4HRSA

Crystal structure of h. volcanii small archaeal modifier protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
GRNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ubiquitin-like small archaeal modifier protein 2 from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii ds2
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 2
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hrsA00
3AE6B 2E3TA 1VJKA 2KAJA 2PIAA 2WU5B 1NENB 1ROEA 1XLNA 2L83A 5EE9A 5G5GA 5EE1A 2AX5A 3CIRB 1EWYC 1FM0D 4JX1C 2CJNA 4P6VF 3ABVB 3CWIA 1TKEA 1F0ZA 1GAQB 3VR8B 4ZHPA 2L52A 1DOYA 3AE4B 1E0ZA 1N5XA 4USAA 1RWSA 1RFKA 2WS3B 3B2GA 1XLOA 1L6UA 1JALA 1YQ4B 3AEGB 2FBWB 3B9JA 3RPFC 1TKYA 1VLBA 3AE8B 1KF6B 3AE3B 5G5HA 3SFDB 3ZYYX 1YJIA 1A70A 2H88B 1XLPA 1RM6C 1JQ4A 1QLBB 2EKIA 2HTME 3P63A 1N5WA 4N6EB 4ZHOA 3AH7A 1L0VB 2M56B 1GPXA 1OQRA 4US9A 3EUB2 1AYFA 3AMZA 3NVVA 1FXIA 1JRPA 2K5PA 4YTMB 2W3RA 4ITKA 4N58A 2DBYA 2BS2B 3WCQA 1E6EB 1WYGA 2WU2B 3NVYA 3NVZA 3SFEB 4JWSC 3W5VB 1VDVA 1NVID 1SB3C 1WGKA 2QIEB 1JWAD 5EE3A 3AN1A 1XO3A 1ZP0B 3AEEB 1T3QA 1N63A 3W9CB 2BS4B 3DWGC 1XLQA 1V97A 1OFFA 2JX5A 1DOXA 1V8CA 1WRIA 5AUIA 1L5PA 1NYRA 1OQQA 2KMMA 2WDRB 3P4PB 5H8YE 4FXCA 1B9RA 1PDXA 4C80A 1TJEA 4LTUA 2MJDA 1WWTA 2CU3A 2DWQA 5AUKA 1QT9A 2Y5CA 4US8A 1JW9D 3AE5B 2K22A 3AEFB 4YSXB 1YQ3B 1I7HA 5C3JB 2MJEA 2WP9B 3AEAB 1QOAA 3P4SB 4HRSA 4YSZB 3AECB 3AB5A 1IUEA 1FFVA 3ETRA 3HRDD 3NS1A 2G1EA 3AE7B 3AEBB 1QOBA 1FXAA 2LEKA 4N59A 3AM9A 3SR6A 1NEKB 4WQMA 1FO4A 1N62A 3AE2B 1FRDA 1QOFA 1DOIA 4YSYB 4WWMA 3VRAB 1N61A 1YJJA 2W54A 1WXQA 3FAHA 3HVZA 3PO0A 1ZXIA 1E7PB 1FFUA 1SIJA 5EE0A 1N60A 1ZOYB 1J7AA 3P4QB 1KFYB 3HUIA 4YTNB 3VR9B 2WQYB 3BIID 4YXDB 3LXFA 2B76B 2PVOD 4IDIA 2PKOA 3P1MA 2Q5WD 1TYGB 1NYQA 2PVGC 3NRZA 3NVWA 2K9XA 2WDQB 1TKGA 1R7SA 5H92C 4YTPB 1SF0A 4KX6B 1DGJA 2W55A 1NI3A 3AE1B 3AV8A 4A9AA 3FC4A 3VRBB 4JWUC 1JWBD 3DWMA 1JROA 1FIQA 1QF6A 3P4RB 2MJ3A 2WDVB 2BT6A 3AEDB 4C7ZA 1CJEA 4ZOHC 2JQRB 1J7CA 5GXGB 3LB8C 2N0SB 2OHFA 2QJLA 1AWDA 2MH7A 1PUTA 1PFDA 2WLBA 1ZUD2 2CJOA 3AE9B 1FRRA 4YT0B 4HROA 3B2FA 1RYJA 1J7BA 3KWLA 1QOGA 1CZPA 2ACZB 2H89B 2M19A 2W3SA 1KRHA 5MPOA 3L4PA 1E10A 3W5UB 1FMAD 2BS3B 4C7YA 1UWMA 5C2TB 1L6VA 1E9MA
chains in the Genus database with same CATH superfamily
2E3TA 1Z5SB 4NAMA 4JGHB 1XXGA 2FCMA 2Z0EB 4ARIA 4NQKE 2IBIB 3L16A 2L52A 2LHDA 3GP7A 3DVGX 3U30A 2Z0DB 4PS8A 2LJ5A 1YX6B 4XWTA 4S17A 2J7QB 3Q8CA 4ICVA 2LZ6A 3TEWA 1U4AA 3WCQA 1AARA 2WXGA 2L05A 3DWGC 3JSVA 2IO0B 2ZCBA 3VHTC 4RF1A 2JWUA 2CU3A 2DWQA 1D4BA 4MGYE 3CSTA 3NZUA 4FHJA 1F2RI 2KC1A 1SE4A 1IUEA 3DOWA 4PK1A 1UELA 4ZRIA 2G4SA 2KTRA 1XCTL 1WI0A 4DXFA 2C7HA 4IDIA 1KLUD 1L0XB 1P7EA 3A9JB 1E8YA 5H92C 4OVVA 3ZTDA 3FC4A 3VRBB 2N9KA 4LLGM 2K8BA 3DWMA 3DBHI 2WXKA 4LDTB 4P16A 4ZOHC 2BYFA 1GG3A 1OQYA 1AWDA 1PFDA 3AE9B 1UBIA 4WJPA 3B1LX 1K52A 1RYJA 4LK0M 3QIJA 2OOBB 3MC8A 3RYTA 1EF5A 3Q8BA 1ET9A 2D11A 2L83A 4GOCA 3ML9A 4E3CA 2MBEA 2ZNVC 3AE4B 2CHZA 4A8XC 1YN3A 4AUQC 3NHEB 1XD3B 3X0WA 2IGDA 1UD7A 3AE3B 2KWVB 2NVUI 1RM6C 2NMQA 2ON8A 3A9KA 4JL9A 4US9A 1AYFA 1JRPA 2BB5A 3QA8A 3BK1A 1PYWD 3NVYA 4F8CB 4OW0A 3QJZA 1OQQA 2WXRA 4GDKB 4AQ7A 3E9SA 4L1BA 4C80A 1V1OA 2KDIA 3DVNV 2XEWA 1IGCA 4TV3A 1FD6A 3BINA 5KHOA 2BYTA 2QEJC 1FO4A 1MVKA 3CF6E 4NZLB 1FFUA 2A4ZA 4XC2A 3PS6A 4MM3A 1TIFA 3LXFA 3IT4B 3V62A 1AW7A 1QKZA 4MACA 1V80A 3EHVA 1TKGA 3B08A 4CHKA 4EZLA 1IYFA 4A9AA 3IHPC 1I4QA 4ZRJA 4I6PA 4ZDVA 1R4MI 1P7FA 4JQWC 1HXYD 3Q3NC 2MHJA 1PGAA 1WFYA 3NOBA 2WLBA 2CJOA 1G6JA 4JIOU 2K6QA 2L00B 2M19A 1E7VA 2W3SA 3ML8A 4DHZE 4ZYNA 3SD5A 1BXTA 1BT0A 1HE8A 1WR6E 1I4GA 4AS1A 4K1RB 3CIRB 2BB6A 3PLUA 2CJNA 4P6VF 2RDBC 3CWIA 2RDGA 2KX3A 1GAQB 3RNAC 1UF0A 3Q3JA 4B9KA 2LVOA 5IA7A 2L0FA 4K7WA 1HTQA 4PS7A 3RZWC 2GOWA 1SGHA 4W9CA 1YJ1A 4CQNA 2DYOA 1A70A 4MGZE 5TR5A 3DBLI 1WGYA 2KTRB 3VXWA 2L76A 3EUB2 2RD0A 3BK2A 3NVVA 2K5PA 4HLEA 2XNAC 3LDZE 2L1AA 4I6NB 1HQRD 5EE3A 1F2RC 1WGDA 3AN1A 2CU1A 1L5PA 1QZEA 4MH0E 3NZSA 4A90A 4GSWA 1WWTA 2JZZA 2MX2A 1I7HA 2LFIA 2K0PA 3N1YC 4IM0A 3ZJTA 3R2IA 2LVPA 1YJJA 4WAAA 5LNK1 1I4PA 5EE0A 3GE3C 4TSSA 2V4IB 4YXDB 2IO2B 1LXDA 1B1ZA 2RGFA 1MFWA 1R4NB 5L83A 4W9HA 1NI3A 2LRUA 3AV8A 2LGDA 3H7SA 4OVUA 2KD0A 3GZNB 2WDVB 1JRUA 1C76A 4W9IA 2ZW1A 3AEDB 4FJVB 3I63C 4IM2A 3N3KB 2J0MA 5BO4B 2JUOA 4O1NA 3GZNI 4TQ0A 1QOGA 4B6WA 1EM7A 4MH8A 3UI3A 1K51A 2GBRA 2PE6B 1UWMA 4BVUC 4LDTD 4GDLB 1VJKA 4IM3A 1EWYC 1FM0D 2KWUB 4OZCA 3DCGA 1XF5L 4IG7B 3HM3A 3AEGB 4HCPB 4ASWC 2YEPF 1JMLA 2BKFA 3RT3B 3ZYYX 3U4EG 1LGRA 3AU4A 2K8HA 1GC7A 3GOEA 2L8JA 1L0VB 2ASQA 2PE9A 4AP4C 5LLIA 3ZDTA 2W3RA 2BS2B 3R7RA 4L2YA 4WJNA 3I5JC 4KDLB 1WSPA 3WAPA 3L0WB 2JX5A 1I42A 1XT9B 2M17A 2MJDA 3APDA 4RNAA 3PZDA 4US8A 2KOXA 4WQOB 1ZGUB 2Z59B 1R4MB 4HKZE 4H2AA 1UGMA 1VZ6A 2MJEA 4DHJB 4AOFA 5AZHA 1NEKB 2ZPYA 1QOFA 4YSYB 2KO3A 1J8CA 5AZGA 1EU3A 1WXQA 5D2MB 4C00A 1P9DU 1YIWA 1T0SC 2AQ2B 3NG0A 1V1PA 3BIID 2Q5WD 3DVGY 1FNWA 1V5TA 2JXXA 4GU2A 2BWFA 3K9OB 3IFWB 5C23A 1RAXA 1TGZB 3N1XC 2DNFA 3P4RB 4XX5A 3JW0X 2N1WA 4RGOS 1XCQL 3PV1A 4E71A 1ACCA 2BVCA 1RRBA 5EDSA 1GUAB 1PUTA 1TS5A 2N7JA 2W9NA 2M4NA 2SAKA 2KFKA 2RSUA 1HTOA 2BS3B 3P2BA 4GB9A 4RM8A 3KUDB 1L6VA 2DAJA 2PIAA 4WWPA 1XLNA 5EE9A 1MHHE 2DZIA 2BTEA 4EE2A 4ZRPA 2O6VA 4ZHPA 1I4RA 2WS3B 3QAQA 4DK5A 2RPVA 4BKSA 2GLSA 3QCAA 3PVLA 1N5WA 2BQQA 2C60A 2KNBA 2LJIA 4C56C 1HEZE 4MEMA 2KDMA 3NVZA 2N9LA 2NS5A 2WX1A 3Q8AA 2M1MA 3UF8A 3PT2B 1DOXA 1WRIA 2M0XA 3UQBA 3N32A 2PJHA 1WZ3A 4RGMA 4YSXB 2IPKD 3AEAB 5I4DA 4LNKA 3TEZA 2AQ1B 2G1EA 3AE7B 3S2AA 3AXCA 3AM9A 1C4PA 3VUYA 3QWZB 3HVZA 1V2YA 1ZXIA 1E7PB 