 1KM7A 1CMXB 1TYGB 1AW7A 2GBMA 1QLBB 2G4DB 3RN9C 2BF8B 1D5ZC 2DZMA 4W9DA 3KYDD 3NRZA 1UBQA 2PW9A 1I4RA 3BK1A 2N0SB 1WJ6A 4A3OA 2V3PA 3DVGY 4FJYA 3B1LX 5D6JB 1HTOA 2DHZA 2BYFA 3CSFA 4N9F4 3DVNU 3QK0A 2JSVX 3HVDA 3RZWC 3VHTC 2KO3A 3AE9B 2W9NA 1ET6A 3EGRA 4OVZA 2KTFA 4AJWA 2Y5CA 3NOBA 1Q10A 2WXGA 2WXOA 3L16A 2V1YA 1TJEA 1NI3A 2Z0DB 1TTNA 4JWSC 1TGZB 3RNFC 2KQ4X 3KQ4A 3OJ4B 2ZW0A 2LWPA 4TQ0A 2BW2A 3AEDB 1SE4A 2M4NA 1XEEA 1YJIA 4NQKE 4K7UA 4ZRQA 5E6NA 1N6ZA 4BFRA 2FIFA 2KQ7A 2X38A 3Q8CA 3K9PB 3N9YC 3VUYA 2LVOA 2QILA 1UNSA 1WJ4A 4PT5A 4ZRJA 3NZSA 1WMHB 4WQMA 2MA9B 4XDCA 1MFWA 2NTTA 3DWMA 1V5OA 1E8WA 4HPPA 3M62B 4FHJA 3ZLZA 1TZ1A 1VZ8A 3AH7A 4LNKA 2GLSA 3NZUA 2K8CA 2VH1A 3BVZA 5LNK1 4O1NA 2L0FA 4YXDB 3MC9A 4RGOS 2G3QB 4KSKC 4US8A 3IG3A 3VQIA 1V80A 4KGRA 2FAZA 1HQRD 2REXA 2IGHA 3RZFA 4JX1C 2H89B 2LJIA 3TJPA 1JCKB 3D32A 2LHDA 4RGTA 2JXTA 5E6JA 1NBFC 1K50A 1YOVB 3HM6X 2IBIB 2LJ5A 4RH6A 1G6JA 1WWTA 1XLNA 1EU4A 1SEBD 4B0MA 5E6OA 3TL5A 4KZ0A 3S2AA 1L0YB 4WURA 3Q3OC 2KTRB 2MX2A 1SSNA 1V86A 1LGRA 1ZOYB 1SIJA 1ZP0B 1SIFA 5DCNA 1HXYD 1EWCA 3N20C 4M00A 4EOYA 3A9JA 2PMVA 5G2NA 5J18A 1GNUA 4YSXB 3PLUA 4LDTB 4ZHOA 1DGJA 4ICUA 2IZVB 2ZVNA 2NVUI 1C4AA 4MGIE 1AN8A 4BAXA 1PQSA 1GUAB 4TV3A 1WRDB 1EF5A 1B9RA 1C77A 2Z8LA 2JQRB 4A9AA 2QIEB 3ZTDA 4C7YA 3ENEA 5G5HA 3ZJTA 1WF9A 2MBBB 4S0RA 1WXVA 2D07B 1HA5A 4F1SA 1MPEA 4IWOA 2OEDA 1BT0A 1TY2A 2M0AA 1D6EC 4DK5A 1IGCA 5IO9A 4HROA 4XZ4A 2HDEA 4XE0A 1A70A 3AI5A 3T8MA 2KX3A 2JVCA 2WXQA 2FUG1 4WWNA 2FIDA 1EO6A 3DVGX 4GSWA 5H92C 1J19A 1WX9A 2WNMA 4B6WA 1ZUD2 3AE5B 1E9MA 3BYYB 2Y5PA 3Q8BA 5L83A 1FXAA 4DDID 4GDKA 2WXNA 4PS7A 2L00B 1FPYA 3FKYA 1FFVA 3UF8A 2V0GA 1WXMA 3U7ZA 1P7FA 4IWPA 1QKZA 2LFIA 1FRDA 3BVGA 5CHFA 2K3UA 4EZLA 1KFYB 1OQQA 1RFAA 1ZXHA 2WDTB 1CJEA 1CZPA 3EHVA 1FFUA 2N7EA 1L6UA 3GP7A 4ZDVA 3NUHB 2XK5A 1XXGA 3NVVA 2NMQA 3AE1B 4JL9A 2M56B 4P6VF 1R7SA 4W9HA 2CU1A 3R8BA 3RPFC 2BWFA 2DWQA 3KW5B 3ZYYX 2AYOB 4ANWA 1FNWA 1KTKA 4BBNF 3FILA 2IJ0A 1NYRA 3IBEA 2WLBA 2CJOA 1V81A 4MGYE 2IGDA 2WWZA 2A5UA 2LD9A 3AB5A 2FE8A 4CYEA 3C0RB 2W3RA 3DCGA 1GB4A 5C1ZA 4MSQB 4HVBA 2MJDA 1WRIA 3KUDB 1WE7A 3A33B 1T3QA 1PGBA 4WJOA 4XC2A 2KAJA 4DHJB 1R4NB 5BMGA 2I1JA 4S17A 3W1YA 3WAPA 3IHPC 4YTMB 1P3QU 3ZTCA 3Q3JA 1QT9A 4K7SA 4HJGE 2BYVE 4OZBA 4JE3B 4M8NA 3VTUA 4B0EA 4A8XC 3IXSA 3BVMA 1STEA 2BS2B 1VCBA 2BBCA 2FNJB 1SBBB 1FMAD 1WYWB 3ML8A 3ZDTA 4MGZE 4HKQA 2UU7A 5FR6A 1IGDA 2RD0A 2ZCBA 4DWFA 3X23A 2MLBA 1V1PB 5BYQA 4DHZE 2IO1B 2LUMA 3N1ZC 5IP4D 3AEFB 3V05A 4FJVB 4BKGA 1WY8A 1NEKB 1QOAA 1HZ6A 2JWUA 2GRIA 2O6VB 1ZXIA 2BYEA 3EECA 5D3IB 2EMSA 1UH6A 3DWGC 3NVYA 4AQ7A 1V1PA 1WZ0A 3WIMA 1XF5L 4ANVA 5DPSA 1CQVA 3FAHA 4GB9A 1WXAA 2GOWA 3I57A 1OEYJ 5C3JB 2AQ1B 2QMTA 4JPSA 1SJED 1EM7A 2WX1A 1TKGA 4UDUC 3B08A 2WX0A 4IWQA 2FBWB 4IM2A 1IBXB 2MP2A 4ZRKA 2SAKA 4M8MA 1UGMA 1WE6A 1RYJA 2KFKB 1PYWD 2AQ2B 1WJNA 2IYDB 2WP9B 3DPDA 3ZUNA 3PV1A 4JIOU 4WJNA 3ZDMC 5IAAC 1WGKA 3PZDA 3AE3B 4FADA 2D5GA 4BOSC 4RF1A 5JH5C 1YJ1A 4OW0A 1SE3A 1WGDA 1AARA 2INPE 4B95A 3QHTA 1SE2A 1EF1A 3KWLA 3R2TA 3HUIA 1MHHE 3VAWA 3BY4B 2MCNB 1T6BX 1XLPA 1MHXA 1JWBD 3WANA 5KHQA 3ZXVA 3B2GA 5AZFA 1J7AA 5C23A 3E56A 4W9JA 2KHWB 4W9LA 1PDXA 2D3AA 1I7HA 2WDVB 5HFYA 1NENB 3TIXA 4TMAB 4EE2A 2KDBA 1J8CA 3Q14C 1LXDA 2KFJA 3EC8A 2WU5B 1YQBA 1JW9D 3H6NA 1FNVA 1E7VA 4ZYNA 2QCZA 1SE9A 3V60A 3P4QB 2L8JA 3TEYA 3Q8AA 2JX5A 2HE7A 4PK1A 1E7PB 1YN4A 3TEXA 3CMMB 2GMIC 2KD0A 4NQLB 1ZDVA 2GBJA 1OTRB 3SFEB 4M01A 2LRUA 3APFA 1ZDXA 2MW5A 2L3ZA 2BS3B 4ITKA 3RMKC 2DZKA 2R2OA 4WQOB 1MG4A 4GXBA 2KWUB 1B1ZA 3DHIC 5EE0A 3UIPB 4DXFA 4MDKE 3JSVA 3W9CB 3CF6E 4ANUA 3U4EG 3LB8C 2WU2B 1M4VA 2WXKA 3ZNHB 1XT9B 3R2IA 1T0QC 2Y5BB 2LXAA 1PFDA 3V61A 1R4MI 4HDOA 1MI0A 2NBVB 3AECB 3U2SC 3ALBA 1C79A 3R7RA 1TS4A 2INDC 5D2MB 3QA8A 3PS6A 4L23A 2FUHB 2KWDA 3SFDB 2WXMA 4IKGA 2VZKD 4KVGB 1KLGD 4C4VB 2MBEA 1L5PA 2JUOA 1YX5B 2JY6A 1RRBA 5H8YE 2ON8A 4KGTA 4FLHA 1L4ZB 1Z2MA 2IGGA 1NVID 3PHXB 5TSSA 3PVLA 4ICVA 1FCLA 3P42A 2AWTA 4NJCA 2CHWA 2L52A 3DHHC 2CHXA 2LUEA 3O65B 1V8CA 2KMAA 3Q2AC 2DZIA 2BPSA 3C19A 4HPLB 4BBNC 2ACZB 4A6QA 1UZXB 2SEBD 2JF5A 1YIWA 3B0AA 2NBUA 3WAOA 2GB1A 2HTME 3V6CB 2KDEB 4YSZB 1I4XA 2KVZA 4OZCA 2DX5B 2QJLA 4HWIB 2K22A 2DLBA 1I42A 4P7IA 1EUVB 2I38A 1F1HA 2R2QA 5MPOA 2WQYB 4DHZB 5HKHA 2DZJA 1WR1A 5BMHA 3RD2A 4ZYSA 3MJWA 4BVUC 2OJWA 1RFKA 2XN9C 2JZZA 2ZNVC 2ASQA 4NAWB 5JHBA 4GGQA 3AULA 1WX7A 2LMCA 3PTFC 2IDYA 4FHKA 2K0PA 4BOZB 4KKIA 4WWOA 3W1SA 2RGFA 3L0WB 1SJHD 3ONSA 1TS3A 1VDVA 2LZ6A 3P2BA 3N3KB 1N63A 4FXCA 2L76A 1WMHA 4NAWA 4IDIA 1K53A 4PS8A 4LNIA 1WGGA 2KN5A 4DBGA 2KJ6A 5G55A 3PGEA 5I4DA 1UGJA 2KNBA 3OG5A 3AXCA 3PLVA 1E0ZA 4HDQA 1IPGA 2LHEA 4XYCA 1ZPSA 1C3TA 2LEKA 2ZPYA 2KN4A 4LNFA 1Q1OA 2M1MA 3CWIA 4A3PA 4YT0B 2HJ8A 2IPKD 2AL6A 1QQRA 3SU8X 4K7WA 3MC0B 1UUPA 2O2VB 1YJJA 1WX8A 4RCOA 2ZCCA 2K1FA 3H9DA 1K8RB 5HHDG 3AE2B 2PE6B 4B9KA 4NZLB 2YLMA 1LQBA 2KTRA 5AUIA 3GOEA 4ZOHC 1D3ZA 3H8HA 3PRPB 4I6LB 3VUWA 3EFUA 1GOZA 2DYOA 2J0KA 2DNFA 2GBKA 3WCQA 1PUTA 4CQNA 3LYYA 2C7NB 4MEMA 4TSSA 5FR3A 3VRAB 3P4RB 1WZ3A 4BKSA 3W2DA 2DBYA 3H7PB 1YQ3B 4KKJA 2ONQA 1ZE3D 1YD8U 3QCAA 2I1KA 4GLSC 1S1QB 2LGSA 3VUXA 4HXDA 3M3JA 4P16A 4WAFA 1V6EA 2NCNA 4M02A 3KVFB 3NY5A 4W9KA 1K52A 3NJTA 1JRUA 3T3NA 3R3MA 2NPTB 5E6PA 1E5WA 4C80A 