4HRSA

Crystal structure of h. volcanii small archaeal modifier protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
GRNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ubiquitin-like small archaeal modifier protein 2 from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii ds2
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 2
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hrsA00
4HRSA 1NEKB 1YJIA 5G5GA 2H89B 2M19A 3DWMA 3KWLA 1FFUA 3NRZA 4N6EB 3DWGC 1KFYB 2N0SB 1V8CA 3L4PA 3NVYA 1WGKA 1FIQA 3FAHA 5MPOA 3AEBB 3BIID 1L5PA 3W5VB 1QF6A 1FRDA 1NVID 1RYJA 1N62A 1ZP0B 1FXAA 3AMZA 2KAJA 4C80A 4KX6B 5GXGB 2PVOD 1L6UA 2MJ3A 1OFFA 1QT9A 2WU2B 2MJDA 2K22A 2W3SA 2OHFA 1J7CA 3B2FA 5EE1A 1SB3C 1XLPA 4YSXB 3NS1A 1T3QA 3AH7A 3AB5A 4ZHPA 2BS2B 3LXFA 3AE7B 4IDIA 2FBWB 2HTME 1JRPA 3EUB2 4P6VF 1SF0A 1AYFA 4JWUC 1J7BA 1JALA 2DWQA 5H8YE 1E0ZA 2WQYB 5H92C 1TYGB 2QJLA 1QOFA 5AUKA 2JX5A 4YTNB 2Q5WD 3AV8A 1DGJA 2L83A 4ZHOA 1YQ3B 1IUEA 4HROA 3P4QB 3AEGB 5C3JB 1V97A 1N60A 1XLQA 1NYQA 2M56B 4C7YA 1FXIA 1N63A 3VRAB 3AE2B 1N5XA 1E10A 3P1MA 4USAA 3CIRB 1WWTA 3NVZA 4WWMA 4A9AA 1VDVA 3HRDD 4JX1C 3SFEB 1N61A 1ROEA 1A70A 1SIJA 2H88B 1OQQA 2MJEA 2E3TA 5AUIA 3VR8B 2WS3B 2CJOA 1RFKA 1DOIA 3AE5B 3NVVA 1B9RA 1L6VA 1KRHA 1TKYA 3FC4A 4N58A 5EE0A 2PVGC 1ZUD2 2WLBA 1FMAD 2DBYA 3AN1A 1JWBD 3AE9B 1JROA 1XLNA 4C7ZA 3LB8C 1CZPA 1GAQB 2PKOA 3NVWA 2LEKA 1NENB 3AEDB 1FRRA 5G5HA 2BS4B 1NI3A 2B76B 2WDRB 1WRIA 4FXCA 1QOGA 1NYRA 3AE3B 4WQMA 4YSYB 3VR9B 3VRBB 3AE8B 3HUIA 3P63A 2WDQB 3B2GA 1DOXA 1QLBB 1YQ4B 3P4PB 1RWSA 2W54A 1J7AA 1I7HA 1PFDA 1TJEA 3CWIA 1UWMA 4ITKA 4N59A 2CJNA 4YT0B 4YTPB 1EWYC 2WDVB 4YTMB 3P4RB 1VJKA 1FFVA 2QIEB 1WYGA 2AX5A 2W55A 1FM0D 2WP9B 3HVZA 1E9MA 2KMMA 1XLOA 3AECB 3AEFB 1JWAD 3PO0A 1L0VB 1FO4A 2Y5CA 4US9A 1E6EB 3AM9A 1TKEA 2K5PA 2WU5B 1AWDA 2ACZB 4YSZB 1GPXA 4US8A 1OQRA 2JQRB 1JQ4A 1E7PB 1TKGA 2K9XA 2W3RA 4JWSC 2PIAA 1DOYA 2MH7A 1QOAA 3ETRA 3P4SB 1N5WA 5EE9A 4YXDB 1PDXA 3ZYYX 5C2TB 3AEEB 5EE3A 3ABVB 2BS3B 1KF6B 1JW9D 1RM6C 1WXQA 1VLBA 4LTUA 2G1EA 1ZXIA 1ZOYB 1R7SA 2L52A 1CJEA 3SFDB 3W5UB 3AE6B 3SR6A 1YJJA 4ZOHC 1PUTA 3W9CB 3RPFC 1XO3A 2CU3A 2EKIA 3B9JA 1F0ZA 3AEAB 1QOBA 3AE4B 2BT6A 3WCQA 3AE1B
chains in the Genus database with same CATH superfamily
3BWUD 1S1QB 3LJ3A 1TS4A 2N1WA 4JL9A 4UDUC 4BOZB 3VTUA 4WQOB 4HJKA 3ZRCA 4HPPA 5D94A 5C1ZA 3VUXA 2DLBA 2KFJA 2SAKA 5CHFA 4CYEA 2OHFA 2YLMA 4M02A 3W1SC 4HVBA 2KK8A 2ZEQA 3R66C 3OLMD 4YTNB 4GN1A 4FLHA 4WAAA 3DPDA 4DXGA 3AEGB 4GDLA 3TMPB 4URKA 2KJRA 3AU5A 4IWPA 3RI7C 3P1MA 2WDTB 3HHMA 3PRZA 3RNGC 2OJRA 2MJEA 3VR8B 2LGDA 3ZTDA 3FC4A 4MDKE 1ZKHA 2IYDB 1FMAD 2O2VB 4ANWA 2PKOA 1WX7A 3PZ8A 5HHDG 1E8WA 1RFAA 3AE3B 3RUIB 3Q6BA 1SSNA 2JF5A 3QWZB 2K1FA 2J42A 1WGRA 1TY2A 4WWOA 1UWMA 1TTNA 4L23A 4ANUA 4LNNA 5DPWA 3GE8C 3HM3A 1OQYA 4WJQA 2O6VA 1TKGA 4DHZB 2RD0A 2ZCBA 1IP9A 4W9GA 1AW7A 2KFKB 1FPYA 1TS5A 3GZNI 2KFKA 4OZCA 1G6JA 3J9CA 2G9HD 5J2RA 1ZOYB 1T0RC 2CU3A 4XX5A 2FNJB 1SE4A 3R3MA 3A4RA 4RGTA 1C79A 1GB4A 2NBVB 1FFUA 1WMHA 1V8CA 2WXOA 1FXAA 2PVOD 2W3SA 3VHTC 1DYQA 4MM3A 2KD0A 2M1MA 2FCMA 2DWQA 1GOZA 2KDMA 1E0ZA 3DBLB 4ZRQA 1SE2A 1QOFA 1UH6A 3AV8A 3ZNGC 2GBJA 2JPHA 3KH0A 1WGHA 1XCTL 3KW5B 3U52E 1VDVA 2LHDA 4MGZE 2WXLA 3O13A 2WX0A 3NVVA 2GBRA 4G3XB 4TSSA 4ASWC 2FCNA 2AL6A 1OEYJ 1ZDXA 2O6VD 3PTFC 1KH0A 2WWZA 1XF5L 4KZ0A 5LNK1 5D3DA 4A20A 1JCKB 2Z8LA 1KLUD 4HCPB 1Q0WB 2MEKA 1H8CA 1J7AA 1I4HA 2CJNA 3Q8FA 4NAMA 1EWYC 1T0QC 2TSSA 2WP9B 1ET9A 5GMVA 2BBCA 4HLEA 1I35A 3KUDB 1OTRB 2INPE 2KTRA 2GOWA 2JQRB 1D3ZA 2BGFA 1QQRA 1C77A 1QOAA 2IJ0A 1WH3A 2LVQA 3VH3B 3APDA 2XNAC 3NG0A 3JSVA 3X23A 2BB5A 3PHWB 1SJHD 3IT4B 3ML9A 3MJ5A 2JXXA 1HZ6A 4XDCA 1V1PB 1R4NI 2L1AA 3ENEA 1CMXB 3VTWA 1BMLC 2IO2B 5IA7A 4MH8A 1N6ZA 2I2YA 4KZCA 4C80A 3BINA 5E6NA 1MHXA 1P9DU 1NDDA 1WXVA 4IDIA 4MH0E 3ZNHB 1SF0A 1AYFA 5IKCM 2ICIA 1I42A 4KKJA 2BWFA 1V49A 4ICVA 3B0AA 3VTVA 1IUEA 4RH6A 4P16A 1C4PA 4WWMA 3HRDD 4GMVA 3PS6A 3KYDD 3BYYB 3FILA 1DOIA 2C5LC 1KRHA 3PVLA 2Z0EB 2QSDA 3C8YA 2WX1A 1SIFA 3IXSA 1NENB 4YL8A 5KHOA 1J0GA 4WQMA 3VUWA 2JXTA 5FR3A 1E7VA 3P4PB 1WX8A 1E90A 2SEBD 1VJKA 3TIXA 3UQAA 5FK9C 3AECB 2LI5A 4GB9A 3AM9A 2KQ4X 3KWVA 3LYYA 4JWSC 3P4SB 1X1MA 2BVCA 4HDQA 1F1HA 1P1AA 1WE6A 4NJCA 2N9EB 4I6LB 2CKHB 2KKCA 4BVUC 1LXDA 1HXYD 3OAWA 3TJPA 3IHPC 3SEBA 2BYTA 3NVYA 1HTQA 3URYA 2PPHA 4IW0A 1FNWA 5AZGA 2MX2A 1C78A 4G11A 1D4BA 2Z0DB 3A4SC 2KC2A 4M01A 2K22A 1HZ5A 3MC9A 1D5XC 1P98A 1MI0A 1J7BA 2INCC 2V4IB 4JGHB 4WJOA 1HA5A 2JYEA 2KWDA 4HWIB 1GC6A 1V97A 3DBLI 3T3NA 3AE2B 1GG3A 3U4EG 2JZ3B 4A9AA 4F8CB 3X0WA 4NZLB 3DBRI 1VZ8A 4KGSA 2JZZA 3GS2A 5EE0A 4JPSA 2C60A 2LASA 2NMQA 4PS3A 1KOTA 3AEDB 3EFUA 3SFDB 2MBBB 2KANA 2IDYA 1IGDA 3CMMB 1I7HA 2NR2A 2N9PC 2RDHA 2FUG1 4NPNA 3HIZA 2OOBB 4PS8A 2IGHA 3KQ4A 1YN3A 3ZJVA 1L0VB 1UWXA 3N20C 2PTLA 3ZNZB 2WYQA 1WRDB 2O6VB 1E5WA 4AP4C 4RF0A 3TEZA 4GDKA 5EE3A 2D11A 1F2RC 2BYFA 3TUOA 3DBSA 3AI5A 3L54A 2LD9A 4IOIE 4AOFA 4MGYE 4JLCA 3ZNID 3AE4B 4HRSA 3BVGA 2WGSA 2DNFA 5JHAA 2KLCA 3NRZA 2KTFA 3L4PA 5MPOA 1WMHB 2MLBA 3W5VB 5IOIA 3AMZA 2KAJA 3NS8A 3L08A 1QT9A 3NS1A 3LXFA 1C1YB 1FEHA 3HK0A 2D2QA 2ZJDA 4W9JA 1GNUA 2HD5B 2CS4A 4H2AA 2JX5A 4S17A 3RNCC 4ZHOA 3U30A 3P4QB 3H7SA 2NBWB 1KM7A 4M0WA 3N30A 1EU4A 3VAWA 1MG8A 5LXIB 1OGWA 1OQQA 2D10A 4LNIA 4FA6A 2K0PA 4WWNA 4HK2A 2MSED 3ECIA 2B76B 1WRIA 1QOGA 1TS2A 4IWOA 1EU3A 1YQ4B 4EE2A 4YTPB 4ITKA 2LJ5A 1V81A 1FFVA 4KIKB 1EWCA 2QHOA 1XCQL 3C19A 3QQ8B 1PGBA 3DBHI 1E7PB 3H7PA 1PGAA 3H7PB 2DYOA 2J0MA 3ZYYX 1ZDVA 5G2NA 4G0NB 2KDBA 4GOCA 3M62B 4LTUA 3U2SC 3DVGX 1FCLA 