5JXVA 1F9JA 2KWCA 2A5UA 1N60A 2MP2B 3PRPB 4YTNB 3RFZB 2G45B 2KFJA 2HTHA 4KGTA 3P1MA 2QC8A 4LNOA 4KX6B 3SU8X 2FCSA 3IT6B 3KWVA 5L95C 3DHIC 5BMGA 4HCNB 2BT6A 2RR9A 4M8NA 1NDDA 4RH6A 1A5RA 1F77A 3T9LA 4PYUA 1SIFA 3ZGZA 4HROA 2WXMA 2H89B 1KLGD 2XN9C 3OAWA 5T8IA 2BYEA 4BBNC 2ZCCA 2FAZA 5FR6A 2UYZB 1WZ0A 5D6JB 1WJ6A 2IJ0A 2G9HD 4KIKA 2W82A 1WX7A 2N9XA 4B0MA 4NY0A 3KYCD 4HDQA 1F52A 1SJED 5HI1A 4ZRQA 2IY0B 1VLBA 2J4XA 3R7QA 4KSKC 4PT5A 1Q10A 1Y56A 2EKIA 4HJKA 3FKYA 2V3SA 4R3DA 1Q0WB 1EF1A 4ITKA 2WU2B 4KKIA 4DHZB 1NVID 1T3QA 4G50A 5J17A 2WXFA 4BAXA 1OFFA 2WXPA 5AUIA 2KYWA 4MGKE 2B3AA 2Y5CA 1VZ7A 3AE5B 1T6BX 4GLSC 1FFVA 1HZ6A 5FR3A 2MA9B 2BKRB 4RF0A 3V61A 1DOIA 4CYEA 1SIJA 3AU5A 4HVBA 2PVOD 5BYRA 2PVGC 4K7UA 1ET6A 3Q3MC 2BWES 3PTFC 2D3AA 2ZEQA 3E56A 2I1JA 1R7SA 1SXTA 4HEA1 1V1PB 2LHEA 4ANVA 1KOTA 2M8SA 4E74A 5IN7A 4I6LB 2HJ8A 2L3ZA 2KKCA 2MSED 3VAWA 2WYQA 2BW2A 2KQSA 2NPTB 2OHFA 2QJLA 4ICUA 4W9FA 1UUPA 2FUG1 4IWQA 3NZ3A 1YMHE 3VH4B 1KLVA 1WM3A 5IKCM 4MJSB 4AJWA 1NENB 3H7PB 4GDKA 2AX5A 3PPAA 4MJSA 4RGNA 3X23A 3DHGC 4URKA 1GJZA 3VH3B 1VCBA 2KMAA 3UQAA 2WGSA 2FBWB 2VRRB 4D2KA 2OJWA 3QC8B 1KF6B 5G5HA 2MWSB 4W9GA 1BMLC 4C4VB 1WXVA 2JT4B 1D5ZC 1LM8B 2FE8A 2MBOA 2OJRA 1I4XA 3KUCB 3W5VB 3M95A 2IY1B 4BKSD 1V97A 1V8CA 1ZE3D 5AZFA 1WGRA 3ZO5B 3ZQ4A 3BVMA 1B9RA 3ZNHB 2JXTA 5AUKA 4F7ZA 3A33B 2LMCA 4KSLC 3NY5A 4XYCA 1SBBB 1V86A 2JF5A 4ANWA 3HRDD 4J3OD 2BBCA 3AEBB 1EO6A 3DDCB 3Q8EA 4XE0A 3OJ4B 1TS2A 4G11A 3JSVB 3RZFA 1ISNA 3V6CB 1GNUA 3WAOA 2RMMA 4GN1A 2PLPA 3VTWA 2KTFA 3RNCC 4P1CC 4Q2JA 1FXTB 2KDBA 3ZVVA 4BBNF 3QX1A 3GB1A 2EMSA 3B0AA 5E6PA 2INDC 5CHVC 5G2NA 1E10A 1PQSA 1WGGA 2R2OA 2WXIA 1KJTA 4XDCA 2JU6X 3HK0A 4BOSC 2KC2A 1E0ZA 4ZRKA 2RDHA 2KHWB 4FADA 1L6UA 2KT7A 3RNGC 3N20C 1IBXA 1C1YB 4A55A 1SE3A 4AWJA 2H88B 2Y3AA 1IBXB 4OZBA 3ZTCA 2PMVA 4IWOA 3A1QA 2WHIA 4FHKA 1EUVB 3VTVA 2DBYA 1YNTE 2LRWA 3PLVA 2KX0A 1VDVA 1SB3C 3L17A 2INPE 3PHWB 2MQJA 4WWNA 3MHSD 4DXAB 1N6ZA 4KGSA 1CK1A 3V6EB 2LWPA 1PGBA 4M0WA 5HG2A 2L0TA 2LXCA 4KKJA 4YSZB 4ARCA 3ZKJC 3TIXA 4KDIC 2ZW0A 1J0GA 5IAAC 4ZYSA 1CQVA 4DXGA 3ECIA 4BOZB 5GMVA 3W2DA 1Z2MA 2K25A 1TBEA 3P4QB 2DLBA 3R66C 3KQ4A 1L4DB 2O2VB 1WRDB 3HHMA 1TS3A 1T0RC 3HVDA 2FCNA 3TBLD 2KVZA 3Q3FA 1P1AA 5DPRA 2VZKD 4M00A 3VFKA 1J7CA 3H6NA 5C1ZA 1UNSA 2JRIB 2EMTA 3ZUNA 5MPOA 2V1YA 2WXNA 4PYZA 1T0QC 1E9MA 1P98A 4MGIE 4EOYA 4XGAB 3ZRCA 3DBRI 5FKAC 4MSMB 2D3CA 2I38A 3KLSX 4YWGG 3ZRFA 3SFDB 5J18A 1JQ4A 4TKNA 3U8ZA 3RNBC 4W9LA 4GDLA 2BPSA 2ZNVB 2ZVNA 2L32A 1TT5B 3SFEB 4JWSC 3VUWA 1L4ZB 1JWSD 2QIEB 1K8RB 3W9CB 3P4PB 2WDRB 2WXQA 5H8YE 1KH0A 1ZDVA 2KDFB 3DPDA 3I3TB 2JRHA 3IXSA 3JVZX 5E6OA 2K1FA 2MBHA 3OLMD 4HRSA 5D3IB 2Y5PA 3NS1A 1E8WA 1UGJA 3BVGA 2HJ1A 4G3XB 2KVRA 2LGSA 3OWEB 2XBBC 3T3NA 4RM9A 3PGEA 2WQYB 3A4RA 1ENFA 1SF0A 5D3DA 3KW5B 3N30A 1WJNA 1WH3A 4IKGA 3Q14C 2MJ3A 3A1QB 4QAYA 2DZMA 3N1ZC 1SJHD 2INNE 3ZXRA 2V9HA 2N0SB 3KUZA 3PSEB 2N9PC 4NPNA 5IOIA 4IOIE 4W9DA 3B2FA 1J7BA 1IPGA 1TY0A 1KRHA 4IWPA 3Q3OC 1FMAD 1LO5D 4K3CA 1TKEA 5E6NA 1DOYA 1TY2A 1V81A 2G4DB 3QK0A 2KZRA 3B9JA 2GBKA 3IAM1 1J19A 3W1YA 1GOZA 2M0AA 2LUMA 1WM2A 2OEDA 3AMZA 3EECA 1E6EB 1LFDA 2J53A 3PHXB 5JHBA 1WGKA 2IGGA 2JZPA 1XO3A 3L10B 1E8XA 4A6QA 3WAMA 2D07B 1TJEA 2KN5A 5DPSA 1C77A 4HWIB 2WP9B 3P4SB 1V9JA 3AB5A 3IVFA 3DBSA 5DPTA 2ICIA 1OTRB 2PPHA 3ALBA 2JZ3B 4FA6A 4XWWA 3I9V1 3IBEA 1ZOYB 2C9WB 5CHWA 2YLMA 1NYQA 3ENEA 2REXA 3EGRA 3TMPB 4S0RA 3AI5A 1MI0A 2V3NA 1NBFC 5AEKB 4W9JA 2FIFA 2GI9A 4C7ZA 2DYBA 5BYSA 3EFCA 5GXGB 3ZW3A 3RN9C 3M3JA 3RMKC 3UINB 3VQIA 3Q69A 1CZPA 2CR5A 1WX9A 4L23A 2KXJA 3W5UB 5C2TB 4LNNA 2MBQA 1CMXB 5G5GA 1C3TA 5EE1A 3OJ3A 4IUMB 4BKGA 5JH5C 3VR8B 1WIAA 3ZJVA 4G0NB 4RCOA 4USAA 1RFKA 2QMTA 3VTUA 2E6XA 4P7IA 1FNUA 3RNEC 1YQ4B 4LCDE 2DENB 4HJGE 2ZZPB 1DYQA 1WGHA 2FIDA 3RD2A 1WYWB 1L0YB 1WYGA 3RULA 3WALA 3EA6A 2K3UA 3CSFA 5DPWA 1NYRA 4DWFA 3URYA 1FNVA 1EWCA 2KQ7A 4M02A 2LI5A 2EELA 5FK9C 2V3PA 4KZ0A 3O65B 3MC9A 4BFRA 2WXJA 4JPSA 1MJDA 2R61A 3U7ZA 1QOBA 4N59A 1FRDA 3Q6BA 3VRAB 4WWMA 2X8XX 4FJYA 4A3OA 3MFGA 1L2NA 2PEAA 2WXOA 5JHAA 2B76B 1TYGB 3SDLC 4NJ6A 2N1VA 2KFKB 2VH1A 1Q1OA 3AE1B 2C7MB 3ZIMA 4DDGD 1TZOA 4RFBA 3BVZA 3U52E 1CJEA 1VD2A 2IO1B 3DBLB 2LXAA 3DVNU 2KDEB 4HKQA 4XDDA 2GBMA 1S3SG 1HZ5A 2XK5A 4YT0B 1WE6A 1PGXA 3P42A 1FCCC 4WAFA 5BYQA 4EZJA 1WF9A 2CHXA 3ABVB 2GBJA 3A9JA 5BMHA 1F0ZA 1ZXHA 3T3OA 5CHFA 4M01A 1D5MC 1XLOA 1GB4A 1T5XD 1WE7A 2IO3B 4K81A 3W1SA 4WURA 3R8BA 2KK8A 3DQVA 3L13A 1YN5A 3PREA 3QARA 2K6DB 1XEEA 3DHHC 3P63A 1H4RA 3AH7A 1GPXA 1FXIA 4FLHA 3GE8C 4OVZA 4KIKB 4MSQB 2LGIA 3V3XA 4W9EA 4B95A 1T0YA 2JVCA 2BS4B 4WJOA 5G55A 3RCZA 1XQQA 4WIPA 4GMVA 3MTNB 4J6IA 1PDXA 2MP2A 5J2RA 3JYUA 1C79A 1GB1A 3WIMA 2K22A 3NJTA 2YEPB 4KVGB 1S1QB 1WJ4A 3BYYB 2HE7A 1V6EA 4DBGA 4IC7B 2DYMA 1TS4A 1N62A 4HK2A 1N61A 2QHOA 4MDKE 2W54A 2SEBD 2ZPNA 3TEYA 3UGBB 4FJZA 3TL5A 2MW5A 5DCNA 1RLFA 5HKHA 3NRZA 1MHXA 3HM6X 3NVWA 1YX5B 1M94A 2NPTA 3U2SC 2DAFA 3SHQA 3TEXA 4JWUC 1JWBD 2INCC 1F1HA 2MRPA 1KTKA 1JCKB 5E6JA 2BYVE 2JQRB 3M62B 4LNIA 2VH2A 2WXHA 3NUHB 3PRMB 3NS8A 4TUUA 4LJOB 1C78A 2J0JA 3AE6B 3J9CA 2KAJA 4F1SA 2WNMA 4JX1C 3H9DA 4EZKA 2AEHA 2JSVX 4A20A 1ZKHA 2AL6A 2GRIA 3B2GA 2NBUA 3TUOA 3RPFC 1TKYA 3AE8B 3V05A 1YJIA 2HTME 3L08A 2KLGA 2IYDB 2EKEC 4MT5A 4NNJB 4KZCA 2BGFA 2KACA 3FILA 1SSNA 2AQ3B 3VUXA 2LGXA 3RI7C 1ZW7A 2PTLA 3T8MA 3VVWB 4EUTA 2QCZA 1FPYA 3LYYA 1JW9D 4ANUA 4LJPB 4YL8A 1YQ3B 3KH0A 2LVQA 5C3JB 4P1BC 1JWUD 2N7EA 4BKTA 3AECB 4NAWB 3ETRA 2LEKA 1NI2A 1V49A 5CTRC 4W9KA 3PO0A 1M4VA 2IGHA 2GMIC 3DBHB 2I2YA 2MCNB 4DHJD 3R3MA 3C0RB 4OZAA 2WDQB 4KGRA 