4HRSA

Crystal structure of h. volcanii small archaeal modifier protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
GRNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 2
publication title Crystal structure of the ubiquitin-like small archaeal modifier protein 2 from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii ds2
molecule tags Protein binding
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hrsA00
2Q5WD 3B2GA 1EWYC 3AEFB 1J7CA 3VRBB 3HUIA 4YT0B 3DWGC 2MH7A 4WWMA 3VRAB 4HRSA 4ZOHC 4YTNB 3VR8B 1YQ3B 4LTUA 1F0ZA 1FRRA 1NVID 5EE0A 1JALA 1GAQB 2FBWB 2OHFA 3VR9B 2ACZB 1XLNA 3AE7B 3EUB2 1ZUD2 2BT6A 4YTPB 1T3QA 2M19A 2CJOA 1WYGA 1N63A 4YSYB 5G5HA 3W5UB 5AUIA 1FM0D 1ZP0B 1A70A 1FRDA 1L6VA 1N61A 3P4RB 4C7ZA 5MPOA 4JX1C 3L4PA 4N58A 3NVWA 1DOIA 1TYGB 2QIEB 5H92C 5GXGB 1B9RA 1YJIA 4FXCA 1FFVA 2KAJA 3NVZA 2JQRB 3SFDB 1QOAA 1L5PA 5AUKA 5EE1A 2PKOA 5C2TB 5EE9A 1FMAD 3AE1B 1AWDA 4JWUC 1OQQA 1NEKB 1DGJA 1QLBB 2DWQA 1QOFA 1R7SA 1WWTA 3AECB 3AH7A 1E10A 1ZOYB 3AE5B 1DOXA 3AEAB 1I7HA 1V97A 2K5PA 1VJKA 1SF0A 4YXDB 1UWMA 1XLOA 2PVOD 1FFUA 2CU3A 2QJLA 4US8A 5H8YE 4WQMA 4YTMB 4ZHPA 5C3JB 3SR6A 1N60A 1XLQA 4ITKA 1KF6B 1RWSA 2JX5A 2PVGC 2WDRB 3AB5A 3AEDB 2WQYB 3AEBB 1VLBA 1WGKA 1RYJA 4A9AA 1JWBD 3NVYA 1NYQA 2WDVB 3CIRB 4ZHOA 4USAA 1PDXA 5G5GA 4N59A 1TKEA 4US9A 3FC4A 1ROEA 4C80A 2L52A 1YJJA 3LB8C 1JW9D 1L6UA 2G1EA 2K9XA 1QF6A 1NENB 1QOBA 1E6EB 1FIQA 3AE8B 5EE3A 4C7YA 1XO3A 3AE2B 3DWMA 1WRIA 4KX6B 4JWSC 1CJEA 3AE4B 1JWAD 1OQRA 1J7BA 2WDQB 3AMZA 3NVVA 4P6VF 2N0SB 1JRPA 2WU2B 2W3RA 3ABVB 1SB3C 3B2FA 4IDIA 1E0ZA 3AEEB 2HTME 1E9MA 2KMMA 1TJEA 2MJEA 2MJ3A 2Y5CA 2WS3B 3LXFA 1AYFA 2BS2B 3AV8A 1E7PB 2LEKA 4N6EB 1DOYA 2MJDA 1NYRA 2M56B 1TKGA 3AN1A 3P63A 1PFDA 3PO0A 1V8CA 1YQ4B 2E3TA 2W3SA 2EKIA 3NS1A 1RFKA 1FXAA 1N62A 1QT9A 1J7AA 2H89B 2K22A 3AM9A 3P1MA 2CJNA 3P4PB 1TKYA 3WCQA 1FO4A 2L83A 3ETRA 3RPFC 3HRDD 2H88B 3SFEB 1WXQA 1L0VB 2DBYA 2WLBA 1ZXIA 1KRHA 3AE6B 2WP9B 3P4QB 2AX5A 2BS3B 2PIAA 3FAHA 3HVZA 2BS4B 1NI3A 1OFFA 1GPXA 1IUEA 4YSZB 3AE3B 3W9CB 3KWLA 1CZPA 2W55A 3NRZA 3CWIA 3P4SB 1QOGA 1KFYB 1N5XA 1SIJA 2B76B 1VDVA 1FXIA 1XLPA 1RM6C 2WU5B 3AE9B 4HROA 1N5WA 3W5VB 4YSXB 1JROA 2W54A 3ZYYX 1JQ4A 3AEGB 3B9JA 3BIID 1PUTA
chains in the Genus database with same CATH superfamily
4MGKE 1YN4A 2BKRB 3ZW3A 3HK0A 1SJHD 1UUPA 4LK0M 4MJSA 2M19A 5AUIA 3U30A 1FNUA 4PT5A 3Q8EA 2ZEQA 4XWTA 2L0FA 4ANVA 2WX1A 2L32A 4IUMB 2JQRB 1H8CA 2PKOA 1XQQA 1FMAD 1WGYA 2JWUA 1ZE3D 1ZKHA 2RPQA 2BWFA 4LCDE 1QOFA 1E7UA 2K6QA 1ZOYB 2AQ2B 3DPDA 1Y8RC 2G3QB 2JVCA 4JIOU 1GC7A 2UWQA 3X23A 3A9JB 4ZRPA 3EFCA 4H2AA 2IO0B 4KGSA 4J3OD 2WDRB 2KC2A 4DXFA 5E6OA 1WGKA 3Q8BA 2PLPA 4NQLB 2KKCA 1BT0A 4N59A 4DBGA 3ENEA 3EGRA 4REZA 2KDEB 1V1PB 2KX3A 4PK1A 1SSNA 2WDQB 2N0SB 3I9V1 1KLGD 2PMVA 3T9LA 5IA7A 2MJ3A 3Q3OC 2BQQA 3KW5B 4KSKC 1TKGA 2LGSA 2LHDA 1OGWA 2AL3A 3RPFC 4IWQA 3KQ4A 3L0WB 1YNTE 1YMHE 1LO5D 3N1YC 1NI3A 4DHZE 2PE6B 1WY8A 4MH0E 3MHZA 2WXMA 3VUYA 4AUQC 3NOBA 1IGCA 3HUIA 2JRHA 1ET6A 4GLSC 1V5OA 3GE8C 1WYWB 1WXVA 2MQJA 3D32A 2GB1A 3CF6E 3IAM1 4M0WB 1RLFA 3IG3A 1FNVA 2BT6A 1HZ5A 1X1MA 5JHAA 3LJ3A 2O2VB 2FCQA 1I4PA 3P4RB 1TY2A 4I6NB 4MM3A 4A3OA 2PE9A 1PGXA 2J52A 4GSWA 1OQYA 2LFIA 2KDMA 3DBRI 2DYOA 1OQQA 3QQ8B 4TQ1A 3PRPB 4ACFA 1EWCA 3LYYA 5H8YE 2CKHB 3B0AA 4XX5A 1C4PA 3AU4A 3ZRCA 2WDVB 4CO7A 4LDTB 1ROEA 1QOBA 3MFGA 4LNNA 3AE2B 3ONSA 3CSTA 5CHVC 2C7HA 3R8BA 4G11A 5TR5A 3JSVA 4XC2A 1FCLA 2BS2B 4XDCA 1NYRA 2LXAA 4AP4C 3WA0A 3J9CA 1VR9A 3NS8A 3M95A 5I4DA 4GMVA 2KLCA 3AM9A 4HJKA 2QILA 1I4HA 3TEXA 3R2IA 1SE2A 3W1YA 1LM8B 1ZGUB 2FIFA 2R2QA 2BS4B 3BINA 2UU7A 4JLCA 3BVGA 4BAXA 3WANA 2LD9A 3KWLA 3MJWA 3BK2A 2FCMA 1Q5WB 1XLPA 3ALBA 4HDOA 3ZUNA 1SBBB 4WWMA 1QILA 2AWTA 1WX7A 2K1FA 4HRSA 3DHIC 4O1NA 2FBWB 2INNE 4W9EA 1HE8A 1BXTA 2BB5A 2LGXA 2KO3A 1MG8A 2JYTA 4W9DA 5CTRC 3NVWA 5IO9A 4LJPB 4MGZE 4MSMB 2KFJA 4FXCA 4HVBA 2RR9A 2D10A 2D3GA 2IJ0A 3S2AA 2ICIA 4F7ZA 5D3IB 3A9KB 4NJ7A 1SF0A 3PLVA 1JRUA 1AN8A 4DXGA 2NR2A 1DYQA 2UYZB 1FXTB 4ANWA 3DBSA 3Q3JA 4HPMB 4PS7A 3U2SC 4DDGD 1MHXA 1XEEA 1E6EB 4IM3A 1FEHA 2FCNA 2J7QB 4WWNA 4JE3B 3RFZB 4IDIA 1ENFA 2DYMA 3N30A 1T0YA 1TJEA 2MJEA 2L1AA 4OHJA 3LXFA 4XDDA 4RGMA 1WRDB 3ZLZA 2K0PA 2LVQA 4N9F4 4IOIE 5BMGA 3RULA 1FXAA 1N62A 1QT9A 1FD6A 4LNKA 1WXQA 1ZXIA 1EUVB 1CK1A 2AQ3B 4BBNC 4IWOA 1OFFA 1MVKA 2Z0EB 4R3DA 2WXQA 2RDHA 3KLSX 3TBLD 4OVUA 1DOXA 1RM6C 2J4XA 4GOCA 2K3UA 1RAXA 3B2GA 3AEFB 3TEYA 2V9HA 2KANA 1Q1OA 2J0MA 5DPRA 1FM0D 4KZ0A 4N58A 4M02A 1XF5L 1L4DB 4GDKA 2X38A 3UINB 2HJ1A 4XE0A 1NEKB 3QWZB 4KDIC 3PLUA 4RGOS 1YD8U 3SEBA 1P7FA 1U4AA 2KWDA 3IVFA 3RD2A 1R4MB 4W9KA 1PGBA 2RD0A 1KF6B 1TS3A 2YLMA 3V61A 2LGIA 2GBMA 4HKZE 4MGIE 3HIZA 4OVVA 2MRPA 4WWPA 3PHXB 3LB8C 4IC7B 4RCOA 4FLHA 5T8IA 2L00B 4NJCA 3U7DA 2PW9A 2O6VB 2AYOB 4DDID 2NTTA 3NUHB 4A90A 2OJRA 3HHMA 2CS4A 1RFKA 1V1OA 3Q3FA 1IPGA 1BUIC 2WLBA 1ZXHA 2BS3B 2WX0A 3X0WA 1HTQA 2A5UA 1VDVA 3ZYYX 1FIQA 1PUTA 4KKJA 1BMLC 1TZOA 4K1RB 4RGTA 2WXOA 4FHKA 4TMAB 2D3AA 4EEWA 5DPWA 1TTNA 4P1BC 4MSQB 2L05A 5H92C 4I6PA 3ZJVA 1T0QC 1MFWA 2MBBB 1E8XA 5D94A 3R3MA 2JF5A 2IDYA 4P1CC 4LNFA 4NAWB 2HTHA 4CQNA 1ZDVA 2QSDA 2MHJA 1V97A 1LGRA 1VCBA 1UWMA 2G4SA 5E6JA 5AZGA 3VH4B 3DDCB 4ASWC 2E6XA 3GZNI 1RWSA 1VLBA 1R4NB 4MM3B 1SE4A 4GN1A 3QJZA 3N3KB 1WX8A 4USAA 1D4BA 2KQSA 1V49A 1JW9D 3M62B 1QF6A 3OWEB 2W82A 1GC6A 3RUIB 3B08A 3NZ3A 3NVVA 5HG2A 2L0TA 3H7SA 3VQIA 4BBNF 4FN2A 1WXAA 1WI0A 2KMMA 4DHJD 3EECA 2INDC 4OZBA 1RRBA 4II2B 3RNAC 3ZRFA 1E90A 3BVZA 4IM0A 3M63B 5HKHA 1FO4A 2V3PA 2WGSA 1C79A 4J6IA 5FKAC 1TS5A 3H8HA 3R7RA 