2MHJA 2V3SA 2MJEA 5TR5A 1L2NA 2HD5B 3TBLD 1WSPA 3ZRFA 3V6EB 2AEHA 1BXTA 3QARA 1K51A 2LGXA 3GE3C 3K9OB 4AJYB 4DQOC 1Y56A 3W5VB 2NPTA 4MGKE 4AOFA 5EE1A 1MG8A 2BQQA 2M8SA 4A90A 1TT5B 2RDHA 2IY1B 2MQJA 4MELA 4AWJA 2KT7A 4ASWC 2L32A 4TQ1A 4KDIC 1BMLC 1JALA 4W9IA 3LXFA 5DPRA 2JYTA 1C78A 3AEBB 4L1BA 1T0YA 3L13A 1WGYA 2MBOA 3PREA 1CK1A 1TS5A 3DBSA 3H1UA 3VTVA 3IT6B 2TSSA 4IW0A 4RNAA 1TY0A 2LRWA 2UWQA 5DPWA 2ZJDA 1JWUD 1S3SG 3A9KB 4Q2JA 4YL8A 2G4SA 3NVZA 4J3OD 2K39A 2N1WA 3OLMD 4NNJB 3UIOB 3RFZB 2RPQA 2K8BA 4MT5A 3AEGB 1NI2A 1XD3B 1QZEA 4GDLB 3A4RA 4LTUA 3RYTA 2LASA 4G50A 4MH8A 3AU4A 2KK8A 2GBNA 2N9LA 3NHEB 4E74A 2LVQA 4RM8A 3MP9A 5J17A 1E8ZA 2INNE 4NJ6A 4XWWA 2M0XA 4RF0A 2ZW1A 3N30A 4PS3A 4OVVA 2Z59B 2EMTA 3RI7C 3U52E 4DXAB 3AEEB 2C7MB 2C60A 1E8XA 4MJSB 4KDLB 3RNBC 3U8ZA 4I6PA 2PVGC 5J2RA 1WJUA 1KLUD 3U30A 1IUEA 4P1BC 2WXJA 5BO4B 2KVRA 1F0ZA 3UQAA 2R61A 1TS2A 1R4MB 2KKCA 3BINA 4AS1A 3T3OA 3MHSD 3UI3A 3NS8A 1D5XC 3P4SB 3IFWB 2D2QA 4LK0M 3OWEB 3NVWA 1ISNA 1P7EA 1NYQA 1C1YB 3M63B 5HG2A 1XO3A 4G11A 2ZPNA 4GN1A 1WGRA 4K3CA 1KRHA 1V97A 2CKHB 5JHAA 2BTEA 3Q69A 3FC4A 1E7UA 4WIPA 3AE8B 4URKA 2JWZA 3V3XA 2WXIA 5IKCM 1L4DB 1KLVA 4FN2A 3PRMB 4HPMB 4X57B 4M0WB 2DYMA 4W9CA 2O6VA 2JPHA 2QSDA 4PYUA 3I3TB 3L10B 1QILA 4IM3A 3RUIB 1L0VB 2I2YA 3HK0A 4K1RB 3AM9A 4GU2A 1VD2A 3OJ3A 2Q5WD 2PPHA 4WWMA 5GMVA 1FIQA 1RM6C 3ZVVA 3HRDD 3UINB 4A55A 2BKFA 1V5TA 3PHWB 4C00A 3QAQA 2KJRA 2JU6X 1KH0A 2PE9A 4RGMA 5CHWA 1IBXA 1UWXA 1TKEA 1SF0A 2MSED 2KFKA 4HCPB 4XX5A 4YSYB 2V3NA 3ZXRA 3PO0A 2G9HD 1PGAA 4II3B 3VH3B 3A4SC 4HJKA 2N4FA 1I35A 4LLGM 3ZGZA 1OGWA 3BK2A 2J0JA 2BS4B 4ZRPA 1F9JA 1RWSA 3VTWA 2KMCA 2DYBA 2XNAC 3APDA 4N59A 5EE9A 3ZW3A 3R7QA 1HE8A 1UBIA 4NY0A 2EKEC 2KXJA 2YVCA 2FCMA 1JROA 4YTPB 4HKZE 2GBRA 3SR6A 2N9KA 4I6NB 4KIKB 2WYQA 2PVOD 1UF0A 2NS5A 4F8CB 1ROEA 3UQBA 3PT2B 3RNGC 2V4LA 2A4ZA 2JXXA 4YTNB 4CO7A 1LO5D 5FK9C 4OHJA 1OEYA 3L08A 2N9PC 2QHOA 2BYTA 1YN5A 2X8XX 2J0MA 4E3CA 2LVPA 2L1AA 3SHQA 1QF6A 1M94A 4KIKA 4WH4A 3ZQ4A 5BYSA 1Y8RC 4QAYA 1V1OA 4HLEA 1ZW7A 4JQWC 4R3DA 4ANXA 4LNOA 1ZKHA 4KSLC 5AZGA 1UELA 1Z5SB 3QC8B 1HZ5A 2B76B 4LDTD 4XWTA 2JZPA 3DBRB 3VR8B 1P98A 2K5PA 3A1QB 3URYA 3WAMA 4BKSD 4L2YA 2K8HA 2FCSA 2GI9A 4BZAA 2YEPB 3ZO5B 1JRPA 3ZJUA 3RCZA 3L54A 3ML9A 3TSSA 1I4PA 2L7RA 3RNEC 1GPXA 4II2B 2PTLA 3A1QA 1OFFA 3I63C 2DENB 2C5LC 2KC1A 1EWYC 3CSTA 2W54A 3W1SC 3U7DA 1TBEA 2IO3B 2M17A 4C56C 3VDZA 3JVZX 4LNNA 5JXVA 1KF6B 2M19A 2L0TA 1XLOA 3RULA 2ZVOA 2QC8A 3C8YA 3IT4B 5CHVC 2L83A 1QOGA 1FD6A 3RNAC 1FO4A 2PLPA 4C4VA 2W82A 3LDZE 2BB5A 2BWES 3MC8A 4MH0E 5CTRC 2WXHA 2ICIA 1ACCA 3ETRA 3NZ3A 3MTNB 1OQYA 2Z0EB 2K25A 1FRRA 1UD7A 1KJTA 5LLIA 1I4QA 2LGYA 4W9FA 2FCQA 3APCA 1F77A 3GE8C 2KJHB 1GJZA 4FBJB 2J7QB 4K3BA 3Q3FA 2MWSB 1YN3A 2V9HA 4D2KA 3DHGC 1N5XA 3KYCD 4NAMA 1GG3A 1U4AA 3TUOA 4FULA 3AE7B 3P63A 4A20A 1F2RI 3H7SA 2NTSA 1E8YA 4YWGG 2W3SA 2KYWA 2KACA 4USAA 3M95A 2ZZPB 3W5UB 3ABVB 2INCC 4K81A 3BIID 4H2AA 2WXFA 5JZEB 2W55A 2D10A 1T0RC 1H4RA 2L05A 3WA0A 1RLFA 2WGSA 2AQ3B 4G3XB 4IOIE 2NR2A 1JQ4A 1E6EB 1YMHE 3J9CA 3VXWA 3GZNB 3AMZA 2B3AA 5D94A 1T5XD 1WR6E 3IAM1 1V2YA 4DHJD 4XDDA 2KLGA 3A9JB 5BMIA 3ZJVA 3GS2A 2RR9A 2BVCA 1SXTA 3VVWB 3MHZA 3TMPB 3QJZA 3DVNV 3DDCB 3AU5A 3AE4B 5KHOA 2BKRB 2KX0A 5D3DA 3DBRI 4KGSA 4DXGA 2ZNVB 2KLCA 2XEWA 2PIAA 2O2VA 1E90A 3HHMA 1LFDA 2KDMA 1L6VA 3PZ8A 2LGDA 2RPVA 2YEPF 1TIFA 4EUTA 1WXQA 4C7ZA 3ZRCA 2PJHA 4LJPB 3Q3MC 2QDFA 1I4HA 4ARCA 2CS4A 1QOFA 5FKAC 1ENFA 2KWVB 1N61A 1VZ7A 4J6IA 1RAXA 2OJRA 4ZHPA 4KZCA 1FXIA 2PKOA 3VRBB 5AEKB 1Q0WB 3SEBA 2KDIA 2O6VD 3ZIMA 2JYEA 3Q3NC 1DOIA 2LI5A 1TKYA 3H7PA 4TUUA 2VZKB 2AX5A 3KH0A 1WFYA 1XCTL 4REZA 2DAFA 1XCQL 2WDQB 1ESFA 3WALA 5EDSA 3KUZA 4RM9A 2EELA 3E9SA 4NPNA 4IC7B 3N32A 4AP4C 4RFBA 2N1VA 4JGHB 2BB6A 4EFOA 1WM2A 3O13A 4EZJA 3EUB2 4N6EB 4N58A 3VH4B 4E71A 1TZOA 1KOTA 1DYQA 4W9EA 4GDKB 1FEHA 3B2FA 2ZEQA 4PYZA 3LJ3A 1ET9A 2N9XA 3Q8FA 3P1MA 1FM0D 2CU3A 3DQVA 3DBLB 3SDLC 1JWSD 3DBHB 3DOWA 2LXCA 1L7YA 2G1EA 2FCNA 2BGFA 1P0RA 4GIVA 2D11A 2HJ1A 1JMLA 1VLBA 4MACA 3Q6BA 2XK5B 1PGXA 4F7ZA 1YX6B 2K6DB 2RMMA 2MBHA 4BKTA 4FJZA 1SGHA 3IAS1 3AE6B 2D3CA 4EEWA 1D5MC 3X0WA 4MSMB 1FCCC 4ZRIA 2H88B 3FILB 1NDDA 2MEKA 5LXIB 1WM3A 4EZKA 1D4BA 3CIRB 4GMVA 3ECIA 1WIAA 4AUQC 2OHFA 4TKNA 2Y3AA 2DAJA 1GAQB 5G5GA 1N62A 2PEAA 3QX1A 1C9FA 2KWCA 2IO2B 2MBQA 5EE3A 5T8IA 1QOBA 4LCDE 5DPTA 3GB1A 3L4PA 5GXGB 2KZRA 1WH3A 3A9KA 3L17A 1E10A 3GZNI 3BYTB 2RSUA 3AV8A 1DOXA 1XLQA 4FA6A 3ZNID 2IY0B 3I5JC 2CJNA 2J4XA 4GDLA 5BYRA 5IN7A 1FXTB 1T0SC 5C2TB 3EFCA 3ZKJC 3P4PB 4MM3B 1N60A 4EKUA 5D7GA 1VJKA 1L0XB 1WXSA 2E3TA 3QIJA 3AN1A 2IO0B 1MVKA 1AYFA 1C76A 2G45B 3QWZB 4IG7B 2VRRB 4MJSA 1IP9A 4CHKA 3KLSX 2KC2A 1Q5WB 3TEWA 2MRPA 3I9V1 1XQQA 4ARIA 4MM3A 1BUIC 1HEZE 2QEJC 4DDGD 3QQ8B 2WXRA 3PRZA 1C4PA 3HIZA 1F52A 2LGIA 1GC6A 2MH7A 2WXLA 4XGAB 1IYFA 1F2RC 4JLCA 4IUMB 1JWAD 3NG0A 3VR9B 3HM3A 2D3BA 3KUCB 1DOYA 3TCAA 2RDBC 5AUKA 1UWMA 4RMAA 2JRIB 2MP2B 4OZAA 1OQRA 3OAWA 2KANA 3BZDB 2BT6A 2K9XA 1P9DU 3HVZA 3VFKA 2KOXA 2WHIA 3MFGA 2CR5A 3RNCC 2JT4B 5IA7A 1X1MA 2JRHA 4M0WA 2J52A 2NBWB 1V9JA 3AEAB 5CX3A 4P1CC 1WGHA 2N7DA 2WS3B 4G0NB 2AL3A 1MJDA 3DBLI 4WJQA 1I4GA 3IVFA 1LM8B 3DBHI 1C4CA 5IOIA 3PZ7A 4LJOB 2CHZA 4W9GA 1FNUA 2KDFB 1A5RA 1WYGA 1VZ6A 2WDRB 2OOBB 3JYUA 1YQ4B 2MJ3A 3KWVA 1AWDA 3N1XC 4OVUA 4GOCA 1J7CA 4JWUC 2J42A 2WXPA 2KQSA 4HCNB 1V49A 5HI1A 4RGNA 2N7JA 3N1YC 3PSEB 3SD5A 3PPAA 3Q8EA 3ZNZB 1P1AA 1YNTE 3RT3B 1H8CA 3EA6A 2V4IB 2E6XA 1J7BA 3V62A 3ZNGC 1ZGUB 4WJPA 1VRAB 1VR9A 1JWMD 2N9EB 1GB1A 2UYZB 4HRSA 3JW0X 3UGBB 5LXHA 2J53A 2KMMA 4HEA1 4KV2A