4JE3B 1YJJA 3TEXA 1XO3A 2DAJA 3GZNB 3B9JA 3NY5A 4I6NB 2IO0B 4B6WA 4A3OA 2WXRA 3DWGC 2Y5PA 3I63C 1FRDA 5D3IB 2B3AA 1L6UA 3R8BA 2YEPF 2WXPA 3L0WB 4W9CA 4CO7A 4MACA 3ZQ4A 4LNKA 1YD8U 1K50A 3QC8B 1C4AA 2WQYB 4LCDE 3Q3MC 1UGJA 4M00A 2L83A 2YVCA 1WJ6A 1MVKA 2GBNA 3N3KB 1WJ4A 4N58A 4N9F4 1S3SG 1XLNA 2LEKA 1NI3A 4YSYB 4TMAB 2ZNVC 3P63A 3ZXRA 4EZKA 2NPTA 3IAS1 4R3DA 4A3PA 1WM2A 2HJ1A 4W9IA 1AARA 2BPSA 4FN2A 1XLOA 3AEFB 1XXGA 1FO4A 1SE9A 1TKEA 1VZ6A 4WH4A 3DVNU 2HE7A 4IM3A 2KWCA 2XEWA 1N5WA 5EE9A 2GRIA 2J0KA 1WYWB 1EF1A 1TBEA 5JHBA 2G1EA 3MJWA 3AXCA 4FULA 3AE6B 1TS3A 1HQRD 4C56C 1PUTA 2D5GA 3BY4B 4HJGE 2UYZB 2WXNA 4BKSD 4ZRKA 2ZVNA 4FJYA 3APCA 1SBBB 2M19A 4XE0A 2DENB 5DPSA 2IO1B 4RFBA 5KHQA 3AEBB 2BKRB 4ZRIA 1RYJA 2KVRA 3Q69A 3M63B 1J7CA 1NBFC 3AH7A 4NJ7A 2NTSA 2K8BA 3RZWC 1JRPA 4P6VF 1L0XB 2G4SA 1LO5D 1JALA 3QA8A 1WY8A 3B1LX 5DCNA 2L7RA 1T6BX 1V5TA 1ZGUB 4HROA 1YX6B 4XDDA 2K8CA 1WF9A 3N1YC 4NY0A 2RPVA 3DVGY 4II2B 1L4ZB 3IVFA 3PSEB 2JU6X 2K39A 1N61A 1ROEA 1P7FA 4RNAA 1MPEA 3ONSA 2PVGC 1LFDA 2DAFA 2ONQA 3ZDTA 3VUYA 1L4DB 2FE8A 3O65B 3DHHC 2J4XA 5D6JB 1B1ZA 3ZDMC 4A55A 2M4NA 2D3BA 2L76A 1E8YA 4JQWC 4Q2JA 2IGGA 4TUUA 1F77A 1GUAB 4MJSB 3PO0A 2QCZA 5LXHA 2LGIA 2Y5CA 1E6EB 3ZGZA 3RYTA 2MP2B 2WHIA 3KUZA 4PYZA 5JH5C 3ABVB 1KF6B 4GDKB 4FBJB 1ZXIA 1ZE3D 2L52A 1CJEA 3NZ3A 4W9EA 4ZOHC 2ZVOA 4DQOC 2EKIA 3E56A 2DZJA 2ZW0A 1QOBA 1UD7A 1K51A 3AE1B 2ON8A 2LRUA 1JMLA 3SD5A 2N0SB 4FHKA 4XWTA 1FXTB 5FKAC 4ZDVA 1L5PA 1QF6A 1N62A 1RAXA 1YN5A 3M95A 1SJED 2MJDA 2G4DB 4AUQC 3SHQA 3VVWB 4M8MA 1XQQA 2BTEA 3Q2AC 3U7ZA 3I57A 2DHZA 1YNTE 4BBNF 1YQ3B 4OHJA 4TKNA 2LVOA 1XLQA 4C7YA 3ML8A 3CSTA 3AU4A 4BKTA 2CU1A 3SFEB 2V0GA 1A70A 3OJ4B 2MBHA 2CJOA 4PS7A 4DXAB 2WXQA 3VXWA 2R61A 4C7ZA 1C4CA 2N1VA 3DBRB 4HXDA 1Q10A 1FRRA 5G5HA 5BMHA 1JWMD 1IBXA 3MTNB 4PK1A 1IBXB 2WDQB 4RGOS 1QLBB 1WE7A 2LMCA 4HEA1 4AJWA 1T5XD 2W54A 3OWEB 1WSPA 2D07B 1YMHE 3JVZX 4NAWB 3A9JA 1V9JA 3A9JB 4HCNB 4XC2A 1BXTA 4KVGB 4L2YA 4C00A 4US9A 1K52A 3A1QA 3WAPA 1UF0A 3PV1A 3T3OA 1F2RI 1U4AA 4W9FA 2KJHB 2DZKA 2NCNA 1KLGD 4BKGA 1WXQA 1VLBA 3D32A 2WXGA 4F7ZA 1IGCA 3WAOA 4E3CA 3DQVA 3EC8A 5CTRC 1P0RA 3K9OB 2QEJC 3JW0X 3W9CB 5IO9A 1R4NB 3CF6E 1F0ZA 4J3OD 2V9HA 2BT6A 4MSMB 1WZ3A 2JY6A 3SU8X 2H89B 2LGSA 3EFCA 1P7EA 4ZRJA 2D3CA 1KFYB 1WGKA 3N1ZC 1VZ7A 5DPRA 1JWSD 5BO4B 2RSUA 1KLVA 3L13A 2NTTA 3QJZA 4P1BC 3DDCB 2KDEB 1VD2A 3B2FA 2FCSA 1TY0A 1WXMA 2J0JA 1ENFA 4GLSC 5D7GA 5E6JA 4WJNA 4GGQA 3TEWA 3UIPB 2I1KA 1LQBA 3RNAC 4XGAB 2Q5WD 4WURA 4RGNA 2M56B 2KJ6A 3ZJTA 1XEEA 4RM9A 2ZZPB 4FJZA 1N5XA 1E10A 2KQSA 1EO6A 1T0YA 3UF8A 1WX9A 4MSQB 2KWUB 5G55A 1LGRA 1MJDA 4W9HA 4X57B 3LB8C 2N7DA 1I4RA 2MBOA 4LDTB 4FXCA 2JWZA 2KTRB 2EELA 4MEMA 2KHWB 2UU7A 3RN9C 5DPTA 2W55A 1FM0D 3OG5A 3NZUA 4BKSA 2WXMA 4DHJB 4ACFA 1EM7A 1TGZB 3L17A 2ACZB 3ZUNA 5BYQA 1CK1A 2X38A 1JQ4A 3UIOB 2KO3A 1DOYA 3ETRA 5LLIA 1F52A 1V1PA 4KDIC 4IWQA 3DBHB 3GB1A 3GE3C 1FNUA 3IG3A 2LHEA 2PMVA 4ZYNA 1R7SA 5L83A 5G5GA 4B9KA 3QX1A 3NJTA 1IPGA 4N6EB 1Y8RC 1SXTA 5TSSA 1ZP0B 3MC8A 3N32A 5GXGB 4B0MA 3I5JC 3H6NA 5IP4D 2E6XA 1T3QA 4ZHPA 2AEHA 2Z59B 2IGDA 4TQ1A 1HE8A 2LXAA 5JZEB 1WGDA 3JYUA 4JWUC 1WFYA 3W1SA 3KYCD 5H8YE 4O1NA 2QJLA 1MG4A 1Y56A 1QKZA 1E8XA 1TZOA 4REZA 1YQBA 3DCGA 3BK2A 4FHJA 4DXFA 4ICUA 3HM6X 3PHXB 1TKYA 2JRIB 1A5RA 1IYFA 4A6QA 1FNVA 3AE9B 1JROA 4IM2A 2V1YA 2KQ7A 3H1UA 3OJ3A 4GDLB 1GB1A 2LUMA 4A90A 4HKZE 2HDEA 2INNE 2IBIB 1RLFA 1Q5WB 2L00B 3BZDB 1D6EC 5AZHA 2WDVB 2KX3A 4YTMB 2REXA 2O2VA 3B08A 3HVZA 4MJSA 4J6IA 2V4LA 3DHIC 1OQRA 4EZJA 4US8A 2CHXA 2PIAA 2V3PA 1XT9B 3R7RA 1WJNA 5C2TB 3UI3A 3V3XA 2OEDA 4NJ6A 3ZRFA 2V3NA 2GBMA 4F1SA 1UELA 2IPKD 3TCAA 3Q8CA 4CHKA 4MGIE 2JUOA 1GJZA 1K8RB 2HTHA 1ZPSA 2PW9A 3BYTB 4KX6B 1D5ZC 4PYUA 4S0RA 1OFFA 1LM8B 1V2YA 2N9KA 1SB3C 1XLPA 2MWSB 2J52A 2KDIA 4GXBA 3HVDA 3MFGA 3A9KA 3AE7B 1WI0A 4HPMB 1VRAB 3PZDA 5I4DA 2LJIA 1VR9A 4W9DA 3NVZA 1EF5A 2K8HA 4JX1C 5AUIA 1E7UA 1I4GA 2X8XX 2WXIA 1AN8A 2WLBA 1OEYA 4WIPA 2M0XA 3V61A 3L10B 3NHEB 4C4VB 3QK0A 1VCBA 3QHTA 2DZMA 1NYRA 5D2MB 1STEA 3B2GA 2J53A 2HJ8A 1RWSA 3ZJUA 5HI1A 1PFDA 2KC1A 4LLGM 3I3TB 2BYEA 2AX5A 4NAWA 3RNFC 1UGMA 2KYWA 4K81A 1JWAD 2WXJA 2FUHB 4LNFA 1PQSA 1GPXA 1F9JA 2MH7A 2A4ZA 2GMIC 4EOYA 3QARA 3AEEB 3RMKC 3UQBA 2AQ2B 3EHVA 4KIKA 2LWPA 2JT4B 2RDGA 2K9XA 2LVPA 2GI9A 2QC8A 2JVCA 5BMGA 2KMAA 2QDFA 3PGEA 4AS1A 2AQ1B 3V62A 4GSWA 1YN4A 3JSVB 3QIJA 2IY0B 1E8ZA 3MHZA 4M0WB 4I6PA 1I4QA 4K7WA 5EE1A 1R4MB 3APFA 3N1XC 4K3CA 2BQQA 4BFRA 2FIDA 1M94A 2N7JA 1TYGB 1WZ0A 3NUHB 1GC7A 3W2DA 4KSKC 3Q3NC 1YOVB 4FADA 1N63A 4DHJD 2MA9B 1EUVB 2RGFA 3MC0B 4CQNA 2L0TA 4LNOA 1SIJA 1D5MC 4MELA 3C0RB 1FCCC 3CSFA 2LUEA 2PJHA 1ESFA 2BWES 3IAM1 2I1JA 4A8XC 1DOXA 2KACA 3WAMA 2PEAA 1ET6A 2RR9A 2D3AA 1KTKA 2BW2A 4YT0B 1Z2MA 1TZ1A 2LGXA 3M3JA 2QIEB 2IO3B 2KOXA 2XK5A 3VQIA 2QMTA 2M8SA 2VH1A 4K7UA 2WU5B 1AWDA 2WXKA 2KN5A 3UGBB 1H4RA 3SDLC 2N4FA 4ANVA 1L0YB 1WXAA 1PDXA 1JWUD 4HKQA 2ZCCA 1M4VA 3H9DA 2PLPA 4BBNC 4P1CC 1JW9D 1RM6C 1T0SC 2N7EA 3T8MA 4K1RB 4DK5A 1C3TA 2L3ZA 5HKHA 3WCQA 1WGYA 2FCQA 2JSVX 2MCNB 1NEKB 4DDID 3NOBA 3DWMA 4RGMA 3VDZA 1SEBD 3PZ7A 1NVID 3AULA 1WJUA 1J19A 3K9PB 4OVZA 1V5OA 4E71A 3ZW3A 3Q3OC 2BKFA 4OW0A 1YX5B 3PRMB 2BS2B 4K3BA 4RMAA 2QILA 2M17A 2FBWB 3RCZA 3FILB 2MQJA 2KX0A 5BYSA 3PREA 4TQ0A 1FD6A 3GOEA 4OVUA 1V86A 2AL3A 1N60A 1NYQA 5IAAC 5J17A 4W9KA 1FXIA 3ZLZA 3P2BA 3V6EB 2KN4A 2CR5A 2RDBC 2PE6B 2G3QB 2NPTB 1WXSA 2Y5BB 3AE5B 1L6VA 2W9NA 2GB1A 5E6PA 4E74A 1ZUD2 1XD3B 1JWBD 1ZXHA 1RRBA 4HDOA 1UBQA 5CX3A 3U8ZA 5AEKB 2V3SA 2C9WB 3AE8B 4BAXA 3H8HA 1I4PA 4N59A 2K3UA 3P42A 4IM0A 