4L23A 1P3QU 2Y5PA 4EZJA 3V6EB 3NRZA 2KTRA 1SIJA 3MTNB 1FXIA 3DBRB 1N5WA 4WAAA 3WAMA 1EWYC 4YTNB 2QMTA 2KN5A 5EE0A 4EOYA 2M0XA 3CMMB 1D5XC 2LGYA 2G4DB 2RDBC 4K7SA 2BPSA 1FRDA 1XT9B 2WXGA 3L4PA 2D3BA 3PPAA 4ZRJA 2QIEB 4EKUA 1V80A 2KTFA 2KX0A 4WJPA 1GJZA 2GLSA 3RCZA 3V60A 4MELA 1E8ZA 4JWUC 1WF9A 4KIKA 2OEDA 3AH7A 3H7PA 1JMLA 3N20C 1KLUD 1FFUA 2QJLA 2PEAA 1LQBA 2ONQA 2MWSB 2WQYB 2HD5B 2WDTB 1ESFA 3FILA 3NVYA 5EDSA 1VZ8A 3ZJUA 2WXJA 2JXTA 4A55A 5GMVA 2G1EA 2HJ8A 3AE8B 3K9OB 5D6JB 1EU4A 3AI5A 1TT5B 4JWSC 4XWWA 2HDEA 1VD2A 2LZ6A 2BKFA 1J0GA 1I4RA 2XEWA 2NCNA 4IKGA 2VH2A 4TSSA 2DHZA 4W9JA 4M8NA 5CHWA 3BVMA 1YN5A 1I4QA 3APDA 2W3SA 3P42A 2RPVA 5C1ZA 1TY0A 2H88B 3U8ZA 4HKQA 3DOWA 3P4QB 3RYTA 5BYQA 4FADA 3W1SC 4B95A 3N1ZC 3JYUA 4RM8A 3RNBC 3ZXRA 2B76B 3W5VB 2NBVB 1WH3A 1JROA 2W54A 2L8JA 3NJTA 2Q5WD 5IAAC 4UDUC 3VXWA 2IO3B 3VDZA 4ZRIA 2KJ6A 1KOTA 4EE2A 1JALA 3AE7B 1ZW7A 3IBEA 4B6WA 4HJGE 1QZEA 4AOFA 2FUG1 1N61A 3L10B 2FUHB 4KV2A 2GBRA 4MDKE 2V3SA 4AJYB 1D3ZA 1TZ1A 1L5PA 3ZNID 3AE1B 2IYDB 2BTEA 2KT7A 2K25A 1T5XD 2KZRA 2PVOD 4GIVA 2LVPA 2M0AA 1TIFA 1FPYA 2DAJA 1C4CA 4GDKB 1PGAA 2L52A 3QCAA 3UI3A 4BVUC 1HEZE 3DVNV 4MACA 4TV3A 1JWAD 3PGEA 1KTKA 3CSFA 1HA5A 4C4VA 1XCQL 3VTVA 3AV8A 4N6EB 4HK2A 3KYCD 1DOYA 1PFDA 3MC0B 3P1MA 2JT4B 3PZ7A 3V05A 2MBHA 2DBYA 1WFYA 4B9KA 1CQVA 2WXHA 2WP9B 4BKTA 2IO2B 1NBFC 1S3SG 4RMAA 3IXSA 4FA6A 4WH4A 3B1LX 3PHWB 3SU8X 2C7NB 4TKNA 2JZPA 3BIID 3V62A 4HEA1 1F1HA 3JW0X 1WSPA 3OG5A 2G45B 2QC8A 3APFA 4X57B 1XLNA 3DVGY 1D6EC 1IBXB 4GDLA 5FR3A 1ZDXA 4HPLB 4E71A 3PS6A 2NBWB 1F77A 1JWUD 2G9HD 4W9IA 4QAYA 2B3AA 2BGFA 3TJPA 3NHEB 4A8XC 1I4XA 2C5LC 5LXIB 1GB4A 4K7WA 1I7HA 1SEBD 1GG3A 2MLBA 3IFWB 3ZNGC 4BFRA 2CU3A 2XNAC 5C3JB 2C9WB 4ITKA 2XK5A 4AQ7A 2PTLA 3DBLI 3I57A 3V6CB 1NYQA 3CIRB 1TBEA 3QHTA 2MBEA 5G5GA 4LLGM 3TUOA 4AS1A 1SXTA 4FBJB 1M94A 1NENB 3DCGA 1ZPSA 3AMZA 4FHJA 3N9YC 3NZSA 2KQ7A 4E74A 3DBHI 3KH0A 3KUZA 4MGYE 4RF1A 3ML9A 5D2MB 1LFDA 1WMHB 3N1XC 2GOWA 2JUOA 1TS2A 2YEPF 3ETRA 3RNCC 3ZXVA 2OOBB 2NTSA 3A9JA 1AARA 4LDTD 3NG0A 2AQ1B 3H6NA 3TIXA 4A6QA 2KDFB 1QOGA 4RF0A 3M3JA 5KHOA 1L0XB 4YT0B 3DWGC 3VR8B 4ZOHC 2K39A 4XZ4A 3RNEC 3WAPA 3TSSA 1GAQB 3HM6X 1ZUD2 3GZNB 1N63A 3OLMD 2ASQA 3ECIA 4C7ZA 2A4ZA 2WXKA 4DQOC 1B9RA 1YJIA 2BYFA 1B1ZA 3L54A 3NVZA 2QCZA 2KDIA 3BK1A 1K50A 2KTRB 1GOZA 2LASA 2KJHB 1DGJA 1F2RC 1XCTL 1R7SA 2IGHA 2D3CA 4ZDVA 3PZ8A 2BVCA 4G50A 3AB5A 3PRZA 3AEDB 3AEBB 1NDDA 1JWSD 3BWUD 1RYJA 3UQAA 3R7QA 1V81A 2GBNA 2ZW0A 3U52E 1Q0WB 1C3TA 2K9XA 2IY0B 3TEWA 3DHGC 3PVLA 4KIKB 4W9LA 3UGBB 3H7PB 3VAWA 2M8SA 4BOZB 4MJSB 3PSEB 2Y5CA 4K3CA 1WE6A 3PRMB 4OW0A 1VZ6A 5LXHA 3DQVA 3P63A 5C23A 3FILB 1MG4A 2KDBA 2QDFA 2FCSA 2JU6X 1G6JA 3HVZA 4GXBA 1E5WA 3W9CB 5DCNA 1KFYB 3PTFC 5JH5C 4WIPA 1YJ1A 4HWIB 3A33B 1EF5A 1KH0A 4GGQA 2MBOA 2Z0DB 3B9JA 2KMCA 1YX6B 2N1WA 3VFKA 3ZDMC 1TGZB 2GBJA 4YWGG 2I2YA 1UBQA 4LTUA 5BYRA 1FRRA 2REXA 1TS4A 2FE8A 3VR9B 4W9GA 3EUB2 1J19A 4YTPB 1T3QA 3L08A 1WYGA 1F52A 2MP2A 1WJ6A 3VVWB 4WWOA 5GXGB 2KC1A 1C1YB 4L2YA 4BZAA 2BB6A 2ZNVC 2INCC 4L1BA 3MC9A 5BO4B 1P7EA 3KYDD 3KWVA 1V5TA 4XGAB 3VH3B 2MCNB 4WQMA 4WAFA 2KXJA 3OJ4B 3Q8CA 2I1KA 2PVGC 2MBQA 1V86A 2RMMA 2QEJC 3A4SC 1K8RB 1OEYA 4ZHOA 2WXLA 2LJIA 4US9A 3C19A 2CHZA 5D7GA 2ZNVB 4NY0A 3AXCA 1UGMA 4NNJB 3DHHC 2HTME 2LJ5A 4EUTA 5JZEB 2CHXA 1E7VA 2LEKA 1UZXB 2LUMA 4NPNA 3PO0A 2BBCA 5IOIA 3QIJA 2K22A 2RDGA 3WCQA 2VZKD 1YX5B 4LNOA 1WJ4A 1KM7A 4EFOA 3ZTDA 4DHZB 3PV1A 3EFUA 1IUEA 1WZ3A 1I35A 2O6VD 2CHWA 3IT6B 1EO6A 1JQ4A 2V4IB 3Q6BA 2Y3AA 4BKGA 1EF1A 3IHPC 1J7CA 1XXGA 2DZMA 2OJWA 5J2RA 2DAFA 4F8CB 3E56A 2PJHA 2LI5A 3ZTCA 2CJOA 4YSYB 4C56C 4K7UA 3GB1A 4F1SA 3RNFC 2WXRA 2FNJB 4FULA 1UNSA 4C00A 1TYGB 5BMHA 3QARA 2CU1A 4PS8A 3JSVB 2EMTA 4CYEA 1MPEA 1QOAA 1WJNA 1VZ7A 2SAKA 5IP4D 1Z2MA 3VUXA 3VUWA 3ZIMA 5G55A 1QLBB 2DLBA 1WWTA 4I6LB 4AWJA 1IP9A 2LXCA 1VJKA 1WGDA 4HLEA 5DPSA 4JGHB 4GDLB 1Z5SB 4GB9A 3PT2B 4A9AA 4WJNA 4M01A 1P1AA 3Q14C 2WHIA 4OVZA 3AULA 1IGDA 3OAWA 5HFYA 4WJOA 2XN9C 4GU2A 3HM3A 1SIFA 2N9LA 5EE3A 3C0RB 1XO3A 3T8MA 1WXMA 1CJEA 2JZZA 4KVGB 3BYYB 4MT5A 2N9XA 2W3RA 2KN4A 2KVRA 3NY5A 2BW2A 1T0SC 3QX1A 2I38A 2K8BA 3EC8A 4CHKA 3H1UA 2M56B 2XK5B 3GE3C 1ET9A 1EU3A 2EKIA 3P4PB 2CJNA 3HRDD 4ANXA 2WWZA 1KRHA 3R66C 3Q8FA 4XYCA 2WXIA 2WXNA 1YN3A 4YL8A 5G2NA 4PS3A 3CWIA 3P4SB 1N5XA 4B0MA 3AE9B 3AU5A 4HROA 5CX3A 5EE9A 2LRWA 2AL6A 2O6VA 2KK8A 3VRAB 3U7ZA 2OHFA 3KVFB 5KHQA 2IGGA 4AJWA 5IN7A 1ZP0B 3DBLB 4PYUA 2K6DB 5AZHA 2JSVX 3A1QA 1FFVA 1HQRD 5C2TB 1C77A 3WALA 4WQOB 2D2QA 3R2TA 1T0RC 3AECB 3DBHB 3AE5B 2Z59B 3WIMA 4EZLA 2N9EB 4D2KA 3SHQA 2J53A 5J18A 5E6PA 3URYA 2JX5A 1GB1A 1JCKB 5L83A 5AZFA 2KFKA 4FJYA 3FKYA 2N1VA 3Q69A 3TL5A 3RZWC 4DXAB 4KZCA 1R4NI 4MEMA 4NZLB 4W9FA 2ZVNA 1L2NA 1RFAA 1SJED 1EM7A 3A4RA 2INPE 4KX6B 4IG7B 1UBIA 4P6VF 2GMIC 1QQRA 4A20A 2HE7A 3AEEB 1WM3A 2LHEA 3RN9C 2DZJA 4DWFA 1E9MA 4WJQA 2RGFA 2XBBC 4NAWA 2J0JA 4S0RA 4IM2A 3I63C 1V9JA 2DZIA 3NS1A 1J7AA 2YEPB 2J0KA 1C76A 4K81A 2N7JA 4NJ6A 1CMXB 2N7DA 2IO1B 1F9JA 1MHHE 2IPKD 3FAHA 3Q3NC 3WAOA 3H9DA 2Z8LA 2V4LA 2D11A 2JY6A 5JXVA 3T3NA 1YOVB 4JQWC 4S17A 2MH7A 1YQ3B 1F0ZA 2KHWB 4KDLB 1HXYD 2NPTA 3UIPB 3BY4B 4W9HA 5FR6A 4HCPB 1L6VA 3UF8A 1DOIA 1E8WA 2KAJA 5AUKA 5EE1A 3RNGC 2R2OA 3DVGX 5IKCM 1L7YA 3EHVA 4JPSA 1E10A 3AEAB 2NS5A 4IW0A 3PZDA 1MJDA 4US8A 1KLVA 1P98A 1VRAB 2DZKA 5JHBA 2LGDA 2DYBA 2L7RA 3IT4B 2NVUI 2X8XX 2MP2B 2C60A 1T6BX 2JRIB 1JWMD 3FC4A 4C80A 2M1MA 1V2YA 3MHSD 2V1YA 3L13A 2KD0A 1WRIA 2LRUA 3QAQA 4ZYSA 1E0ZA 2N7EA 1D5ZC 1I42A 1SGHA 3JVZX 3ZNHB 2WS3B 4RM9A 1WZ0A 1WR6E 3AN1A 3QA8A 2LUEA 3N32A 