4HRXA

Crystal structure of kai2
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
VVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, alpha/beta fold family protein
publication title The Structure of the Karrikin-Insensitive Protein (KAI2) in Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 95
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hrxA00
3IURA 3ZI7A 1MU0A 1QFSA 5ALUA 3LIPA 3D2AA 5FPPA 2PUJA 3K9BA 2XQKA 3WYNA 4OUKX 3O9VA 2OCKA 4K6HA 1H2WA 5FRDA 1CUBA 1D07A 1CUZA 1XRMA 2WTNA 2PSFA 4X93A 5EI5A 5LKAA 1L7QA 2DHDA 3KDAA 4LYDA 5CW2A 5AM1A 4B82A 5ALPA 3B5EA 3D7RA 3WWOA 1QIFA 3BIXA 1U4NA 1CIJA 2AJLI 5AM5A 3WWPA 2HA6A 3STUA 1DTEA 1R50A 1H2XA 5AI0A 1W76A 1G4HA 2WUFA 4J0IA 4MEBA 1UWCA 4X3CA 4J3JA 5CT6A 1X2EA 4HVTA 4M0FA 3C5VA 1LBSA 5J3JA 1DQYA 1EVQA 4L3WA 2VT6A 1AX9A 3I1IA 1XROA 5CXUA 5ALMA 1JT2A 4KE6A 1J2EA 2IITA 3IBTA 3STXA 4ZWNA 3AIKA 3HEAA 3N2ZB 3V1NA 5I7UA 5AI6A 4FFWA 4CCYA 3GBSA 4UHDA 1IUNA 3W06A 4C6HA 4EHBA 1L7RA 4U2CA 2C7BA 3KXPA 1LBTA 2WG2A 1SFRA 2OCGA 5LKRA 1MX5A 5F4ZA 4F0JA 4RE5A 5LZ5A 1W52X 2FUKA 2JEYA 4BRZA 1CUIA 1JKMA 3DYIA 3WK7A 4F5ZA 3G7NA 3H04A 3QMWA 2C5GA 5E4JA 5T4HA 3D5EA 1QIDA 2WJ4A 1UKCA 5A7GA 2HA3A 3RK4A 1ODCA 1RWQA 4GECA 1UK6A 2YH2A 1PFQA 1XKLA 4AX4A 2D0DA 4AZ3A 1LZKA 3IB3A 4JH0A 3R3YA 1WOMA 2G5PA 1K5PA 2QZPA 3VXKA 1QIIA 5AOAA 2I03A 5JANA 2WILA 3HACA 3WKEA 1HBJA 1MTZA 2O7RA 4Y2XA 4BTLA 1UKBA 3H19A 4KYVA 2XQGA 1FFAA 5K3DA 2WFLB 3CCBA 6YASA 2JGMA 3DNMA 1FFEA 3DDUA 2ECFA 1XZMA 4AO7A 1YS1X 2BAGA 3W05A 4H7FA 2QXTA 2WSLA 4U2GA 5A71A 4X94A 4AB1A 5ALVA 5HF5A 1XZJA 1AC5A 1UOQA 3TEJA 1BE0A 3V1KA 4FKBA 3JWEA 2OGZA 3WK8A 2XMZA 4PSDA 4P08A 2Z5GA 1XQXA 4DMKA 4BDSA 3FLEA 4WFIA 1UK7A 1F6WA 3DQZA 1YCDA 3WLAA 1J1IA 2QTBA 1LPOA 3WZMA 3RM3A 