4FJVB 2K25A 2AWTA 2MHJA 4YSZB 2K5PA 5IN7A 3BVZA 5C23A 5HFYA 4XYCA 2R2QA 4ZRPA 3IFWB 3E9SA 4KGTA 1WIAA 2UWQA 4YWGG 2VRRB 4NQKE 3MP9A 3EECA 2DZIA 2NVUI 4ANXA 3V05A 2L8JA 3GP7A 4P7IA 4AWJA 4W9LA 2KZRA 2KWVB 2IY1B 3KWLA 2MP2A 1UZXB 4PT5A 1QZEA 3RNBC 1WR6E 2DYBA 1TT5B 4OZBA 4LDTD 2A5UA 4M8NA 3Q3FA 1SE3A 2HTME 3A9KB 4EZLA 4L1BA 5T8IA 2MRPA 5AUKA 2EMSA 2KT7A 5C3JB 4KV2A 4TV3A 5J18A 2CHWA 1WWTA 3PPAA 4GIVA 4KGRA 4LJOB 2C7MB 2AQ3B 2Y3AA 2ZNVB 3V60A 1UBIA 1B9RA 3FKYA 4ARIA 5FR6A 1QILA 1L7YA 2DBYA 2ZPYA 3AN1A 2N9XA 1GAQB 4DHZE 2WXFA 4K7SA 4DWFA 3TSSA 1C9FA 1ISNA 1WM3A 2DYMA 2BS4B 4C4VA 4WJPA 4KSLC 2M0AA 2ZW1A 3PLVA 3VR9B 3VRBB 5E6OA 1NI2A 4RM8A 4WAFA 3KUCB 1K53A 3ZXVA 1P3QU 1TJEA 3QAQA 3BVMA 3P4RB 1WGGA 3KVFB 4EKUA 2KMMA 3Q3JA 2L05A 3WANA 2ASQA 1MFWA 4MT5A 2RMMA 3R2IA 4RCOA 2BS3B 4XWWA 2K6QA 4G50A 1V1OA 2R2OA 1BUIC 2VH2A 1I4XA 2KLGA 4NNJB 1ZW7A 2OJWA 3ALBA 4GU2A 2N9LA 1FIQA 3FAHA 1TIFA 2L0FA 3BIID 3RFZB 5L95C 4IKGA 2WNMA 2MJ3A 2W82A 3RZFA 2ZPNA 3R2TA 4YSXB 1Q1OA 3AB5A 4MM3B 1UNSA 3R7QA 4XZ4A 3TEYA 3S2AA 5AZFA 3T9LA 5EDSA 5BYRA 4BOSC 2CHZA 1DGJA 2VZKB 3TL5A 2C7NB 3EA6A 3N9YC 3QCAA 2KMCA 3PLUA 4BZAA 2E3TA 1YJ1A 2D3GA 1CQVA 3LDZE 2J7QB 1UUPA 1CZPA 2VZKD 3BK1A 3NVWA 3DHGC 2KDFB 3MHSD 3RD2A 3A1QB 2WXHA 3ZTCA 1C76A 1SGHA 1L2NA 3ZKJC 2I38A 3IBEA 4ARCA 4QAYA 2IZVB 3EGRA 4OZAA 1WYGA 5HG2A 1E9MA 4LJPB 2JWUA 2XK5B 3NZSA 2NBUA 2YEPB 5CHVC 3ZO5B 2XBBC 4IG7B 2LGYA 3A33B 1HTOA 3TBLD 2LXCA 2MW5A 3W5UB 4DDGD 2EMTA 1ACCA 1YIWA 3RPFC 2C7HA 4EEWA 3AEAB 1PGXA 4RF1A 1BT0A 3U7DA 1YJIA 2BF8B 3IT6B 3VFKA 4KKIA 1JRUA 3V6CB 3RNEC 4B0EA 1V6EA 2PE9A 5TR5A 2WU2B 1WR1A 2MBQA 4EFOA 2MBEA 3Q8AA 2GBKA 1V80A 5CHWA 1MHHE 3KLSX 3WALA 3EUB2 4OVVA 3ZVVA 4MGKE 2NS5A 5H92C 2XN9C 1R4MI 3DOWA 4ZYSA 4HPLB 1J8CA 2DX5B 4II3B 3WA0A 1KJTA 3VRAB 4USAA 2JZPA 3CIRB 2INDC 4IUMB 2H88B 2WS3B 1RFKA 1Z5SB 3L16A 3Q14C 4NQLB 5JXVA 2LRWA 2G45B 4JIOU 2JRHA 4D2KA 2GLSA 2KXJA 2JYTA 2WDRB 3DVNV 3WIMA 4DBGA 2LZ6A 3HUIA 4B95A 3CWIA 2FIFA 4EUTA 3Q8EA 4IC7B 5BMIA 3PRPB 2BB6A 2AYOB 3Q8BA 4AJYB 3I9V1 3ZIMA 3RULA 3UINB 4KDLB 2W3RA 2EKEC 1HEZE 1PYWD 3PT2B 4LK0M 4YXDB 2FAZA 3W1YA 4AQ7A 3RT3B 3VH4B 4WWPA 2K6DB 2BYVE 2KNBA 2RPQA 2LFIA 2L32A 3SR6A 2KVZA
chains in the Genus database with same CATH topology
2JSVX 3BWUD 1TS4A 3BVGA 4HRSA 4UDUC 1NEKB 2H89B 3DWMA 1P7EA 4RGMA 3NRZA 1KFYB 3L4PA 5MPOA 1WGKA 1SEBD 3PZ7A 1VZ7A 3W5VB 1JWSD 1NVID 3AMZA 2KAJA 2DLBA 2NTTA 4OVZA 2SAKA 1QT9A 3B2FA 2OHFA 1TY0A 4OW0A 3NS1A 1ENFA 4GLSC 5D7GA 2BS2B 3LXFA 1FEHA 2QILA 2FBWB 5E6JA 3FILB 3TEWA 5BYSA 4TQ0A 4H2AA 2JX5A 4YTNB 2Q5WD 4ZHOA 1FD6A 4WURA 3P4QB 3AEGB 4DXGA 4RGNA 4M0WA 1N60A 2M56B 1NYQA 3ZJTA 1XEEA 1FXIA 1EU4A 1N5XA 1E10A 3P1MA 2KN4A 2MJEA 3VR8B 1OQQA 3AE5B 1L6VA 3FC4A 2GB1A 1ZUD2 1FMAD 1JWBD 3LB8C 1ZXHA 2K0PA 2PKOA 1I4RA 3PZ8A 5HHDG 2B76B 4FXCA 1WRIA 1QOGA 3AE3B 1SSNA 1TS2A 2EELA 3AE8B 2J42A 1EU3A 1YQ4B 4EE2A 3H8HA 1TY2A 1I4PA 4YTPB 1UWMA 4ITKA 4N59A 2K3UA 3P42A 1FFVA 2W55A 4L23A 1FM0D 1EWCA 2WXMA 1XCQL 1EM7A 1PGBA 4YSZB 2K5PA 2ACZB 3BVZA 1CK1A 2X38A 5BYQA 5HFYA 1JQ4A 1E7PB 1TKGA 1PGAA 4ZRPA 1DOYA 3ETRA 1V1PA 2DYOA 3ZYYX 1ZDVA 3E9SA 1AW7A 1TS5A 3GB1A 1FNUA 4KGTA 4OZCA 2LHEA 2PMVA 4YWGG 3J9CA 4LTUA 2G9HD 3MP9A 1ZOYB 1R7SA 3U2SC 1FCLA 4JE3B 3V05A 1YJJA 3TEXA 1XO3A 2CU3A 3GP7A 3B9JA 1SE4A 4RGTA 1C79A 5G5GA 1GB4A 3KWLA 1FFUA 2WXRA 4N6EB 3DWGC 1V8CA 2WXOA 4PT5A 1SXTA 2Y5PA 5TSSA 1FRDA 1ZP0B 1FXAA 5D3IB 5GXGB 4OZBA 2PVOD 4B0MA 1L6UA 3R8BA 2YEPF 2WXPA 4MACA 3ZQ4A 2W3SA 2E6XA 1T3QA 4ZHPA 2IGDA 4TQ1A 1SE3A 1DYQA 1K50A 2HTME 4L1BA 4JWUC 2DWQA 5T8IA 3W1SA 1GOZA 2KDMA 1C4AA 5H8YE 1E0ZA 2WQYB 4O1NA 4ZRQA 1SE2A 2QJLA 1Y56A 1QOFA 5AUKA 1QKZA 1UGJA 1TZOA 3AV8A 4REZA 2L83A 5C3JB 1MVKA 3BK2A 1XCTL 1WWTA 4DXFA 4KGRA 3U52E 1VDVA 2AQ3B 2Y3AA 2LHDA 2WXLA 3O13A 1B9RA 3NVVA 4ARIA 1TKYA 4N58A 1QILA 2DBYA 3AN1A 4TSSA 4A6QA 1FNVA 3AE9B 1JROA 1XLNA 1GAQB 2WXFA 2LEKA 3TSSA 1C9FA 1ZDXA 2DYMA 4GDLB 1GB1A 2BS4B 1NI3A 1KH0A 2LUMA 2M0AA 1XF5L 4YSYB 4TMAB 5LNK1 4A90A 2ZW1A 5D3DA 4HKZE 3VRBB 3VR9B 2HDEA 3P63A 2INNE 1JCKB 2Z8LA 4WAFA 1KLUD 1K53A 2MEKA 1J7AA 1D6EC 1I4HA 1TJEA 3BZDB 3IAS1 4R3DA 2CJNA 3Q8FA 4NAMA 1EWYC 2WDVB 3BVMA 2TSSA 3P4RB 4YTMB 2WP9B 1ET9A 3HVZA 2KMMA 1XLOA 3AEFB 2BBCA 1XXGA 1FO4A 1TKEA 1VZ6A 2INPE 4WH4A 4US8A 1OQRA 2JQRB 1QQRA 4MT5A 2PIAA 2V3PA 1C77A 1QOAA 2RMMA 1N5WA 5EE9A 2GRIA 2IJ0A 3R2IA 5C2TB 3UI3A 4RCOA 3V3XA 2BS3B 2OEDA 4XWWA 2XNAC 2G1EA 2BB5A 1SJHD 3AE6B 3IT4B 1TS3A 1HQRD 1V1OA 4C56C 1BUIC 1PUTA 2D5GA 2V3NA 1I4XA 4HJGE 3MJ5A 2WXNA 2IPKD 1HZ6A 4XDCA 1SBBB 3Q8CA 1V1PB 2M19A 4XE0A 2N9LA 2L1AA 1FIQA 3FAHA 1BMLC 4RFBA 3AEBB 3BIID 3RFZB 4MH8A 1ZPSA 2I2YA 2PW9A 1RYJA 3BYTB 4C80A 4KX6B 1D5ZC 4IKGA 2WNMA 3Q69A 2MJ3A 1OFFA 2W82A 2N9KA 1MHXA 1J7CA 1SB3C 1XLPA 3R2TA 2J52A 4YSXB 3AH7A 3AB5A 3HVDA 2NTSA 3MFGA 4MM3B 3AE7B 4IDIA 1UNSA 1JRPA 4P6VF 1L0XB 1SF0A 1AYFA 1LO5D 1VRAB 1JALA 2ICIA 3TEYA 4KKJA 5BYRA 1DGJA 1T6BX 1IUEA 2VZKB 4HROA 4XDDA 5I4DA 4RH6A 2LJIA 4P16A 1VR9A 2RPVA 1C4PA 1L4ZB 3NVZA 4WWMA 3EA6A 3N9YC 3HRDD 4JX1C 2JU6X 1N61A 1ROEA 2E3TA 5AUIA 1P7FA 3BYYB 3FILA 1DOIA 1MPEA 1I4GA 4RNAA 1KRHA 2WXIA 1AN8A 1CQVA 2PVGC 2WLBA 2QSDA 3C8YA 2ONQA 4WIPA 1L4DB 1UUPA 1CZPA 2FE8A 2VZKD 3BK1A 3IXSA 2J4XA 3NVWA 1B1ZA 1NENB 4WQMA 1NYRA 4A55A 2WXHA 2JXTA 1STEA 1C76A 5FR3A 3B2GA 2I38A 2J53A 2IGGA 4Q2JA 3P4PB 4ARCA 1RWSA 3ZJUA 5HI1A 1PFDA 4LLGM 2SEBD 1F77A 1VJKA 3EGRA 4OZAA 1WYGA 2AX5A 5HG2A 1E9MA 2JWUA 5FK9C 3PO0A 3AECB 1JWAD 2WXJA 2LGIA 2Y5CA 1E6EB 2KQ4X 3AM9A 3ZGZA 3KWVA 2YEPB 1GPXA 3LYYA 4JWSC 2MH7A 3P4SB 4NJCA 3AEEB 3ABVB 1KF6B 4GDKB 