2MX2A 4RGNA 2H89B 2I1JA 1STEA 2RSUA 2L3ZA 4RH6A 1H4RA 2JXXA 1L0VB 2DENB 1PYWD 2WNMA 2WXPA 1S1QB 2R61A 4KGRA 5AEKB 4ICVA 4ARIA 2ZZPB 1P9DU 2W55A 4B0EA 1A5RA 5J17A 2JPHA 2WU5B 2FAZA 2KNBA 2NBUA 1J8CA 4RNAA 4P16A 4WURA 2KYWA 1M4VA 3QC8B 2TSSA 5L95C 4BOSC 2AEHA 3VTUA 3RMKC 2BYEA 2J42A 3BZDB 4HXDA 5HI1A 5BYSA 3O13A 4ANUA 2BF8B 3SFDB 4KKIA 3I3TB 3TMPB 1V1PA 2KJRA 1UWXA 3VHTC 1LXDA 1WXSA 4HPPA 3ZKJC 2K5PA 1WGGA 4TQ0A 1XLQA 1WM2A 3W2DA 1JWBD 5LLIA 1PDXA 4G0NB 3RZFA 1L6UA 5BMIA 5HHDG 1C78A 4DK5A 2SEBD 4NAMA 2ZPYA 3DWMA 4BKSD 4K3BA 3ABVB 3UIOB 1WE7A 2IZVB 3W1SA 3QK0A 2GI9A 4E3CA 2ZW1A 1AYFA 2MJDA 2N9PC 2GBKA 2EELA 4ZYNA 1SE3A 1V8CA 2W9NA 1XD3B 4M0WA 2K8CA 1HTOA 3IAS1 4ZRKA 2O2VA 2N9KA 3NZUA 3AE6B 3ZO5B 5LNK1 4LNIA 3KUCB 2KACA 2DNFA 2DX5B 3TCAA 2KWVB 4ZRQA 1SE9A 3UQBA 1GPXA 2ON8A 3AE3B 2L76A 5TSSA 3RT3B 1UF0A 3V3XA 4M00A 1N6ZA 3AEGB 1ISNA 2BWES 1C9FA 1WIAA 1YQBA 4Q2JA 4M8MA 3C8YA 1ACCA 2ACZB 3Q2AC 2C7MB 4II3B 3W5UB 4ICUA 1PQSA 4A3PA 1P0RA 1A70A 5MPOA 4JX1C 2MA9B 3GP7A 2VZKB 3EA6A 1E8YA 4TUUA 1AW7A 2MSED 1L0YB 1IYFA 1AWDA 2DWQA 1I4GA 4MH8A 3KUDB 3MC8A 4DHJB 4KGTA 3ZQ4A 2ZCBA 4YXDB 2WXFA 4IWPA 4YTMB 4ZHPA 3SR6A 1UH6A 2IBIB 3RI7C 2KLGA 2V3NA 2LWPA 2M4NA 3VTWA 3ZVVA 3A1QB 1TKEA 2MEKA 3L16A 3O65B 1IBXA 3AE4B 1YIWA 1J7BA 2M17A 2KQ4X 3B2FA 2KWUB 3SD5A 2BYVE 2IGDA 1QKZA 4BKSA 3OJ3A 2ZCCA 1NI2A 1L4ZB 2KOXA 2IY1B 2E3TA 2KFKB 3ZNZB 2KVZA 3GOEA 1FCCC 2VH1A 2MW5A 3SFEB 2NMQA 1OTRB 2JZ3B 2K8HA 4KSLC 2AX5A 2PIAA 2CR5A 1WX9A 5DPTA 2JWZA 3K9PB 4FJVB 2PPHA 4W9CA 2JYEA 3SDLC 3VRBB 3A9KA 5D3DA 1K53A 3PREA 1NVID 3LDZE 2ZPNA 3HVDA 2FIDA 4HDQA 5G5HA 1C4AA 1FNWA 2V0GA 4ARCA 1WMHA 4EZKA 1MI0A 2GRIA 3MP9A 2KMAA 4C4VB 1HZ6A 2QHOA 2WYQA 2EKEC 4PYZA 1K51A 1XLOA 3ZDTA 2LMCA 4RFBA 2NPTB 1N60A 3E9SA 4OZAA 3APCA 3ZGZA 4URKA 1V6EA 1OEYJ 4P7IA 3MJ5A 3GS2A 1GNUA 1KJTA 2Y5BB 2ZJDA 1YJJA 5CHFA 4OZCA 2YVCA 1WR1A 4FJZA 1K52A 1WGHA 4HCNB 3ZJTA 5FK9C 4C7YA 3BYTB 3Q3MC 3DVNU 1OQRA 2KWCA 1JRPA 1WGRA 2WU2B 4NQKE 1SB3C 3I5JC 2D5GA 3U4EG 1UGJA 1UD7A 2N4FA 1F2RI 3L17A 1R4MI 1E7PB 4G3XB 4LJOB 1YQ4B 1Y56A 1TKYA 1GUAB 2L83A 3P2BA 2VRRB 2LVOA 3ML8A 2EMSA 1D5MC 1WJUA 3Q8AA 1UELA 3TEZA 2ZVOA 4YSZB 3T3OA 1CZPA 1Q10A 2D07B 4YSXB 4JL9A 2BYTA 5E6NA
chains in the Genus database with same CATH topology
1L0XB 1BMLC 1TZOA 4YT0B 3DWGC 2MH7A 1YN4A 3VR8B 4ZOHC 1YQ3B 4RGTA 2WXOA 1F0ZA 4TMAB 3TSSA 1GAQB 1HXYD 1SJHD 1UUPA 4LK0M 1ZUD2 5H92C 2M19A 1N63A 5AUIA 1FNUA 3ZJVA 4PT5A 3Q8EA 1L6VA 4C7ZA 2WXKA 4XWTA 1DOIA 4DQOC 2L32A 1YJIA 1B9RA 1B1ZA 2KAJA 3NVZA 2JQRB 3BK1A 1K50A 5AUKA 5EE1A 2IDYA 2PKOA 1FMAD 1GOZA 2JWUA 1ZE3D 4NAWB 1DGJA 1F2RC 1XCTL 4CQNA 1ZDVA 1QOFA 1R7SA 4JPSA 2IGHA 1E10A 2QSDA 1ZOYB 2AQ2B 3AEAB 1V97A 3PZ8A 1UWMA 4US8A 1VRAB 5E6JA 4ZRPA 4H2AA 2E6XA 4KGSA 4J3OD 1RWSA 2WDRB 3AB5A 3AEDB 3AEBB 1VLBA 1JWSD 3BWUD 3IT4B 1WGKA 4DXFA 4MM3B 1RYJA 1SE4A 3Q8BA 1T6BX 2ZW0A 2PLPA 4USAA 3U52E 1D4BA 1JWMD 4N59A 3EGRA 3FC4A 4C80A 4REZA 1V1PB 1JW9D 2K9XA 1QF6A 3OWEB 2W82A 3TEWA 1SSNA 1WRIA 2WDQB 3NVVA 3NZ3A 2N0SB 3I9V1 5HG2A 1KLGD 2PMVA 4ZYSA 1E0ZA 1D5ZC 3VQIA 2KMMA 2Y5CA 2MJ3A 2WS3B 4OW0A 1VZ6A 4OZBA 1TKGA 3AN1A 3BVZA 3P63A 2LHDA 3FILB 4RGNA 2H89B 1FO4A 1STEA 2V3PA 4RH6A 3RPFC 1L0VB 2JU6X 3KQ4A 1PYWD 1C79A 1YNTE 2WNMA 1YMHE 1LO5D 2WXPA 3HVZA 5FKAC 1TS5A 2R61A 1NI3A 4KGRA 3H8HA 4L23A 2Y5PA 4ARIA 3W9CB 2W55A 3MHZA 3NRZA 4B0EA 1KFYB 1SIJA 4WIPA 1FXIA 2WU5B 2WXMA 1N5WA 1KH0A 3B9JA 4RNAA 1EWYC 4YWGG 1IGCA 4P16A 2I2YA 3HUIA 4WURA 1ET6A 1M4VA 4GLSC 4YTNB 2TSSA 4LTUA 5BYRA 2QMTA 1FRRA 2GB1A 5EE0A 3IAM1 1TS4A 2FE8A 1D5XC 3VR9B 1FNVA 3EUB2 2BT6A 2J42A 1HZ5A 1T3QA 3BZDB 1WYGA 4YTPB 5HI1A 1FRDA 1I4PA 2WXGA 1TY2A 3P4RB 3L4PA 1PGXA 5BYSA 2QIEB 3O13A 5GXGB 2J52A 4L2YA 3SFDB 4KKIA 2LFIA 1V1PA 2KDMA 2BB6A 2DYOA 4L1BA 4JWUC 1OQQA 1UWXA 4TQ1A 1P7EA 2OEDA 3AH7A 1JMLA 1KLUD 3KWVA 2K5PA 1EWCA 3LYYA 1FFUA 2QJLA 5H8YE 4WQMA 4WAFA 4TQ0A 1XLQA 2ONQA 2PVGC 3Q8CA 1C4PA 2WQYB 3W2DA 1ESFA 1JWBD 2RMMA 3FILA 2QEJC 3NVYA 1VZ8A 2WDVB 4ZHOA 3ZJUA 2WXJA 1PDXA 2JXTA 2WXLA 2LJIA 4US9A 1ROEA 4A55A 1L6UA 2G1EA 5BMIA 1QOBA 3AE8B 3MFGA 1C78A 5HHDG 2SEBD 5D7GA 4NAMA 3AE2B 3DWMA 1EU4A 4JWSC 4XWWA 2HDEA 3ABVB 3R8BA 2HTME 3W1SA 1I4RA 2GI9A 4IKGA 2ZW1A 1FCLA 4TSSA 1AYFA 2BS2B 2LEKA 4XDCA 2MJDA 2LUMA 1NYRA 2EELA 3J9CA 3PO0A 2BBCA 1SE3A 3BVMA 1VR9A 1I4QA 1V8CA 1YN5A 5I4DA 2W3SA 3P42A 2RPVA 2K22A 2RDGA 3AM9A 4M0WA 3WCQA 2QILA 2VZKD 1I4HA 3TEXA 3IAS1 1TY0A 2H88B 3R2IA 1SE2A 2N9KA 4HKQA 3AE6B 5LNK1 3P4QB 5BYQA 2BS4B 2KACA 3BVGA 4ZRQA 1GPXA 1IUEA 2ON8A 3AE3B 3KWLA 3BK2A 5TSSA 2B76B 1XLPA 3V3XA 3W5VB 3IT6B 1JROA 2W54A 1JQ4A 3AEGB 2V4IB 2Y3AA 2Q5WD 4UDUC 1J7CA 1XXGA 1C9FA 1SBBB 4WWMA 1QILA 4HRSA 4Q2JA 3E56A 4EE2A 4O1NA 1JALA 2FBWB 3C8YA 2INNE 1ACCA 2ACZB 3AE7B 4HJGE 3W5UB 2CJOA 4YSYB 4C56C 2FUG1 3GB1A 1BXTA 2BB5A 1A70A 1N61A 2WXRA 5MPOA 4JX1C 1UNSA 3GP7A 2JYTA 2VZKB 3EA6A 3NVWA 1TYGB 5BMHA 1AW7A 4FXCA 1MPEA 1L5PA 1L0YB 1QOAA 1VZ7A 2SAKA 3AE1B 2IJ0A 1AWDA 2ICIA 1QLBB 2DLBA 2DWQA 1I4GA 1WWTA 4MH8A 5D3IB 2BTEA 4KGTA 1T5XD 3ZQ4A 1VJKA 1SF0A 4YXDB 2PVOD 2WXFA 4YTMB 4ZHPA 1AN8A 2M0AA 3SR6A 4DXGA 1DYQA 4GDLB 1C4CA 2V3NA 4A9AA 4GDKB 4OVZA 1TKEA 2MEKA 1PGAA 2L52A 3U2SC 1IGDA 5HFYA 3UI3A 1IBXA 1MHXA 1HEZE 1XEEA 2XN9C 1E6EB 1FIQA 2N9LA 5EE3A 1XO3A 4MACA 1CJEA 1FEHA 1JWAD 3AE4B 1J7BA 3BYYB 4MT5A 4JE3B 2KQ4X 3RFZB 2W3RA 3B2FA 2KN4A 4IDIA 1KTKA 2BW2A 1ENFA 2DYMA 1HA5A 1TJEA 2MJEA 2L1AA 2IGDA 1QKZA 1XCQL 3LXFA 4OHJA 4XDDA 4RGMA 2I38A 3AV8A 4N6EB 1DOYA 2M56B 1L4ZB 1PFDA 2K0PA 2E3TA 1ET9A 1EU3A 2EKIA 3MC0B 4IOIE 1FXAA 1N62A 1QT9A 3P4PB 5BMGA 3P1MA 2CJNA 1FD6A 