4H7HA 4Y2YA 3STWA 3AIMA 2CB9A 1ZICA 3QZUA 4G4JA 5T4BA 4UPDA 4ROTA 5EHNA 1CUVA 5K5EA 4MQLA 3GELA 1B41A 4MEAA 1GKLA 2GZRA 4H7IA 2HDWA 4ZREA 3Q8WA 4BE4A 5EFZA 4FOLA 4KAFA 4B84A 5BWBA 3U0VA 3IULA 3A2LA 3QVMA 1XQVA 2RONA 3LLCA 4HXGA 2WG1A 4XVCA 3WA7A 3C6XA 5ALXA 2VA9A 5BOVA 3OC0A 3WIOA 3QMVA 2V97A 4ZXFA 1QTIA 2QJRA 4ZI5A 3ZV7A 3H2JA 3WZLA 3HRHA 5AM4A 1XQWA 3WK4A 4Y2UA 1Q83A 4MYDA 3WJ2A 3FAKA 2EDCA 1XZDA 4LYEA 4RGYA 1MJ5A 1JU4A 1MO2A 5EIAA 4J0GA 2HM7A 2XE4A 4G5XA 3AZPA 3EF3A 2J4FA 3NOXA 1DINA 1CVLA 2V9ZA 2G5TA 3I2GA 1H2ZA 4UHHA 3FSGA 1LLFA 4UHCA 1TQHA 3LS2A 1AKNA 1DX4A 3TRDA 2QOEA 1A7UA 1OXMA 1EI9A 4DIUA 2QR5A 4UBLA 4RE6A 1ZD3A 2WIDA 4G4IA 4YX9A 3I6MA 5A7FA 1WCYA 1XRRA 4B81A 2VATA 3FOBA 5ISMA 5EIEA 4DSAA 2E3JA 3M3DA 2DHEA 4Y2TA 5ALIA 1QLWA 3GA7A 3STYA 2AJBA 2PUHA 1ZI9A 1CLEA 4H7JA 3HZOA 1Y37A 4E15A 1H22A 2WLSA 1XLVA 3C45A 1CUGA 3AZOA 4QZVA 2GZSA 2CJPA 2CKMA 2ZYRA 4HRXA 3X3HA 1QIGA 3WK5A 4C4YA 5AK6A 2C0QA 4DNOA 5FDFA 4BP8A 5JYCA 2ZJFA 1P0PA 1EA5A 1VXRA 4J0CA 4GEGA 2IX9A 4DYHA 2JGEA 3ESAA 4CFSA 4U2EA 5HF8A 1WPXA 4H0CA 1QIEA 4Y2VA 3WL8A 4DMHA 4GLBA 5AK4A 3FYTA 1UKAA 3H2GA 4BZZA 3WKDA 1LZLA 1UK8A 3BL8A 3LCRA 4MWTA 5JZ9A 5AI5A 4UBMA 5LLSA 5CH5A 4J0KA 3W04A 4X00A 1TCAA 4Q3OA 4BDTA 2J4CA 2JEZA 2C0PA 2CBGA 5C8VA 3G0GA 2H7CA 3SX4A 1H2YA 4H7EA 1MAAA 4IQ4A 1CUUA 4BE9A 3AILA 4X6XA 2HIHA 2ZSIA 5AH0A 5EHQA 1XZFA 3HJUA 4MJ3A 3AZQA 4K5QA 4X97A 1EVEA 3OM8A 1P0IA 2VF2A 1QFMA 3STTA 2BJHA 2WHPA 4BBZA 1CUXA 2AJ8A 2WUDA 1CUHA 4J0DA 5T4FA 4YASA 5SYMA 3V1MA 5AI8A 4MWSA 1R9NA 3MUNA 2NW6A 2DFPA 1LPAB 4BZWA 1ZD2P 1HLGA 2ONCA 1GPLA 2JIDA 2ZVDA 4CIBA 1BN6A 1DX6A 1QO7A 5ALDA 4HRYA 1MX9A 4I4CA 4J0HA 4OU4A 1XZEA 2OAGA 2AXEA 2HU7A 4L0CA 4CG2A 4KJXA 3LP5A 1QGED 3OG9A 5A62A 2GYWA 1XLUA 1EK1A 1EH5A 1VJ5A 