2AQ2B 1ZXIA 1ZE3D 2L52A 3W5UB 1CJEA 3NZ3A 3SR6A 1ACCA 4ZOHC 3RPFC 4DQOC 2EKIA 2RDGA 3E56A 3AEAB 2ZW0A 1QOBA 2K9XA 1PGXA 4RF1A 1K51A 1HXYD 3AE1B 2ON8A 2GI9A 1YJIA 1JMLA 3IT6B 5BMGA 3SEBA 2BYTA 4AS1A 4KKIA 2AQ1B 2N0SB 3NVYA 4XWTA 3URYA 5FKAC 1L5PA 1QF6A 1YN4A 4B0EA 1N62A 1FNWA 1C78A 3MHZA 1YN5A 1I4QA 2WU2B 1D4BA 1SJED 2MJDA 2K22A 3Q8AA 5EE1A 1HZ5A 1MHHE 3KLSX 3EUB2 1D5XC 2N7JA 1MI0A 1J7BA 2V4IB 5H92C 1TYGB 2XN9C 3NUHB 2BTEA 3U7ZA 3I57A 1HA5A 3W2DA 1YNTE 2JYEA 2KWDA 4ZYSA 1YQ3B 4OHJA 1V97A 1XLQA 3T3NA 4C7YA 1N63A 3VRAB 3AE2B 3U4EG 4USAA 2JZPA 3CIRB 3MC0B 4CQNA 4A9AA 3SFEB 2V0GA 4NZLB 1A70A 1SIJA 1VZ8A 2H88B 4KGSA 1D5MC 2WS3B 2CJOA 1RFKA 3GS2A 5EE0A 5JXVA 4JPSA 2WXQA 1FCCC 2R61A 2NMQA 4C7ZA 1C4CA 4D2KA 1ESFA 3AEDB 1Q10A 1FRRA 5G5HA 2JYTA 3SFDB 2WDRB 5BMHA 3IAM1 1JWMD 1IBXA 2IDYA 3HUIA 1IBXB 2WDQB 4A8XC 4RGOS 1DOXA 2KACA 1QLBB 2LMCA 4HEA1 1ET6A 1IGDA 1T5XD 2W54A 1I7HA 3CWIA 3OWEB 1KTKA 2BW2A 1WSPA 4YT0B 2RDHA 2FUG1 1YMHE 4NAWB 2QIEB 3Q8EA 2IGHA 3KQ4A 5BMIA 2BB6A 1YN3A 3VQIA 1BXTA 2QMTA 3Q8BA 3ZJVA 1L0VB 4L2YA 1UWXA 1K52A 2PTLA 4US9A 2WU5B 1AWDA 3I9V1 2WXKA 2W3RA 1L0YB 1HEZE 3T3OA 1F2RI 1PYWD 4LK0M 1PDXA 4YXDB 1JWUD 4HKQA 4RF0A 3TEZA 4AQ7A 1M4VA 5EE3A 1KLGD 2PLPA 1WXQA 1JW9D 1RM6C 1F2RC 1VLBA 3TUOA 2WXGA 1IGCA 4IOIE 2QEJC 2LFIA 3W9CB 2L32A 1F0ZA 4J3OD 3AE4B 2BT6A 3WCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRS A;  1NEK B;  1YJI A;  5G5G A;  2H89 B;  2M19 A;  3DWM A;  3KWL A;  1FFU A;  3NRZ A;  4N6E B;  3DWG C;  1KFY B;  2N0S B;  1V8C A;  3L4P A;  3NVY A;  1WGK A;  1FIQ A;  3FAH A;  5MPO A;  3AEB B;  3BII D;  1L5P A;  3W5V B;  1QF6 A;  1FRD A;  1NVI D;  1RYJ A;  1N62 A;  1ZP0 B;  1FXA A;  3AMZ A;  2KAJ A;  4C80 A;  4KX6 B;  5GXG B;  2PVO D;  1L6U A;  2MJ3 A;  1OFF A;  1QT9 A;  2WU2 B;  2MJD A;  2K22 A;  2W3S A;  2OHF A;  1J7C A;  3B2F A;  5EE1 A;  1SB3 C;  1XLP A;  4YSX B;  3NS1 A;  1T3Q A;  3AH7 A;  3AB5 A;  4ZHP A;  2BS2 B;  3LXF A;  3AE7 B;  4IDI A;  2FBW B;  2HTM E;  1JRP A;  3EUB 2;  4P6V F;  1SF0 A;  1AYF A;  4JWU C;  1J7B A;  1JAL A;  2DWQ A;  5H8Y E;  1E0Z A;  2WQY B;  5H92 C;  1TYG B;  2QJL A;  1QOF A;  5AUK A;  2JX5 A;  4YTN B;  2Q5W D;  3AV8 A;  1DGJ A;  2L83 A;  4ZHO A;  1YQ3 B;  1IUE A;  4HRO A;  3P4Q B;  3AEG B;  5C3J B;  1V97 A;  1N60 A;  1XLQ A;  1NYQ A;  2M56 B;  4C7Y A;  1FXI A;  1N63 A;  3VRA B;  3AE2 B;  1N5X A;  1E10 A;  3P1M A;  4USA A;  3CIR B;  1WWT A;  3NVZ A;  4WWM A;  4A9A A;  1VDV A;  3HRD D;  4JX1 C;  3SFE B;  1N61 A;  1ROE A;  1A70 A;  1SIJ A;  2H88 B;  1OQQ A;  2MJE A;  2E3T A;  5AUI A;  3VR8 B;  2WS3 B;  2CJO A;  1RFK A;  1DOI A;  3AE5 B;  3NVV A;  1B9R A;  1L6V A;  1KRH A;  1TKY A;  3FC4 A;  4N58 A;  5EE0 A;  2PVG C;  1ZUD 2;  2WLB A;  1FMA D;  2DBY A;  3AN1 A;  1JWB D;  3AE9 B;  1JRO A;  1XLN A;  4C7Z A;  3LB8 C;  1CZP A;  1GAQ B;  2PKO A;  3NVW A;  2LEK A;  1NEN B;  3AED B;  1FRR A;  5G5H A;  2BS4 B;  1NI3 A;  2B76 B;  2WDR B;  1WRI A;  4FXC A;  1QOG A;  1NYR A;  3AE3 B;  4WQM A;  4YSY B;  3VR9 B;  3VRB B;  3AE8 B;  3HUI A;  3P63 A;  2WDQ B;  3B2G A;  1DOX A;  1QLB B;  1YQ4 B;  3P4P B;  1RWS A;  2W54 A;  1J7A A;  1I7H A;  1PFD A;  1TJE A;  3CWI A;  1UWM A;  4ITK A;  4N59 A;  2CJN A;  4YT0 B;  4YTP B;  1EWY C;  2WDV B;  4YTM B;  3P4R B;  1VJK A;  1FFV A;  2QIE B;  1WYG A;  2AX5 A;  2W55 A;  1FM0 D;  2WP9 B;  3HVZ A;  1E9M A;  2KMM A;  1XLO A;  3AEC B;  3AEF B;  1JWA D;  3PO0 A;  1L0V B;  1FO4 A;  2Y5C A;  4US9 A;  1E6E B;  3AM9 A;  1TKE A;  2K5P A;  2WU5 B;  1AWD A;  2ACZ B;  4YSZ B;  1GPX A;  4US8 A;  1OQR A;  2JQR B;  1JQ4 A;  1E7P B;  1TKG A;  2K9X A;  2W3R A;  4JWS C;  2PIA A;  1DOY A;  2MH7 A;  1QOA A;  3ETR A;  3P4S B;  1N5W A;  5EE9 A;  4YXD B;  1PDX A;  3ZYY X;  5C2T B;  3AEE B;  5EE3 A;  3ABV B;  2BS3 B;  1KF6 B;  1JW9 D;  1RM6 C;  1WXQ A;  1VLB A;  4LTU A;  2G1E A;  1ZXI A;  1ZOY B;  1R7S A;  2L52 A;  1CJE A;  3SFD B;  3W5U B;  3AE6 B;  3SR6 A;  1YJJ A;  4ZOH C;  1PUT A;  3W9C B;  3RPF C;  1XO3 A;  2CU3 A;  2EKI A;  3B9J A;  1F0Z A;  3AEA B;  1QOB A;  3AE4 B;  2BT6 A;  3WCQ A;  3AE1 B; 
#chains in the Genus database with same CATH topology
 3BWU D;  1S1Q B;  3LJ3 A;  1TS4 A;  2N1W A;  4JL9 A;  4UDU C;  4BOZ B;  3VTU A;  4WQO B;  4HJK A;  3ZRC A;  4HPP A;  5D94 A;  5C1Z A;  3VUX A;  2DLB A;  2KFJ A;  2SAK A;  5CHF A;  4CYE A;  2OHF A;  2YLM A;  4M02 A;  3W1S C;  4HVB A;  2KK8 A;  2ZEQ A;  3R66 C;  3OLM D;  4YTN B;  4GN1 A;  4FLH A;  4WAA A;  3DPD A;  4DXG A;  3AEG B;  4GDL A;  3TMP B;  4URK A;  2KJR A;  3AU5 A;  4IWP A;  3RI7 C;  3P1M A;  2WDT B;  3HHM A;  3PRZ A;  3RNG C;  2OJR A;  2MJE A;  3VR8 B;  2LGD A;  3ZTD A;  3FC4 A;  4MDK E;  1ZKH A;  2IYD B;  1FMA D;  2O2V B;  4ANW A;  2PKO A;  1WX7 A;  3PZ8 A;  5HHD G;  1E8W A;  1RFA A;  3AE3 B;  3RUI B;  3Q6B A;  1SSN A;  2JF5 A;  3QWZ B;  2K1F A;  2J42 A;  1WGR A;  1TY2 A;  4WWO A;  1UWM A;  1TTN A;  4L23 A;  4ANU A;  4LNN A;  5DPW A;  3GE8 C;  3HM3 A;  1OQY A;  4WJQ A;  2O6V A;  1TKG A;  4DHZ B;  2RD0 A;  2ZCB A;  1IP9 A;  4W9G A;  1AW7 A;  2KFK B;  1FPY A;  1TS5 A;  3GZN I;  2KFK A;  4OZC A;  1G6J A;  3J9C A;  2G9H D;  5J2R A;  1ZOY B;  1T0R C;  2CU3 A;  4XX5 A;  2FNJ B;  1SE4 A;  3R3M A;  3A4R A;  4RGT A;  1C79 A;  1GB4 A;  2NBV B;  1FFU A;  1WMH A;  1V8C A;  2WXO A;  1FXA A;  2PVO D;  2W3S A;  3VHT C;  1DYQ A;  4MM3 A;  2KD0 A;  2M1M A;  2FCM A;  2DWQ A;  1GOZ A;  2KDM A;  1E0Z A;  3DBL B;  4ZRQ A;  1SE2 A;  1QOF A;  1UH6 A;  3AV8 A;  3ZNG C;  2GBJ A;  2JPH A;  3KH0 A;  1WGH A;  1XCT L;  3KW5 B;  3U52 