3PZ7A 1FCCC 3V05A 3HRDD 3SFEB 2NMQA 1WXQA 2DBYA 1ZXIA 1KRHA 1CK1A 1CQVA 2AQ3B 2WP9B 2WXHA 2AX5A 2PIAA 3Q8FA 1OFFA 2WXIA 2WXNA 1YN3A 1MVKA 3IXSA 4R3DA 2WXQA 2RDHA 3CWIA 3KLSX 1N5XA 3P4SB 4WH4A 4B0MA 1DOXA 2BYTA 3AE9B 1RM6C 4HROA 2J4XA 5EE9A 2JZPA 3BIID 2K3UA 3B2GA 2JYEA 3AEFB 3VRBB 3TEYA 4HEA1 5D3DA 1K53A 1WSPA 3VRAB 3U7ZA 1NVID 2OHFA 3HVDA 1XLNA 1D6EC 1IBXB 2IGGA 5G5HA 1C4AA 1FNWA 1FM0D 1ZP0B 2V0GA 4ARCA 5FR3A 4N58A 1ZDXA 1MI0A 1XF5L 1L4DB 2GRIA 2JSVX 3MP9A 1FFVA 2X38A 1HQRD 1F77A 1JWUD 2G9HD 5C2TB 1HZ6A 4A8XC 1I4XA 4XE0A 1C77A 1NEKB 3R2TA 1GB4A 4RGOS 3AECB 3AE5B 1I7HA 3SEBA 1SEBD 1P7FA 1K51A 2KWDA 1XLOA 2LMCA 2CU3A 4RFBA 2XNAC 5C3JB 4D2KA 2J53A 1N60A 1PGBA 3E9SA 4ITKA 1KF6B 2JX5A 3URYA 4OZAA 1TS3A 1GB1A 1JCKB 3ZGZA 4AQ7A 2PTLA 3I57A 1NYQA 2LGIA 3CIRB 3Q69A 4HKZE 3MJ5A 3GS2A 5G5GA 4LLGM 3TUOA 4AS1A 4NZLB 1YJJA 4OZCA 1SXTA 3LB8C 1K52A 1NENB 4RCOA 1SJED 5T8IA 1EM7A 3ZJTA 1ZPSA 5FK9C 4C7YA 2INPE 3BYTB 4NJCA 4KX6B 2PW9A 3AMZA 1OQRA 4P6VF 3N9YC 1QQRA 1JRPA 2WU2B 1SB3C 2NTTA 3AEEB 2LHEA 2D5GA 3NUHB 3U4EG 1UGJA 1E9MA 4RF1A 4A90A 1F2RI 1E7PB 1YQ4B 1TS2A 3NS1A 1RFKA 2YEPF 1J7AA 2YEPB 1Y56A 1C76A 1TKYA 1V1OA 2L83A 3ETRA 2N7JA 2WLBA 1BUIC 2NTSA 1D5MC 1MHHE 1ZXHA 2BS3B 2IPKD 3FAHA 3Q8AA 2AQ1B 3TEZA 4A6QA 4YSZB 3T3OA 2Z8LA 1CZPA 5JXVA 1QOGA 4RF0A 1VDVA 1Q10A 4YSXB 3T3NA 3ZYYX 1PUTA 4KKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5W D;  3B2G A;  1EWY C;  3AEF B;  1J7C A;  3VRB B;  3HUI A;  4YT0 B;  3DWG C;  2MH7 A;  4WWM A;  3VRA B;  4HRS A;  4ZOH C;  4YTN B;  3VR8 B;  1YQ3 B;  4LTU A;  1F0Z A;  1FRR A;  1NVI D;  5EE0 A;  1JAL A;  1GAQ B;  2FBW B;  2OHF A;  3VR9 B;  2ACZ B;  1XLN A;  3AE7 B;  3EUB 2;  1ZUD 2;  2BT6 A;  4YTP B;  1T3Q A;  2M19 A;  2CJO A;  1WYG A;  1N63 A;  4YSY B;  5G5H A;  3W5U B;  5AUI A;  1FM0 D;  1ZP0 B;  1A70 A;  1FRD A;  1L6V A;  1N61 A;  3P4R B;  4C7Z A;  5MPO A;  4JX1 C;  3L4P A;  4N58 A;  3NVW A;  1DOI A;  1TYG B;  2QIE B;  5H92 C;  5GXG B;  1B9R A;  1YJI A;  4FXC A;  1FFV A;  2KAJ A;  3NVZ A;  2JQR B;  3SFD B;  1QOA A;  1L5P A;  5AUK A;  5EE1 A;  2PKO A;  5C2T B;  5EE9 A;  1FMA D;  3AE1 B;  1AWD A;  4JWU C;  1OQQ A;  1NEK B;  1DGJ A;  1QLB B;  2DWQ A;  1QOF A;  1R7S A;  1WWT A;  3AEC B;  3AH7 A;  1E10 A;  1ZOY B;  3AE5 B;  1DOX A;  3AEA B;  1I7H A;  1V97 A;  2K5P A;  1VJK A;  1SF0 A;  4YXD B;  1UWM A;  1XLO A;  2PVO D;  1FFU A;  2CU3 A;  2QJL A;  4US8 A;  5H8Y E;  4WQM A;  4YTM B;  4ZHP A;  5C3J B;  3SR6 A;  1N60 A;  1XLQ A;  4ITK A;  1KF6 B;  1RWS A;  2JX5 A;  2PVG C;  2WDR B;  3AB5 A;  3AED B;  2WQY B;  3AEB B;  1VLB A;  1WGK A;  1RYJ A;  4A9A A;  1JWB D;  3NVY A;  1NYQ A;  2WDV B;  3CIR B;  4ZHO A;  4USA A;  1PDX A;  5G5G A;  4N59 A;  1TKE A;  4US9 A;  3FC4 A;  1ROE A;  4C80 A;  2L52 A;  1YJJ A;  3LB8 C;  1JW9 D;  1L6U A;  2G1E A;  2K9X A;  1QF6 A;  1NEN B;  1QOB A;  1E6E B;  1FIQ A;  3AE8 B;  5EE3 A;  4C7Y A;  1XO3 A;  3AE2 B;  3DWM A;  1WRI A;  4KX6 B;  4JWS C;  1CJE A;  3AE4 B;  1JWA D;  1OQR A;  1J7B A;  2WDQ B;  3AMZ A;  3NVV A;  4P6V F;  2N0S B;  1JRP A;  2WU2 B;  2W3R A;  3ABV B;  1SB3 C;  3B2F A;  4IDI A;  1E0Z A;  3AEE B;  2HTM E;  1E9M A;  2KMM A;  1TJE A;  2MJE A;  2MJ3 A;  2Y5C A;  2WS3 B;  3LXF A;  1AYF A;  2BS2 B;  3AV8 A;  1E7P B;  2LEK A;  4N6E B;  1DOY A;  2MJD A;  1NYR A;  2M56 B;  1TKG A;  3AN1 A;  3P63 A;  1PFD A;  3PO0 A;  1V8C A;  1YQ4 B;  2E3T A;  2W3S A;  2EKI A;  3NS1 A;  1RFK A;  1FXA A;  1N62 A;  1QT9 A;  1J7A A;  2H89 B;  2K22 A;  3AM9 A;  3P1M A;  2CJN A;  3P4P B;  1TKY A;  3WCQ A;  1FO4 A;  2L83 A;  3ETR A;  3RPF C;  3HRD D;  2H88 B;  3SFE B;  1WXQ A;  1L0V B;  2DBY A;  2WLB A;  1ZXI A;  1KRH A;  3AE6 B;  2WP9 B;  3P4Q B;  2AX5 A;  2BS3 B;  2PIA A;  3FAH A;  3HVZ A;  2BS4 B;  1NI3 A;  1OFF A;  1GPX A;  1IUE A;  4YSZ B;  3AE3 B;  3W9C B;  3KWL A;  1CZP A;  2W55 A;  3NRZ A;  3CWI A;  3P4S B;  1QOG A;  1KFY B;  1N5X A;  1SIJ A;  2B76 B;  1VDV A;  1FXI A;  1XLP A;  1RM6 C;  2WU5 B;  3AE9 B;  4HRO A;  1N5W A;  3W5V B;  4YSX B;  1JRO A;  2W54 A;  3ZYY X;  1JQ4 A;  3AEG B;  3B9J A;  3BII D;  1PUT A; 
#chains in the Genus database with same CATH topology
 4MGK E;  1YN4 A;  2BKR B;  3ZW3 A;  3HK0 A;  1SJH D;  1UUP A;  4LK0 M;  4MJS A;  2M19 A;  5AUI A;  3U30 A;  1FNU A;  4PT5 A;  3Q8E A;  2ZEQ A;  4XWT A;  2L0F A;  4ANV A;  2WX1 A;  2L32 A;  4IUM B;  2JQR B;  1H8C A;  2PKO A;  1XQQ A;  1FMA D;  1WGY A;  2JWU A;  1ZE3 D;  1ZKH A;  2RPQ A;  2BWF A;  4LCD E;  1QOF A;  1E7U A;  2K6Q A;  1ZOY B;  2AQ2 B;  3DPD A;  1Y8R C;  2G3Q B;  2JVC A;  4JIO U;  1GC7 A;  2UWQ A;  3X23 A;  3A9J B;  4ZRP A;  3EFC A;  4H2A A;  2IO0 B;  4KGS A;  4J3O D;  2WDR B;  2KC2 A;  4DXF A;  5E6O A;  1WGK A;  3Q8B A;  2PLP A;  4NQL B;  2KKC A;  1BT0 A;  4N59 A;  4DBG A;  3ENE A;  3EGR A;  4REZ A;  2KDE B;  1V1P B;  2KX3 A;  4PK1 A;  1SSN A;  2WDQ B;  2N0S B;  3I9V 1;  1KLG D;  2PMV A;  3T9L A;  5IA7 A;  2MJ3 A;  3Q3O C;  2BQQ A;  3KW5 B;  4KSK C;  1TKG A;  2LGS A;  2LHD A;  1OGW A;  2AL3 A;  3RPF C;  4IWQ A;  3KQ4 A;  3L0W B;  1YNT E;  1YMH E;  1LO5 D;  3N1Y C;  1NI3 A;  4DHZ E;  2PE6 B;  1WY8 A;  4MH0 E;  3MHZ A;  2WXM A;  3VUY A;  4AUQ C;  3NOB A;  1IGC A;  3HUI A;  2JRH A;  1ET6 A;  4GLS C;  1V5O A;  3GE8 C;  1WYW B;  1WXV A;  2MQJ A;  3D32 A;  2GB1 A;  3CF6 E;  3IAM 1;  4M0W B;  1RLF A;  3IG3 A;  1FNV A;  2BT6 A;  1HZ5 A;  1X1M A;  5JHA A;  3LJ3 A;  2O2V B;  2FCQ A;  1I4P A;  3P4R B;  1TY2 A;  4I6N B;  4MM3 A;  4A3O A;  2PE9 A;  1PGX A;  2J52 A;  4GSW A;  1OQY A;  2LFI A;  2KDM A;  3DBR