4M0MA 1DU4A 2WFMA 3R3UA 3KWFA 5T4EA 3T52A 3ZPXA 2ACKA 2QUBA 3IVMA 4QWMA 2XLCA 4PW0A 5ESRA 4U2DA 4OSEA 4HXEB 2BUBA 4E46A 1EX9A 4BC1A 1CUSA 3F97A 1E8NA 4WFJA 2RGUA 1X70A 4ETWA 3PF8A 3P2MA 4Z49A 5D3KA 1IZ8A 1TIBA 2WQZA 2Z3WA 5KREA 1K8QA 4OU5A 1ORVA 1LPNA 3AUKA 3DKRA 3CN9A 1ZGBA 1CV2A 1VZ2A 1E8DA 5E4TA 5BWCA 4FNGA 4UBJA 4LXIA 1C4XA 3WKBA 3QH4A 1BU8A 2Y6UA 1W6RA 2JF0A 2V98A 4BYMA 1R88A 4G8CA 3PICA 2J3DA 4W1QA 5AKZA 4LKOA 1JJBA 1WB5A 3NWOA 2PU5A 4HTAA 4BCCA 2C4HA 5AIBA 2RI6A 5CT9A 1ZD5A 4RPCA 5DYYA 3G0CA 5AIAA 5EHZA 1ACJA 1W1IA 2WKWA 1DWQA 2OLEA 4EUSA 3W9BA 2WIJA 1FJ2A 4P93A 4BCDA 2WJ6A 4W1RA 5CXXA 3WKAA 1ZI8A 4B6GA 2XQJA 5AO9A 1THTA 4C87A 5AKHA 4A23A 1YB6A 1KU6A 3WKCA 5KWIA 4N8EA 4BAGA 3C5WP 3IDAA 4W1SA 3O4JA 2WIFA 1CFJA 5AKEA 1GQRA 2VAVA 3ZWQA 4AO8A 1P0QA 4FHZA 2DQYA 4Y7DA 4PNZA 1K4YA 5IVKA 1BN7A 3WQHA 2G4LA 1QTRA 4UBNA 3K6KA 1E5TA 3STVA 5IVIA 3VVMA 1XQYA 4B80A 2BCEA 1BROA 3H17A 3ILSA 4G1FA 5AICA 1HPLA 5ALJA 1CUDA 2OCLA 4WY5A 1CUAA 1XZKA 4TPKA 7YASA 3O4HA 4D9JA 1CUEA 3BDIA 5EIHA 2XMRA 3WIBA 5ALOA 2D5LA 2ZJ6A 2QT9A 2AJCA 4UHEA 5CTAA 1CRLA 4BVJA 2X8BA 1HDEA 3EBLA 3IUNA 1LGYA 2X76A 2OAEA 2W22A 1N5MA 4TGLA 1XZCA 4S0XA 4RNCA 1Q84A 4Y2RA 1JI3A 4Y9SA 3WWCA 4AO6A 4FBMA 3WL7A 5A6VA 4QDOA 2QKYA 4DNPA 1QJ4A 1RYYA 3UUFA 3OTQA 4Q34A 4KE7A 4V2IA 3FSGD 5ALRA 2XMBA 4N5IX 4B85A 5JD6A 3R3WA 2JGKA 4KACA 1SCKA 1XRNA 4NZZA 1CUWA 4BB0A 2EEPA 2DCMA 1JMKC 1WM1A 1GKKA 4PSUA 5HKAA 4K6GA 4AMYA 1H23A 4XWGA 4N8SA 5AKGA 2OPHA 4MYSA 4WJLA 3EIOA 5JD5A 5CRIA 1LPPA 1VXOA 2XB6A 1Q0ZA 1SOMA 2QMQA 1EDDA 4GWLA 1R4ZA 3VJLA 3MVEA 4QDXA 5K3FB 4YK7A 2GBCA 1UZAA 5ALKA 3ZLVA 3R41A 5DJ5A 2HHAA 4EY7A 4HXFB 1IMJA 4DNFA 4DMCA 5AKLA 1A88A 1AQLA 4PF1A 1DQZA 4ZV7A 4EA6A 1NU8A 3GUUA 4X92A 3PFBA 1JFRA 3BJRA 2H1IA 