E;  1VDV A;  2LHD A;  4MGZ E;  2WXL A;  3O13 A;  2WX0 A;  3NVV A;  2GBR A;  4G3X B;  4TSS A;  4ASW C;  2FCN A;  2AL6 A;  1OEY J;  1ZDX A;  2O6V D;  3PTF C;  1KH0 A;  2WWZ A;  1XF5 L;  4KZ0 A;  5LNK 1;  5D3D A;  4A20 A;  1JCK B;  2Z8L A;  1KLU D;  4HCP B;  1Q0W B;  2MEK A;  1H8C A;  1J7A A;  1I4H A;  2CJN A;  3Q8F A;  4NAM A;  1EWY C;  1T0Q C;  2TSS A;  2WP9 B;  1ET9 A;  5GMV A;  2BBC A;  4HLE A;  1I35 A;  3KUD B;  1OTR B;  2INP E;  2KTR A;  2GOW A;  2JQR B;  1D3Z A;  2BGF A;  1QQR A;  1C77 A;  1QOA A;  2IJ0 A;  1WH3 A;  2LVQ A;  3VH3 B;  3APD A;  2XNA C;  3NG0 A;  3JSV A;  3X23 A;  2BB5 A;  3PHW B;  1SJH D;  3IT4 B;  3ML9 A;  3MJ5 A;  2JXX A;  1HZ6 A;  4XDC A;  1V1P B;  1R4N I;  2L1A A;  3ENE A;  1CMX B;  3VTW A;  1BML C;  2IO2 B;  5IA7 A;  4MH8 A;  1N6Z A;  2I2Y A;  4KZC A;  4C80 A;  3BIN A;  5E6N A;  1MHX A;  1P9D U;  1NDD A;  1WXV A;  4IDI A;  4MH0 E;  3ZNH B;  1SF0 A;  1AYF A;  5IKC M;  2ICI A;  1I42 A;  4KKJ A;  2BWF A;  1V49 A;  4ICV A;  3B0A A;  3VTV A;  1IUE A;  4RH6 A;  4P16 A;  1C4P A;  4WWM A;  3HRD D;  4GMV A;  3PS6 A;  3KYD D;  3BYY B;  3FIL A;  1DOI A;  2C5L C;  1KRH A;  3PVL A;  2Z0E B;  2QSD A;  3C8Y A;  2WX1 A;  1SIF A;  3IXS A;  1NEN B;  4YL8 A;  5KHO A;  1J0G A;  4WQM A;  3VUW A;  2JXT A;  5FR3 A;  1E7V A;  3P4P B;  1WX8 A;  1E90 A;  2SEB D;  1VJK A;  3TIX A;  3UQA A;  5FK9 C;  3AEC B;  2LI5 A;  4GB9 A;  3AM9 A;  2KQ4 X;  3KWV A;  3LYY A;  4JWS C;  3P4S B;  1X1M A;  2BVC A;  4HDQ A;  1F1H A;  1P1A A;  1WE6 A;  4NJC A;  2N9E B;  4I6L B;  2CKH B;  2KKC A;  4BVU C;  1LXD A;  1HXY D;  3OAW A;  3TJP A;  3IHP C;  3SEB A;  2BYT A;  3NVY A;  1HTQ A;  3URY A;  2PPH A;  4IW0 A;  1FNW A;  5AZG A;  2MX2 A;  1C78 A;  4G11 A;  1D4B A;  2Z0D B;  3A4S C;  2KC2 A;  4M01 A;  2K22 A;  1HZ5 A;  3MC9 A;  1D5X C;  1P98 A;  1MI0 A;  1J7B A;  2INC C;  2V4I B;  4JGH B;  4WJO A;  1HA5 A;  2JYE A;  2KWD A;  4HWI B;  1GC6 A;  1V97 A;  3DBL I;  3T3N A;  3AE2 B;  1GG3 A;  3U4E G;  2JZ3 B;  4A9A A;  4F8C B;  3X0W A;  4NZL B;  3DBR I;  1VZ8 A;  4KGS A;  2JZZ A;  3GS2 A;  5EE0 A;  4JPS A;  2C60 A;  2LAS A;  2NMQ A;  4PS3 A;  1KOT A;  3AED B;  3EFU A;  3SFD B;  2MBB B;  2KAN A;  2IDY A;  1IGD A;  3CMM B;  1I7H A;  2NR2 A;  2N9P C;  2RDH A;  2FUG 1;  4NPN A;  3HIZ A;  2OOB B;  4PS8 A;  2IGH A;  3KQ4 A;  1YN3 A;  3ZJV A;  1L0V B;  1UWX A;  3N20 C;  2PTL A;  3ZNZ B;  2WYQ A;  1WRD B;  2O6V B;  1E5W A;  4AP4 C;  4RF0 A;  3TEZ A;  4GDK A;  5EE3 A;  2D11 A;  1F2R C;  2BYF A;  3TUO A;  3DBS A;  3AI5 A;  3L54 A;  2LD9 A;  4IOI E;  4AOF A;  4MGY E;  4JLC A;  3ZNI D;  3AE4 B;  4HRS A;  3BVG A;  2WGS A;  2DNF A;  5JHA A;  2KLC A;  3NRZ A;  2KTF A;  3L4P A;  5MPO A;  1WMH B;  2MLB A;  3W5V B;  5IOI A;  3AMZ A;  2KAJ A;  3NS8 A;  3L08 A;  1QT9 A;  3NS1 A;  3LXF A;  1C1Y B;  1FEH A;  3HK0 A;  2D2Q A;  2ZJD A;  4W9J A;  1GNU A;  2HD5 B;  2CS4 A;  4H2A A;  2JX5 A;  4S17 A;  3RNC C;  4ZHO A;  3U30 A;  3P4Q B;  3H7S A;  2NBW B;  1KM7 A;  4M0W A;  3N30 A;  1EU4 A;  3VAW A;  1MG8 A;  5LXI B;  1OGW A;  1OQQ A;  2D10 A;  4LNI A;  4FA6 A;  2K0P A;  4WWN A;  4HK2 A;  2MSE D;  3ECI A;  2B76 B;  1WRI A;  1QOG A;  1TS2 A;  4IWO A;  1EU3 A;  1YQ4 B;  4EE2 A;  4YTP B;  4ITK A;  2LJ5 A;  1V81 A;  1FFV A;  4KIK B;  1EWC A;  2QHO A;  1XCQ L;  3C19 A;  3QQ8 B;  1PGB A;  3DBH I;  1E7P B;  3H7P A;  1PGA A;  3H7P B;  2DYO A;  2J0M A;  3ZYY X;  1ZDV A;  5G2N A;  4G0N B;  2KDB A;  4GOC A;  3M62 B;  4LTU A;  3U2S C;  3DVG X;  1FCL A;  4JE3 B;  1YJJ A;  3TEX A;  1XO3 A;  2DAJ A;  3GZN B;  3B9J A;  3NY5 A;  4I6N B;  2IO0 B;  4B6W A;  4A3O A;  2WXR A;  3DWG C;  2Y5P A;  3I63 C;  1FRD A;  5D3I B;  2B3A A;  1L6U A;  3R8B A;  2YEP F;  2WXP A;  3L0W B;  4W9C A;  4CO7 A;  4MAC A;  3ZQ4 A;  4LNK A;  1YD8 U;  1K50 A;  3QC8 B;  1C4A A;  2WQY B;  4LCD E;  3Q3M C;  1UGJ A;  4M00 A;  2L83 A;  2YVC A;  1WJ6 A;  1MVK A;  2GBN A;  3N3K B;  1WJ4 A;  4N58 A;  4N9F 4;  1S3S G;  1XLN A;  2LEK A;  1NI3 A;  4YSY B;  4TMA B;  2ZNV C;  3P63 A;  3ZXR A;  4EZK A;  2NPT A;  3IAS 1;  4R3D A;  4A3P A;  1WM2 A;  2HJ1 A;  4W9I A;  1AAR A;  2BPS A;  4FN2 A;  1XLO A;  3AEF B;  1XXG A;  1FO4 A;  1SE9 A;  1TKE A;  1VZ6 A;  4WH4 A;  3DVN U;  2HE7 A;  4IM3 A;  2KWC A;  2XEW A;  1N5W A;  5EE9 A;  2GRI A;  2J0K A;  1WYW B;  1EF1 A;  1TBE A;  5JHB A;  2G1E A;  3MJW A;  3AXC A;  4FUL A;  3AE6 B;  1TS3 A;  1HQR D;  4C56 C;  1PUT A;  2D5G A;  3BY4 B;  4HJG E;  2UYZ B;  2WXN A;  4BKS D;  4ZRK A;  2ZVN A;  4FJY A;  3APC A;  1SBB B;  2M19 A;  4XE0 A;  2DEN B;  5DPS A;  2IO1 B;  4RFB A;  5KHQ A;  3AEB B;  2BKR B;  4ZRI A;  1RYJ A;  2KVR A;  3Q69 A;  3M63 B;  1J7C A;  1NBF C;  3AH7 A;  4NJ7 A;  2NTS A;  2K8B A;  3RZW C;  1JRP A;  4P6V F;  1L0X B;  2G4S A;  1LO5 D;  1JAL A;  3QA8 A;  1WY8 A;  3B1L X;  5DCN A;  2L7R A;  1T6B X;  1V5T A;  1ZGU B;  4HRO A;  1YX6 B;  4XDD A;  2K8C A;  1WF9 A;  3N1Y C;  4NY0 A;  2RPV A;  3DVG Y;  4II2 B;  1L4Z B;  3IVF A;  3PSE B;  2JU6 X;  2K39 A;  1N61 A;  1ROE A;  1P7F A;  4RNA A;  1MPE A;  3ONS A;  2PVG C;  1LFD A;  2DAF A;  2ONQ A;  3ZDT A;  3VUY A;  1L4D B;  2FE8 A;  3O65 B;  3DHH C;  2J4X A;  5D6J B;  1B1Z A;  3ZDM C;  4A55 A;  2M4N A;  2D3B A;  2L76 A;  1E8Y A;  4JQW C;  4Q2J A;  2IGG A;  4TUU A;  1F77 A;  1GUA B;  4MJS B;  3PO0 A;  2QCZ A;  5LXH A;  2LGI A;  2Y5C A;  1E6E B;  3ZGZ A;  3RYT A;  2MP2 B;  2WHI A;  3KUZ A;  4PYZ A;  5JH5 C;  3ABV B;  1KF6 B;  4GDK B;  4FBJ B;  1ZXI A;  1ZE3 D;  2L52 A;  1CJE A;  3NZ3 A;  4W9E A;  4ZOH C;  2ZVO A;  4DQO C;  2EKI A;  