1WY8A 2C5LC 2DX5B 1AN8A 5KHQA 2KJHB 1YQBA 1QF6A 1JROA 1KM7A 4UDUC 1MG4A 2KLCA 4REZA 2WX0A 3R2TA 3LB8C 1E8ZA 4WH4A 2JY6A 3Q8FA 2AWTA 2N4FA 1UZXB 3MJ5A 1L7YA 2O2VA 3LJ3A 2KMMA 4TQ1A 2Y5BB 4EKUA 1ROEA 2QILA 1YN4A 1D5XC 4NAWA 2KJ6A 3ZLZA 1IGDA 1N5XA 2DZKA 4MELA 3A4SC 1HA5A 2KMCA 1XLPA 3QQ8B 3V60A 3H1UA 5BMIA 4N6EB 1OGWA 2M56B 2N7DA 2IZVB 1VRAB 5CX3A 1JWAD 1ZP0B 2JWZA 3AEEB 1N63A 4C4VA 4BZAA 3MHZA 1E5WA 4XZ4A 1WX8A 4FXCA 2X38A 4LTUA 2D10A 1LQBA 1QQRA 2FNJB 2R2QA 4II3B 3BWUD 3AEFB 2GB1A 1I4HA 2CS4A 4OHJA 4K3BA 1X1MA 3CMMB 2LGYA 4GIVA 2NTTA 3U7DA 1VZ8A 1Y8RC 1RFAA 2K39A 4RMAA 4X57B 2K9XA 4HDOA 3DBRB 2J42A 1EU4A 2KANA 3ZNID 3D32A 3H7PA 3APCA 1P0RA 1FIQA 1MPEA 3AULA 5IO9A 4CO7A 3I57A 2KQ4X 5IP4D 2WXLA 2CKHB 5D7GA 1VR9A 2UWQA 4HPPA 1WJUA 1WMHA 2DZJA 5HHDG 1FCLA 4C7YA 1WMHB 2HD5B 2O6VB 4DDID 1ESFA 4JLCA 4FULA 3TCAA 2LASA 3ZNGC 3QHTA 1D3ZA 3A9KB 2NCNA 1R4NI 1ZPSA 1RWSA 1P3QU 3ZNZB 3IG3A 4JE3B 2ZVOA 2AYOB 1UH6A 1OQRA 1JWMD 3RNFC 1BUIC 2NBVB 4GGQA 5LXIB 5TSSA 2PW9A 4N58A 1WXAA 3MJWA 2YVCA 2FUHB 4IW0A 3W1SC 2WDTB 3BYTB 4TMAB 1SEBD 1STEA 2G3QB 2AL3A 1C9FA 4WWOA 2Z8LA 4FBJB 3EFUA 2KN4A 3PZ8A 1UWXA 3ZXVA 3H8HA 1YOVB 2I1KA 3FILB 2C7NB 1FXAA 2UU7A 3L54A 3SR6A 3AE2B 5D94A 2KWDA 4M0WB 2VZKB 3C8YA 2D3GA 2QSDA 3VDZA 4EEWA 4II2B 1J7AA 2N9EB 1KFYB 2XK5B 3BY4B 3HUIA 3C19A 4PS3A 1QILA 2PKOA 3SEBA 3MC0B 1E90A 3IAS1 3KVFB 1Q5WB 2W55A 1K50A 2BF8B 1YD8U 2O6VD 1SE9A 1OEYA 4DQOC 4GXBA 1WXSA 2HDEA 4HPMB 3ONSA 3HIZA 1C4AA 1ZUD2 2FCQA 1FRRA 3UIOB 4RGTA 4ACFA 1TTNA 2LUEA 1E7UA 3M63B 2WU5B 2ZJDA 3WA0A 3OG5A 1H8CA 4AJYB 1OEYJ 4HPLB 4A3PA 4EFOA 4M8MA 4N9F4 3APFA 3KYDD 2D5GA 3BZDB 1JALA 1FEHA 2MBBB 4MM3B 4LNFA 1QLBB 4ZHOA 4NJ7A 2GBNA 4YTMB 5LXHA 2RPQA 2K8CA 2J0KA 3TJPA 3N9YC 3UIPB 2V0GA 1XLQA 3ZDMC 3EC8A 2MLBA 3PRZA 5HFYA 1QT9A 2NR2A 2ONQA 4HXDA 1UBQA 2JPHA 1QOAA 1K53A 1WXMA 2NBWB 4ANXA 2D3BA 2QDFA 1TZ1A 4WQMA 1D6EC 1WR1A 3FAHA 2IDYA 1MG8A 3VR9B 1V5OA 1I35A 4KV2A 2J52A 2DHZA 2LD9A 4YTPB 4NJCA 1DGJA 3MP9A 2MEKA 3GS2A 2WWZA 3Q2AC 3WANA 2D2QA 5JZEB 1SE2A 3PZ7A 4NQLB 1C4CA 1GC6A 4WJQA 2CHWA 2JYTA 3K9PB 2KJRA 1ZDXA 4B0EA 3O13A 2MH7A 3RUIB 2TSSA 4FN2A 3KWLA 2ACZB 4K7SA 3ZJUA 3TSSA 2L7RA 1IP9A 3L4PA 2V4LA 2JYEA 2NTSA
chains in the Genus database with same CATH topology
3AE6B 2E3TA 3J9CA 2KAJA 2PIAA 1XLNA 4NAMA 5EE9A 1MHHE 1XXGA 4ARIA 2WNMA 4EE2A 2BTEA 4JX1C 4ZRPA 4ZHPA 2JSVX 2L52A 1I4RA 2LHDA 2GRIA 2WS3B 3B2GA 5FKAC 2RPVA 2I38A 3GP7A 3KLSX 3TUOA 3RPFC 1TKYA 4YWGG 3AE8B 3V05A 3SFDB 1YJIA 1JQ4A 2HTME 1N5WA 4XWTA 2LJIA 4C56C 1HEZE 4MT5A 3Q8CA 3TEWA 2L32A 3WCQA 2KACA 3FILA 1SSNA 2KDMA 3NVZA 3SFEB 4JWSC 2AQ3B 1L4ZB 1JWSD 2N9LA 2QIEB 2WXGA 3Q8AA 3W9CB 3DWGC 1DOXA 1WRIA 3P4PB 2WDRB 2WXQA 2PTLA 5H8YE 1KH0A 1ZDVA 4RF1A 2JWUA 2CU3A 2DWQA 1D4BA 3LYYA 1JW9D 4RGMA 4YSXB 1YQ3B 2IPKD 3IXSA 1F2RI 5C3JB 3AEAB 1JWUD 4HRSA 5D3IB 5I4DA 3AECB 4NAWB 2Y5PA 1SE4A 1IUEA 2AQ1B 3ETRA 3TEZA 3NS1A 2G1EA 3AE7B 2LEKA 3AM9A 1C4PA 1UGJA 3BVGA 1XCTL 4DXFA 3HVZA 3PO0A 1ZXIA 1E7PB 5JXVA 1M4VA 2IGHA 3OWEB 1N60A 3T3NA 4YTNB 3RFZB 2WQYB 4KGTA 4IDIA 3P1MA 2I2YA 1KLUD 1L0XB 1P7EA 4OZAA 2WDQB 1ENFA 4KGRA 5H92C 1SF0A 4KX6B 5D3DA 1AN8A 3FC4A 3VRBB 2N9KA 3IT6B 4IKGA 3DWMA 3KWVA 1JROA 4LLGM 1QF6A 2MJ3A 4UDUC 5BMGA 2WXKA 4REZA 2BT6A 4P16A 1SJHD 4ZOHC 2INNE 3R2TA 3LB8C 2N0SB 4RH6A 1AWDA 1F77A 4WH4A 4IOIE 1PFDA 3Q8FA 3AE9B 3ZGZA 4HROA 3B2FA 1K52A 1J7BA 1RYJA 2H89B 2WXMA 3MJ5A 1KLGD 4LK0M 1TY0A 1KRHA 2XN9C 5T8IA 1FMAD 3Q8BA 2KMMA 4TQ1A 1ET9A 1ROEA 2L83A 2QILA 1LO5D 1YN4A 1D5XC 1TKEA 2IJ0A 2G9HD 2W82A 1DOYA 3AE4B 1IGDA 1TY2A 1N5XA 4B0MA 4A8XC 1YN3A 1SJED 1HA5A 3B9JA 4ZRQA 5HI1A 3IAM1 2IGDA 1VLBA 2J4XA 3AE3B 1XLPA 4PT5A 1GOZA 1RM6C 2NMQA 2ON8A 5BMIA 1Q10A 1Y56A 2EKIA 4N6EB 2M0AA 2LUMA 2M56B 4R3DA 2OEDA 4US9A 1AYFA 3AMZA 1JRPA 2BB5A 3BK1A 4ITKA 1PYWD 1E6EB 3NVYA 2WU2B 2J53A 4KKIA 1VRAB 1NVID 1WGKA 2IGGA 1JWAD 2JZPA 1XO3A 1ZP0B 3AEEB 1T3QA 1N63A 3MHZA 2WXFA 1OFFA 4A6QA 4OW0A 2WXPA 4GDKB 1OQQA 2WXRA 5AUIA 4AQ7A 4FXCA 3E9SA 4L1BA 4C80A 1TJEA 2X38A 4LTUA 1QQRA 1V1OA 2Y5CA 1VZ7A 3BWUD 3AE5B 1C77A 1IGCA 3AEFB 2GB1A 1T6BX 1I4HA 2WP9B 3P4SB 1FD6A 3AB5A 4GLSC 4OHJA 1FFVA 1HZ6A 2BYTA 5FR3A 2QEJC 2ICIA 1MVKA 1FO4A 4RF0A 1DOIA 4NZLB 2NTTA 1VZ8A 1FFUA 4XWWA 1SIJA 3I9V1 1ZOYB 3LXFA 2PVOD 3IT4B 1AW7A 1QKZA 2PVGC 1ET6A 1NYQA 4MACA 5BYRA 2K9XA 1TKGA 3E56A 3EGRA 1R7SA 1SXTA 2J42A 1EU4A 4HEA1 1V1PB 4A9AA 2LHEA 1MI0A 1I4QA 2V3NA 1FIQA 1MPEA 2GI9A 4C7ZA 1P7FA 5BYSA 1HXYD 3I57A 2BW2A 5GXGB 2KQ4X 2OHFA 2QJLA 2WXLA 5D7GA 1PGAA 1VR9A 2WLBA 2CJOA 1UUPA 2FUG1 3VQIA 3NZ3A 3Q69A 1CZPA 2M19A 4L23A 1YMHE 2W3SA 5HHDG 1FCLA 3W5UB 4C7YA 1BXTA 5C2TB 1ESFA 5G5GA 1I4GA 1NENB 4AS1A 5EE1A 2AX5A 3CIRB 2BB6A 4RGNA 2CJNA 4P6VF 3CWIA 2RDGA 1GAQB 3VR8B 3ZJVA 1ZPSA 4RCOA 1RWSA 4USAA 1RFKA 2QMTA 2E6XA 1FNUA 1YQ4B 2FBWB 4JE3B 4D2KA 1KF6B 5G5HA 4CQNA 2DYOA 1A70A 4HJGE 1BMLC 1DYQA 1OQRA 3EUB2 1D5ZC 3BK2A 2FE8A 3NVVA 2K5PA 1JWMD 1BUIC 5TSSA 2PW9A 4N58A 1L0YB 1WYGA 1I4XA 2XNAC 3W5VB 3EA6A 2K3UA 2L1AA 1HQRD 5EE3A 1F2RC 3BYTB 1SEBD 3AN1A 4TMAB 1STEA 1V97A 1V8CA 1ZE3D 1L5PA 1NYRA 1C9FA 3ZQ4A 2Z8LA 3URYA 3BVMA 1B9RA 4A90A 1FNVA 1EWCA 1WWTA 2JXTA 5AUKA 2EELA 2LMCA 2KN4A 5FK9C 2V3PA 3PZ8A 1UWXA 1SBBB 1I7HA 2LFIA 3H8HA 2K0PA 2WXJA 3FILB 3HRDD 4J3OD 2BBCA 4JPSA 2R61A 3U7ZA 3AEBB 1QOBA 1FXAA 4N59A 3ZJTA 3R2IA 3SR6A 3Q8EA 3AE2B 4XE0A 1FRDA 2KWDA 3VRAB 1TS2A 4WWMA 2VZKB 1YJJA 3C8YA 5LNK1 1I4PA 3MFGA 2QSDA 5EE0A 4TSSA 1J7AA 1KFYB 3HUIA 2WXOA 2V4IB 4YXDB 2B76B 1QILA 2PKOA 1B1ZA 1TYGB 3SEBA 3MC0B 2RMMA 2PLPA 3IAS1 2W55A 1NI3A 3AE1B 3AV8A 1K50A 1TZOA 4RFBA 3BVZA 3U52E 