chains in the Genus database with same CATH topology
2KACA 1SB3C 5BYQA 4USAA 2LUMA 3W5UB 3AEFB 3ABVB 1WSPA 3V05A 4KX6B 1EU3A 1BXTA 1NEKB 1K51A 3BIID 4H2AA 2WXFA 1QOAA 3BWUD 1HZ6A 2RDGA 2JWUA 2W55A 4DQOC 1Y56A 3W5VB 2GRIA 1ZXIA 5D3IB 4US9A 5EE1A 4A90A 3DWGC 2AQ3B 3NS1A 3NVYA 4AQ7A 2RDHA 1V1PA 4IOIE 1XF5L 2EKIA 1JQ4A 3TEZA 1E6EB 2L32A 4TQ1A 1CQVA 3FAHA 1BMLC 1JALA 1YMHE 3J9CA 3AMZA 3I57A 3LXFA 2JYTA 1C78A 3AEBB 4L1BA 1N5WA 5C3JB 1T5XD 3IAM1 2AQ1B 2QMTA 4JPSA 1SJED 4XDDA 1EM7A 3B9JA 1TKGA 3MJ5A 4UDUC 1TYGB 2FBWB 1AW7A 1IBXB 2SAKA 1CK1A 1QLBB 1TS5A 5BMIA 3ZJVA 3GS2A 1RYJA 1D5ZC 1SXTA 1PYWD 3IT6B 2AQ2B 2TSSA 3NRZA 4RNAA 1TY0A 3MHZA 2PW9A 2WP9B 1JWUD 3AE4B 1I4RA 4Q2JA 3NVZA 5D3DA 4J3OD 3BK1A 2N0SB 1WGKA 4KGSA 4DXGA 3AE3B 2V3PA 2D5GA 2PIAA 3RFZB 2KDMA 1L6VA 4RF1A 3PZ8A 2RPVA 4MT5A 4OW0A 1SE3A 2YEPF 3AEGB 4GDLB 1WXQA 4C7ZA 4LTUA 2JSVX 3HVDA 4MH8A 2INPE 1SE2A 1I4HA 3AE9B 4ARCA 1ET6A 1QOFA 3EGRA 4OVZA 5FKAC 3KWLA 2N9LA 3R2TA 3HUIA 1MHHE 3MP9A 1ENFA 1N61A 2Y5CA 1Q10A 1T6BX 1VZ7A 1XLPA 2INNE 2WXGA 1MHXA 4XWWA 4RF0A 1JWBD 4ZHPA 1FXIA 2WXOA 2PKOA 1TJEA 3B2GA 1NI3A 2ZW1A 3VRBB 1J7AA 3E56A 3SEBA 4JWSC 2JYEA 1DOIA 3U52E 1PDXA 1TKYA 3AEEB 1I7HA 2WDVB 2KQ4X 5HFYA 2VZKB 3KQ4A 2PVGC 1NENB 2AX5A 2ZW0A 4TQ0A 1XCTL 4REZA 2WDQB 1XCQL 4TMAB 4EE2A 2BW2A 1KLUD 3AEDB 1ESFA 1IUEA 2WXJA 1SE4A 2WU5B 2EELA 1F0ZA 1JW9D 3E9SA 1XEEA 2R61A 1FNVA 1TS2A 1YJIA 4AS1A 4RFBA 3T3OA 4ZRQA 3UI3A 2BB6A 3P4QB 3O13A 3TEYA 3EUB2 4N6EB 3Q8AA 4N58A 2JX5A 2X38A 3Q8CA 1TZOA 3N9YC 1D5XC 3P4SB 1DYQA 4GDKB 1FEHA 3B2FA 2QILA 1UNSA 4PT5A 4LK0M 1E7PB 1YN4A 3TEXA 3OWEB 3NVWA 4WQMA 1P7EA 1ET9A 1NYQA 3Q8FA 3P1MA 1ZDVA 4XDCA 1FM0D 5HG2A 1XO3A 3SFEB 2CU3A 2NTTA 3DWMA 1ZDXA 2BS3B 4ITKA 1VZ8A 1JWSD 3AH7A 1KRHA 3BVZA 1V97A 1B1ZA 5LNK1 2BTEA 2G1EA 3Q69A 4O1NA 5EE0A 3FC4A 4DXFA 3W9CB 4WIPA 3AE8B 4YXDB 4RGOS 3V3XA 4US8A 3VQIA 2WXIA 1JMLA 1VLBA 4KGRA 4MACA 1L4DB 1HQRD 1PGXA 2IGHA 4JX1C 2H89B 2LJIA 1JCKB 2RMMA 3U4EG 2DYMA 2QSDA 2LHDA 3LB8C 2JXTA 2WU2B 4RGTA 5E6JA 1M4VA 1K50A 1QILA 3IAS1 1L0VB 2WXKA 3AE6B 2I2YA 3AM9A 3R2IA 4RH6A 1WWTA 1XLNA 1PFDA 1D5MC 1EU4A 1SEBD 4B0MA 1MI0A 2Q5WD 4WWMA 1FIQA 1FCCC 3U2SC 3AECB 1L0YB 4WURA 1RM6C 2H88B 3FILB 1C79A 1TS4A 1SSNA 3HRDD 1ZOYB 4L23A 1SIJA 1ZP0B 2MEKA 2KWDA 3SFDB 2WXMA 4A55A 1D4BA 4IKGA 3CIRB 2VZKD 1KLGD 1HXYD 1EWCA 2JU6X 1KH0A 1L5PA 4RGMA 1IBXA 1UWXA 1TKEA 1SF0A 2OHFA 2PMVA 2Y3AA 4YSXB 1GAQB 5G5GA 5H8YE 1N62A 2ON8A 4KGTA 1C9FA 4YSYB 5EE3A 1L4ZB 1QOBA 5T8IA 2V3NA 4ZHOA 3GB1A 2IGGA 1DGJA 1NVID 1PGAA 2G9HD 3L4PA 3PO0A 5GXGB 5TSSA 4LLGM 1FCLA 1C4AA 3ZGZA 1AN8A 3BK2A 3P42A 2BS4B 4NJCA 1E10A 4ZRPA 2L52A 1RWSA 3BYTB 1B9RA 3AV8A 1DOXA 1V8CA 1C77A 1XLQA 2XNAC 2Z8LA 2CJNA 2JQRB 4A9AA 2QIEB 4C7YA 2J4XA 2ACZB 4A6QA 5G5HA 5BYRA 3ZJTA 4N59A 2SEBD 5EE9A 5C2TB 1HA5A 1MPEA 3P4PB 2OEDA 2GB1A 2HTME 1JROA 4YSZB 4YTPB 4HKZE 1I4XA 4OZCA 3SR6A 1TY2A 2N9KA 2QJLA 4MM3B 2M0AA 2K22A 1N60A 2DLBA 1D6EC 2PVOD 1IGCA 5D7GA 1VJKA 4HROA 2HDEA 1ROEA 4XE0A 2I38A 1L0XB 1A70A 2E3TA 2WQYB 3AN1A 5MPOA 4YTNB 1MVKA 1LO5D 1AYFA 5FK9C 1C76A 4OHJA 5BMHA 2BYTA 4ZYSA 1YN5A 3KLSX 2WXQA 2FUG1 3TEWA 1RFKA 2XN9C 2L1AA 3I9V1 1QF6A 4ARIA 1BUIC 1HEZE 2QEJC 4NAWB 5H92C 2LMCA 4WH4A 3ZQ4A 5BYSA 2WXRA 2IDYA 2K0PA 2WNMA 4KKIA 3W1SA 1C4PA 1SJHD 1ZUD2 3AE5B 1TS3A 1V1OA 1VDVA 1E9MA 2LGIA 3BYYB 4R3DA 2Y5PA 3Q8BA 2MH7A 2WXLA 1F2RC 1FXAA 1HZ5A 2B76B 1N63A 4XWTA 2JZPA 3VR8B 2K5PA 2WXNA 1JWAD 3URYA 4FXCA 3VR9B 4IDIA 1DOYA 1K53A 1FFVA 2V0GA 4L2YA 5AUKA 1UWMA 2GI9A 1P7FA 3U7ZA 1QKZA 2LFIA 1FRDA 3BVGA 2YEPB 4OZAA 1JRPA 5I4DA 3ZJUA 2K3UA 1KFYB 1OQQA 3TSSA 1UGJA 1OQRA 1ZXHA 1CJEA 1E0ZA 1I4PA 2LHEA 1CZPA 1GPXA 3BZDB 1ZPSA 1FFUA 2BT6A 2PTLA 2LEKA 2K9XA 2KN4A 1L6UA 3HVZA 3GP7A 3NUHB 1OFFA 1XXGA 3MFGA 3NVVA 2NMQA 3CWIA 4YT0B 2IPKD 3AE1B 1EWYC 4M0WA 1QQRA 2M56B 4P6VF 1R7SA 2W54A 2J52A 3MC0B 1UUPA 3R8BA 3RPFC 1YJJA 3AEAB 4C56C 4RCOA 2DWQA 5JXVA 2WS3B 5HHDG 1KF6B 3AE2B 2M19A 3ZYYX 1XLOA 4NZLB 1I4GA 1FNWA 5AUIA 1C4CA 1KTKA 4ZOHC 3FILA 3PZ7A 2IJ0A 1NYRA 3C8YA 3IT4B 3H8HA 2WLBA 1FNUA 2L83A 1QOGA 1FD6A 2CJOA 1WYGA 1FO4A 1GOZA 1VZ6A 2DYOA 2PLPA 2WDRB 2W82A 3WCQA 2IGDA 1PUTA 4CQNA 2BB5A 1YQ4B 2MJ3A 3AB5A 2FE8A 3LYYA 4TSSA 5FR3A 3VRAB 2W3RA 2WXHA 2ICIA 3KWVA 3P4RB 1ACCA 3ETRA 3NZ3A 1GB4A 1AWDA 2MJDA 1WRIA 3W2DA 2DBYA 1T3QA 1J7CA 1PGBA 2KAJA 1YQ3B 1FRRA 5BMGA 1I4QA 4JWUC 4KKJA 2J42A 2WXPA 5HI1A 4RGNA 2ONQA 2N7JA 1ZE3D 4YTMB 1F77A 3Q8EA 1QT9A 4HJGE 4GLSC 1YNTE 3EA6A 4OZBA 2V4IB 4JE3B 2E6XA 4P16A 1J7BA 4WAFA 4B0EA 4A8XC 1YN3A 3IXSA 3BVMA 1STEA 2BS2B 4D2KA 1N5XA 4NAMA 1VRAB 2BBCA 1VR9A 1K52A 1SBBB 1FMAD 3T3NA 1JWMD 3TUOA 1GB1A 4HRSA 3AE7B 3P63A 1F2RI 2NTSA 4C80A 4HKQA 2J53A 2KMMA 4HEA1 4YWGG 1IGDA 2MJEA 2W3SA 1V1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOI A;  1SB3 C;  1CJE A;  4YSY B;  4USA A;  5EE3 A;  1QOB A;  1E0Z A;  4ZHO A;  1CZP A;  3W5U B;  1PDX A;  1GPX A;  1TKY A;  1DGJ A;  1NVI D;  3AEE B;  1I7H A;  