3E56 A;  2DZJ A;  2ZW0 A;  1QOB A;  1UD7 A;  1K51 A;  3AE1 B;  2ON8 A;  2LRU A;  1JML A;  3SD5 A;  2N0S B;  4FHK A;  4XWT A;  1FXT B;  5FKA C;  4ZDV A;  1L5P A;  1QF6 A;  1N62 A;  1RAX A;  1YN5 A;  3M95 A;  1SJE D;  2MJD A;  2G4D B;  4AUQ C;  3SHQ A;  3VVW B;  4M8M A;  1XQQ A;  2BTE A;  3Q2A C;  3U7Z A;  3I57 A;  2DHZ A;  1YNT E;  4BBN F;  1YQ3 B;  4OHJ A;  4TKN A;  2LVO A;  1XLQ A;  4C7Y A;  3ML8 A;  3CST A;  3AU4 A;  4BKT A;  2CU1 A;  3SFE B;  2V0G A;  1A70 A;  3OJ4 B;  2MBH A;  2CJO A;  4PS7 A;  4DXA B;  2WXQ A;  3VXW A;  2R61 A;  4C7Z A;  1C4C A;  2N1V A;  3DBR B;  4HXD A;  1Q10 A;  1FRR A;  5G5H A;  5BMH A;  1JWM D;  1IBX A;  3MTN B;  4PK1 A;  1IBX B;  2WDQ B;  4RGO S;  1QLB B;  1WE7 A;  2LMC A;  4HEA 1;  4AJW A;  1T5X D;  2W54 A;  3OWE B;  1WSP A;  2D07 B;  1YMH E;  3JVZ X;  4NAW B;  3A9J A;  1V9J A;  3A9J B;  4HCN B;  4XC2 A;  1BXT A;  4KVG B;  4L2Y A;  4C00 A;  4US9 A;  1K52 A;  3A1Q A;  3WAP A;  1UF0 A;  3PV1 A;  3T3O A;  1F2R I;  1U4A A;  4W9F A;  2KJH B;  2DZK A;  2NCN A;  1KLG D;  4BKG A;  1WXQ A;  1VLB A;  3D32 A;  2WXG A;  4F7Z A;  1IGC A;  3WAO A;  4E3C A;  3DQV A;  3EC8 A;  5CTR C;  1P0R A;  3K9O B;  2QEJ C;  3JW0 X;  3W9C B;  5IO9 A;  1R4N B;  3CF6 E;  1F0Z A;  4J3O D;  2V9H A;  2BT6 A;  4MSM B;  1WZ3 A;  2JY6 A;  3SU8 X;  2H89 B;  2LGS A;  3EFC A;  1P7E A;  4ZRJ A;  2D3C A;  1KFY B;  1WGK A;  3N1Z C;  1VZ7 A;  5DPR A;  1JWS D;  5BO4 B;  2RSU A;  1KLV A;  3L13 A;  2NTT A;  3QJZ A;  4P1B C;  3DDC B;  2KDE B;  1VD2 A;  3B2F A;  2FCS A;  1TY0 A;  1WXM A;  2J0J A;  1ENF A;  4GLS C;  5D7G A;  5E6J A;  4WJN A;  4GGQ A;  3TEW A;  3UIP B;  2I1K A;  1LQB A;  3RNA C;  4XGA B;  2Q5W D;  4WUR A;  4RGN A;  2M56 B;  2KJ6 A;  3ZJT A;  1XEE A;  4RM9 A;  2ZZP B;  4FJZ A;  1N5X A;  1E10 A;  2KQS A;  1EO6 A;  1T0Y A;  3UF8 A;  1WX9 A;  4MSQ B;  2KWU B;  5G55 A;  1LGR A;  1MJD A;  4W9H A;  4X57 B;  3LB8 C;  2N7D A;  1I4R A;  2MBO A;  4LDT B;  4FXC A;  2JWZ A;  2KTR B;  2EEL A;  4MEM A;  2KHW B;  2UU7 A;  3RN9 C;  5DPT A;  2W55 A;  1FM0 D;  3OG5 A;  3NZU A;  4BKS A;  2WXM A;  4DHJ B;  4ACF A;  1EM7 A;  1TGZ B;  3L17 A;  2ACZ B;  3ZUN A;  5BYQ A;  1CK1 A;  2X38 A;  1JQ4 A;  3UIO B;  2KO3 A;  1DOY A;  3ETR A;  5LLI A;  1F52 A;  1V1P A;  4KDI C;  4IWQ A;  3DBH B;  3GB1 A;  3GE3 C;  1FNU A;  3IG3 A;  2LHE A;  2PMV A;  4ZYN A;  1R7S A;  5L83 A;  5G5G A;  4B9K A;  3QX1 A;  3NJT A;  1IPG A;  4N6E B;  1Y8R C;  1SXT A;  5TSS A;  1ZP0 B;  3MC8 A;  3N32 A;  5GXG B;  4B0M A;  3I5J C;  3H6N A;  5IP4 D;  2E6X A;  1T3Q A;  4ZHP A;  2AEH A;  2Z59 B;  2IGD A;  4TQ1 A;  1HE8 A;  2LXA A;  5JZE B;  1WGD A;  3JYU A;  4JWU C;  1WFY A;  3W1S A;  3KYC D;  5H8Y E;  4O1N A;  2QJL A;  1MG4 A;  1Y56 A;  1QKZ A;  1E8X A;  1TZO A;  4REZ A;  1YQB A;  3DCG A;  3BK2 A;  4FHJ A;  4DXF A;  4ICU A;  3HM6 X;  3PHX B;  1TKY A;  2JRI B;  1A5R A;  1IYF A;  4A6Q A;  1FNV A;  3AE9 B;  1JRO A;  4IM2 A;  2V1Y A;  2KQ7 A;  3H1U A;  3OJ3 A;  4GDL B;  1GB1 A;  2LUM A;  4A90 A;  4HKZ E;  2HDE A;  2INN E;  2IBI B;  1RLF A;  1Q5W B;  2L00 B;  3BZD B;  1D6E C;  5AZH A;  2WDV B;  2KX3 A;  4YTM B;  2REX A;  2O2V A;  3B08 A;  3HVZ A;  4MJS A;  4J6I A;  2V4L A;  3DHI C;  1OQR A;  4EZJ A;  4US8 A;  2CHX A;  2PIA A;  2V3P A;  1XT9 B;  3R7R A;  1WJN A;  5C2T B;  3UI3 A;  3V3X A;  2OED A;  4NJ6 A;  3ZRF A;  2V3N A;  2GBM A;  4F1S A;  1UEL A;  2IPK D;  3TCA A;  3Q8C A;  4CHK A;  4MGI E;  2JUO A;  1GJZ A;  1K8R B;  2HTH A;  1ZPS A;  2PW9 A;  3BYT B;  4KX6 B;  1D5Z C;  4PYU A;  4S0R A;  1OFF A;  1LM8 B;  1V2Y A;  2N9K A;  1SB3 C;  1XLP A;  2MWS B;  2J52 A;  2KDI A;  4GXB A;  3HVD A;  3MFG A;  3A9K A;  3AE7 B;  1WI0 A;  4HPM B;  1VRA B;  3PZD A;  5I4D A;  2LJI A;  1VR9 A;  4W9D A;  3NVZ A;  1EF5 A;  2K8H A;  4JX1 C;  5AUI A;  1E7U A;  1I4G A;  2X8X X;  2WXI A;  1AN8 A;  2WLB A;  1OEY A;  4WIP A;  2M0X A;  3V61 A;  3L10 B;  3NHE B;  4C4V B;  3QK0 A;  1VCB A;  3QHT A;  2DZM A;  1NYR A;  5D2M B;  1STE A;  3B2G A;  2J53 A;  2HJ8 A;  1RWS A;  3ZJU A;  5HI1 A;  1PFD A;  2KC1 A;  4LLG M;  3I3T B;  2BYE A;  2AX5 A;  4NAW A;  3RNF C;  1UGM A;  2KYW A;  4K81 A;  1JWA D;  2WXJ A;  2FUH B;  4LNF A;  1PQS A;  1GPX A;  1F9J A;  2MH7 A;  2A4Z A;  2GMI C;  4EOY A;  3QAR A;  3AEE B;  3RMK C;  3UQB A;  2AQ2 B;  3EHV A;  4KIK A;  2LWP A;  2JT4 B;  2RDG A;  2K9X A;  2LVP A;  2GI9 A;  2QC8 A;  2JVC A;  5BMG A;  2KMA A;  2QDF A;  3PGE A;  4AS1 A;  2AQ1 B;  3V62 A;  4GSW A;  1YN4 A;  3JSV B;  3QIJ A;  2IY0 B;  1E8Z A;  3MHZ A;  4M0W B;  4I6P A;  1I4Q A;  4K7W A;  5EE1 A;  1R4M B;  3APF A;  3N1X C;  4K3C A;  2BQQ A;  4BFR A;  2FID A;  1M94 A;  2N7J A;  1TYG B;  1WZ0 A;  3NUH B;  1GC7 A;  3W2D A;  4KSK C;  3Q3N C;  1YOV B;  4FAD A;  1N63 A;  4DHJ D;  2MA9 B;  1EUV B;  2RGF A;  3MC0 B;  4CQN A;  2L0T A;  4LNO A;  1SIJ A;  1D5M C;  4MEL A;  3C0R B;  1FCC C;  3CSF A;  2LUE A;  2PJH A;  1ESF A;  2BWE S;  3IAM 1;  2I1J A;  4A8X C;  1DOX A;  2KAC A;  3WAM A;  2PEA A;  1ET6 A;  2RR9 A;  2D3A A;  1KTK A;  2BW2 A;  4YT0 B;  1Z2M A;  1TZ1 A;  2LGX A;  3M3J A;  2QIE B;  2IO3 B;  2KOX A;  2XK5 A;  3VQI A;  2QMT A;  2M8S A;  2VH1 A;  4K7U A;  2WU5 B;  1AWD A;  2WXK A;  2KN5 A;  3UGB B;  1H4R A;  3SDL C;  2N4F A;  4ANV A;  1L0Y B;  1WXA A;  1PDX A;  1JWU D;  4HKQ A;  2ZCC A;  1M4V A;  3H9D A;  2PLP A;  4BBN C;  4P1C C;  1JW9 D;  1RM6 C;  1T0S C;  2N7E A;  3T8M A;  4K1R B;  4DK5 A;  1C3T A;  2L3Z A;  5HKH A;  3WCQ A;  1WGY A;  2FCQ A;  2JSV X;  2MCN B;  1NEK B;  4DDI D;  3NOB A;  3DWM A;  4RGM A;  3VDZ A;  