I;  2DYO A;  1OQQ A;  3QQ8 B;  4TQ1 A;  3PRP B;  4ACF A;  1EWC A;  3LYY A;  5H8Y E;  2CKH B;  3B0A A;  4XX5 A;  1C4P A;  3AU4 A;  3ZRC A;  2WDV B;  4CO7 A;  4LDT B;  1ROE A;  1QOB A;  3MFG A;  4LNN A;  3AE2 B;  3ONS A;  3CST A;  5CHV C;  2C7H A;  3R8B A;  4G11 A;  5TR5 A;  3JSV A;  4XC2 A;  1FCL A;  2BS2 B;  4XDC A;  1NYR A;  2LXA A;  4AP4 C;  3WA0 A;  3J9C A;  1VR9 A;  3NS8 A;  3M95 A;  5I4D A;  4GMV A;  2KLC A;  3AM9 A;  4HJK A;  2QIL A;  1I4H A;  3TEX A;  3R2I A;  1SE2 A;  3W1Y A;  1LM8 B;  1ZGU B;  2FIF A;  2R2Q A;  2BS4 B;  3BIN A;  2UU7 A;  4JLC A;  3BVG A;  4BAX A;  3WAN A;  2LD9 A;  3KWL A;  3MJW A;  3BK2 A;  2FCM A;  1Q5W B;  1XLP A;  3ALB A;  4HDO A;  3ZUN A;  1SBB B;  4WWM A;  1QIL A;  2AWT A;  1WX7 A;  2K1F A;  4HRS A;  3DHI C;  4O1N A;  2FBW B;  2INN E;  4W9E A;  1HE8 A;  1BXT A;  2BB5 A;  2LGX A;  2KO3 A;  1MG8 A;  2JYT A;  4W9D A;  5CTR C;  3NVW A;  5IO9 A;  4LJP B;  4MGZ E;  4MSM B;  2KFJ A;  4FXC A;  4HVB A;  2RR9 A;  2D10 A;  2D3G A;  2IJ0 A;  3S2A A;  2ICI A;  4F7Z A;  5D3I B;  3A9K B;  4NJ7 A;  1SF0 A;  3PLV A;  1JRU A;  1AN8 A;  4DXG A;  2NR2 A;  1DYQ A;  2UYZ B;  1FXT B;  4ANW A;  3DBS A;  3Q3J A;  4HPM B;  4PS7 A;  3U2S C;  4DDG D;  1MHX A;  1XEE A;  1E6E B;  4IM3 A;  1FEH A;  2FCN A;  2J7Q B;  4WWN A;  4JE3 B;  3RFZ B;  4IDI A;  1ENF A;  2DYM A;  3N30 A;  1T0Y A;  1TJE A;  2MJE A;  2L1A A;  4OHJ A;  3LXF A;  4XDD A;  4RGM A;  1WRD B;  3ZLZ A;  2K0P A;  2LVQ A;  4N9F 4;  4IOI E;  5BMG A;  3RUL A;  1FXA A;  1N62 A;  1QT9 A;  1FD6 A;  4LNK A;  1WXQ A;  1ZXI A;  1EUV B;  1CK1 A;  2AQ3 B;  4BBN C;  4IWO A;  1OFF A;  1MVK A;  2Z0E B;  4R3D A;  2WXQ A;  2RDH A;  3KLS X;  3TBL D;  4OVU A;  1DOX A;  1RM6 C;  2J4X A;  4GOC A;  2K3U A;  1RAX A;  3B2G A;  3AEF B;  3TEY A;  2V9H A;  2KAN A;  1Q1O A;  2J0M A;  5DPR A;  1FM0 D;  4KZ0 A;  4N58 A;  4M02 A;  1XF5 L;  1L4D B;  4GDK A;  2X38 A;  3UIN B;  2HJ1 A;  4XE0 A;  1NEK B;  3QWZ B;  4KDI C;  3PLU A;  4RGO S;  1YD8 U;  3SEB A;  1P7F A;  1U4A A;  2KWD A;  3IVF A;  3RD2 A;  1R4M B;  4W9K A;  1PGB A;  2RD0 A;  1KF6 B;  1TS3 A;  2YLM A;  3V61 A;  2LGI A;  2GBM A;  4HKZ E;  4MGI E;  3HIZ A;  4OVV A;  2MRP A;  4WWP A;  3PHX B;  3LB8 C;  4IC7 B;  4RCO A;  4FLH A;  5T8I A;  2L00 B;  4NJC A;  3U7D A;  2PW9 A;  2O6V B;  2AYO B;  4DDI D;  2NTT A;  3NUH B;  4A90 A;  2OJR A;  3HHM A;  2CS4 A;  1RFK A;  1V1O A;  3Q3F A;  1IPG A;  1BUI C;  2WLB A;  1ZXH A;  2BS3 B;  2WX0 A;  3X0W A;  1HTQ A;  2A5U A;  1VDV A;  3ZYY X;  1FIQ A;  1PUT A;  4KKJ A;  1BML C;  1TZO A;  4K1R B;  4RGT A;  2WXO A;  4FHK A;  4TMA B;  2D3A A;  4EEW A;  5DPW A;  1TTN A;  4P1B C;  4MSQ B;  2L05 A;  5H92 C;  4I6P A;  3ZJV A;  1T0Q C;  1MFW A;  2MBB B;  1E8X A;  5D94 A;  3R3M A;  2JF5 A;  2IDY A;  4P1C C;  4LNF A;  4NAW B;  2HTH A;  4CQN A;  1ZDV A;  2QSD A;  2MHJ A;  1V97 A;  1LGR A;  1VCB A;  1UWM A;  2G4S A;  5E6J A;  5AZG A;  3VH4 B;  3DDC B;  4ASW C;  2E6X A;  3GZN I;  1RWS A;  1VLB A;  1R4N B;  4MM3 B;  1SE4 A;  4GN1 A;  3QJZ A;  3N3K B;  1WX8 A;  4USA A;  1D4B A;  2KQS A;  1V49 A;  1JW9 D;  3M62 B;  1QF6 A;  3OWE B;  2W82 A;  1GC6 A;  3RUI B;  3B08 A;  3NZ3 A;  3NVV A;  5HG2 A;  2L0T A;  3H7S A;  3VQI A;  4BBN F;  4FN2 A;  1WXA A;  1WI0 A;  2KMM A;  4DHJ D;  3EEC A;  2IND C;  4OZB A;  1RRB A;  4II2 B;  3RNA C;  3ZRF A;  1E90 A;  3BVZ A;  4IM0 A;  3M63 B;  5HKH A;  1FO4 A;  2V3P A;  2WGS A;  1C79 A;  4J6I A;  5FKA C;  1TS5 A;  3H8H A;  3R7R A;  4L23 A;  1P3Q U;  2Y5P A;  4EZJ A;  3V6E B;  3NRZ A;  2KTR A;  1SIJ A;  3MTN B;  1FXI A;  3DBR B;  1N5W A;  4WAA A;  3WAM A;  1EWY C;  4YTN B;  2QMT A;  2KN5 A;  5EE0 A;  4EOY A;  2M0X A;  3CMM B;  1D5X C;  2LGY A;  2G4D B;  2RDB C;  4K7S A;  2BPS A;  1FRD A;  1XT9 B;  2WXG A;  3L4P A;  2D3B A;  3PPA A;  4ZRJ A;  2QIE B;  4EKU A;  1V80 A;  2KTF A;  2KX0 A;  4WJP A;  1GJZ A;  2GLS A;  3RCZ A;  3V60 A;  4MEL A;  1E8Z A;  4JWU C;  1WF9 A;  4KIK A;  2OED A;  3AH7 A;  3H7P A;  1JML A;  3N20 C;  1KLU D;  1FFU A;  2QJL A;  2PEA A;  1LQB A;  2ONQ A;  2MWS B;  2WQY B;  2HD5 B;  2WDT B;  1ESF A;  3FIL A;  3NVY A;  5EDS A;  1VZ8 A;  3ZJU A;  2WXJ A;  2JXT A;  4A55 A;  5GMV A;  2G1E A;  2HJ8 A;  3AE8 B;  3K9O B;  5D6J B;  1EU4 A;  3AI5 A;  1TT5 B;  4JWS C;  4XWW A;  2HDE A;  1VD2 A;  2LZ6 A;  2BKF A;  1J0G A;  1I4R A;  2XEW A;  2NCN A;  4IKG A;  2VH2 A;  4TSS A;  2DHZ A;  4W9J A;  4M8N A;  5CHW A;  3BVM A;  1YN5 A;  1I4Q A;  3APD A;  2W3S A;  3P42 A;  2RPV A;  5C1Z A;  1TY0 A;  2H88 B;  3U8Z A;  4HKQ A;  3DOW A;  3P4Q B;  3RYT A;  5BYQ A;  4FAD A;  3W1S C;  4B95 A;  3N1Z C;  3JYU A;  4RM8 A;  3RNB C;  3ZXR A;  2B76 B;  3W5V B;  2NBV B;  1WH3 A;  1JRO A;  2W54 A;  2L8J A;  3NJT A;  2Q5W D;  5IAA C;  4UDU C;  3VXW A;  2IO3 B;  3VDZ A;  4ZRI A;  2KJ6 A;  1KOT A;  4EE2 A;  1JAL A;  3AE7 B;  1ZW7 A;  3IBE A;  4B6W A;  4HJG E;  1QZE A;  4AOF A;  2FUG 1;  1N61 A;  3L10 B;  2FUH B;  4KV2 A;  2GBR A;  4MDK E;  2V3S A;  4AJY B;  1D3Z A;  1TZ1 A;  1L5P A;  3ZNI D;  3AE1 B;  2IYD B;  2BTE A;  2KT7 A;  2K25 A;  1T5X D;  2KZR A;  2PVO D;  4GIV A;  2LVP A;  2M0A A;  1TIF A;  1FPY A;  2DAJ A;  1C4C A;  4GDK B;  1PGA A;  2L52 A;  3QCA A;  3UI3 A;  4BVU C;  1HEZ E;  3DVN V;  4MAC A;  4TV3 A;  1JWA D;  3PGE A;  1KTK A;  3CSF A;  1HA5 A;  4C4V A;  1XCQ L;  3VTV A;  3AV8 A;  4N6E B;  4HK2 A;  3KYC D;  1DOY A;  1PFD A;  3MC0 B;  3P1M A;  2JT4 B;  3PZ7 A;  3V05 A;  2MBH A;  2DBY A;  1WFY A;  4B9K A;  1CQV A;  2WXH A;  2WP9 B;  4BKT A;  2IO2 B;  1NBF C;  1S3S G;  4RMA A;  3IXS