2WDV B;  1FFU A;  2BT6 A;  3AEF B;  2LEK A;  3L4P A;  5GXG B;  2K9X A;  3ABV B;  2PVG C;  1NEN B;  2AX5 A;  1L6U A;  4KX6 B;  3HVZ A;  2WDQ B;  1OFF A;  2BS4 B;  1NEK B;  3AED B;  3NVV A;  1E10 A;  3CWI A;  3BII D;  1IUE A;  2L52 A;  1QOA A;  3AE1 B;  1RWS A;  1EWY C;  2W55 A;  4YT0 B;  2M56 B;  4P6V F;  1R7S A;  1B9R A;  2WU5 B;  3AV8 A;  3W5V B;  1V8C A;  1JW9 D;  1XLQ A;  1DOX A;  1F0Z A;  1ZXI A;  2W54 A;  4US9 A;  3RPF C;  1YJJ A;  2CJN A;  3AEA B;  1YJI A;  2JQR B;  5EE1 A;  4A9A A;  2QIE B;  3DWG C;  3NVY A;  2DWQ A;  3NS1 A;  4C7Y A;  2WS3 B;  2ACZ B;  1KF6 B;  3AE2 B;  5G5H A;  2EKI A;  2M19 A;  3P4Q B;  4N59 A;  1JQ4 A;  5EE9 A;  3ZYY X;  1XLO A;  1E6E B;  3EUB 2;  4N6E B;  5C2T B;  4N58 A;  2JX5 A;  3FAH A;  1JAL A;  5AUI A;  4ZOH C;  3AMZ A;  3P4P B;  3P4S B;  3LXF A;  3AEB B;  1NYR A;  3B2F A;  1N5W A;  2HTM E;  5C3J B;  1JRO A;  1E7P B;  2WLB A;  4YTP B;  4YSZ B;  2L83 A;  4WQM A;  1QOG A;  3NVW A;  2CJO A;  1WYG A;  1FO4 A;  3SR6 A;  1NYQ A;  2QJL A;  3B9J A;  2WDR B;  1TKG A;  2K22 A;  1FM0 D;  1N60 A;  3P1M A;  3WCQ A;  1XO3 A;  3SFE B;  2CU3 A;  1PUT A;  1TYG B;  2FBW B;  2PVO D;  3DWM A;  1YQ4 B;  2MJ3 A;  3AB5 A;  1VJK A;  2BS3 B;  4HRO A;  4ITK A;  1QLB B;  3AH7 A;  1ROE A;  5MPO A;  1A70 A;  2E3T A;  2WQY B;  3AN1 A;  1KRH A;  2W3R A;  3VRA B;  4YTN B;  1V97 A;  1RYJ A;  3P4R B;  2G1E A;  1AYF A;  3ETR A;  5EE0 A;  1AWD A;  3PO0 A;  3FC4 A;  2MJD A;  1WRI A;  3NRZ A;  3W9C B;  3AE8 B;  4YXD B;  2DBY A;  1T3Q A;  1J7C A;  2WP9 B;  2KAJ A;  4US8 A;  1YQ3 B;  1FRR A;  1RFK A;  1VLB A;  3AE4 B;  4JWU C;  1QF6 A;  3NVZ A;  4JX1 C;  2N0S B;  1WGK A;  2H89 B;  3AE3 B;  4YTM B;  5H92 C;  2PIA A;  1QT9 A;  2WU2 B;  3LB8 C;  1L6V A;  1L0V B;  3AE6 B;  3AM9 A;  1ZUD 2;  1WWT A;  1XLN A;  1VDV A;  3AE5 B;  3AEG B;  1PFD A;  1E9M A;  1WXQ A;  4C7Z A;  2Q5W D;  4LTU A;  4WWM A;  1FIQ A;  2MH7 A;  1J7B A;  3AEC B;  1RM6 C;  2H88 B;  1FXA A;  2B76 B;  1N63 A;  2BS2 B;  3AE9 B;  1N5X A;  2K5P A;  3VR8 B;  1JWA D;  3HRD D;  1QOF A;  4FXC A;  1ZOY B;  3KWL A;  1SIJ A;  1ZP0 B;  3VR9 B;  3HUI A;  3SFD B;  1FMA D;  3CIR B;  4IDI A;  1N61 A;  2Y5C A;  1DOY A;  1FFV A;  1XLP A;  5AUK A;  1UWM A;  1JWB D;  4HRS A;  4ZHP A;  1L5P A;  3AE7 B;  1FXI A;  3P63 A;  1FRD A;  2PKO A;  1TJE A;  3B2G A;  1NI3 A;  1TKE A;  3VRB B;  1SF0 A;  1J7A A;  1JRP A;  2KMM A;  2OHF A;  4C80 A;  4YSX B;  1GAQ B;  2MJE A;  4JWS C;  5G5G A;  1KFY B;  1N62 A;  1OQQ A;  2W3S A;  5H8Y E;  1OQR A; 
#chains in the Genus database with same CATH topology
 1SB3 C;  4WAA A;  2C7H A;  3JSV B;  2VH2 A;  2C9W B;  4HK2 A;  4KX6 B;  4ACF A;  2HTH A;  1HTQ A;  1EU3 A;  1GC7 A;  3T9L A;  3BWU D;  2RDG A;  4IM0 A;  1R4N I;  5L95 C;  4US9 A;  2K6Q A;  4NJ7 A;  2XBB C;  4WWP A;  1J0G A;  3NS1 A;  2EKI A;  5AZH A;  3TEZ A;  2JZ3 B;  2D3G A;  3R66 C;  1N5W A;  3B9J A;  3MJ5 A;  1WI0 A;  1KM7 A;  1CMX B;  1TYG B;  1AW7 A;  2GBM A;  1QLB B;  2G4D B;  3RN9 C;  2BF8 B;  1D5Z C;  2DZM A;  4W9D A;  3KYD D;  3NRZ A;  1UBQ A;  2PW9 A;  1I4R A;  3BK1 A;  2N0S B;  1WJ6 A;  4A3O A;  2V3P A;  3DVG Y;  4FJY A;  3B1L X;  5D6J B;  1HTO A;  2DHZ A;  2BYF A;  3CSF A;  4N9F 4;  3DVN U;  3QK0 A;  2JSV X;  3HVD A;  3RZW C;  3VHT C;  2KO3 A;  3AE9 B;  2W9N A;  1ET6 A;  3EGR A;  4OVZ A;  2KTF A;  4AJW A;  2Y5C A;  3NOB A;  1Q10 A;  2WXG A;  2WXO A;  3L16 A;  2V1Y A;  1TJE A;  1NI3 A;  2Z0D B;  1TTN A;  4JWS C;  1TGZ B;  3RNF C;  2KQ4 X;  3KQ4 A;  3OJ4 B;  2ZW0 A;  2LWP A;  4TQ0 A;  2BW2 A;  3AED B;  1SE4 A;  2M4N A;  1XEE A;  1YJI A;  4NQK E;  4K7U A;  4ZRQ A;  5E6N A;  1N6Z A;  4BFR A;  2FIF A;  2KQ7 A;  2X38 A;  3Q8C A;  3K9P B;  3N9Y C;  3VUY A;  2LVO A;  2QIL A;  1UNS A;  1WJ4 A;  4PT5 A;  4ZRJ A;  3NZS A;  1WMH B;  4WQM A;  2MA9 B;  4XDC A;  1MFW A;  2NTT A;  3DWM A;  1V5O A;  1E8W A;  4HPP A;  3M62 B;  4FHJ A;  3ZLZ A;  1TZ1 A;  1VZ8 A;  3AH7 A;  4LNK A;  2GLS A;  3NZU A;  2K8C A;  2VH1 A;  3BVZ A;  5LNK 1;  4O1N A;  2L0F A;  4YXD B;  3MC9 A;  4RGO S;  2G3Q B;  4KSK C;  4US8 A;  3IG3 A;  3VQI A;  1V80 A;  4KGR A;  2FAZ A;  1HQR D;  2REX A;  2IGH A;  3RZF A;  4JX1 C;  2H89 B;  2LJI A;  3TJP A;  1JCK B;  3D32 A;  2LHD A;  4RGT A;  2JXT A;  5E6J A;  1NBF C;  1K50 A;  1YOV B;  3HM6 X;  2IBI B;  2LJ5 A;  4RH6 A;  1G6J A;  1WWT A;  1XLN A;  1EU4 A;  1SEB D;  4B0M A;  5E6O A;  3TL5 A;  4KZ0 A;  3S2A A;  1L0Y B;  4WUR A;  3Q3O C;  2KTR B;  2MX2 A;  1SSN A;  1V86 A;  1LGR A;  1ZOY B;  1SIJ A;  1ZP0 B;  1SIF A;  5DCN A;  1HXY D;  1EWC A;  3N20 C;  4M00 A;  4EOY A;  3A9J A;  2PMV A;  5G2N A;  5J18 A;  1GNU A;  4YSX B;  3PLU A;  4LDT B;  4ZHO A;  1DGJ A;  4ICU A;  2IZV B;  2ZVN A;  2NVU I;  1C4A A;  4MGI E;  1AN8 A;  4BAX A;  1PQS A;  1GUA B;  4TV3 A;  1WRD B;  1EF5 A;  1B9R A;  1C77 A;  2Z8L A;  2JQR B;  4A9A A;  2QIE B;  3ZTD A;  4C7Y A;  3ENE A;  5G5H A;  3ZJT A;  1WF9 A;  2MBB B;  4S0R A;  1WXV A;  2D07 B;  1HA5 A;  4F1S A;  1MPE A;  4IWO A;  2OED A;  1BT0 A;  1TY2 A;  2M0A A;  1D6E C;  4DK5 A;  1IGC A;  5IO9 A;  4HRO A;  4XZ4 A;  2HDE A;  4XE0 A;  1A70 A;  3AI5 A;  3T8M A;  2KX3 A;  2JVC A;  2WXQ A;  2FUG 1;  4WWN A;  2FID A;  1EO6 A;  3DVG X;  4GSW A;  5H92 C;  1J19 A;  1WX9 