1SEB D;  3PZ7 A;  1NVI D;  3AUL A;  1WJU A;  1J19 A;  3K9P B;  4OVZ A;  1V5O A;  4E71 A;  3ZW3 A;  3Q3O C;  2BKF A;  4OW0 A;  1YX5 B;  3PRM B;  2BS2 B;  4K3B A;  4RMA A;  2QIL A;  2M17 A;  2FBW B;  3RCZ A;  3FIL B;  2MQJ A;  2KX0 A;  5BYS A;  3PRE A;  4TQ0 A;  1FD6 A;  3GOE A;  4OVU A;  1V86 A;  2AL3 A;  1N60 A;  1NYQ A;  5IAA C;  5J17 A;  4W9K A;  1FXI A;  3ZLZ A;  3P2B A;  3V6E B;  2KN4 A;  2CR5 A;  2RDB C;  2PE6 B;  2G3Q B;  2NPT B;  1WXS A;  2Y5B B;  3AE5 B;  1L6V A;  2W9N A;  2GB1 A;  5E6P A;  4E74 A;  1ZUD 2;  1XD3 B;  1JWB D;  1ZXH A;  1RRB A;  4HDO A;  1UBQ A;  5CX3 A;  3U8Z A;  5AEK B;  2V3S A;  2C9W B;  3AE8 B;  4BAX A;  3H8H A;  1I4P A;  4N59 A;  2K3U A;  3P42 A;  4IM0 A;  4FJV B;  2K25 A;  2AWT A;  2MHJ A;  4YSZ B;  2K5P A;  5IN7 A;  3BVZ A;  5C23 A;  5HFY A;  4XYC A;  2R2Q A;  4ZRP A;  3IFW B;  3E9S A;  4KGT A;  1WIA A;  2UWQ A;  4YWG G;  2VRR B;  4NQK E;  3MP9 A;  3EEC A;  2DZI A;  2NVU I;  4ANX A;  3V05 A;  2L8J A;  3GP7 A;  4P7I A;  4AWJ A;  4W9L A;  2KZR A;  2KWV B;  2IY1 B;  3KWL A;  2MP2 A;  1UZX B;  4PT5 A;  1QZE A;  3RNB C;  1WR6 E;  2DYB A;  1TT5 B;  4OZB A;  4LDT D;  2A5U A;  4M8N A;  3Q3F A;  1SE3 A;  2HTM E;  3A9K B;  4EZL A;  4L1B A;  5T8I A;  2MRP A;  5AUK A;  2EMS A;  2KT7 A;  5C3J B;  4KV2 A;  4TV3 A;  5J18 A;  2CHW A;  1WWT A;  3PPA A;  4GIV A;  4KGR A;  4LJO B;  2C7M B;  2AQ3 B;  2Y3A A;  2ZNV B;  3V60 A;  1UBI A;  1B9R A;  3FKY A;  4ARI A;  5FR6 A;  1QIL A;  1L7Y A;  2DBY A;  2ZPY A;  3AN1 A;  2N9X A;  1GAQ B;  4DHZ E;  2WXF A;  4K7S A;  4DWF A;  3TSS A;  1C9F A;  1ISN A;  1WM3 A;  2DYM A;  2BS4 B;  4C4V A;  4WJP A;  4KSL C;  2M0A A;  2ZW1 A;  3PLV A;  3VR9 B;  3VRB B;  5E6O A;  1NI2 A;  4RM8 A;  4WAF A;  3KUC B;  1K53 A;  3ZXV A;  1P3Q U;  1TJE A;  3QAQ A;  3BVM A;  3P4R B;  1WGG A;  3KVF B;  4EKU A;  2KMM A;  3Q3J A;  2L05 A;  3WAN A;  2ASQ A;  1MFW A;  4MT5 A;  2RMM A;  3R2I A;  4RCO A;  2BS3 B;  4XWW A;  2K6Q A;  4G50 A;  1V1O A;  2R2O A;  1BUI C;  2VH2 A;  1I4X A;  2KLG A;  4NNJ B;  1ZW7 A;  2OJW A;  3ALB A;  4GU2 A;  2N9L A;  1FIQ A;  3FAH A;  1TIF A;  2L0F A;  3BII D;  3RFZ B;  5L95 C;  4IKG A;  2WNM A;  2MJ3 A;  2W82 A;  3RZF A;  2ZPN A;  3R2T A;  4YSX B;  1Q1O A;  3AB5 A;  4MM3 B;  1UNS A;  3R7Q A;  4XZ4 A;  3TEY A;  3S2A A;  5AZF A;  3T9L A;  5EDS A;  5BYR A;  4BOS C;  2CHZ A;  1DGJ A;  2VZK B;  3TL5 A;  2C7N B;  3EA6 A;  3N9Y C;  3QCA A;  2KMC A;  3PLU A;  4BZA A;  2E3T A;  1YJ1 A;  2D3G A;  1CQV A;  3LDZ E;  2J7Q B;  1UUP A;  1CZP A;  2VZK D;  3BK1 A;  3NVW A;  3DHG C;  2KDF B;  3MHS D;  3RD2 A;  3A1Q B;  2WXH A;  3ZTC A;  1C76 A;  1SGH A;  1L2N A;  3ZKJ C;  2I38 A;  3IBE A;  4ARC A;  4QAY A;  2IZV B;  3EGR A;  4OZA A;  1WYG A;  5HG2 A;  1E9M A;  4LJP B;  2JWU A;  2XK5 B;  3NZS A;  2NBU A;  2YEP B;  5CHV C;  3ZO5 B;  2XBB C;  4IG7 B;  2LGY A;  3A33 B;  1HTO A;  3TBL D;  2LXC A;  2MW5 A;  3W5U B;  4DDG D;  2EMT A;  1ACC A;  1YIW A;  3RPF C;  2C7H A;  4EEW A;  3AEA B;  1PGX A;  4RF1 A;  1BT0 A;  3U7D A;  1YJI A;  2BF8 B;  3IT6 B;  3VFK A;  4KKI A;  1JRU A;  3V6C B;  3RNE C;  4B0E A;  1V6E A;  2PE9 A;  5TR5 A;  2WU2 B;  1WR1 A;  2MBQ A;  4EFO A;  2MBE A;  3Q8A A;  2GBK A;  1V80 A;  5CHW A;  1MHH E;  3KLS X;  3WAL A;  3EUB 2;  4OVV A;  3ZVV A;  4MGK E;  2NS5 A;  5H92 C;  2XN9 C;  1R4M I;  3DOW A;  4ZYS A;  4HPL B;  1J8C A;  2DX5 B;  4II3 B;  3WA0 A;  1KJT A;  3VRA B;  4USA A;  2JZP A;  3CIR B;  2IND C;  4IUM B;  2H88 B;  2WS3 B;  1RFK A;  1Z5S B;  3L16 A;  3Q14 C;  4NQL B;  5JXV A;  2LRW A;  2G45 B;  4JIO U;  2JRH A;  4D2K A;  2GLS A;  2KXJ A;  2JYT A;  2WDR B;  3DVN V;  3WIM A;  4DBG A;  2LZ6 A;  3HUI A;  4B95 A;  3CWI A;  2FIF A;  4EUT A;  3Q8E A;  4IC7 B;  5BMI A;  3PRP B;  2BB6 A;  2AYO B;  3Q8B A;  4AJY B;  3I9V 1;  3ZIM A;  3RUL A;  3UIN B;  4KDL B;  2W3R A;  2EKE C;  1HEZ E;  1PYW D;  3PT2 B;  4LK0 M;  4YXD B;  2FAZ A;  3W1Y A;  4AQ7 A;  3RT3 B;  3VH4 B;  4WWP A;  2K6D B;  2BYV E;  2KNB A;  2RPQ A;  2LFI A;  2L32 A;  3SR6 A;  2KVZ A; 
#chains in the Genus database with same CATH homology
 2JSV X;  3BWU D;  1TS4 A;  3BVG A;  4HRS A;  4UDU C;  1NEK B;  2H89 B;  3DWM A;  1P7E A;  4RGM A;  3NRZ A;  1KFY B;  3L4P A;  5MPO A;  1WGK A;  1SEB D;  3PZ7 A;  1VZ7 A;  3W5V B;  1JWS D;  1NVI D;  3AMZ A;  2KAJ A;  2DLB A;  2NTT A;  4OVZ A;  2SAK A;  1QT9 A;  3B2F A;  2OHF A;  1TY0 A;  4OW0 A;  3NS1 A;  1ENF A;  4GLS C;  5D7G A;  2BS2 B;  3LXF A;  1FEH A;  2QIL A;  2FBW B;  5E6J A;  3FIL B;  3TEW A;  5BYS A;  4TQ0 A;  4H2A A;  2JX5 A;  4YTN B;  2Q5W D;  4ZHO A;  1FD6 A;  4WUR A;  3P4Q B;  3AEG B;  4DXG A;  4RGN A;  4M0W A;  1N60 A;  2M56 B;  1NYQ A;  3ZJT A;  1XEE A;  1FXI A;  1EU4 A;  1N5X A;  1E10 A;  3P1M A;  2KN4 A;  2MJE A;  3VR8 B;  1OQQ A;  3AE5 B;  1L6V A;  3FC4 A;  2GB1 A;  1ZUD 2;  1FMA D;  1JWB D;  3LB8 C;  1ZXH A;  2K0P A;  2PKO A;  1I4R A;  3PZ8 A;  5HHD G;  2B76 B;  4FXC A;  1WRI A;  1QOG A;  3AE3 B;  1SSN A;  1TS2 A;  2EEL A;  3AE8 B;  2J42 A;  1EU3 A;  1YQ4 B;  4EE2 A;  3H8H A;  1TY2 A;  1I4P A;  4YTP B;  1UWM A;  4ITK A;  4N59 A;  2K3U A;  3P42 A;  1FFV A;  2W55 A;  4L23 A;  1FM0 D;  1EWC A;  2WXM A;  1XCQ L;  1EM7 A;  1PGB A;  4YSZ B;  2K5P A;  2ACZ B;  3BVZ A;  1CK1 A;  2X38 A;  5BYQ A;  5HFY A;  1JQ4 A;  1E7P B;  1TKG A;  1PGA A;  4ZRP A;  1DOY A;  3ETR A;  1V1P A;  2DYO A;  3ZYY X;  1ZDV A;  3E9S A;  1AW7 A;  1TS5 A;  3GB1 A;  1FNU A;  4KGT A;  4OZC A;  2LHE A;  2PMV A;  4YWG G;  3J9C A;  4LTU A;  2G9H D;  3MP9 A;  1ZOY B;  1R7S A;  3U2S C;  1FCL