2WDVB 1C76A 2ZW1A 4Q2JA 4DQOC 3AEDB 1CJEA 4HKQA 2HDEA 4XDDA 3GB1A 1C4AA 1ZUD2 4O1NA 1HZ5A 1FRRA 4YT0B 4TQ0A 1QOGA 4RGTA 1EM7A 1PGXA 4MH8A 1E10A 3UI3A 1K51A 1UWMA 4GDLB 1VJKA 2WU5B 3P42A 1FCCC 4WAFA 2WXIA 1EWYC 1FM0D 2JU6X 4XDCA 5BYQA 1F0ZA 3ABVB 5BMHA 4OZCA 1ZXHA 3T3OA 1E0ZA 2D5GA 1D5MC 1XF5L 2RDHA 3BZDB 1XLOA 1L6UA 1GB4A 1T5XD 1JALA 1FEHA 3AEGB 3W1SA 4WURA 2YEPF 1JMLA 3R8BA 1IBXA 4A55A 3ZYYX 1SE3A 1YN5A 4MM3B 3U4EG 2H88B 2Y3AA 1XEEA 1IBXB 1QLBB 4OZBA 3P63A 4ZHOA 3AH7A 1L0VB 2PMVA 1GPXA 1FXIA 4YTMB 2W3RA 2DBYA 2BS2B 4OVZA 4L2YA 1YNTE 2LGIA 3V3XA 1VDVA 1SB3C 3N9YC 2INPE 2V0GA 1WSPA 2BS4B 1XLQA 2JX5A 4WIPA 1PDXA 2MJDA 4KGSA 1C79A 1CK1A 5HFYA 1QT9A 1GB1A 4RNAA 2ONQA 1PGBA 4M0WA 4US8A 2K22A 2YEPB 5HG2A 4HKZE 2MJEA 1VZ6A 4H2AA 1QOAA 1K53A 3BYYB 4KKJA 4YSZB 4ARCA 2ZW0A 2DYMA 4ZYSA 1CQVA 1TS4A 1NEKB 4WQMA 4DXGA 1N62A 1QOFA 4YSYB 1EU3A 1N61A 1D6EC 2W54A 1WXQA 3FAHA 3W2DA 2SEBD 3TEYA 2IDYA 3P4QB 2AQ2B 2DLBA 3VR9B 3KQ4A 1L4DB 1V1PA 3BIID 2Q5WD 3NRZA 1FNWA 1MHXA 2J52A 3NVWA 1TS3A 3HVDA 4YTPB 4NJCA 1DGJA 3MP9A 2MEKA 3GS2A 3U2SC 3TEXA 4JWUC 1JWBD 2VZKD 3P4RB 1SE2A 3PZ7A 1KTKA 1JCKB 4RGOS 1C4CA 5E6JA 1XCQL 2JYTA 1ACCA 2JQRB 1J7CA 1ZDXA 3O13A 4B0EA 2MH7A 2WXHA 1PUTA 3NUHB 1TS5A 1UNSA 2TSSA 2N7JA 3KWLA 2ACZB 3ZJUA 2SAKA 3TSSA 1C78A 5MPOA 3L4PA 2BS3B 2JYEA 2NTSA 2WXNA 1L6VA 1E9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE6 B;  2E3T A;  1VJK A;  2KAJ A;  2PIA A;  2WU5 B;  1NEN B;  1ROE A;  1XLN A;  2L83 A;  5EE9 A;  5G5G A;  5EE1 A;  2AX5 A;  3CIR B;  1EWY C;  1FM0 D;  4JX1 C;  2CJN A;  4P6V F;  3ABV B;  3CWI A;  1TKE A;  1F0Z A;  1GAQ B;  3VR8 B;  4ZHP A;  2L52 A;  1DOY A;  3AE4 B;  1E0Z A;  1N5X A;  4USA A;  1RWS A;  1RFK A;  2WS3 B;  3B2G A;  1XLO A;  1L6U A;  1JAL A;  1YQ4 B;  3AEG B;  2FBW B;  3B9J A;  3RPF C;  1TKY A;  1VLB A;  3AE8 B;  1KF6 B;  3AE3 B;  5G5H A;  3SFD B;  3ZYY X;  1YJI A;  1A70 A;  2H88 B;  1XLP A;  1RM6 C;  1JQ4 A;  1QLB B;  2EKI A;  2HTM E;  3P63 A;  1N5W A;  4N6E B;  4ZHO A;  3AH7 A;  1L0V B;  2M56 B;  1GPX A;  1OQR A;  4US9 A;  3EUB 2;  1AYF A;  3AMZ A;  3NVV A;  1FXI A;  1JRP A;  2K5P A;  4YTM B;  2W3R A;  4ITK A;  4N58 A;  2DBY A;  2BS2 B;  3WCQ A;  1E6E B;  1WYG A;  2WU2 B;  3NVY A;  3NVZ A;  3SFE B;  4JWS C;  3W5V B;  1VDV A;  1NVI D;  1SB3 C;  1WGK A;  2QIE B;  1JWA D;  5EE3 A;  3AN1 A;  1XO3 A;  1ZP0 B;  3AEE B;  1T3Q A;  1N63 A;  3W9C B;  2BS4 B;  3DWG C;  1XLQ A;  1V97 A;  1OFF A;  2JX5 A;  1DOX A;  1V8C A;  1WRI A;  5AUI A;  1L5P A;  1NYR A;  1OQQ A;  2KMM A;  2WDR B;  3P4P B;  5H8Y E;  4FXC A;  1B9R A;  1PDX A;  4C80 A;  1TJE A;  4LTU A;  2MJD A;  1WWT A;  2CU3 A;  2DWQ A;  5AUK A;  1QT9 A;  2Y5C A;  4US8 A;  1JW9 D;  3AE5 B;  2K22 A;  3AEF B;  4YSX B;  1YQ3 B;  1I7H A;  5C3J B;  2MJE A;  2WP9 B;  3AEA B;  1QOA A;  3P4S B;  4HRS A;  4YSZ B;  3AEC B;  3AB5 A;  1IUE A;  1FFV A;  3ETR A;  3HRD D;  3NS1 A;  2G1E A;  3AE7 B;  3AEB B;  1QOB A;  1FXA A;  2LEK A;  4N59 A;  3AM9 A;  3SR6 A;  1NEK B;  4WQM A;  1FO4 A;  1N62 A;  3AE2 B;  1FRD A;  1QOF A;  1DOI A;  4YSY B;  4WWM A;  3VRA B;  1N61 A;  1YJJ A;  2W54 A;  1WXQ A;  3FAH A;  3HVZ A;  3PO0 A;  1ZXI A;  1E7P B;  1FFU A;  1SIJ A;  5EE0 A;  1N60 A;  1ZOY B;  1J7A A;  3P4Q B;  1KFY B;  3HUI A;  4YTN B;  3VR9 B;  2WQY B;  3BII D;  4YXD B;  3LXF A;  2B76 B;  2PVO D;  4IDI A;  2PKO A;  3P1M A;  2Q5W D;  1TYG B;  1NYQ A;  2PVG C;  3NRZ A;  3NVW A;  2K9X A;  2WDQ B;  1TKG A;  1R7S A;  5H92 C;  4YTP B;  1SF0 A;  4KX6 B;  1DGJ A;  2W55 A;  1NI3 A;  3AE1 B;  3AV8 A;  4A9A A;  3FC4 A;  3VRB B;  4JWU C;  1JWB D;  3DWM A;  1JRO A;  1FIQ A;  1QF6 A;  3P4R B;  2MJ3 A;  2WDV B;  2BT6 A;  3AED B;  4C7Z A;  1CJE A;  4ZOH C;  2JQR B;  1J7C A;  5GXG B;  3LB8 C;  2N0S B;  2OHF A;  2QJL A;  1AWD A;  2MH7 A;  1PUT A;  1PFD A;  2WLB A;  1ZUD 2;  2CJO A;  3AE9 B;  1FRR A;  4YT0 B;  4HRO A;  3B2F A;  1RYJ A;  1J7B A;  3KWL A;  1QOG A;  1CZP A;  2ACZ B;  2H89 B;  2M19 A;  2W3S A;  1KRH A;  5MPO A;  3L4P A;  1E10 A;  3W5U B;  1FMA D;  2BS3 B;  4C7Y A;  1UWM A;  5C2T B;  1L6V A;  1E9M A; 
#chains in the Genus database with same CATH topology
 2E3T A;  1Z5S B;  4NAM A;  4JGH B;  1XXG A;  2FCM A;  2Z0E B;  4ARI A;  4NQK E;  2IBI B;  3L16 A;  2L52 A;  2LHD A;  3GP7 A;  3DVG X;  3U30 A;  2Z0D B;  4PS8 A;  2LJ5 A;  1YX6 B;  4XWT A;  4S17 A;  2J7Q B;  3Q8C A;  4ICV A;  2LZ6 A;  3TEW A;  1U4A A;  3WCQ A;  1AAR A;  2WXG A;  2L05 A;  3DWG C;  3JSV A;  2IO0 B;  2ZCB A;  3VHT C;  4RF1 A;  2JWU A;  2CU3 A;  2DWQ A;  1D4B A;  4MGY E;  3CST A;  3NZU A;  4FHJ A;  1F2R I;  2KC1 A;  1SE4 A;  1IUE A;  3DOW A;  4PK1 A;  1UEL A;  4ZRI A;  2G4S A;  2KTR A;  1XCT L;  1WI0 A;  4DXF A;  2C7H A;  4IDI A;  1KLU D;  1L0X B;  1P7E A;  3A9J B;  1E8Y A;  5H92 C;  4OVV A;  3ZTD A;  3FC4 A;  3VRB B;  2N9K A;  4LLG M;  2K8B A;  3DWM A;  3DBH I;  2WXK A;  4LDT B;  4P16 A;  4ZOH C;  2BYF A;  1GG3 A;  1OQY A;  1AWD A;  1PFD A;  3AE9 B;  1UBI A;  4WJP A;  3B1L X;  1K52 A;  1RYJ A;  4LK0 M;  3QIJ A;  2OOB B;  3MC8 A;  3RYT A;  1EF5 A;  3Q8B A;  1ET9 A;  2D11 A;  2L83 A;  4GOC A;  3ML9 A;  4E3C A;  2MBE A;  2ZNV C;  3AE4 B;  2CHZ A;  4A8X C;  1YN3 A;  4AUQ C;  3NHE B;  1XD3 B;  3X0W A;  2IGD A;  1UD7 A;  3AE3 B;  2KWV B;  2NVU I;  1RM6 C;  2NMQ A;  2ON8 A;  3A9K A;  4JL9 A;  4US9 A;  1AYF A;  1JRP A;  2BB5 A;  3QA8 A;  3BK1 A;  1PYW D;  3NVY A;  4F8C B;  4OW0 A;  3QJZ A;  1OQQ A;  2WXR A;  4GDK B;  4AQ7 A;  3E9S A;  4L1B A;  4C80 A;  1V1O A;  2KDI A;  3DVN V;  2XEW A;  1IGC A;  4TV3 A;  1FD6 