A;  2WNM A;  4B6W A;  1ZUD 2;  3AE5 B;  1E9M A;  3BYY B;  2Y5P A;  3Q8B A;  5L83 A;  1FXA A;  4DDI D;  4GDK A;  2WXN A;  4PS7 A;  2L00 B;  1FPY A;  3FKY A;  1FFV A;  3UF8 A;  2V0G A;  1WXM A;  3U7Z A;  1P7F A;  4IWP A;  1QKZ A;  2LFI A;  1FRD A;  3BVG A;  5CHF A;  2K3U A;  4EZL A;  1KFY B;  1OQQ A;  1RFA A;  1ZXH A;  2WDT B;  1CJE A;  1CZP A;  3EHV A;  1FFU A;  2N7E A;  1L6U A;  3GP7 A;  4ZDV A;  3NUH B;  2XK5 A;  1XXG A;  3NVV A;  2NMQ A;  3AE1 B;  4JL9 A;  2M56 B;  4P6V F;  1R7S A;  4W9H A;  2CU1 A;  3R8B A;  3RPF C;  2BWF A;  2DWQ A;  3KW5 B;  3ZYY X;  2AYO B;  4ANW A;  1FNW A;  1KTK A;  4BBN F;  3FIL A;  2IJ0 A;  1NYR A;  3IBE A;  2WLB A;  2CJO A;  1V81 A;  4MGY E;  2IGD A;  2WWZ A;  2A5U A;  2LD9 A;  3AB5 A;  2FE8 A;  4CYE A;  3C0R B;  2W3R A;  3DCG A;  1GB4 A;  5C1Z A;  4MSQ B;  4HVB A;  2MJD A;  1WRI A;  3KUD B;  1WE7 A;  3A33 B;  1T3Q A;  1PGB A;  4WJO A;  4XC2 A;  2KAJ A;  4DHJ B;  1R4N B;  5BMG A;  2I1J A;  4S17 A;  3W1Y A;  3WAP A;  3IHP C;  4YTM B;  1P3Q U;  3ZTC A;  3Q3J A;  1QT9 A;  4K7S A;  4HJG E;  2BYV E;  4OZB A;  4JE3 B;  4M8N A;  3VTU A;  4B0E A;  4A8X C;  3IXS A;  3BVM A;  1STE A;  2BS2 B;  1VCB A;  2BBC A;  2FNJ B;  1SBB B;  1FMA D;  1WYW B;  3ML8 A;  3ZDT A;  4MGZ E;  4HKQ A;  2UU7 A;  5FR6 A;  1IGD A;  2RD0 A;  2ZCB A;  4DWF A;  3X23 A;  2MLB A;  1V1P B;  5BYQ A;  4DHZ E;  2IO1 B;  2LUM A;  3N1Z C;  5IP4 D;  3AEF B;  3V05 A;  4FJV B;  4BKG A;  1WY8 A;  1NEK B;  1QOA A;  1HZ6 A;  2JWU A;  2GRI A;  2O6V B;  1ZXI A;  2BYE A;  3EEC A;  5D3I B;  2EMS A;  1UH6 A;  3DWG C;  3NVY A;  4AQ7 A;  1V1P A;  1WZ0 A;  3WIM A;  1XF5 L;  4ANV A;  5DPS A;  1CQV A;  3FAH A;  4GB9 A;  1WXA A;  2GOW A;  3I57 A;  1OEY J;  5C3J B;  2AQ1 B;  2QMT A;  4JPS A;  1SJE D;  1EM7 A;  2WX1 A;  1TKG A;  4UDU C;  3B08 A;  2WX0 A;  4IWQ A;  2FBW B;  4IM2 A;  1IBX B;  2MP2 A;  4ZRK A;  2SAK A;  4M8M A;  1UGM A;  1WE6 A;  1RYJ A;  2KFK B;  1PYW D;  2AQ2 B;  1WJN A;  2IYD B;  2WP9 B;  3DPD A;  3ZUN A;  3PV1 A;  4JIO U;  4WJN A;  3ZDM C;  5IAA C;  1WGK A;  3PZD A;  3AE3 B;  4FAD A;  2D5G A;  4BOS C;  4RF1 A;  5JH5 C;  1YJ1 A;  4OW0 A;  1SE3 A;  1WGD A;  1AAR A;  2INP E;  4B95 A;  3QHT A;  1SE2 A;  1EF1 A;  3KWL A;  3R2T A;  3HUI A;  1MHH E;  3VAW A;  3BY4 B;  2MCN B;  1T6B X;  1XLP A;  1MHX A;  1JWB D;  3WAN A;  5KHQ A;  3ZXV A;  3B2G A;  5AZF A;  1J7A A;  5C23 A;  3E56 A;  4W9J A;  2KHW B;  4W9L A;  1PDX A;  2D3A A;  1I7H A;  2WDV B;  5HFY A;  1NEN B;  3TIX A;  4TMA B;  4EE2 A;  2KDB A;  1J8C A;  3Q14 C;  1LXD A;  2KFJ A;  3EC8 A;  2WU5 B;  1YQB A;  1JW9 D;  3H6N A;  1FNV A;  1E7V A;  4ZYN A;  2QCZ A;  1SE9 A;  3V60 A;  3P4Q B;  2L8J A;  3TEY A;  3Q8A A;  2JX5 A;  2HE7 A;  4PK1 A;  1E7P B;  1YN4 A;  3TEX A;  3CMM B;  2GMI C;  2KD0 A;  4NQL B;  1ZDV A;  2GBJ A;  1OTR B;  3SFE B;  4M01 A;  2LRU A;  3APF A;  1ZDX A;  2MW5 A;  2L3Z A;  2BS3 B;  4ITK A;  3RMK C;  2DZK A;  2R2O A;  4WQO B;  1MG4 A;  4GXB A;  2KWU B;  1B1Z A;  3DHI C;  5EE0 A;  3UIP B;  4DXF A;  4MDK E;  3JSV A;  3W9C B;  3CF6 E;  4ANU A;  3U4E G;  3LB8 C;  2WU2 B;  1M4V A;  2WXK A;  3ZNH B;  1XT9 B;  3R2I A;  1T0Q C;  2Y5B B;  2LXA A;  1PFD A;  3V61 A;  1R4M I;  4HDO A;  1MI0 A;  2NBV B;  3AEC B;  3U2S C;  3ALB A;  1C79 A;  3R7R A;  1TS4 A;  2IND C;  5D2M B;  3QA8 A;  3PS6 A;  4L23 A;  2FUH B;  2KWD A;  3SFD B;  2WXM A;  4IKG A;  2VZK D;  4KVG B;  1KLG D;  4C4V B;  2MBE A;  1L5P A;  2JUO A;  1YX5 B;  2JY6 A;  1RRB A;  5H8Y E;  2ON8 A;  4KGT A;  4FLH A;  1L4Z B;  1Z2M A;  2IGG A;  1NVI D;  3PHX B;  5TSS A;  3PVL A;  4ICV A;  1FCL A;  3P42 A;  2AWT A;  4NJC A;  2CHW A;  2L52 A;  3DHH C;  2CHX A;  2LUE A;  3O65 B;  1V8C A;  2KMA A;  3Q2A C;  2DZI A;  2BPS A;  3C19 A;  4HPL B;  4BBN C;  2ACZ B;  4A6Q A;  1UZX B;  2SEB D;  2JF5 A;  1YIW A;  3B0A A;  2NBU A;  3WAO A;  2GB1 A;  2HTM E;  3V6C B;  2KDE B;  4YSZ B;  1I4X A;  2KVZ A;  4OZC A;  2DX5 B;  2QJL A;  4HWI B;  2K22 A;  2DLB A;  1I42 A;  4P7I A;  1EUV B;  2I38 A;  1F1H A;  2R2Q A;  5MPO A;  2WQY B;  4DHZ B;  5HKH A;  2DZJ A;  1WR1 A;  5BMH A;  3RD2 A;  4ZYS A;  3MJW A;  4BVU C;  2OJW A;  1RFK A;  2XN9 C;  2JZZ A;  2ZNV C;  2ASQ A;  4NAW B;  5JHB A;  4GGQ A;  3AUL A;  1WX7 A;  2LMC A;  3PTF C;  2IDY A;  4FHK A;  2K0P A;  4BOZ B;  4KKI A;  4WWO A;  3W1S A;  2RGF A;  3L0W B;  1SJH D;  3ONS A;  1TS3 A;  1VDV A;  2LZ6 A;  3P2B A;  3N3K B;  1N63 A;  4FXC A;  2L76 A;  1WMH A;  4NAW A;  4IDI A;  1K53 A;  4PS8 A;  4LNI A;  1WGG A;  2KN5 A;  4DBG A;  2KJ6 A;  5G55 A;  3PGE A;  5I4D A;  1UGJ A;  2KNB A;  3OG5 A;  3AXC A;  3PLV A;  1E0Z A;  4HDQ A;  1IPG A;  2LHE A;  4XYC A;  1ZPS A;  1C3T A;  2LEK A;  2ZPY A;  2KN4 A;  4LNF A;  1Q1O A;  2M1M A;  3CWI A;  4A3P A;  4YT0 B;  2HJ8 A;  2IPK D;  2AL6 A;  1QQR A;  3SU8 X;  4K7W A;  3MC0 B;  1UUP A;  2O2V B;  1YJJ A;  1WX8 A;  4RCO A;  2ZCC A;  2K1F A;  3H9D A;  1K8R B;  5HHD G;  3AE2 B;  2PE6 B;  4B9K A;  4NZL B;  2YLM A;  1LQB A;  2KTR A;  5AUI A;  3GOE A;  4ZOH C;  1D3Z A;  3H8H A;  3PRP B;  4I6L B;  3VUW A;  3EFU A;  1GOZ A;  2DYO A;  2J0K A;  2DNF A;  2GBK A;  3WCQ A;  1PUT A;  4CQN A;  3LYY A;  2C7N B;  4MEM A;  4TSS A;  5FR3 A;  3VRA B;  3P4R B;  1WZ3 A;  4BKS A;  3W2D A;  