3DKKA 5IVDA 1XLWA 2B20A 5JAPA 2JGLA 1PJAA 4ZRDA 3RKSA 4TVKA 3R3XA 2H7XA 1XZLA 5CBKA 2HRQA 4DNQA 3RLIA 1O6FA 5LIPA 5FPQA 4U2BA 4BATA 2ZSHA 3E0XA 3UMJA 4WY8A 3W9UA 1ODSA 1YAJA 1MAHA 3C6BA 4X91A 2PSJA 3D0KA 2O2HA 4EBBA 3HC7A 5IVHA 4GBGA 3H2KA 5JATA 1SCQA 3V1LA 4G9GA 3V9AA 4X85A 1ACLA 1EB9A 3QBJA 2XUGA 4I19A 2XLBA 1ZOIA 2QS9A 2HA5A 2B9VA 3EQ9A 2XUPA 1VLQA 1LPMA 3PUIA 5E4YA 3YASA 3HI4A 2QUAA 4X6YA 1PV1A 1QE3A 4OB7A 2XUDA 3WK9A 2HADA 2PX6A 4X95A 5HFAA 3WMRA 4KE9A 3PF9A 2GBIA 3H1AA 4QA9A 5ALTA 2R11A 1FFCA 1CUCA 5A7HA 3EQ7A 3BF8A 1ZJ4A 2JGIA 1MPXA 1YSCA 3PFCA 1ODTC 3E3AA 1VKHA 2VSQA 4W63A 4BRSA 3I2IA 2OGTA 5AK3A 1E89A 2CMFA 5ALYA 2HA2A 2HFJA 4G8DA 3O95A 2XMDA 4LHEA 4QDZA 3C6ZA 1XRPA 2H7YA 5DYTA 4J7AA 1QIMA 4GI1A 4ZV9A 2XUHA 4IHAA 1K6EA 2GBGA 4JYMA 5JZSA 4BAZA 2RHTA 5AI4A 4KRYA 5CH3A 3E1GA 1MNAA 2ZYIA 2VT7A 2WHQA 2CZQA 1Z68A 2OGSA 1XZGA 3I1YA 2WFLA 4FLEA 4F60A 2FX5A 1ZIXA 1LPSA 3ANSA 2WU4A 3I2FA 2B4KA 3IA2A 2C58A 4UHBA 1E66A 2XMCA 3ICWA 1UOPA 1F0NA 1EHYA 5DNUA 5CURA 1QIHA 4UBIA 4N5HX 3M83A 1QO9A 2J3QA 1XKTA 2WJ3A 4DSZA 4DLNA 4AQDA 4FNMA 2ZYSA 5D3ZA 2ACEA 5A2GA 3H0CA 1T2NA 5KBYA 4NS4A 1WHSA 2XUOA 5C7YA 2BUCA 3OPMA 1B6GA 5AM0A 3G0DA 5K3FA 1Y7IA 4PQEA 3R0VA 3VJMA 1ZIYA 5FV4A 1A8UA 1QIJA 2WM2A 4CCYB 5FOQA 2YYSA 4H18A 1R3DA 2WUGA 4CCWA 5HQ3B 3BDVA 4B9AA 3KSRA 3R40A 3A70A 4C4ZA 2B61A 2PU7A 3UUEA 3L1HA 2JGJA 1EB8A 4GHWA 1Q0RA 3WYDA 5BV7A 2OCIA 1ZD4A 3ICVA 5LZ7A 2LIPA 2PL5A 1THGA 1CQWA 2O2IA 3WA6A 3W2TA 5AKXA 2HU5A 4JUIA 4OCZA 4KE8A 4LXGA 4UFOA 2VTVA 4OD0A 1MT3A 3IIIA 2BGNA 3OOSA 4HZGA 3MGAA 4H35A 3DL7A 4IH4A 3VISA 1OCEA 4EY4A 5JALA 2XMQA 3C87A 1GQSA 3GROA 3QYJA 2PSDA 2DR0A 1C7IA 4LIPD 2O2GA 3DCNA 3BE8A 4OB6A 4BP9A 5FLKA 3TGLA 3F8SA 1JJFA 1USWA 1CUFA 3IUJA 1ISPA 3HABA 5CT8A 1NU6A 