A;  3BIN A;  5KHO A;  2BYT A;  2QEJ C;  1FO4 A;  1MVK A;  3CF6 E;  4NZL B;  1FFU A;  2A4Z A;  4XC2 A;  3PS6 A;  4MM3 A;  1TIF A;  3LXF A;  3IT4 B;  3V62 A;  1AW7 A;  1QKZ A;  4MAC A;  1V80 A;  3EHV A;  1TKG A;  3B08 A;  4CHK A;  4EZL A;  1IYF A;  4A9A A;  3IHP C;  1I4Q A;  4ZRJ A;  4I6P A;  4ZDV A;  1R4M I;  1P7F A;  4JQW C;  1HXY D;  3Q3N C;  2MHJ A;  1PGA A;  1WFY A;  3NOB A;  2WLB A;  2CJO A;  1G6J A;  4JIO U;  2K6Q A;  2L00 B;  2M19 A;  1E7V A;  2W3S A;  3ML8 A;  4DHZ E;  4ZYN A;  3SD5 A;  1BXT A;  1BT0 A;  1HE8 A;  1WR6 E;  1I4G A;  4AS1 A;  4K1R B;  3CIR B;  2BB6 A;  3PLU A;  2CJN A;  4P6V F;  2RDB C;  3CWI A;  2RDG A;  2KX3 A;  1GAQ B;  3RNA C;  1UF0 A;  3Q3J A;  4B9K A;  2LVO A;  5IA7 A;  2L0F A;  4K7W A;  1HTQ A;  4PS7 A;  3RZW C;  2GOW A;  1SGH A;  4W9C A;  1YJ1 A;  4CQN A;  2DYO A;  1A70 A;  4MGZ E;  5TR5 A;  3DBL I;  1WGY A;  2KTR B;  3VXW A;  2L76 A;  3EUB 2;  2RD0 A;  3BK2 A;  3NVV A;  2K5P A;  4HLE A;  2XNA C;  3LDZ E;  2L1A A;  4I6N B;  1HQR D;  5EE3 A;  1F2R C;  1WGD A;  3AN1 A;  2CU1 A;  1L5P A;  1QZE A;  4MH0 E;  3NZS A;  4A90 A;  4GSW A;  1WWT A;  2JZZ A;  2MX2 A;  1I7H A;  2LFI A;  2K0P A;  3N1Y C;  4IM0 A;  3ZJT A;  3R2I A;  2LVP A;  1YJJ A;  4WAA A;  5LNK 1;  1I4P A;  5EE0 A;  3GE3 C;  4TSS A;  2V4I B;  4YXD B;  2IO2 B;  1LXD A;  1B1Z A;  2RGF A;  1MFW A;  1R4N B;  5L83 A;  4W9H A;  1NI3 A;  2LRU A;  3AV8 A;  2LGD A;  3H7S A;  4OVU A;  2KD0 A;  3GZN B;  2WDV B;  1JRU A;  1C76 A;  4W9I A;  2ZW1 A;  3AED B;  4FJV B;  3I63 C;  4IM2 A;  3N3K B;  2J0M A;  5BO4 B;  2JUO A;  4O1N A;  3GZN I;  4TQ0 A;  1QOG A;  4B6W A;  1EM7 A;  4MH8 A;  3UI3 A;  1K51 A;  2GBR A;  2PE6 B;  1UWM A;  4BVU C;  4LDT D;  4GDL B;  1VJK A;  4IM3 A;  1EWY C;  1FM0 D;  2KWU B;  4OZC A;  3DCG A;  1XF5 L;  4IG7 B;  3HM3 A;  3AEG B;  4HCP B;  4ASW C;  2YEP F;  1JML A;  2BKF A;  3RT3 B;  3ZYY X;  3U4E G;  1LGR A;  3AU4 A;  2K8H A;  1GC7 A;  3GOE A;  2L8J A;  1L0V B;  2ASQ A;  2PE9 A;  4AP4 C;  5LLI A;  3ZDT A;  2W3R A;  2BS2 B;  3R7R A;  4L2Y A;  4WJN A;  3I5J C;  4KDL B;  1WSP A;  3WAP A;  3L0W B;  2JX5 A;  1I42 A;  1XT9 B;  2M17 A;  2MJD A;  3APD A;  4RNA A;  3PZD A;  4US8 A;  2KOX A;  4WQO B;  1ZGU B;  2Z59 B;  1R4M B;  4HKZ E;  4H2A A;  1UGM A;  1VZ6 A;  2MJE A;  4DHJ B;  4AOF A;  5AZH A;  1NEK B;  2ZPY A;  1QOF A;  4YSY B;  2KO3 A;  1J8C A;  5AZG A;  1EU3 A;  1WXQ A;  5D2M B;  4C00 A;  1P9D U;  1YIW A;  1T0S C;  2AQ2 B;  3NG0 A;  1V1P A;  3BII D;  2Q5W D;  3DVG Y;  1FNW A;  1V5T A;  2JXX A;  4GU2 A;  2BWF A;  3K9O B;  3IFW B;  5C23 A;  1RAX A;  1TGZ B;  3N1X C;  2DNF A;  3P4R B;  4XX5 A;  3JW0 X;  2N1W A;  4RGO S;  1XCQ L;  3PV1 A;  4E71 A;  1ACC A;  2BVC A;  1RRB A;  5EDS A;  1GUA B;  1PUT A;  1TS5 A;  2N7J A;  2W9N A;  2M4N A;  2SAK A;  2KFK A;  2RSU A;  1HTO A;  2BS3 B;  3P2B A;  4GB9 A;  4RM8 A;  3KUD B;  1L6V A;  2DAJ A;  2PIA A;  4WWP A;  1XLN A;  5EE9 A;  1MHH E;  2DZI A;  2BTE A;  4EE2 A;  4ZRP A;  2O6V A;  4ZHP A;  1I4R A;  2WS3 B;  3QAQ A;  4DK5 A;  2RPV A;  4BKS A;  2GLS A;  3QCA A;  3PVL A;  1N5W A;  2BQQ A;  2C60 A;  2KNB A;  2LJI A;  4C56 C;  1HEZ E;  4MEM A;  2KDM A;  3NVZ A;  2N9L A;  2NS5 A;  2WX1 A;  3Q8A A;  2M1M A;  3UF8 A;  3PT2 B;  1DOX A;  1WRI A;  2M0X A;  3UQB A;  3N32 A;  2PJH A;  1WZ3 A;  4RGM A;  4YSX B;  2IPK D;  3AEA B;  5I4D A;  4LNK A;  3TEZ A;  2AQ1 B;  2G1E A;  3AE7 B;  3S2A A;  3AXC A;  3AM9 A;  1C4P A;  3VUY A;  3QWZ B;  3HVZ A;  1V2Y A;  1ZXI A;  1E7P B;  5JXV A;  1F9J A;  2KWC A;  2A5U A;  1N60 A;  2MP2 B;  3PRP B;  4YTN B;  3RFZ B;  2G45 B;  2KFJ A;  2HTH A;  4KGT A;  3P1M A;  2QC8 A;  4LNO A;  4KX6 B;  3SU8 X;  2FCS A;  3IT6 B;  3KWV A;  5L95 C;  3DHI C;  5BMG A;  4HCN B;  2BT6 A;  2RR9 A;  4M8N A;  1NDD A;  4RH6 A;  1A5R A;  1F77 A;  3T9L A;  4PYU A;  1SIF A;  3ZGZ A;  4HRO A;  2WXM A;  2H89 B;  1KLG D;  2XN9 C;  3OAW A;  5T8I A;  2BYE A;  4BBN C;  2ZCC A;  2FAZ A;  5FR6 A;  2UYZ B;  1WZ0 A;  5D6J B;  1WJ6 A;  2IJ0 A;  2G9H D;  4KIK A;  2W82 A;  1WX7 A;  2N9X A;  4B0M A;  4NY0 A;  3KYC D;  4HDQ A;  1F52 A;  1SJE D;  5HI1 A;  4ZRQ A;  2IY0 B;  1VLB A;  2J4X A;  3R7Q A;  4KSK C;  4PT5 A;  1Q10 A;  1Y56 A;  2EKI A;  4HJK A;  3FKY A;  2V3S A;  4R3D A;  1Q0W B;  1EF1 A;  4ITK A;  2WU2 B;  4KKI A;  4DHZ B;  1NVI D;  1T3Q A;  4G50 A;  5J17 A;  2WXF A;  4BAX A;  1OFF A;  2WXP A;  5AUI A;  2KYW A;  4MGK E;  2B3A A;  2Y5C A;  1VZ7 A;  3AE5 B;  1T6B X;  4GLS C;  1FFV A;  1HZ6 A;  5FR3 A;  2MA9 B;  2BKR B;  4RF0 A;  3V61 A;  1DOI A;  4CYE A;  1SIJ A;  3AU5 A;  4HVB A;  2PVO D;  5BYR A;  2PVG C;  4K7U A;  1ET6 A;  3Q3M C;  2BWE S;  3PTF C;  2D3A A;  2ZEQ A;  3E56 A;  2I1J A;  1R7S A;  1SXT A;  4HEA 1;  1V1P B;  2LHE A;  4ANV A;  1KOT A;  2M8S A;  4E74 A;  5IN7 A;  4I6L B;  2HJ8 A;  2L3Z A;  2KKC A;  2MSE D;  3VAW A;  2WYQ A;  2BW2 A;  2KQS A;  2NPT B;  2OHF A;  2QJL A;  4ICU A;  4W9F A;  1UUP A;  2FUG 1;  4IWQ A;  3NZ3 A;  1YMH E;  3VH4 B;  1KLV A;  1WM3 A;  5IKC M;  4MJS B;  4AJW A;  1NEN B;  3H7P B;  4GDK A;  2AX5 A;  3PPA A;  4MJS A;  4RGN A;  3X23 A;  3DHG C;  4URK A;  1GJZ A;  3VH3 B;  1VCB A;  2KMA A;  3UQA A;  2WGS A;  2FBW B;  2VRR B;  4D2K A;  2OJW A;  3QC8 B;  1KF6 B;  5G5H A;  2MWS B;  4W9G A;  1BML C;  4C4V B;  1WXV A;  2JT4 B;  1D5Z C;  1LM8 B;  2FE8 A;  2MBO A;  2OJR A;  1I4X A;  3KUC B;  3W5V B;  3M95 A;  2IY1 B;  4BKS D;  1V97 A;  1V8C A;  1ZE3 D;  5AZF A;  1WGR A;  3ZO5 B;  3ZQ4 A;  3BVM A;  1B9R A;  3ZNH B;  2JXT A;  5AUK A;  4F7Z A;  3A33 B;  2LMC A;  4KSL C;  