2DBY A;  3H7P B;  1YQ3 B;  4KKJ A;  2ONQ A;  1ZE3 D;  1YD8 U;  3QCA A;  2I1K A;  4GLS C;  1S1Q B;  2LGS A;  3VUX A;  4HXD A;  3M3J A;  4P16 A;  4WAF A;  1V6E A;  2NCN A;  4M02 A;  3KVF B;  3NY5 A;  4W9K A;  1K52 A;  3NJT A;  1JRU A;  3T3N A;  3R3M A;  2NPT B;  5E6P A;  1E5W A;  4C80 A;  2MHJ A;  2V3S A;  2MJE A;  5TR5 A;  1L2N A;  2HD5 B;  3TBL D;  1WSP A;  3ZRF A;  3V6E B;  2AEH A;  1BXT A;  3QAR A;  1K51 A;  2LGX A;  3GE3 C;  3K9O B;  4AJY B;  4DQO C;  1Y56 A;  3W5V B;  2NPT A;  4MGK E;  4AOF A;  5EE1 A;  1MG8 A;  2BQQ A;  2M8S A;  4A90 A;  1TT5 B;  2RDH A;  2IY1 B;  2MQJ A;  4MEL A;  4AWJ A;  2KT7 A;  4ASW C;  2L32 A;  4TQ1 A;  4KDI C;  1BML C;  1JAL A;  4W9I A;  3LXF A;  5DPR A;  2JYT A;  1C78 A;  3AEB B;  4L1B A;  1T0Y A;  3L13 A;  1WGY A;  2MBO A;  3PRE A;  1CK1 A;  1TS5 A;  3DBS A;  3H1U A;  3VTV A;  3IT6 B;  2TSS A;  4IW0 A;  4RNA A;  1TY0 A;  2LRW A;  2UWQ A;  5DPW A;  2ZJD A;  1JWU D;  1S3S G;  3A9K B;  4Q2J A;  4YL8 A;  2G4S A;  3NVZ A;  4J3O D;  2K39 A;  2N1W A;  3OLM D;  4NNJ B;  3UIO B;  3RFZ B;  2RPQ A;  2K8B A;  4MT5 A;  3AEG B;  1NI2 A;  1XD3 B;  1QZE A;  4GDL B;  3A4R A;  4LTU A;  3RYT A;  2LAS A;  4G50 A;  4MH8 A;  3AU4 A;  2KK8 A;  2GBN A;  2N9L A;  3NHE B;  4E74 A;  2LVQ A;  4RM8 A;  3MP9 A;  5J17 A;  1E8Z A;  2INN E;  4NJ6 A;  4XWW A;  2M0X A;  4RF0 A;  2ZW1 A;  3N30 A;  4PS3 A;  4OVV A;  2Z59 B;  2EMT A;  3RI7 C;  3U52 E;  4DXA B;  3AEE B;  2C7M B;  2C60 A;  1E8X A;  4MJS B;  4KDL B;  3RNB C;  3U8Z A;  4I6P A;  2PVG C;  5J2R A;  1WJU A;  1KLU D;  3U30 A;  1IUE A;  4P1B C;  2WXJ A;  5BO4 B;  2KVR A;  1F0Z A;  3UQA A;  2R61 A;  1TS2 A;  1R4M B;  2KKC A;  3BIN A;  4AS1 A;  3T3O A;  3MHS D;  3UI3 A;  3NS8 A;  1D5X C;  3P4S B;  3IFW B;  2D2Q A;  4LK0 M;  3OWE B;  3NVW A;  1ISN A;  1P7E A;  1NYQ A;  1C1Y B;  3M63 B;  5HG2 A;  1XO3 A;  4G11 A;  2ZPN A;  4GN1 A;  1WGR A;  4K3C A;  1KRH A;  1V97 A;  2CKH B;  5JHA A;  2BTE A;  3Q69 A;  3FC4 A;  1E7U A;  4WIP A;  3AE8 B;  4URK A;  2JWZ A;  3V3X A;  2WXI A;  5IKC M;  1L4D B;  1KLV A;  4FN2 A;  3PRM B;  4HPM B;  4X57 B;  4M0W B;  2DYM A;  4W9C A;  2O6V A;  2JPH A;  2QSD A;  4PYU A;  3I3T B;  3L10 B;  1QIL A;  4IM3 A;  3RUI B;  1L0V B;  2I2Y A;  3HK0 A;  4K1R B;  3AM9 A;  4GU2 A;  1VD2 A;  3OJ3 A;  2Q5W D;  2PPH A;  4WWM A;  5GMV A;  1FIQ A;  1RM6 C;  3ZVV A;  3HRD D;  3UIN B;  4A55 A;  2BKF A;  1V5T A;  3PHW B;  4C00 A;  3QAQ A;  2KJR A;  2JU6 X;  1KH0 A;  2PE9 A;  4RGM A;  5CHW A;  1IBX A;  1UWX A;  1TKE A;  1SF0 A;  2MSE D;  2KFK A;  4HCP B;  4XX5 A;  4YSY B;  2V3N A;  3ZXR A;  3PO0 A;  2G9H D;  1PGA A;  4II3 B;  3VH3 B;  3A4S C;  4HJK A;  2N4F A;  1I35 A;  4LLG M;  3ZGZ A;  1OGW A;  3BK2 A;  2J0J A;  2BS4 B;  4ZRP A;  1F9J A;  1RWS A;  3VTW A;  2KMC A;  2DYB A;  2XNA C;  3APD A;  4N59 A;  5EE9 A;  3ZW3 A;  3R7Q A;  1HE8 A;  1UBI A;  4NY0 A;  2EKE C;  2KXJ A;  2YVC A;  2FCM A;  1JRO A;  4YTP B;  4HKZ E;  2GBR A;  3SR6 A;  2N9K A;  4I6N B;  4KIK B;  2WYQ A;  2PVO D;  1UF0 A;  2NS5 A;  4F8C B;  1ROE A;  3UQB A;  3PT2 B;  3RNG C;  2V4L A;  2A4Z A;  2JXX A;  4YTN B;  4CO7 A;  1LO5 D;  5FK9 C;  4OHJ A;  1OEY A;  3L08 A;  2N9P C;  2QHO A;  2BYT A;  1YN5 A;  2X8X X;  2J0M A;  4E3C A;  2LVP A;  2L1A A;  3SHQ A;  1QF6 A;  1M94 A;  4KIK A;  4WH4 A;  3ZQ4 A;  5BYS A;  1Y8R C;  4QAY A;  1V1O A;  4HLE A;  1ZW7 A;  4JQW C;  4R3D A;  4ANX A;  4LNO A;  1ZKH A;  4KSL C;  5AZG A;  1UEL A;  1Z5S B;  3QC8 B;  1HZ5 A;  2B76 B;  4LDT D;  4XWT A;  2JZP A;  3DBR B;  3VR8 B;  1P98 A;  2K5P A;  3A1Q B;  3URY A;  3WAM A;  4BKS D;  4L2Y A;  2K8H A;  2FCS A;  2GI9 A;  4BZA A;  2YEP B;  3ZO5 B;  1JRP A;  3ZJU A;  3RCZ A;  3L54 A;  3ML9 A;  3TSS A;  1I4P A;  2L7R A;  3RNE C;  1GPX A;  4II2 B;  2PTL A;  3A1Q A;  1OFF A;  3I63 C;  2DEN B;  2C5L C;  2KC1 A;  1EWY C;  3CST A;  2W54 A;  3W1S C;  3U7D A;  1TBE A;  2IO3 B;  2M17 A;  4C56 C;  3VDZ A;  3JVZ X;  4LNN A;  5JXV A;  1KF6 B;  2M19 A;  2L0T A;  1XLO A;  3RUL A;  2ZVO A;  2QC8 A;  3C8Y A;  3IT4 B;  5CHV C;  2L83 A;  1QOG A;  1FD6 A;  3RNA C;  1FO4 A;  2PLP A;  4C4V A;  2W82 A;  3LDZ E;  2BB5 A;  2BWE S;  3MC8 A;  4MH0 E;  5CTR C;  2WXH A;  2ICI A;  1ACC A;  3ETR A;  3NZ3 A;  3MTN B;  1OQY A;  2Z0E B;  2K25 A;  1FRR A;  1UD7 A;  1KJT A;  5LLI A;  1I4Q A;  2LGY A;  4W9F A;  2FCQ A;  3APC A;  1F77 A;  3GE8 C;  2KJH B;  1GJZ A;  4FBJ B;  2J7Q B;  4K3B A;  3Q3F A;  2MWS B;  1YN3 A;  2V9H A;  4D2K A;  3DHG C;  1N5X A;  3KYC D;  4NAM A;  1GG3 A;  1U4A A;  3TUO A;  4FUL A;  3AE7 B;  3P63 A;  4A20 A;  1F2R I;  3H7S A;  2NTS A;  1E8Y A;  4YWG G;  2W3S A;  2KYW A;  2KAC A;  4USA A;  3M95 A;  2ZZP B;  3W5U B;  3ABV B;  2INC C;  4K81 A;  3BII D;  4H2A A;  2WXF A;  5JZE B;  2W55 A;  2D10 A;  1T0R C;  1H4R A;  2L05 A;  3WA0 A;  1RLF A;  2WGS A;  2AQ3 B;  4G3X B;  4IOI E;  2NR2 A;  1JQ4 A;  1E6E B;  1YMH E;  3J9C A;  3VXW A;  3GZN B;  3AMZ A;  2B3A A;  5D94 A;  1T5X D;  1WR6 E;  3IAM 1;  1V2Y A;  4DHJ D;  4XDD A;  2KLG A;  3A9J B;  5BMI A;  3ZJV A;  3GS2 A;  2RR9 A;  2BVC A;  1SXT A;  3VVW B;  3MHZ A;  3TMP B;  3QJZ A;  3DVN V;  3DDC B;  3AU5 A;  3AE4 B;  5KHO A;  2BKR B;  2KX0 A;  5D3D A;  3DBR I;  4KGS A;  4DXG A;  2ZNV B;  2KLC A;  2XEW