A;  4FA6 A;  4WH4 A;  3B1L X;  3PHW B;  3SU8 X;  2C7N B;  4TKN A;  2JZP A;  3BII D;  3V62 A;  4HEA 1;  1F1H A;  3JW0 X;  1WSP A;  3OG5 A;  2G45 B;  2QC8 A;  3APF A;  4X57 B;  1XLN A;  3DVG Y;  1D6E C;  1IBX B;  4GDL A;  5FR3 A;  1ZDX A;  4HPL B;  4E71 A;  3PS6 A;  2NBW B;  1F77 A;  1JWU D;  2G9H D;  4W9I A;  4QAY A;  2B3A A;  2BGF A;  3TJP A;  3NHE B;  4A8X C;  1I4X A;  2C5L C;  5LXI B;  1GB4 A;  4K7W A;  1I7H A;  1SEB D;  1GG3 A;  2MLB A;  3IFW B;  3ZNG C;  4BFR A;  2CU3 A;  2XNA C;  5C3J B;  2C9W B;  4ITK A;  2XK5 A;  4AQ7 A;  2PTL A;  3DBL I;  3I57 A;  3V6C B;  1NYQ A;  3CIR B;  1TBE A;  3QHT A;  2MBE A;  5G5G A;  4LLG M;  3TUO A;  4AS1 A;  1SXT A;  4FBJ B;  1M94 A;  1NEN B;  3DCG A;  1ZPS A;  3AMZ A;  4FHJ A;  3N9Y C;  3NZS A;  2KQ7 A;  4E74 A;  3DBH I;  3KH0 A;  3KUZ A;  4MGY E;  4RF1 A;  3ML9 A;  5D2M B;  1LFD A;  1WMH B;  3N1X C;  2GOW A;  2JUO A;  1TS2 A;  2YEP F;  3ETR A;  3RNC C;  3ZXV A;  2OOB B;  2NTS A;  3A9J A;  1AAR A;  4LDT D;  3NG0 A;  2AQ1 B;  3H6N A;  3TIX A;  4A6Q A;  2KDF B;  1QOG A;  4RF0 A;  3M3J A;  5KHO A;  1L0X B;  4YT0 B;  3DWG C;  3VR8 B;  4ZOH C;  2K39 A;  4XZ4 A;  3RNE C;  3WAP A;  3TSS A;  1GAQ B;  3HM6 X;  1ZUD 2;  3GZN B;  1N63 A;  3OLM D;  2ASQ A;  3ECI A;  4C7Z A;  2A4Z A;  2WXK A;  4DQO C;  1B9R A;  1YJI A;  2BYF A;  1B1Z A;  3L54 A;  3NVZ A;  2QCZ A;  2KDI A;  3BK1 A;  1K50 A;  2KTR B;  1GOZ A;  2LAS A;  2KJH B;  1DGJ A;  1F2R C;  1XCT L;  1R7S A;  2IGH A;  2D3C A;  4ZDV A;  3PZ8 A;  2BVC A;  4G50 A;  3AB5 A;  3PRZ A;  3AED B;  3AEB B;  1NDD A;  1JWS D;  3BWU D;  1RYJ A;  3UQA A;  3R7Q A;  1V81 A;  2GBN A;  2ZW0 A;  3U52 E;  1Q0W B;  1C3T A;  2K9X A;  2IY0 B;  3TEW A;  3DHG C;  3PVL A;  4KIK B;  4W9L A;  3UGB B;  3H7P B;  3VAW A;  2M8S A;  4BOZ B;  4MJS B;  3PSE B;  2Y5C A;  4K3C A;  1WE6 A;  3PRM B;  4OW0 A;  1VZ6 A;  5LXH A;  3DQV A;  3P63 A;  5C23 A;  3FIL B;  1MG4 A;  2KDB A;  2QDF A;  2FCS A;  2JU6 X;  1G6J A;  3HVZ A;  4GXB A;  1E5W A;  3W9C B;  5DCN A;  1KFY B;  3PTF C;  5JH5 C;  4WIP A;  1YJ1 A;  4HWI B;  3A33 B;  1EF5 A;  1KH0 A;  4GGQ A;  2MBO A;  2Z0D B;  3B9J A;  2KMC A;  1YX6 B;  2N1W A;  3VFK A;  3ZDM C;  1TGZ B;  2GBJ A;  4YWG G;  2I2Y A;  1UBQ A;  4LTU A;  5BYR A;  1FRR A;  2REX A;  1TS4 A;  2FE8 A;  3VR9 B;  4W9G A;  3EUB 2;  1J19 A;  4YTP B;  1T3Q A;  3L08 A;  1WYG A;  1F52 A;  2MP2 A;  1WJ6 A;  3VVW B;  4WWO A;  5GXG B;  2KC1 A;  1C1Y B;  4L2Y A;  4BZA A;  2BB6 A;  2ZNV C;  2INC C;  4L1B A;  3MC9 A;  5BO4 B;  1P7E A;  3KYD D;  3KWV A;  1V5T A;  4XGA B;  3VH3 B;  2MCN B;  4WQM A;  4WAF A;  2KXJ A;  3OJ4 B;  3Q8C A;  2I1K A;  2PVG C;  2MBQ A;  1V86 A;  2RMM A;  2QEJ C;  3A4S C;  1K8R B;  1OEY A;  4ZHO A;  2WXL A;  2LJI A;  4US9 A;  3C19 A;  2CHZ A;  5D7G A;  2ZNV B;  4NY0 A;  3AXC A;  1UGM A;  4NNJ B;  3DHH C;  2HTM E;  2LJ5 A;  4EUT A;  5JZE B;  2CHX A;  1E7V A;  2LEK A;  1UZX B;  2LUM A;  4NPN A;  3PO0 A;  2BBC A;  5IOI A;  3QIJ A;  2K22 A;  2RDG A;  3WCQ A;  2VZK D;  1YX5 B;  4LNO A;  1WJ4 A;  1KM7 A;  4EFO A;  3ZTD A;  4DHZ B;  3PV1 A;  3EFU A;  1IUE A;  1WZ3 A;  1I35 A;  2O6V D;  2CHW A;  3IT6 B;  1EO6 A;  1JQ4 A;  2V4I B;  3Q6B A;  2Y3A A;  4BKG A;  1EF1 A;  3IHP C;  1J7C A;  1XXG A;  2DZM A;  2OJW A;  5J2R A;  2DAF A;  4F8C B;  3E56 A;  2PJH A;  2LI5 A;  3ZTC A;  2CJO A;  4YSY B;  4C56 C;  4K7U A;  3GB1 A;  4F1S A;  3RNF C;  2WXR A;  2FNJ B;  4FUL A;  1UNS A;  4C00 A;  1TYG B;  5BMH A;  3QAR A;  2CU1 A;  4PS8 A;  3JSV B;  2EMT A;  4CYE A;  1MPE A;  1QOA A;  1WJN A;  1VZ7 A;  2SAK A;  5IP4 D;  1Z2M A;  3VUX A;  3VUW A;  3ZIM A;  5G55 A;  1QLB B;  2DLB A;  1WWT A;  4I6L B;  4AWJ A;  1IP9 A;  2LXC A;  1VJK A;  1WGD A;  4HLE A;  5DPS A;  4JGH B;  4GDL B;  1Z5S B;  4GB9 A;  3PT2 B;  4A9A A;  4WJN A;  4M01 A;  1P1A A;  3Q14 C;  2WHI A;  4OVZ A;  3AUL A;  1IGD A;  3OAW A;  5HFY A;  4WJO A;  2XN9 C;  4GU2 A;  3HM3 A;  1SIF A;  2N9L A;  5EE3 A;  3C0R B;  1XO3 A;  3T8M A;  1WXM A;  1CJE A;  2JZZ A;  4KVG B;  3BYY B;  4MT5 A;  2N9X A;  2W3R A;  2KN4 A;  2KVR A;  3NY5 A;  2BW2 A;  1T0S C;  3QX1 A;  2I38 A;  2K8B A;  3EC8 A;  4CHK A;  3H1U A;  2M56 B;  2XK5 B;  3GE3 C;  1ET9 A;  1EU3 A;  2EKI A;  3P4P B;  2CJN A;  3HRD D;  4ANX A;  2WWZ A;  1KRH A;  3R66 C;  3Q8F A;  4XYC A;  2WXI A;  2WXN A;  1YN3 A;  4YL8 A;  5G2N A;  4PS3 A;  3CWI A;  3P4S B;  1N5X A;  4B0M A;  3AE9 B;  3AU5 A;  4HRO A;  5CX3 A;  5EE9 A;  2LRW A;  2AL6 A;  2O6V A;  2KK8 A;  3VRA B;  3U7Z A;  2OHF A;  3KVF B;  5KHQ A;  2IGG A;  4AJW A;  5IN7 A;  1ZP0 B;  3DBL B;  4PYU A;  2K6D B;  5AZH A;  2JSV X;  3A1Q A;  1FFV A;  1HQR D;  5C2T B;  1C77 A;  3WAL A;  4WQO B;  2D2Q A;  3R2T A;  1T0R C;  3AEC B;  3DBH B;  3AE5 B;  2Z59 B;  3WIM A;  4EZL A;  2N9E B;  4D2K A;  3SHQ A;  2J53 A;  5J18 A;  5E6P A;  3URY A;  2JX5 A;  1GB1 A;  1JCK B;  5L83 A;  5AZF A;  2KFK A;  4FJY A;  3FKY A;  2N1V A;  3Q69 A;  3TL5 A;  3RZW C;  4DXA B;  4KZC A;  1R4N I;  4MEM A;  4NZL B;  4W9F A;  2ZVN A;  1L2N A;  1RFA A;  1SJE D;  1EM7 A;  3A4R A;  2INP E;  4KX6 B;  4IG7 B;  1UBI A;  4P6V F;  2GMI C;  1QQR A;  4A20 A;  2HE7 A;  3AEE B;  1WM3 A;  2LHE A;  3RN9 C;  2DZJ A;  4DWF A;  1E9M A;  4WJQ A;  2RGF A;  2XBB C;  4NAW A;  2J0J A;  4S0R A;  4IM2 A;  3I63 C;  1V9J A;  2DZI A;  3NS1 A;  1J7A A;  2YEP B;  2J0K A;  1C76 A;  4K81 A;  2N7J A;  4NJ6 A;  1CMX B;  2N7D A;  2IO1 B;  1F9J A;  1MHH E;  2IPK D;  3FAH A;  3Q3N C;  3WAO A;  3H9D A;  2Z8L A;  2V4L A;  2D11 A;  2JY6 A;  5JXV A;  3T3N A;  1YOV B;  4JQW C;  4S17 A;  2MH7 