5AOBA 4BAUA 1FFDA 4M0EA 2XUFA 4KAJA 4BC0A 5JAUA 5ALFA 1Y7HA 4X6UA 5ALGA 2HRRA 3DOIA 1N1MA 1EDBA 2RHWA 4BTVA 1I6WA 4W9RA 4UUQA 4U2FA 2I3ZA 4WCVA 2XI4A 4EZIA 3B3QA 5K3EA 4H77A 3CXUA 1ETHA 1YASA 1VA5A 3KOOA 3I2KA 2QRUA 4XIIA 1UK9A 3JW8A 3L1JA 4L9AA 2YASA 4B0PA 5HK8A 4A5SA 4XJVA 2H9YA 3I6ZA 1XRQA 1TCBA 5ALSA 4CG3A 4PV7A 2X5XA 4WFKA 3FCXA 2HA4A 1IUOA 4OYYA 4AN0A 5DNVA 1JU3A 4K2AA 3H18A 2VQ6A 2ZJ7A 3FWHA 3EQ8A 4G4GA 3VVLA 2DQZA 4AZ0A 1BEZA 3SK0A 3VKFA 5AM2A 3IUQA 1BCSA 5AM3A 1TRHA 1YAHA 2QM0A 4YPVA 3R3ZA 2XUJA 2OQIA 2PSHA 1VOTA 3WL5A 4CIAA 3QPDA 4QWWA 1TK3A 5FP0A 2G63A 1E8MA 3U1TA 2HL6A 3OURA 1IVYA 3G0IA 5AHXA 1EK2A 3AIOA 4FLFA 1VE7A 1R9MA 5YASA 2XMGA 5FKJA 4W1PA 3GFFA 2PSEA 1YB7A 2Z8XA 3FLBA 1HL7A 3G8YA 1U65A 4UBKA 1OILA 3O0DA 1K63A 2YXPX 5AKYA 4KR0A 2VJDA 5HK9A 3H2HA 2ORYA 1EDEA 3HLKA 5HQ3A 5HF9A 1W4LA 1CPYA 4E11A 2WTMA 5AI9A 1G5FA 1DWPA 4PSCA 3G9XA 4G9EA 4FBLA 3C8HA 3MUOA 1TAHA 2OQVA 4O08A 3AFIA 3HYSA 2XQIA 1MX1A 4I3FA 4KEAA 4DTCA 3ANTA 4P9NA 4J0JA 4MXDA 2Q0XA 2XUAA 3C43A 2WU3A 3BF7A 4JNCA 1CR6A 3A6ZA 3WI7A 5EHXA 1T4MA 3ZLUA 4H7DA 1ZI6A 1DWOA 4JEIA 3C6YA 3CN7A 5FUMA 3D59A 3D2BA 2WUEA 4IH1A 4Q05A 4Q82A 4QLOA 3L1IA 1DT3A 5HFNA 3PE6A 1NX9A 4EY8A 3B12A 3CCCA 1CUJA 5JADA 2RIPA 3PI6A 1P0MA 2EDAA 2WHRA 2R8BA 3C70A 1GPNA 1BCRA 3S8YA 1SC9A 3C8DA 1ZJ5A 1E3QA 5HZGA 3QITA 3S2ZA 2Y1KA 1N8SA 5I9IA 4HS9A 1W75A 3ZLTA 1IUPA 4HAIA 1FFBA 2JGFA 3G9ZA 4EY6A 2VAXA 5SYNA 3I6YA 2QJWA 2VJAA 2Y6VA 3TJMA 3D2CA 3WJ1A 3AJAA 2GYVA 3M82A 4Y2SA 3Q0TA 5C8ZA 3I2JA 4K6KA 1EINA 5JIBA 4FTWA 3D3NA 4BVLA 4Q3KA 2ROQA 5D7BA 4NMWA 5DTJA 2WFZA 4DMFA 2Z3ZA 4WDQA 1F8UA 3K2IA 4NVRA 1WPRA 3FYUB 4UBOA 2WIGA 3NGMA 1BEEA 3PUHA 1A8SA 1VA4A 4EB0A 4QDUA 1UXOA 3ED1A 1LPBB 5AOCA 5JARA 3LIIA 4X71A 1UFOA 3RARA 2VJBA 1ORWA 