A;  2PIA A;  2O2V A;  1E90 A;  3HHM A;  1LFD A;  2KDM A;  1L6V A;  3PZ8 A;  2LGD A;  2RPV A;  2YEP F;  1TIF A;  4EUT A;  1WXQ A;  4C7Z A;  3ZRC A;  2PJH A;  4LJP B;  3Q3M C;  2QDF A;  1I4H A;  4ARC A;  2CS4 A;  1QOF A;  5FKA C;  1ENF A;  2KWV B;  1N61 A;  1VZ7 A;  4J6I A;  1RAX A;  2OJR A;  4ZHP A;  4KZC A;  1FXI A;  2PKO A;  3VRB B;  5AEK B;  1Q0W B;  3SEB A;  2KDI A;  2O6V D;  3ZIM A;  2JYE A;  3Q3N C;  1DOI A;  2LI5 A;  1TKY A;  3H7P A;  4TUU A;  2VZK B;  2AX5 A;  3KH0 A;  1WFY A;  1XCT L;  4REZ A;  2DAF A;  1XCQ L;  2WDQ B;  1ESF A;  3WAL A;  5EDS A;  3KUZ A;  4RM9 A;  2EEL A;  3E9S A;  4NPN A;  4IC7 B;  3N32 A;  4AP4 C;  4RFB A;  2N1V A;  4JGH B;  2BB6 A;  4EFO A;  1WM2 A;  3O13 A;  4EZJ A;  3EUB 2;  4N6E B;  4N58 A;  3VH4 B;  4E71 A;  1TZO A;  1KOT A;  1DYQ A;  4W9E A;  4GDK B;  1FEH A;  3B2F A;  2ZEQ A;  4PYZ A;  3LJ3 A;  1ET9 A;  2N9X A;  3Q8F A;  3P1M A;  1FM0 D;  2CU3 A;  3DQV A;  3DBL B;  3SDL C;  1JWS D;  3DBH B;  3DOW A;  2LXC A;  1L7Y A;  2G1E A;  2FCN A;  2BGF A;  1P0R A;  4GIV A;  2D11 A;  2HJ1 A;  1JML A;  1VLB A;  4MAC A;  3Q6B A;  2XK5 B;  1PGX A;  4F7Z A;  1YX6 B;  2K6D B;  2RMM A;  2MBH A;  4BKT A;  4FJZ A;  1SGH A;  3IAS 1;  3AE6 B;  2D3C A;  4EEW A;  1D5M C;  3X0W A;  4MSM B;  1FCC C;  4ZRI A;  2H88 B;  3FIL B;  1NDD A;  2MEK A;  5LXI B;  1WM3 A;  4EZK A;  1D4B A;  3CIR B;  4GMV A;  3ECI A;  1WIA A;  4AUQ C;  2OHF A;  4TKN A;  2Y3A A;  2DAJ A;  1GAQ B;  5G5G A;  1N62 A;  2PEA A;  3QX1 A;  1C9F A;  2KWC A;  2IO2 B;  2MBQ A;  5EE3 A;  5T8I A;  1QOB A;  4LCD E;  5DPT A;  3GB1 A;  3L4P A;  5GXG B;  2KZR A;  1WH3 A;  3A9K A;  3L17 A;  1E10 A;  3GZN I;  3BYT B;  2RSU A;  3AV8 A;  1DOX A;  1XLQ A;  4FA6 A;  3ZNI D;  2IY0 B;  3I5J C;  2CJN A;  2J4X A;  4GDL A;  5BYR A;  5IN7 A;  1FXT B;  1T0S C;  5C2T B;  3EFC A;  3ZKJ C;  3P4P B;  4MM3 B;  1N60 A;  4EKU A;  5D7G A;  1VJK A;  1L0X B;  1WXS A;  2E3T A;  3QIJ A;  3AN1 A;  2IO0 B;  1MVK A;  1AYF A;  1C76 A;  2G45 B;  3QWZ B;  4IG7 B;  2VRR B;  4MJS A;  1IP9 A;  4CHK A;  3KLS X;  2KC2 A;  1Q5W B;  3TEW A;  2MRP A;  3I9V 1;  1XQQ A;  4ARI A;  4MM3 A;  1BUI C;  1HEZ E;  2QEJ C;  4DDG D;  3QQ8 B;  2WXR A;  3PRZ A;  1C4P A;  3HIZ A;  1F52 A;  2LGI A;  1GC6 A;  2MH7 A;  2WXL A;  4XGA B;  1IYF A;  1F2R C;  4JLC A;  4IUM B;  1JWA D;  3NG0 A;  3VR9 B;  3HM3 A;  2D3B A;  3KUC B;  1DOY A;  3TCA A;  2RDB C;  5AUK A;  1UWM A;  4RMA A;  2JRI B;  2MP2 B;  4OZA A;  1OQR A;  3OAW A;  2KAN A;  3BZD B;  2BT6 A;  2K9X A;  1P9D U;  3HVZ A;  3VFK A;  2KOX A;  2WHI A;  3MFG A;  2CR5 A;  3RNC C;  2JT4 B;  5IA7 A;  1X1M A;  2JRH A;  4M0W A;  2J52 A;  2NBW B;  1V9J A;  3AEA B;  5CX3 A;  4P1C C;  1WGH A;  2N7D A;  2WS3 B;  4G0N B;  2AL3 A;  1MJD A;  3DBL I;  4WJQ A;  1I4G A;  3IVF A;  1LM8 B;  3DBH I;  1C4C A;  5IOI A;  3PZ7 A;  4LJO B;  2CHZ A;  4W9G A;  1FNU A;  2KDF B;  1A5R A;  1WYG A;  1VZ6 A;  2WDR B;  2OOB B;  3JYU A;  1YQ4 B;  2MJ3 A;  3KWV A;  1AWD A;  3N1X C;  4OVU A;  4GOC A;  1J7C A;  4JWU C;  2J42 A;  2WXP A;  2KQS A;  4HCN B;  1V49 A;  5HI1 A;  4RGN A;  2N7J A;  3N1Y C;  3PSE B;  3SD5 A;  3PPA A;  3Q8E A;  3ZNZ B;  1P1A A;  1YNT E;  3RT3 B;  1H8C A;  3EA6 A;  2V4I B;  2E6X A;  1J7B A;  3V62 A;  3ZNG C;  1ZGU B;  4WJP A;  1VRA B;  1VR9 A;  1JWM D;  2N9E B;  1GB1 A;  2UYZ B;  4HRS A;  3JW0 X;  3UGB B;  5LXH A;  2J53 A;  2KMM A;  4HEA 1;  4KV2 A; 
#chains in the Genus database with same CATH homology
 2KAC A;  1SB3 C;  5BYQ A;  4USA A;  2LUM A;  3W5U B;  3AEF B;  3ABV B;  1WSP A;  3V05 A;  4KX6 B;  1EU3 A;  1BXT A;  1NEK B;  1K51 A;  3BII D;  4H2A A;  2WXF A;  1QOA A;  3BWU D;  1HZ6 A;  2RDG A;  2JWU A;  2W55 A;  4DQO C;  1Y56 A;  3W5V B;  2GRI A;  1ZXI A;  5D3I B;  4US9 A;  5EE1 A;  4A90 A;  3DWG C;  2AQ3 B;  3NS1 A;  3NVY A;  4AQ7 A;  2RDH A;  1V1P A;  4IOI E;  1XF5 L;  2EKI A;  1JQ4 A;  3TEZ A;  1E6E B;  2L32 A;  4TQ1 A;  1CQV A;  3FAH A;  1BML C;  1JAL A;  1YMH E;  3J9C A;  3AMZ A;  3I57 A;  3LXF A;  2JYT A;  1C78 A;  3AEB B;  4L1B A;  1N5W A;  5C3J B;  1T5X D;  3IAM 1;  2AQ1 B;  2QMT A;  4JPS A;  1SJE D;  4XDD A;  1EM7 A;  3B9J A;  1TKG A;  3MJ5 A;  4UDU C;  1TYG B;  2FBW B;  1AW7 A;  1IBX B;  2SAK A;  1CK1 A;  1QLB B;  1TS5 A;  5BMI A;  3ZJV A;  3GS2 A;  1RYJ A;  1D5Z C;  1SXT A;  1PYW D;  3IT6 B;  2AQ2 B;  2TSS A;  3NRZ A;  4RNA A;  1TY0 A;  3MHZ A;  2PW9 A;  2WP9 B;  1JWU D;  3AE4 B;  1I4R A;  4Q2J A;  3NVZ A;  5D3D A;  4J3O D;  3BK1 A;  2N0S B;  1WGK A;  4KGS A;  4DXG A;  3AE3 B;  2V3P A;  2D5G A;  2PIA A;  3RFZ B;  2KDM A;  1L6V A;  4RF1 A;  3PZ8 A;  2RPV A;  4MT5 A;  4OW0 A;  1SE3 A;  2YEP F;  3AEG B;  4GDL B;  1WXQ A;  4C7Z A;  4LTU A;  2JSV X;  3HVD A;  4MH8 A;  2INP E;  1SE2 A;  1I4H A;  3AE9 B;  4ARC A;  1ET6 A;  1QOF A;  3EGR A;  4OVZ A;  5FKA C;  3KWL A;  2N9L A;  3R2T A;  3HUI A;  1MHH E;  3MP9 A;  1ENF A;  1N61 A;  2Y5C A;  1Q10 A;  1T6B X;  1VZ7 A;  1XLP A;  2INN E;  2WXG A;  1MHX A;  4XWW A;  4RF0 A;  1JWB D;  4ZHP A;  1FXI A;  2WXO A;  2PKO A;  1TJE A;  3B2G A;  1NI3 A;  2ZW1 A;  3VRB B;  1J7A A;  3E56 A;  3SEB A;  4JWS C;  2JYE A;  1DOI A;  3U52 E;  1PDX A;  1TKY A;  3AEE B;  1I7H A;  2WDV B;  2KQ4 X;  5HFY A;  2VZK B;  3KQ4 A;  2PVG C;  1NEN B;  2AX5 A;  2ZW0 A;  4TQ0 A;  1XCT L;  4REZ A;  2WDQ B;  1XCQ L;  4TMA B;  4EE2 A;  2BW2 A;  1KLU D;  3AED B;  1ESF A;  1IUE A;  2WXJ A;  1SE4 A;  2WU5 B;  2EEL A;  1F0Z A;  1JW9 D;  3E9S A;  1XEE A;  2R61 A;  1FNV A;  1TS2 A;  1YJI A;  4AS1 A;  4RFB A;  3T3O A;  4ZRQ A;  3UI3 A;  2BB6 A;  3P4Q B;  3O13 A;  3TEY A;  3EUB 2;  4N6E B;  3Q8A A;  4N58 A;  2JX5 A;  2X38 A;  3Q8C A;  1TZO A;  3N9Y C;  1D5X C;  3P4S B;  1DYQ A;  4GDK B;  1FEH A;  3B2F A;  2QIL A;  1UNS A;  4PT5 A;  4LK0 M;  1E7P B;  1YN4 A;  3TEX A;  3OWE B;  3NVW A;  4WQM A;  1P7E A;  1ET9 A;  1NYQ A;  3Q8F A;  3P1M A;  1ZDV A;  4XDC A;  1FM0 D;  5HG2 A;  1XO3 A;  3SFE B;  2CU3 A;  2NTT A;  3DWM A;  1ZDX A;  2BS3 B;  4ITK A;  1VZ8 A;  1JWS D;  3AH7 A;  1KRH A;  3BVZ A;  1V97 A;  1B1Z A;  5LNK 1;  2BTE A;  2G1E A;  3Q69 A;  4O1N A;  5EE0 A;  3FC4 A;  4DXF A;  3W9C B;  4WIP A;  3AE8 B;  4YXD B;  4RGO S;  3V3X A;  4US8 A;  3VQI A;  2WXI A;  1JML A;  1VLB A;  4KGR A;  4MAC A;  1L4D B;  1HQR D;  1PGX A;  2IGH A;  4JX1 C;  2H89 B;  2LJI A;  1JCK B;  2RMM A;  3U4E G;  2DYM A;  2QSD A;  2LHD A;  3LB8 C;  2JXT A;  2WU2 B;  4RGT A;  5E6J A;  1M4V A;  1K50 A;  1QIL A;  3IAS 1;  1L0V B;  2WXK A;  3AE6 B;  2I2Y A;  3AM9 A;  3R2I A;  4RH6 A;  1WWT A;  1XLN A;  1PFD A;  1D5M C;  1EU4 A;  1SEB D;  4B0M A;  1MI0 A;  2Q5W D;  4WWM A;  1FIQ A;  1FCC C;  3U2S C;  3AEC B;  1L0Y B;  4WUR A;  1RM6 C;  2H88 B;  3FIL B;  1C79 A;  1TS4 A;  1SSN A;  3HRD D;  1ZOY B;  4L23 A;  1SIJ A;  1ZP0 B;  2MEK A;  2KWD A;  3SFD B;  2WXM A;  4A55 A;  1D4B A;  4IKG A;  3CIR B;  2VZK D;  1KLG D;  1HXY D;  1EWC A;  2JU6 X;  1KH0 A;  1L5P A;  4RGM A;  1IBX A;  1UWX A;  1TKE A;  1SF0 A;  2OHF A;  2PMV A;  2Y3A A;  4YSX B;  1GAQ B;  5G5G A;  5H8Y E;  1N62 A;  2ON8 A;  4KGT A;  1C9F A;  4YSY B;  5EE3 A;  1L4Z B;  1QOB A;  5T8I A;  2V3N A;  4ZHO A;  3GB1 A;  2IGG A;  1DGJ A;  1NVI D;  1PGA A;  2G9H D;  3L4P A;  3PO0 A;  5GXG B;  5TSS A;  4LLG M;  1FCL A;  1C4A A;  3ZGZ A;  1AN8 A;  3BK2 A;  3P42 A;  2BS4 B;  4NJC A;  1E10 A;  4ZRP A;  2L52 A;  1RWS A;  3BYT B;  1B9R A;  3AV8 A;  1DOX A;  1V8C A;  1C77 A;  1XLQ A;  2XNA C;  2Z8L A;  2CJN A;  2JQR B;  4A9A A;  2QIE B;  4C7Y A;  2J4X A;  2ACZ B;  4A6Q A;  5G5H A;  5BYR A;  3ZJT A;  4N59 A;  2SEB D;  5EE9 A;  5C2T B;  1HA5 A;  1MPE A;  3P4P B;  2OED A;  2GB1 A;  2HTM E;  1JRO A;  4YSZ B;  4YTP B;  4HKZ E;  1I4X A;  4OZC A;  3SR6 A;  1TY2 A;  2N9K A;  2QJL A;  4MM3 B;  2M0A A;  2K22 A;  1N60 A;  2DLB A;  1D6E C;  2PVO D;  1IGC A;  5D7G A;  1VJK A;  4HRO A;  2HDE A;  1ROE A;  4XE0 A;  2I38 A;  1L0X B;  1A70 A;  2E3T A;  2WQY B;  3AN1 A;  5MPO A;  4YTN B;  1MVK A;  1LO5 D;  1AYF A;  5FK9 C;  1C76 A;  4OHJ A;  5BMH A;  2BYT A;  4ZYS A;  1YN5 A;  3KLS X;  2WXQ A;  2FUG 1;  3TEW A;  1RFK A;  2XN9 C;  2L1A A;  3I9V 1;  1QF6 A;  4ARI A;  1BUI C;  1HEZ E;  2QEJ C;  4NAW B;  5H92 C;  2LMC A;  4WH4 A;  3ZQ4 A;  5BYS A;  2WXR A;  2IDY A;  2K0P A;  2WNM A;  4KKI A;  3W1S A;  1C4P A;  1SJH D;  1ZUD 2;  3AE5 B;  1TS3 A;  1V1O A;  1VDV A;  1E9M A;  2LGI A;  3BYY B;  4R3D A;  2Y5P A;  3Q8B A;  2MH7 A;  2WXL A;  1F2R C;  1FXA A;  1HZ5 A;  2B76 B;  1N63 A;  4XWT A;  2JZP A;  3VR8 B;  2K5P A;  2WXN A;  1JWA D;  3URY A;  4FXC A;  3VR9 B;  4IDI A;  1DOY A;  1K53 A;  1FFV A;  2V0G A;  4L2Y A;  5AUK A;  1UWM A;  2GI9 A;  1P7F A;  3U7Z A;  1QKZ A;  2LFI A;  1FRD A;  3BVG A;  2YEP B;  4OZA A;  1JRP A;  5I4D A;  3ZJU A;  2K3U A;  1KFY B;  1OQQ A;  3TSS A;  1UGJ A;  1OQR A;  1ZXH A;  1CJE A;  1E0Z A;  1I4P A;  2LHE A;  1CZP A;  1GPX A;  3BZD B;  1ZPS A;  1FFU A;  2BT6 A;  2PTL A;  2LEK A;  2K9X A;  2KN4 A;  1L6U A;  3HVZ A;  3GP7 A;  3NUH B;  1OFF A;  1XXG A;  3MFG A;  3NVV A;  2NMQ A;  3CWI A;  4YT0 B;  2IPK D;  3AE1 B;  1EWY C;  4M0W A;  1QQR A;  2M56 B;  4P6V F;  1R7S A;  2W54 A;  2J52 A;  3MC0 B;  1UUP A;  3R8B A;  3RPF C;  1YJJ A;  3AEA B;  4C56 C;  4RCO A;  2DWQ A;  5JXV A;  2WS3 B;  5HHD G;  1KF6 B;  3AE2 B;  2M19 A;  3ZYY X;  1XLO A;  4NZL B;  1I4G A;  1FNW A;  5AUI A;  1C4C A;  1KTK A;  4ZOH C;  3FIL A;  3PZ7 A;  2IJ0 A;  1NYR A;  3C8Y A;  3IT4 B;  3H8H A;  2WLB A;  1FNU A;  2L83 A;  1QOG A;  1FD6 A;  2CJO A;  1WYG A;  1FO4 A;  1GOZ A;  1VZ6 A;  2DYO A;  2PLP A;  2WDR B;  2W82 A;  3WCQ A;  2IGD A;  1PUT A;  4CQN A;  2BB5 A;  1YQ4 B;  2MJ3 A;  3AB5 A;  2FE8 A;  3LYY A;  4TSS A;  5FR3 A;  3VRA B;  2W3R A;  2WXH A;  2ICI A;  3KWV A;  3P4R B;  1ACC A;  3ETR A;  3NZ3 A;  1GB4 A;  1AWD A;  2MJD A;  1WRI A;  3W2D A;  2DBY A;  1T3Q A;  1J7C A;  1PGB A;  2KAJ A;  1YQ3 B;  1FRR A;  5BMG A;  1I4Q A;  4JWU C;  4KKJ A;  2J42 A;  2WXP A;  5HI1 A;  4RGN A;  2ONQ A;  2N7J A;  1ZE3 D;  4YTM B;  1F77 A;  3Q8E A;  1QT9 A;  4HJG E;  4GLS C;  1YNT E;  3EA6 A;  4OZB A;  2V4I B;  4JE3 B;  2E6X A;  4P16 A;  1J7B A;  4WAF A;  4B0E A;  4A8X C;  1YN3 A;  3IXS A;  3BVM A;  1STE A;  2BS2 B;  4D2K A;  1N5X A;  4NAM A;  1VRA B;  2BBC A;  1VR9 A;  1K52 A;  1SBB B;  1FMA D;  3T3N A;  1JWM D;  3TUO A;  1GB1 A;  4HRS A;  3AE7 B;  3P63 A;  1F2R I;  2NTS A;  4C80 A;  4HKQ A;  2J53 A;  2KMM A;  4HEA 1;  4YWG G;  1IGD A;  2MJE A;  2W3S A;  1V1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...