3NY5 A;  4XYC A;  1SBB B;  1V86 A;  2JF5 A;  4ANW A;  3HRD D;  4J3O D;  2BBC A;  3AEB B;  1EO6 A;  3DDC B;  3Q8E A;  4XE0 A;  3OJ4 B;  1TS2 A;  4G11 A;  3JSV B;  3RZF A;  1ISN A;  3V6C B;  1GNU A;  3WAO A;  2RMM A;  4GN1 A;  2PLP A;  3VTW A;  2KTF A;  3RNC C;  4P1C C;  4Q2J A;  1FXT B;  2KDB A;  3ZVV A;  4BBN F;  3QX1 A;  3GB1 A;  2EMS A;  3B0A A;  5E6P A;  2IND C;  5CHV C;  5G2N A;  1E10 A;  1PQS A;  1WGG A;  2R2O A;  2WXI A;  1KJT A;  4XDC A;  2JU6 X;  3HK0 A;  4BOS C;  2KC2 A;  1E0Z A;  4ZRK A;  2RDH A;  2KHW B;  4FAD A;  1L6U A;  2KT7 A;  3RNG C;  3N20 C;  1IBX A;  1C1Y B;  4A55 A;  1SE3 A;  4AWJ A;  2H88 B;  2Y3A A;  1IBX B;  4OZB A;  3ZTC A;  2PMV A;  4IWO A;  3A1Q A;  2WHI A;  4FHK A;  1EUV B;  3VTV A;  2DBY A;  1YNT E;  2LRW A;  3PLV A;  2KX0 A;  1VDV A;  1SB3 C;  3L17 A;  2INP E;  3PHW B;  2MQJ A;  4WWN A;  3MHS D;  4DXA B;  1N6Z A;  4KGS A;  1CK1 A;  3V6E B;  2LWP A;  1PGB A;  4M0W A;  5HG2 A;  2L0T A;  2LXC A;  4KKJ A;  4YSZ B;  4ARC A;  3ZKJ C;  3TIX A;  4KDI C;  2ZW0 A;  1J0G A;  5IAA C;  4ZYS A;  1CQV A;  4DXG A;  3ECI A;  4BOZ B;  5GMV A;  3W2D A;  1Z2M A;  2K25 A;  1TBE A;  3P4Q B;  2DLB A;  3R66 C;  3KQ4 A;  1L4D B;  2O2V B;  1WRD B;  3HHM A;  1TS3 A;  1T0R C;  3HVD A;  2FCN A;  3TBL D;  2KVZ A;  3Q3F A;  1P1A A;  5DPR A;  2VZK D;  4M00 A;  3VFK A;  1J7C A;  3H6N A;  5C1Z A;  1UNS A;  2JRI B;  2EMT A;  3ZUN A;  5MPO A;  2V1Y A;  2WXN A;  4PYZ A;  1T0Q C;  1E9M A;  1P98 A;  4MGI E;  4EOY A;  4XGA B;  3ZRC A;  3DBR I;  5FKA C;  4MSM B;  2D3C A;  2I38 A;  3KLS X;  4YWG G;  3ZRF A;  3SFD B;  5J18 A;  1JQ4 A;  4TKN A;  3U8Z A;  3RNB C;  4W9L A;  4GDL A;  2BPS A;  2ZNV B;  2ZVN A;  2L32 A;  1TT5 B;  3SFE B;  4JWS C;  3VUW A;  1L4Z B;  1JWS D;  2QIE B;  1K8R B;  3W9C B;  3P4P B;  2WDR B;  2WXQ A;  5H8Y E;  1KH0 A;  1ZDV A;  2KDF B;  3DPD A;  3I3T B;  2JRH A;  3IXS A;  3JVZ X;  5E6O A;  2K1F A;  2MBH A;  3OLM D;  4HRS A;  5D3I B;  2Y5P A;  3NS1 A;  1E8W A;  1UGJ A;  3BVG A;  2HJ1 A;  4G3X B;  2KVR A;  2LGS A;  3OWE B;  2XBB C;  3T3N A;  4RM9 A;  3PGE A;  2WQY B;  3A4R A;  1ENF A;  1SF0 A;  5D3D A;  3KW5 B;  3N30 A;  1WJN A;  1WH3 A;  4IKG A;  3Q14 C;  2MJ3 A;  3A1Q B;  4QAY A;  2DZM A;  3N1Z C;  1SJH D;  2INN E;  3ZXR A;  2V9H A;  2N0S B;  3KUZ A;  3PSE B;  2N9P C;  4NPN A;  5IOI A;  4IOI E;  4W9D A;  3B2F A;  1J7B A;  1IPG A;  1TY0 A;  1KRH A;  4IWP A;  3Q3O C;  1FMA D;  1LO5 D;  4K3C A;  1TKE A;  5E6N A;  1DOY A;  1TY2 A;  1V81 A;  2G4D B;  3QK0 A;  2KZR A;  3B9J A;  2GBK A;  3IAM 1;  1J19 A;  3W1Y A;  1GOZ A;  2M0A A;  2LUM A;  1WM2 A;  2OED A;  3AMZ A;  3EEC A;  1E6E B;  1LFD A;  2J53 A;  3PHX B;  5JHB A;  1WGK A;  2IGG A;  2JZP A;  1XO3 A;  3L10 B;  1E8X A;  4A6Q A;  3WAM A;  2D07 B;  1TJE A;  2KN5 A;  5DPS A;  1C77 A;  4HWI B;  2WP9 B;  3P4S B;  1V9J A;  3AB5 A;  3IVF A;  3DBS A;  5DPT A;  2ICI A;  1OTR B;  2PPH A;  3ALB A;  2JZ3 B;  4FA6 A;  4XWW A;  3I9V 1;  3IBE A;  1ZOY B;  2C9W B;  5CHW A;  2YLM A;  1NYQ A;  3ENE A;  2REX A;  3EGR A;  3TMP B;  4S0R A;  3AI5 A;  1MI0 A;  2V3N A;  1NBF C;  5AEK B;  4W9J A;  2FIF A;  2GI9 A;  4C7Z A;  2DYB A;  5BYS A;  3EFC A;  5GXG B;  3ZW3 A;  3RN9 C;  3M3J A;  3RMK C;  3UIN B;  3VQI A;  3Q69 A;  1CZP A;  2CR5 A;  1WX9 A;  4L23 A;  2KXJ A;  3W5U B;  5C2T B;  4LNN A;  2MBQ A;  1CMX B;  5G5G A;  1C3T A;  5EE1 A;  3OJ3 A;  4IUM B;  4BKG A;  5JH5 C;  3VR8 B;  1WIA A;  3ZJV A;  4G0N B;  4RCO A;  4USA A;  1RFK A;  2QMT A;  3VTU A;  2E6X A;  4P7I A;  1FNU A;  3RNE C;  1YQ4 B;  4LCD E;  2DEN B;  4HJG E;  2ZZP B;  1DYQ A;  1WGH A;  2FID A;  3RD2 A;  1WYW B;  1L0Y B;  1WYG A;  3RUL A;  3WAL A;  3EA6 A;  2K3U A;  3CSF A;  5DPW A;  1NYR A;  4DWF A;  3URY A;  1FNV A;  1EWC A;  2KQ7 A;  4M02 A;  2LI5 A;  2EEL A;  5FK9 C;  2V3P A;  4KZ0 A;  3O65 B;  3MC9 A;  4BFR A;  2WXJ A;  4JPS A;  1MJD A;  2R61 A;  3U7Z A;  1QOB A;  4N59 A;  1FRD A;  3Q6B A;  3VRA B;  4WWM A;  2X8X X;  4FJY A;  4A3O A;  3MFG A;  1L2N A;  2PEA A;  2WXO A;  5JHA A;  2B76 B;  1TYG B;  3SDL C;  4NJ6 A;  2N1V A;  2KFK B;  2VH1 A;  1Q1O A;  3AE1 B;  2C7M B;  3ZIM A;  4DDG D;  1TZO A;  4RFB A;  3BVZ A;  3U52 E;  1CJE A;  1VD2 A;  2IO1 B;  3DBL B;  2LXA A;  3DVN U;  2KDE B;  4HKQ A;  4XDD A;  2GBM A;  1S3S G;  1HZ5 A;  2XK5 A;  4YT0 B;  1WE6 A;  1PGX A;  3P42 A;  1FCC C;  4WAF A;  5BYQ A;  4EZJ A;  1WF9 A;  2CHX A;  3ABV B;  2GBJ A;  3A9J A;  5BMH A;  1F0Z A;  1ZXH A;  3T3O A;  5CHF A;  4M01 A;  1D5M C;  1XLO A;  1GB4 A;  1T5X D;  1WE7 A;  2IO3 B;  4K81 A;  3W1S A;  4WUR A;  3R8B A;  2KK8 A;  3DQV A;  3L13 A;  1YN5 A;  3PRE A;  3QAR A;  2K6D B;  1XEE A;  3DHH C;  3P63 A;  1H4R A;  3AH7 A;  1GPX A;  1FXI A;  4FLH A;  3GE8 C;  4OVZ A;  4KIK B;  4MSQ B;  2LGI A;  3V3X A;  4W9E A;  4B95 A;  1T0Y A;  2JVC A;  2BS4 B;  4WJO A;  5G55 A;  3RCZ A;  1XQQ A;  4WIP A;  4GMV A;  3MTN B;  4J6I A;  1PDX A;  2MP2 A;  5J2R A;  3JYU A;  1C79 A;  1GB1 A;  3WIM A;  2K22 A;  3NJT A;  2YEP B;  4KVG B;  1S1Q B;  1WJ4 A;  3BYY B;  2HE7 A;  1V6E A;  4DBG A;  4IC7 B;  2DYM A;  1TS4 A;  1N62 A;  4HK2 A;  1N61 A;  2QHO A;  4MDK E;  2W54 A;  2SEB D;  2ZPN A;  3TEY A;  3UGB B;  4FJZ A;  3TL5 A;  2MW5 A;  5DCN A;  1RLF A;  5HKH A;  3NRZ A;  1MHX A;  3HM6 X;  3NVW A;  1YX5 B;  1M94 A;  2NPT A;  3U2S C;  2DAF A;  3SHQ A;  3TEX A;  4JWU C;  1JWB D;  2INC C;  1F1H A;  2MRP A;  1KTK A;  1JCK B;  5E6J A;  2BYV E;  2JQR B;  3M62 B;  4LNI A;  2VH2 A;  2WXH A;  3NUH B;  3PRM B;  3NS8 A;  4TUU A;  4LJO B;  1C78 A;  2J0J A;  3AE6 B;  3J9C A;  