A;  1YQ3 B;  1F0Z A;  2KHW B;  4KDL B;  1HXY D;  2NPT A;  3UIP B;  3BY4 B;  4W9H A;  5FR6 A;  4HCP B;  1L6V A;  3UF8 A;  1DOI A;  1E8W A;  2KAJ A;  5AUK A;  5EE1 A;  3RNG C;  2R2O A;  3DVG X;  5IKC M;  1L7Y A;  3EHV A;  4JPS A;  1E10 A;  3AEA B;  2NS5 A;  4IW0 A;  3PZD A;  1MJD A;  4US8 A;  1KLV A;  1P98 A;  1VRA B;  2DZK A;  5JHB A;  2LGD A;  2DYB A;  2L7R A;  3IT4 B;  2NVU I;  2X8X X;  2MP2 B;  2C60 A;  1T6B X;  2JRI B;  1JWM D;  3FC4 A;  4C80 A;  2M1M A;  1V2Y A;  3MHS D;  2V1Y A;  3L13 A;  2KD0 A;  1WRI A;  2LRU A;  3QAQ A;  4ZYS A;  1E0Z A;  2N7E A;  1D5Z C;  1I42 A;  1SGH A;  3JVZ X;  3ZNH B;  2WS3 B;  4RM9 A;  1WZ0 A;  1WR6 E;  3AN1 A;  3QA8 A;  2LUE A;  3N32 A;  2MX2 A;  4RGN A;  2H89 B;  2I1J A;  1STE A;  2RSU A;  2L3Z A;  4RH6 A;  1H4R A;  2JXX A;  1L0V B;  2DEN B;  1PYW D;  2WNM A;  2WXP A;  1S1Q B;  2R61 A;  4KGR A;  5AEK B;  4ICV A;  4ARI A;  2ZZP B;  1P9D U;  2W55 A;  4B0E A;  1A5R A;  5J17 A;  2JPH A;  2WU5 B;  2FAZ A;  2KNB A;  2NBU A;  1J8C A;  4RNA A;  4P16 A;  4WUR A;  2KYW A;  1M4V A;  3QC8 B;  2TSS A;  5L95 C;  4BOS C;  2AEH A;  3VTU A;  3RMK C;  2BYE A;  2J42 A;  3BZD B;  4HXD A;  5HI1 A;  5BYS A;  3O13 A;  4ANU A;  2BF8 B;  3SFD B;  4KKI A;  3I3T B;  3TMP B;  1V1P A;  2KJR A;  1UWX A;  3VHT C;  1LXD A;  1WXS A;  4HPP A;  3ZKJ C;  2K5P A;  1WGG A;  4TQ0 A;  1XLQ A;  1WM2 A;  3W2D A;  1JWB D;  5LLI A;  1PDX A;  4G0N B;  3RZF A;  1L6U A;  5BMI A;  5HHD G;  1C78 A;  4DK5 A;  2SEB D;  4NAM A;  2ZPY A;  3DWM A;  4BKS D;  4K3B A;  3ABV B;  3UIO B;  1WE7 A;  2IZV B;  3W1S A;  3QK0 A;  2GI9 A;  4E3C A;  2ZW1 A;  1AYF A;  2MJD A;  2N9P C;  2GBK A;  2EEL A;  4ZYN A;  1SE3 A;  1V8C A;  2W9N A;  1XD3 B;  4M0W A;  2K8C A;  1HTO A;  3IAS 1;  4ZRK A;  2O2V A;  2N9K A;  3NZU A;  3AE6 B;  3ZO5 B;  5LNK 1;  4LNI A;  3KUC B;  2KAC A;  2DNF A;  2DX5 B;  3TCA A;  2KWV B;  4ZRQ A;  1SE9 A;  3UQB A;  1GPX A;  2ON8 A;  3AE3 B;  2L76 A;  5TSS A;  3RT3 B;  1UF0 A;  3V3X A;  4M00 A;  1N6Z A;  3AEG B;  1ISN A;  2BWE S;  1C9F A;  1WIA A;  1YQB A;  4Q2J A;  4M8M A;  3C8Y A;  1ACC A;  2ACZ B;  3Q2A C;  2C7M B;  4II3 B;  3W5U B;  4ICU A;  1PQS A;  4A3P A;  1P0R A;  1A70 A;  5MPO A;  4JX1 C;  2MA9 B;  3GP7 A;  2VZK B;  3EA6 A;  1E8Y A;  4TUU A;  1AW7 A;  2MSE D;  1L0Y B;  1IYF A;  1AWD A;  2DWQ A;  1I4G A;  4MH8 A;  3KUD B;  3MC8 A;  4DHJ B;  4KGT A;  3ZQ4 A;  2ZCB A;  4YXD B;  2WXF A;  4IWP A;  4YTM B;  4ZHP A;  3SR6 A;  1UH6 A;  2IBI B;  3RI7 C;  2KLG A;  2V3N A;  2LWP A;  2M4N A;  3VTW A;  3ZVV A;  3A1Q B;  1TKE A;  2MEK A;  3L16 A;  3O65 B;  1IBX A;  3AE4 B;  1YIW A;  1J7B A;  2M17 A;  2KQ4 X;  3B2F A;  2KWU B;  3SD5 A;  2BYV E;  2IGD A;  1QKZ A;  4BKS A;  3OJ3 A;  2ZCC A;  1NI2 A;  1L4Z B;  2KOX A;  2IY1 B;  2E3T A;  2KFK B;  3ZNZ B;  2KVZ A;  3GOE A;  1FCC C;  2VH1 A;  2MW5 A;  3SFE B;  2NMQ A;  1OTR B;  2JZ3 B;  2K8H A;  4KSL C;  2AX5 A;  2PIA A;  2CR5 A;  1WX9 A;  5DPT A;  2JWZ A;  3K9P B;  4FJV B;  2PPH A;  4W9C A;  2JYE A;  3SDL C;  3VRB B;  3A9K A;  5D3D A;  1K53 A;  3PRE A;  1NVI D;  3LDZ E;  2ZPN A;  3HVD A;  2FID A;  4HDQ A;  5G5H A;  1C4A A;  1FNW A;  2V0G A;  4ARC A;  1WMH A;  4EZK A;  1MI0 A;  2GRI A;  3MP9 A;  2KMA A;  4C4V B;  1HZ6 A;  2QHO A;  2WYQ A;  2EKE C;  4PYZ A;  1K51 A;  1XLO A;  3ZDT A;  2LMC A;  4RFB A;  2NPT B;  1N60 A;  3E9S A;  4OZA A;  3APC A;  3ZGZ A;  4URK A;  1V6E A;  1OEY J;  4P7I A;  3MJ5 A;  3GS2 A;  1GNU A;  1KJT A;  2Y5B B;  2ZJD A;  1YJJ A;  5CHF A;  4OZC A;  2YVC A;  1WR1 A;  4FJZ A;  1K52 A;  1WGH A;  4HCN B;  3ZJT A;  5FK9 C;  4C7Y A;  3BYT B;  3Q3M C;  3DVN U;  1OQR A;  2KWC A;  1JRP A;  1WGR A;  2WU2 B;  4NQK E;  1SB3 C;  3I5J C;  2D5G A;  3U4E G;  1UGJ A;  1UD7 A;  2N4F A;  1F2R I;  3L17 A;  1R4M I;  1E7P B;  4G3X B;  4LJO B;  1YQ4 B;  1Y56 A;  1TKY A;  1GUA B;  2L83 A;  3P2B A;  2VRR B;  2LVO A;  3ML8 A;  2EMS A;  1D5M C;  1WJU A;  3Q8A A;  1UEL A;  3TEZ A;  2ZVO A;  4YSZ B;  3T3O A;  1CZP A;  1Q10 A;  2D07 B;  4YSX B;  4JL9 A;  2BYT A;  5E6N A; 
#chains in the Genus database with same CATH homology
 1L0X B;  1BML C;  1TZO A;  4YT0 B;  3DWG C;  2MH7 A;  1YN4 A;  3VR8 B;  4ZOH C;  1YQ3 B;  4RGT A;  2WXO A;  1F0Z A;  4TMA B;  3TSS A;  1GAQ B;  1HXY D;  1SJH D;  1UUP A;  4LK0 M;  1ZUD 2;  5H92 C;  2M19 A;  1N63 A;  5AUI A;  1FNU A;  3ZJV A;  4PT5 A;  3Q8E A;  1L6V A;  4C7Z A;  2WXK A;  4XWT A;  1DOI A;  4DQO C;  2L32 A;  1YJI A;  1B9R A;  1B1Z A;  2KAJ A;  3NVZ A;  2JQR B;  3BK1 A;  1K50 A;  5AUK A;  5EE1 A;  2IDY A;  2PKO A;  1FMA D;  1GOZ A;  2JWU A;  1ZE3 D;  4NAW B;  1DGJ A;  1F2R C;  1XCT L;  4CQN A;  1ZDV A;  1QOF A;  1R7S A;  4JPS A;  2IGH A;  1E10 A;  2QSD A;  1ZOY B;  2AQ2 B;  3AEA B;  1V97 A;  3PZ8 A;  1UWM A;  4US8 A;  1VRA B;  5E6J A;  4ZRP A;  4H2A A;  2E6X A;  4KGS A;  4J3O D;  1RWS A;  2WDR B;  3AB5 A;  3AED B;  3AEB B;  1VLB A;  1JWS D;  3BWU D;  3IT4 B;  1WGK A;  4DXF A;  4MM3 B;  1RYJ A;  1SE4 A;  3Q8B A;  1T6B X;  2ZW0 A;  2PLP A;  4USA A;  3U52 E;  1D4B A;  1JWM D;  4N59 A;  3EGR A;  3FC4 A;  4C80 A;  4REZ A;  1V1P B;  1JW9 D;  2K9X A;  1QF6 A;  3OWE B;  2W82 A;  3TEW A;  1SSN A;  1WRI A;  2WDQ B;  3NVV A;  3NZ3 A;  2N0S B;  3I9V 1;  5HG2 A;  1KLG D;  2PMV A;  4ZYS A;  1E0Z A;  1D5Z C;  3VQI A;  2KMM A;  2Y5C A;  2MJ3 A;  2WS3 B;  4OW0 A;  1VZ6 A;  4OZB A;  1TKG A;  3AN1 A;  3BVZ A;  3P63 A;  2LHD A;  3FIL B;  4RGN A;  2H89 B;  1FO4 A;  1STE A;  2V3P A;  4RH6 A;  3RPF C;  1L0V B;  2JU6 X;  3KQ4 A;  1PYW D;  1C79 A;  1YNT E;  2WNM A;  1YMH E;  1LO5 