A;  4JE3 B;  3V05 A;  1YJJ A;  3TEX A;  1XO3 A;  2CU3 A;  3GP7 A;  3B9J A;  1SE4 A;  4RGT A;  1C79 A;  5G5G A;  1GB4 A;  3KWL A;  1FFU A;  2WXR A;  4N6E B;  3DWG C;  1V8C A;  2WXO A;  4PT5 A;  1SXT A;  2Y5P A;  5TSS A;  1FRD A;  1ZP0 B;  1FXA A;  5D3I B;  5GXG B;  4OZB A;  2PVO D;  4B0M A;  1L6U A;  3R8B A;  2YEP F;  2WXP A;  4MAC A;  3ZQ4 A;  2W3S A;  2E6X A;  1T3Q A;  4ZHP A;  2IGD A;  4TQ1 A;  1SE3 A;  1DYQ A;  1K50 A;  2HTM E;  4L1B A;  4JWU C;  2DWQ A;  5T8I A;  3W1S A;  1GOZ A;  2KDM A;  1C4A A;  5H8Y E;  1E0Z A;  2WQY B;  4O1N A;  4ZRQ A;  1SE2 A;  2QJL A;  1Y56 A;  1QOF A;  5AUK A;  1QKZ A;  1UGJ A;  1TZO A;  3AV8 A;  4REZ A;  2L83 A;  5C3J B;  1MVK A;  3BK2 A;  1XCT L;  1WWT A;  4DXF A;  4KGR A;  3U52 E;  1VDV A;  2AQ3 B;  2Y3A A;  2LHD A;  2WXL A;  3O13 A;  1B9R A;  3NVV A;  4ARI A;  1TKY A;  4N58 A;  1QIL A;  2DBY A;  3AN1 A;  4TSS A;  4A6Q A;  1FNV A;  3AE9 B;  1JRO A;  1XLN A;  1GAQ B;  2WXF A;  2LEK A;  3TSS A;  1C9F A;  1ZDX A;  2DYM A;  4GDL B;  1GB1 A;  2BS4 B;  1NI3 A;  1KH0 A;  2LUM A;  2M0A A;  1XF5 L;  4YSY B;  4TMA B;  5LNK 1;  4A90 A;  2ZW1 A;  5D3D A;  4HKZ E;  3VRB B;  3VR9 B;  2HDE A;  3P63 A;  2INN E;  1JCK B;  2Z8L A;  4WAF A;  1KLU D;  1K53 A;  2MEK A;  1J7A A;  1D6E C;  1I4H A;  1TJE A;  3BZD B;  3IAS 1;  4R3D A;  2CJN A;  3Q8F A;  4NAM A;  1EWY C;  2WDV B;  3BVM A;  2TSS A;  3P4R B;  4YTM B;  2WP9 B;  1ET9 A;  3HVZ A;  2KMM A;  1XLO A;  3AEF B;  2BBC A;  1XXG A;  1FO4 A;  1TKE A;  1VZ6 A;  2INP E;  4WH4 A;  4US8 A;  1OQR A;  2JQR B;  1QQR A;  4MT5 A;  2PIA A;  2V3P A;  1C77 A;  1QOA A;  2RMM A;  1N5W A;  5EE9 A;  2GRI A;  2IJ0 A;  3R2I A;  5C2T B;  3UI3 A;  4RCO A;  3V3X A;  2BS3 B;  2OED A;  4XWW A;  2XNA C;  2G1E A;  2BB5 A;  1SJH D;  3AE6 B;  3IT4 B;  1TS3 A;  1HQR D;  1V1O A;  4C56 C;  1BUI C;  1PUT A;  2D5G A;  2V3N A;  1I4X A;  4HJG E;  3MJ5 A;  2WXN A;  2IPK D;  1HZ6 A;  4XDC A;  1SBB B;  3Q8C A;  1V1P B;  2M19 A;  4XE0 A;  2N9L A;  2L1A A;  1FIQ A;  3FAH A;  1BML C;  4RFB A;  3AEB B;  3BII D;  3RFZ B;  4MH8 A;  1ZPS A;  2I2Y A;  2PW9 A;  1RYJ A;  3BYT B;  4C80 A;  4KX6 B;  1D5Z C;  4IKG A;  2WNM A;  3Q69 A;  2MJ3 A;  1OFF A;  2W82 A;  2N9K A;  1MHX A;  1J7C A;  1SB3 C;  1XLP A;  3R2T A;  2J52 A;  4YSX B;  3AH7 A;  3AB5 A;  3HVD A;  2NTS A;  3MFG A;  4MM3 B;  3AE7 B;  4IDI A;  1UNS A;  1JRP A;  4P6V F;  1L0X B;  1SF0 A;  1AYF A;  1LO5 D;  1VRA B;  1JAL A;  2ICI A;  3TEY A;  4KKJ A;  5BYR A;  1DGJ A;  1T6B X;  1IUE A;  2VZK B;  4HRO A;  4XDD A;  5I4D A;  4RH6 A;  2LJI A;  4P16 A;  1VR9 A;  2RPV A;  1C4P A;  1L4Z B;  3NVZ A;  4WWM A;  3EA6 A;  3N9Y C;  3HRD D;  4JX1 C;  2JU6 X;  1N61 A;  1ROE A;  2E3T A;  5AUI A;  1P7F A;  3BYY B;  3FIL A;  1DOI A;  1MPE A;  1I4G A;  4RNA A;  1KRH A;  2WXI A;  1AN8 A;  1CQV A;  2PVG C;  2WLB A;  2QSD A;  3C8Y A;  2ONQ A;  4WIP A;  1L4D B;  1UUP A;  1CZP A;  2FE8 A;  2VZK D;  3BK1 A;  3IXS A;  2J4X A;  3NVW A;  1B1Z A;  1NEN B;  4WQM A;  1NYR A;  4A55 A;  2WXH A;  2JXT A;  1STE A;  1C76 A;  5FR3 A;  3B2G A;  2I38 A;  2J53 A;  2IGG A;  4Q2J A;  3P4P B;  4ARC A;  1RWS A;  3ZJU A;  5HI1 A;  1PFD A;  4LLG M;  2SEB D;  1F77 A;  1VJK A;  3EGR A;  4OZA A;  1WYG A;  2AX5 A;  5HG2 A;  1E9M A;  2JWU A;  5FK9 C;  3PO0 A;  3AEC B;  1JWA D;  2WXJ A;  2LGI A;  2Y5C A;  1E6E B;  2KQ4 X;  3AM9 A;  3ZGZ A;  3KWV A;  2YEP B;  1GPX A;  3LYY A;  4JWS C;  2MH7 A;  3P4S B;  4NJC A;  3AEE B;  3ABV B;  1KF6 B;  4GDK B;  2AQ2 B;  1ZXI A;  1ZE3 D;  2L52 A;  3W5U B;  1CJE A;  3NZ3 A;  3SR6 A;  1ACC A;  4ZOH C;  3RPF C;  4DQO C;  2EKI A;  2RDG A;  3E56 A;  3AEA B;  2ZW0 A;  1QOB A;  2K9X A;  1PGX A;  4RF1 A;  1K51 A;  1HXY D;  3AE1 B;  2ON8 A;  2GI9 A;  1YJI A;  1JML A;  3IT6 B;  5BMG A;  3SEB A;  2BYT A;  4AS1 A;  4KKI A;  2AQ1 B;  2N0S B;  3NVY A;  4XWT A;  3URY A;  5FKA C;  1L5P A;  1QF6 A;  1YN4 A;  4B0E A;  1N62 A;  1FNW A;  1C78 A;  3MHZ A;  1YN5 A;  1I4Q A;  2WU2 B;  1D4B A;  1SJE D;  2MJD A;  2K22 A;  3Q8A A;  5EE1 A;  1HZ5 A;  1MHH E;  3KLS X;  3EUB 2;  1D5X C;  2N7J A;  1MI0 A;  1J7B A;  2V4I B;  5H92 C;  1TYG B;  2XN9 C;  3NUH B;  2BTE A;  3U7Z A;  3I57 A;  1HA5 A;  3W2D A;  1YNT E;  2JYE A;  2KWD A;  4ZYS A;  1YQ3 B;  4OHJ A;  1V97 A;  1XLQ A;  3T3N A;  4C7Y A;  1N63 A;  3VRA B;  3AE2 B;  3U4E G;  4USA A;  2JZP A;  3CIR B;  3MC0 B;  4CQN A;  4A9A A;  3SFE B;  2V0G A;  4NZL B;  1A70 A;  1SIJ A;  1VZ8 A;  2H88 B;  4KGS A;  1D5M C;  2WS3 B;  2CJO A;  1RFK A;  3GS2 A;  5EE0 A;  5JXV A;  4JPS A;  2WXQ A;  1FCC C;  2R61 A;  2NMQ A;  4C7Z A;  1C4C A;  4D2K A;  1ESF A;  3AED B;  1Q10 A;  1FRR A;  5G5H A;  2JYT A;  3SFD B;  2WDR B;  5BMH A;  3IAM 1;  1JWM D;  1IBX A;  2IDY A;  3HUI A;  1IBX B;  2WDQ B;  4A8X C;  4RGO S;  1DOX A;  2KAC A;  1QLB B;  2LMC A;  4HEA 1;  1ET6 A;  1IGD A;  1T5X D;  2W54 A;  1I7H A;  3CWI A;  3OWE B;  1KTK A;  2BW2 A;  1WSP A;  4YT0 B;  2RDH A;  2FUG 1;  1YMH E;  4NAW B;  2QIE B;  3Q8E A;  2IGH A;  3KQ4 A;  5BMI A;  2BB6 A;  1YN3 A;  3VQI A;  1BXT A;  2QMT A;  3Q8B A;  3ZJV A;  1L0V B;  4L2Y A;  1UWX A;  1K52 A;  2PTL A;  4US9 A;  2WU5 B;  1AWD A;  3I9V 1;  2WXK A;  2W3R A;  1L0Y B;  1HEZ E;  3T3O A;  1F2R I;  1PYW D;  4LK0 M;  1PDX A;  4YXD B;  1JWU D;  4HKQ A;  4RF0 A;  3TEZ A;  4AQ7 A;  1M4V A;  5EE3 A;  1KLG D;  2PLP A;  1WXQ A;  1JW9 D;  1RM6 C;  1F2R C;  1VLB A;  3TUO A;  2WXG A;  1IGC A;  4IOI E;  2QEJ C;  2LFI A;  3W9C B;  2L32 A;  1F0Z A;  4J3O D;  3AE4 B;  2BT6 A;  3WCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...