2BKLA 2O7VA 4OPMA 3I2HA 2VEOA 4KAAA 5FXMA 4FWBA 2WHPB 1HKHA 4XX1A 5C81A 4UHFA 4AN1A 1IZ7A 4OB8A 4CG1A 1CUYA 1QIKA 3G0BA 1N5RA 1AGYA 3FLAA 3A2NA 2XDWA 4Y2PA 5DTIA 1C7JA 2DSNA 3DD5A 5HF6A 4KRXA 2OG1A 4FFVA 2XQFA 3WWEA 1QZ3A 4AXBA 4QE3A 1QOZA 1XFDA 3O9MA 3FCYA 4FLMA 2FJPA 2HA0A 5ALHA 1XZHA 5ALWA 1EXWA 1VZ3A 4JYPA 3WL6A 4B7ZA 3VJKA 3QPCA 1O6GA 3FBWA 1YA8A 3JYHA 5JAHA 5AKIA 1YS2X 2WG0A 4A16A 3BXPA 4B9EA 4IO0A 2HU8A 4H7KA 3D4LA 3SC2A 1YR2A 1ZGCA 5DWDA 3DYVA 5HCUA 2PBLA 3G02A 3FNBA 3F67A 4QEKA 4MQMA 3IUMA 2XUQA 1WHTA 4GDMA 1CQZA 5JZBA 2QXUA 4UFPA 1SCIA 3SWWA 4DM7A 4BCBA 4Q3LA 2AJDA 2W6CX 2PVSA 3O4GA 3G9TA 5LZ4A 1GT6A 1HQDA 1G66A 2PM8A 1KU0A 5LZ9A 4FMPA 4ARAA 1BS9A 1JMYA 5E2IA 5C8XA 3DL4A 4E14A 2PKYX 2GYUA 2FJ0A 1XRLA 4GW3A 5AJHA 2BGRA 3H2IA 5CT5A 5H3HA 5KWJA 5I8PA 2HA7A 4C4XA 4PO3X 1TKRA 1AUOA 2V96A 3N0TA 2XUKA 5IH7A 1S8OA 1J06A 5LZ2A 1X2BA 4C01A 5ALLA 5EGNA 4QDTA 4B83A 2Y2UA 5JD4A 5HKBA 3DEAA 4L72A 5JAOA 5K3CA 1L7AA 5AKJA 1QONA 1MN6A 1AURA 3O4IA 3M81A 2UZ0A 5IKXA 4ARBA 2P8SA 1UT6A 3DS8A 2HFKA 3GZJA 1BRTA 1FSSA 2XUIA 5LZ8A 5AP9A 1A8QA 3G9UA 2DHCA 4P92A 4Y2QA 3H1BA 4QLAA 4X7BA 4C88A 1WB6A 5K3AA 4G8BA 4QNNA 3F9CA 1GXSA 1R1DA 1JJIA 4UFNA 1VE6A 3ESDA 3FYUA 3AINA 3DOHA 3A2MA 5DLPA 3QPAA 2BFNA 2RAUA 2WIKA 3FVRA 4FDMA 3F98A 5AKKA 1UOOA 1GPKA 5JASA 2CUTA 2XMSA 5D6OA 2XT0A 2K2QB 4ITVA 3V48A 4GXNA 4Y2JA 5ALQA 3QM1A 2CEKA 1XZIA 2BUAA 4ZGBA 3QMMA 4Q1VA 1GGVA 4AMZA 4INZA 1YA4A 2OXEA 1KEZA 1M33A 2PPLA 3BWXA 3E4DA 2Z8ZA 4B0OA 3R3VA 3HSSA 3FYUC 4J03A 4EY5A 1U8EA 1AMNA 1XZAA 1F0PA 4X90A 3NUZA 2IIVA 1XZBA 3DLTA 1DT5A 1RP1A 4OYLA 5AK5A 5K3BA 1AZWA 3ESBA 1TCCA 5ALEA 5LYYA 4DGQA 4LXHA 4N8DA 5DYWA 4WDRA 2C5FA 4BVKA 3FVTA 3KD2A 3DJYA 5CMLA 5ALNA 5CH8A 2QVBA 3F96A 1GZ7A 2GBFA 1J07A 3T4UA 3VDXA 4CI9A 4F21A 2JBWA 3KWJA 3WK6A 4IH9A 1U2EA 5DNWA 1G42A 4C89A 1MNQA 5LP1A 3BIWA 2I3DA 2Y2VA 5ALZA 2I78A 1WB4A 2ES4A 3ESCA 2VJCA 5CT4A 3HXKA 3BJMA 2ZYHA 3I28A 3PDCA 1CEXA 3WWDA 1LNSA