D;  2WXP A;  3HVZ A;  5FKA C;  1TS5 A;  2R61 A;  1NI3 A;  4KGR A;  3H8H A;  4L23 A;  2Y5P A;  4ARI A;  3W9C B;  2W55 A;  3MHZ A;  3NRZ A;  4B0E A;  1KFY B;  1SIJ A;  4WIP A;  1FXI A;  2WU5 B;  2WXM A;  1N5W A;  1KH0 A;  3B9J A;  4RNA A;  1EWY C;  4YWG G;  1IGC A;  4P16 A;  2I2Y A;  3HUI A;  4WUR A;  1ET6 A;  1M4V A;  4GLS C;  4YTN B;  2TSS A;  4LTU A;  5BYR A;  2QMT A;  1FRR A;  2GB1 A;  5EE0 A;  3IAM 1;  1TS4 A;  2FE8 A;  1D5X C;  3VR9 B;  1FNV A;  3EUB 2;  2BT6 A;  2J42 A;  1HZ5 A;  1T3Q A;  3BZD B;  1WYG A;  4YTP B;  5HI1 A;  1FRD A;  1I4P A;  2WXG A;  1TY2 A;  3P4R B;  3L4P A;  1PGX A;  5BYS A;  2QIE B;  3O13 A;  5GXG B;  2J52 A;  4L2Y A;  3SFD B;  4KKI A;  2LFI A;  1V1P A;  2KDM A;  2BB6 A;  2DYO A;  4L1B A;  4JWU C;  1OQQ A;  1UWX A;  4TQ1 A;  1P7E A;  2OED A;  3AH7 A;  1JML A;  1KLU D;  3KWV A;  2K5P A;  1EWC A;  3LYY A;  1FFU A;  2QJL A;  5H8Y E;  4WQM A;  4WAF A;  4TQ0 A;  1XLQ A;  2ONQ A;  2PVG C;  3Q8C A;  1C4P A;  2WQY B;  3W2D A;  1ESF A;  1JWB D;  2RMM A;  3FIL A;  2QEJ C;  3NVY A;  1VZ8 A;  2WDV B;  4ZHO A;  3ZJU A;  2WXJ A;  1PDX A;  2JXT A;  2WXL A;  2LJI A;  4US9 A;  1ROE A;  4A55 A;  1L6U A;  2G1E A;  5BMI A;  1QOB A;  3AE8 B;  3MFG A;  1C78 A;  5HHD G;  2SEB D;  5D7G A;  4NAM A;  3AE2 B;  3DWM A;  1EU4 A;  4JWS C;  4XWW A;  2HDE A;  3ABV B;  3R8B A;  2HTM E;  3W1S A;  1I4R A;  2GI9 A;  4IKG A;  2ZW1 A;  1FCL A;  4TSS A;  1AYF A;  2BS2 B;  2LEK A;  4XDC A;  2MJD A;  2LUM A;  1NYR A;  2EEL A;  3J9C A;  3PO0 A;  2BBC A;  1SE3 A;  3BVM A;  1VR9 A;  1I4Q A;  1V8C A;  1YN5 A;  5I4D A;  2W3S A;  3P42 A;  2RPV A;  2K22 A;  2RDG A;  3AM9 A;  4M0W A;  3WCQ A;  2QIL A;  2VZK D;  1I4H A;  3TEX A;  3IAS 1;  1TY0 A;  2H88 B;  3R2I A;  1SE2 A;  2N9K A;  4HKQ A;  3AE6 B;  5LNK 1;  3P4Q B;  5BYQ A;  2BS4 B;  2KAC A;  3BVG A;  4ZRQ A;  1GPX A;  1IUE A;  2ON8 A;  3AE3 B;  3KWL A;  3BK2 A;  5TSS A;  2B76 B;  1XLP A;  3V3X A;  3W5V B;  3IT6 B;  1JRO A;  2W54 A;  1JQ4 A;  3AEG B;  2V4I B;  2Y3A A;  2Q5W D;  4UDU C;  1J7C A;  1XXG A;  1C9F A;  1SBB B;  4WWM A;  1QIL A;  4HRS A;  4Q2J A;  3E56 A;  4EE2 A;  4O1N A;  1JAL A;  2FBW B;  3C8Y A;  2INN E;  1ACC A;  2ACZ B;  3AE7 B;  4HJG E;  3W5U B;  2CJO A;  4YSY B;  4C56 C;  2FUG 1;  3GB1 A;  1BXT A;  2BB5 A;  1A70 A;  1N61 A;  2WXR A;  5MPO A;  4JX1 C;  1UNS A;  3GP7 A;  2JYT A;  2VZK B;  3EA6 A;  3NVW A;  1TYG B;  5BMH A;  1AW7 A;  4FXC A;  1MPE A;  1L5P A;  1L0Y B;  1QOA A;  1VZ7 A;  2SAK A;  3AE1 B;  2IJ0 A;  1AWD A;  2ICI A;  1QLB B;  2DLB A;  2DWQ A;  1I4G A;  1WWT A;  4MH8 A;  5D3I B;  2BTE A;  4KGT A;  1T5X D;  3ZQ4 A;  1VJK A;  1SF0 A;  4YXD B;  2PVO D;  2WXF A;  4YTM B;  4ZHP A;  1AN8 A;  2M0A A;  3SR6 A;  4DXG A;  1DYQ A;  4GDL B;  1C4C A;  2V3N A;  4A9A A;  4GDK B;  4OVZ A;  1TKE A;  2MEK A;  1PGA A;  2L52 A;  3U2S C;  1IGD A;  5HFY A;  3UI3 A;  1IBX A;  1MHX A;  1HEZ E;  1XEE A;  2XN9 C;  1E6E B;  1FIQ A;  2N9L A;  5EE3 A;  1XO3 A;  4MAC A;  1CJE A;  1FEH A;  1JWA D;  3AE4 B;  1J7B A;  3BYY B;  4MT5 A;  4JE3 B;  2KQ4 X;  3RFZ B;  2W3R A;  3B2F A;  2KN4 A;  4IDI A;  1KTK A;  2BW2 A;  1ENF A;  2DYM A;  1HA5 A;  1TJE A;  2MJE A;  2L1A A;  2IGD A;  1QKZ A;  1XCQ L;  3LXF A;  4OHJ A;  4XDD A;  4RGM A;  2I38 A;  3AV8 A;  4N6E B;  1DOY A;  2M56 B;  1L4Z B;  1PFD A;  2K0P A;  2E3T A;  1ET9 A;  1EU3 A;  2EKI A;  3MC0 B;  4IOI E;  1FXA A;  1N62 A;  1QT9 A;  3P4P B;  5BMG A;  3P1M A;  2CJN A;  1FD6 A;  3PZ7 A;  1FCC C;  3V05 A;  3HRD D;  3SFE B;  2NMQ A;  1WXQ A;  2DBY A;  1ZXI A;  1KRH A;  1CK1 A;  1CQV A;  2AQ3 B;  2WP9 B;  2WXH A;  2AX5 A;  2PIA A;  3Q8F A;  1OFF A;  2WXI A;  2WXN A;  1YN3 A;  1MVK A;  3IXS A;  4R3D A;  2WXQ A;  2RDH A;  3CWI A;  3KLS X;  1N5X A;  3P4S B;  4WH4 A;  4B0M A;  1DOX A;  2BYT A;  3AE9 B;  1RM6 C;  4HRO A;  2J4X A;  5EE9 A;  2JZP A;  3BII D;  2K3U A;  3B2G A;  2JYE A;  3AEF B;  3VRB B;  3TEY A;  4HEA 1;  5D3D A;  1K53 A;  1WSP A;  3VRA B;  3U7Z A;  1NVI D;  2OHF A;  3HVD A;  1XLN A;  1D6E C;  1IBX B;  2IGG A;  5G5H A;  1C4A A;  1FNW A;  1FM0 D;  1ZP0 B;  2V0G A;  4ARC A;  5FR3 A;  4N58 A;  1ZDX A;  1MI0 A;  1XF5 L;  1L4D B;  2GRI A;  2JSV X;  3MP9 A;  1FFV A;  2X38 A;  1HQR D;  1F77 A;  1JWU D;  2G9H D;  5C2T B;  1HZ6 A;  4A8X C;  1I4X A;  4XE0 A;  1C77 A;  1NEK B;  3R2T A;  1GB4 A;  4RGO S;  3AEC B;  3AE5 B;  1I7H A;  3SEB A;  1SEB D;  1P7F A;  1K51 A;  2KWD A;  1XLO A;  2LMC A;  2CU3 A;  4RFB A;  2XNA C;  5C3J B;  4D2K A;  2J53 A;  1N60 A;  1PGB A;  3E9S A;  4ITK A;  1KF6 B;  2JX5 A;  3URY A;  4OZA A;  1TS3 A;  1GB1 A;  1JCK B;  3ZGZ A;  4AQ7 A;  2PTL A;  3I57 A;  1NYQ A;  2LGI A;  3CIR B;  3Q69 A;  4HKZ E;  3MJ5 A;  3GS2 A;  5G5G A;  4LLG M;  3TUO A;  4AS1 A;  4NZL B;  1YJJ A;  4OZC A;  1SXT A;  3LB8 C;  1K52 A;  1NEN B;  4RCO A;  1SJE D;  5T8I A;  1EM7 A;  3ZJT A;  1ZPS A;  5FK9 C;  4C7Y A;  2INP E;  3BYT B;  4NJC A;  4KX6 B;  2PW9 A;  3AMZ A;  1OQR A;  4P6V F;  3N9Y C;  1QQR A;  1JRP A;  2WU2 B;  1SB3 C;  2NTT A;  3AEE B;  2LHE A;  2D5G A;  3NUH B;  3U4E G;  1UGJ A;  1E9M A;  4RF1 A;  4A90 A;  1F2R I;  1E7P B;  1YQ4 B;  1TS2 A;  3NS1 A;  1RFK A;  2YEP F;  1J7A A;  2YEP B;  1Y56 A;  1C76 A;  1TKY A;  1V1O A;  2L83 A;  3ETR A;  2N7J A;  2WLB A;  1BUI C;  2NTS A;  1D5M C;  1MHH E;  1ZXH A;  2BS3 B;  2IPK D;  3FAH A;  3Q8A A;  2AQ1 B;  3TEZ A;  4A6Q A;  4YSZ B;  3T3O A;  2Z8L A;  1CZP A;  5JXV A;  1QOG A;  4RF0 A;  1VDV A;  1Q10 A;  4YSX B;  3T3N A;  3ZYY X;  1PUT A;  4KKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...