2KAJ A;  4F1S A;  2WNM A;  4JX1 C;  3H9D A;  4EZK A;  2AEH A;  2JSV X;  4A20 A;  1ZKH A;  2AL6 A;  2GRI A;  3B2G A;  2NBU A;  3TUO A;  3RPF C;  1TKY A;  3AE8 B;  3V05 A;  1YJI A;  2HTM E;  3L08 A;  2KLG A;  2IYD B;  2EKE C;  4MT5 A;  4NNJ B;  4KZC A;  2BGF A;  2KAC A;  3FIL A;  1SSN A;  2AQ3 B;  3VUX A;  2LGX A;  3RI7 C;  1ZW7 A;  2PTL A;  3T8M A;  3VVW B;  4EUT A;  2QCZ A;  1FPY A;  3LYY A;  1JW9 D;  4ANU A;  4LJP B;  4YL8 A;  1YQ3 B;  3KH0 A;  2LVQ A;  5C3J B;  4P1B C;  1JWU D;  2N7E A;  4BKT A;  3AEC B;  4NAW B;  3ETR A;  2LEK A;  1NI2 A;  1V49 A;  5CTR C;  4W9K A;  3PO0 A;  1M4V A;  2IGH A;  2GMI C;  3DBH B;  2I2Y A;  2MCN B;  4DHJ D;  3R3M A;  3C0R B;  4OZA A;  2WDQ B;  4KGR A;  1WY8 A;  2C5L C;  2DX5 B;  1AN8 A;  5KHQ A;  2KJH B;  1YQB A;  1QF6 A;  1JRO A;  1KM7 A;  4UDU C;  1MG4 A;  2KLC A;  4REZ A;  2WX0 A;  3R2T A;  3LB8 C;  1E8Z A;  4WH4 A;  2JY6 A;  3Q8F A;  2AWT A;  2N4F A;  1UZX B;  3MJ5 A;  1L7Y A;  2O2V A;  3LJ3 A;  2KMM A;  4TQ1 A;  2Y5B B;  4EKU A;  1ROE A;  2QIL A;  1YN4 A;  1D5X C;  4NAW A;  2KJ6 A;  3ZLZ A;  1IGD A;  1N5X A;  2DZK A;  4MEL A;  3A4S C;  1HA5 A;  2KMC A;  1XLP A;  3QQ8 B;  3V60 A;  3H1U A;  5BMI A;  4N6E B;  1OGW A;  2M56 B;  2N7D A;  2IZV B;  1VRA B;  5CX3 A;  1JWA D;  1ZP0 B;  2JWZ A;  3AEE B;  1N63 A;  4C4V A;  4BZA A;  3MHZ A;  1E5W A;  4XZ4 A;  1WX8 A;  4FXC A;  2X38 A;  4LTU A;  2D10 A;  1LQB A;  1QQR A;  2FNJ B;  2R2Q A;  4II3 B;  3BWU D;  3AEF B;  2GB1 A;  1I4H A;  2CS4 A;  4OHJ A;  4K3B A;  1X1M A;  3CMM B;  2LGY A;  4GIV A;  2NTT A;  3U7D A;  1VZ8 A;  1Y8R C;  1RFA A;  2K39 A;  4RMA A;  4X57 B;  2K9X A;  4HDO A;  3DBR B;  2J42 A;  1EU4 A;  2KAN A;  3ZNI D;  3D32 A;  3H7P A;  3APC A;  1P0R A;  1FIQ A;  1MPE A;  3AUL A;  5IO9 A;  4CO7 A;  3I57 A;  2KQ4 X;  5IP4 D;  2WXL A;  2CKH B;  5D7G A;  1VR9 A;  2UWQ A;  4HPP A;  1WJU A;  1WMH A;  2DZJ A;  5HHD G;  1FCL A;  4C7Y A;  1WMH B;  2HD5 B;  2O6V B;  4DDI D;  1ESF A;  4JLC A;  4FUL A;  3TCA A;  2LAS A;  3ZNG C;  3QHT A;  1D3Z A;  3A9K B;  2NCN A;  1R4N I;  1ZPS A;  1RWS A;  1P3Q U;  3ZNZ B;  3IG3 A;  4JE3 B;  2ZVO A;  2AYO B;  1UH6 A;  1OQR A;  1JWM D;  3RNF C;  1BUI C;  2NBV B;  4GGQ A;  5LXI B;  5TSS A;  2PW9 A;  4N58 A;  1WXA A;  3MJW A;  2YVC A;  2FUH B;  4IW0 A;  3W1S C;  2WDT B;  3BYT B;  4TMA B;  1SEB D;  1STE A;  2G3Q B;  2AL3 A;  1C9F A;  4WWO A;  2Z8L A;  4FBJ B;  3EFU A;  2KN4 A;  3PZ8 A;  1UWX A;  3ZXV A;  3H8H A;  1YOV B;  2I1K A;  3FIL B;  2C7N B;  1FXA A;  2UU7 A;  3L54 A;  3SR6 A;  3AE2 B;  5D94 A;  2KWD A;  4M0W B;  2VZK B;  3C8Y A;  2D3G A;  2QSD A;  3VDZ A;  4EEW A;  4II2 B;  1J7A A;  2N9E B;  1KFY B;  2XK5 B;  3BY4 B;  3HUI A;  3C19 A;  4PS3 A;  1QIL A;  2PKO A;  3SEB A;  3MC0 B;  1E90 A;  3IAS 1;  3KVF B;  1Q5W B;  2W55 A;  1K50 A;  2BF8 B;  1YD8 U;  2O6V D;  1SE9 A;  1OEY A;  4DQO C;  4GXB A;  1WXS A;  2HDE A;  4HPM B;  3ONS A;  3HIZ A;  1C4A A;  1ZUD 2;  2FCQ A;  1FRR A;  3UIO B;  4RGT A;  4ACF A;  1TTN A;  2LUE A;  1E7U A;  3M63 B;  2WU5 B;  2ZJD A;  3WA0 A;  3OG5 A;  1H8C A;  4AJY B;  1OEY J;  4HPL B;  4A3P A;  4EFO A;  4M8M A;  4N9F 4;  3APF A;  3KYD D;  2D5G A;  3BZD B;  1JAL A;  1FEH A;  2MBB B;  4MM3 B;  4LNF A;  1QLB B;  4ZHO A;  4NJ7 A;  2GBN A;  4YTM B;  5LXH A;  2RPQ A;  2K8C A;  2J0K A;  3TJP A;  3N9Y C;  3UIP B;  2V0G A;  1XLQ A;  3ZDM C;  3EC8 A;  2MLB A;  3PRZ A;  5HFY A;  1QT9 A;  2NR2 A;  2ONQ A;  4HXD A;  1UBQ A;  2JPH A;  1QOA A;  1K53 A;  1WXM A;  2NBW B;  4ANX A;  2D3B A;  2QDF A;  1TZ1 A;  4WQM A;  1D6E C;  1WR1 A;  3FAH A;  2IDY A;  1MG8 A;  3VR9 B;  1V5O A;  1I35 A;  4KV2 A;  2J52 A;  2DHZ A;  2LD9 A;  4YTP B;  4NJC A;  1DGJ A;  3MP9 A;  2MEK A;  3GS2 A;  2WWZ A;  3Q2A C;  3WAN A;  2D2Q A;  5JZE B;  1SE2 A;  3PZ7 A;  4NQL B;  1C4C A;  1GC6 A;  4WJQ A;  2CHW A;  2JYT A;  3K9P B;  2KJR A;  1ZDX A;  4B0E A;  3O13 A;  2MH7 A;  3RUI B;  2TSS A;  4FN2 A;  3KWL A;  2ACZ B;  4K7S A;  3ZJU A;  3TSS A;  2L7R A;  1IP9 A;  3L4P A;  2V4L A;  2JYE A;  2NTS A; 
#chains in the Genus database with same CATH homology
 3AE6 B;  2E3T A;  3J9C A;  2KAJ A;  2PIA A;  1XLN A;  4NAM A;  5EE9 A;  1MHH E;  1XXG A;  4ARI A;  2WNM A;  4EE2 A;  2BTE A;  4JX1 C;  4ZRP A;  4ZHP A;  2JSV X;  2L52 A;  1I4R A;  2LHD A;  2GRI A;  2WS3 B;  3B2G A;  5FKA C;  2RPV A;  2I38 A;  3GP7 A;  3KLS X;  3TUO A;  3RPF C;  1TKY A;  4YWG G;  3AE8 B;  3V05 A;  3SFD B;  1YJI A;  1JQ4 A;  2HTM E;  1N5W A;  4XWT A;  2LJI A;  4C56 C;  1HEZ E;  4MT5 A;  3Q8C A;  3TEW A;  2L32 A;  3WCQ A;  2KAC A;  3FIL A;  1SSN A;  2KDM A;  3NVZ A;  3SFE B;  4JWS C;  2AQ3 B;  1L4Z B;  1JWS D;  2N9L A;  2QIE B;  2WXG A;  3Q8A A;  3W9C B;  3DWG C;  1DOX A;  1WRI A;  3P4P B;  2WDR B;  2WXQ A;  2PTL A;  5H8Y E;  1KH0 A;  1ZDV A;  4RF1 A;  2JWU A;  2CU3 A;  2DWQ A;  1D4B A;  3LYY A;  1JW9 D;  4RGM A;  4YSX B;  1YQ3 B;  2IPK D;  3IXS A;  1F2R I;  5C3J B;  3AEA B;  1JWU D;  4HRS A;  5D3I B;  5I4D A;  3AEC B;  4NAW B;  2Y5P A;  1SE4 A;  1IUE A;  2AQ1 B;  3ETR A;  3TEZ A;  3NS1 A;  2G1E A;  3AE7 B;  2LEK A;  3AM9 A;  1C4P A;  1UGJ A;  3BVG A;  1XCT L;  4DXF A;  3HVZ A;  3PO0 A;  1ZXI A;  1E7P B;  5JXV A;  1M4V A;  2IGH A;  3OWE B;  1N60 A;  3T3N A;  4YTN B;  3RFZ B;  2WQY B;  4KGT A;  4IDI A;  3P1M A;  2I2Y A;  1KLU D;  1L0X B;  1P7E A;  4OZA A;  2WDQ B;  1ENF A;  4KGR A;  5H92 C;  1SF0 A;  4KX6 B;  5D3D A;  1AN8 A;  3FC4 A;  3VRB B;  2N9K A;  3IT6 B;  4IKG A;  3DWM A;  3KWV A;  1JRO A;  4LLG M;  1QF6 A;  2MJ3 A;  4UDU C;  5BMG A;  2WXK A;  4REZ A;  2BT6 A;  4P16 A;  1SJH D;  4ZOH C;  2INN E;  3R2T A;  3LB8 C;  2N0S B;  4RH6 A;  1AWD A;  1F77 A;  4WH4 A;  4IOI E;  1PFD A;  3Q8F A;  3AE9 B;  3ZGZ A;  4HRO A;  3B2F A;  1K52 A;  1J7B A;  1RYJ A;  2H89 B;  2WXM A;  3MJ5 A;  1KLG D;  4LK0 M;  1TY0 A;  1KRH A;  2XN9 C;  5T8I A;  1FMA D;  3Q8B A;  2KMM A;  4TQ1 A;  1ET9 A;  1ROE A;  2L83 A;  2QIL A;  1LO5 D;  1YN4 A;  1D5X C;  1TKE A;  2IJ0 A;  2G9H D;  2W82 A;  1DOY A;  3AE4 B;  1IGD A;  1TY2 A;  1N5X A;  4B0M A;  4A8X C;  1YN3 A;  1SJE D;  1HA5 A;  3B9J A;  4ZRQ A;  5HI1 A;  3IAM 1;  2IGD A;  1VLB A;  2J4X A;  3AE3 B;  1XLP A;  4PT5 A;  1GOZ A;  1RM6 C;  2NMQ A;  2ON8 A;  5BMI A;  1Q10 A;  1Y56 A;  2EKI A;  4N6E B;  2M0A A;  2LUM A;  2M56 B;  4R3D A;  2OED A;  4US9 A;  1AYF A;  3AMZ A;  1JRP A;  2BB5 A;  3BK1 A;  4ITK A;  1PYW D;  1E6E B;  3NVY A;  2WU2 B;  2J53 A;  4KKI A;  1VRA B;  1NVI D;  1WGK A;  2IGG A;  1JWA D;  2JZP A;  1XO3 A;  1ZP0 B;  3AEE B;  1T3Q A;  1N63 A;  3MHZ A;  2WXF A;  1OFF A;  4A6Q A;  4OW0 A;  2WXP A;  4GDK B;  1OQQ A;  2WXR A;  5AUI A;  4AQ7 A;  4FXC A;  3E9S A;  4L1B A;  4C80 A;  1TJE A;  2X38 A;  4LTU A;  1QQR A;  1V1O A;  2Y5C A;  1VZ7 A;  3BWU D;  3AE5 B;  1C77 A;  1IGC A;  3AEF B;  2GB1 A;  1T6B X;  1I4H A;  2WP9 B;  3P4S B;  1FD6 A;  3AB5 A;  4GLS C;  4OHJ A;  1FFV A;  1HZ6 A;  2BYT A;  5FR3 A;  2QEJ C;  2ICI A;  1MVK A;  1FO4 A;  4RF0 A;  1DOI A;  4NZL B;  2NTT A;  1VZ8 A;  1FFU A;  4XWW A;  1SIJ A;  3I9V 1;  1ZOY B;  3LXF A;  2PVO D;  3IT4 B;  1AW7 A;  1QKZ A;  2PVG C;  1ET6 A;  1NYQ A;  4MAC A;  5BYR A;  2K9X A;  1TKG A;  3E56 A;  3EGR A;  1R7S A;  1SXT A;  2J42 A;  1EU4 A;  4HEA 1;  1V1P B;  4A9A A;  2LHE A;  1MI0 A;  1I4Q A;  2V3N A;  1FIQ A;  1MPE A;  2GI9 A;  4C7Z A;  1P7F A;  5BYS A;  1HXY D;  3I57 A;  2BW2 A;  5GXG B;  2KQ4 X;  2OHF A;  2QJL A;  2WXL A;  5D7G A;  1PGA A;  1VR9 A;  2WLB A;  2CJO A;  1UUP A;  2FUG 1;  3VQI A;  3NZ3 A;  3Q69 A;  1CZP A;  2M19 A;  4L23 A;  1YMH E;  2W3S A;  5HHD G;  1FCL A;  3W5U B;  4C7Y A;  1BXT A;  5C2T B;  1ESF A;  5G5G A;  1I4G A;  1NEN B;  4AS1 A;  5EE1 A;  2AX5 A;  3CIR B;  2BB6 A;  4RGN A;  2CJN A;  4P6V F;  3CWI A;  2RDG A;  1GAQ B;  3VR8 B;  3ZJV A;  1ZPS A;  4RCO A;  1RWS A;  4USA A;  1RFK A;  2QMT A;  2E6X A;  1FNU A;  1YQ4 B;  2FBW B;  4JE3 B;  4D2K A;  1KF6 B;  5G5H A;  4CQN A;  2DYO A;  1A70 A;  4HJG E;  1BML C;  1DYQ A;  1OQR A;  3EUB 2;  1D5Z C;  3BK2 A;  2FE8 A;  3NVV A;  2K5P A;  1JWM D;  1BUI C;  5TSS A;  2PW9 A;  4N58 A;  1L0Y B;  1WYG A;  1I4X A;  2XNA C;  3W5V B;  3EA6 A;  2K3U A;  2L1A A;  1HQR D;  5EE3 A;  1F2R C;  3BYT B;  1SEB D;  3AN1 A;  4TMA B;  1STE A;  1V97 A;  1V8C A;  1ZE3 D;  1L5P A;  1NYR A;  1C9F A;  3ZQ4 A;  2Z8L A;  3URY A;  3BVM A;  1B9R A;  4A90 A;  1FNV A;  1EWC A;  1WWT A;  2JXT A;  5AUK A;  2EEL A;  2LMC A;  2KN4 A;  5FK9 C;  2V3P A;  3PZ8 A;  1UWX A;  1SBB B;  1I7H A;  2LFI A;  3H8H A;  2K0P A;  2WXJ A;  3FIL B;  3HRD D;  4J3O D;  2BBC A;  4JPS A;  2R61 A;  3U7Z A;  3AEB B;  1QOB A;  1FXA A;  4N59 A;  3ZJT A;  3R2I A;  3SR6 A;  3Q8E A;  3AE2 B;  4XE0 A;  1FRD A;  2KWD A;  3VRA B;  1TS2 A;  4WWM A;  2VZK B;  1YJJ A;  3C8Y A;  5LNK 1;  1I4P A;  3MFG A;  2QSD A;  5EE0 A;  4TSS A;  1J7A A;  1KFY B;  3HUI A;  2WXO A;  2V4I B;  4YXD B;  2B76 B;  1QIL A;  2PKO A;  1B1Z A;  1TYG B;  3SEB A;  3MC0 B;  2RMM A;  2PLP A;  3IAS 1;  2W55 A;  1NI3 A;  3AE1 B;  3AV8 A;  1K50 A;  1TZO A;  4RFB A;  3BVZ A;  3U52 E;  2WDV B;  1C76 A;  2ZW1 A;  4Q2J A;  4DQO C;  3AED B;  1CJE A;  4HKQ A;  2HDE A;  4XDD A;  3GB1 A;  1C4A A;  1ZUD 2;  4O1N A;  1HZ5 A;  1FRR A;  4YT0 B;  4TQ0 A;  1QOG A;  4RGT A;  1EM7 A;  1PGX A;  4MH8 A;  1E10 A;  3UI3 A;  1K51 A;  1UWM A;  4GDL B;  1VJK A;  2WU5 B;  3P42 A;  1FCC C;  4WAF A;  2WXI A;  1EWY C;  1FM0 D;  2JU6 X;  4XDC A;  5BYQ A;  1F0Z A;  3ABV B;  5BMH A;  4OZC A;  1ZXH A;  3T3O A;  1E0Z A;  2D5G A;  1D5M C;  1XF5 L;  2RDH A;  3BZD B;  1XLO A;  1L6U A;  1GB4 A;  1T5X D;  1JAL A;  1FEH A;  3AEG B;  3W1S A;  4WUR A;  2YEP F;  1JML A;  3R8B A;  1IBX A;  4A55 A;  3ZYY X;  1SE3 A;  1YN5 A;  4MM3 B;  3U4E G;  2H88 B;  2Y3A A;  1XEE A;  1IBX B;  1QLB B;  4OZB A;  3P63 A;  4ZHO A;  3AH7 A;  1L0V B;  2PMV A;  1GPX A;  1FXI A;  4YTM B;  2W3R A;  2DBY A;  2BS2 B;  4OVZ A;  4L2Y A;  1YNT E;  2LGI A;  3V3X A;  1VDV A;  1SB3 C;  3N9Y C;  2INP E;  2V0G A;  1WSP A;  2BS4 B;  1XLQ A;  2JX5 A;  4WIP A;  1PDX A;  2MJD A;  4KGS A;  1C79 A;  1CK1 A;  5HFY A;  1QT9 A;  1GB1 A;  4RNA A;  2ONQ A;  1PGB A;  4M0W A;  4US8 A;  2K22 A;  2YEP B;  5HG2 A;  4HKZ E;  2MJE A;  1VZ6 A;  4H2A A;  1QOA A;  1K53 A;  3BYY B;  4KKJ A;  4YSZ B;  4ARC A;  2ZW0 A;  2DYM A;  4ZYS A;  1CQV A;  1TS4 A;  1NEK B;  4WQM A;  4DXG A;  1N62 A;  1QOF A;  4YSY B;  1EU3 A;  1N61 A;  1D6E C;  2W54 A;  1WXQ A;  3FAH A;  3W2D A;  2SEB D;  3TEY A;  2IDY A;  3P4Q B;  2AQ2 B;  2DLB A;  3VR9 B;  3KQ4 A;  1L4D B;  1V1P A;  3BII D;  2Q5W D;  3NRZ A;  1FNW A;  1MHX A;  2J52 A;  3NVW A;  1TS3 A;  3HVD A;  4YTP B;  4NJC A;  1DGJ A;  3MP9 A;  2MEK A;  3GS2 A;  3U2S C;  3TEX A;  4JWU C;  1JWB D;  2VZK D;  3P4R B;  1SE2 A;  3PZ7 A;  1KTK A;  1JCK B;  4RGO S;  1C4C A;  5E6J A;  1XCQ L;  2JYT A;  1ACC A;  2JQR B;  1J7C A;  1ZDX A;  3O13 A;  4B0E A;  2MH7 A;  2WXH A;  1PUT A;  3NUH B;  1TS5 A;  1UNS A;  2TSS A;  2N7J A;  3KWL A;  2ACZ B;  3ZJU A;  2SAK A;  3TSS A;  1C78 A;  5MPO A;  3L4P A;  2BS3 B;  2JYE A;  2NTS A;  2WXN A;  1L6V A;  1E9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...