chains in the Genus database with same CATH superfamily
1COWD 1OAOA 1VHLA 1M0EA 1K9VF 4CQMA 3NTLA 2Z09A 1ODFA 5C37A 3LLSA 3LIPA 4C0SA 3PXBA 3MJFA 4RHEA 5FPPA 2G07A 1O5TA 3HKCA 1NFQA 4TUYB 2PUJA 3IL2A 1N3YA 2IH4A 1MT0A 4MS4B 4W99A 2PKQP 2WSSA 2A5DA 4BNGA 1ZNWA 2R62A 1K08A 3L6UA 5I7FA 4JEMA 1HE4A 3ETDA 3O9VA 4Y6QA 3HJGA 4TV8B 2OCKA 2WSMA 2OA0A 1KE1A 1JJ7A 2FUG1 2MSWA 4FHCA 1GQOA 4HDRA 4G84A 4MKFA 3P4XA 1CUBA 2HN9A 4XB1A 4XJSA 5IDQA 3ADCA 5KOJA 2CLLB 1OA0A 3DHEA 2GKOA 3IKVA 3GJ0A 4X93A 1ZM2A 5HYVA 1CQIB 3PENA 3BE5A 3OSUA 5AM1A 3OF3A 2YVUA 2D6FA 3MWYW 2Y0BA 1E9DA 2P67A 4LDPA 1KA9H 1ZYUA 2ZUSA 3NETA 2BH9A 1B73A 2ALJA 2IK8A 2FW7A 3D3WB 5EA2A 1KMIY 1NA5A 3CIOA 4IIJA 3QEAZ 2JLWA 5HCNA 2PKCA 1U3GA 1CIJA 3R7BA 3F0TA 5LU8A 5AM5A 1NW5A 1V5GA 3PC2A 4MITA 1PEKE 4EX7A 1W9MA 1Z0SA 1FTYA 4GXRA 1KXJA 1BKDR 4PCAA 3G5MA 3F7MA 4V0LA 2IBMA 3OX2A 1J00A 1JDZA 1S01A 2C3MA 3MJ4A 3IP8A 3GUYA 1W76A 5ARCA 5HM6A 5F9FA 5B6JA 3UV3A 2H4JA 2ZYDA 4MEBA 3FMIA 4Q4AB 4X3CA 2FKAA 3NONA 3PLNA 4MKHA 3WWZA 1NDUA 2NAFA 1X2EA 2J0UB 3QELB 1EFDN 4GD3Q 5CT6A 5F4BA 3TLGB 1A71A 1NZJA 1QJCA 1IBCA 1KVTA 1Z0ZA 3PHGA 3K1TA 5J3JA 1EVQA 3MTJA 5HCIA 2IYTA 2OHXA 1Z7BA 1D0IA 4QUDA 2H5JA 5KTMA 2IYPA 3EW9A 3I1IA 2V1XA 1KYZA 2EOAA 4EATA 4HX9A 3QFFA 4GQAA 3E5HA 2PANA 1UDXA 2JFWA 1J2EA 5A1JA 5BRJA 4OHBA 3TD9A 1CC1S 3JTMA 3MWEB 2GVDC 3OJFA 2BEUB 3NBZC 4ZWNA 5KJEA 5FD8A 3STXA 3AF2A 2C1EA 1L4YA 3BQNB 4F11A 2FDCA 3AIKA 2CE7A 5I7UA 4WINA 3PTLA 3B7WA 3GDGA 3U9LA 3Q3HA 1RE0A 4Z51A 3HCAA 3IDOA 2I2DA 3OM1A 4XDGA 5D2CA 2JH3A 2P35A 2QXYA 3E22B 4WZAA 2X0EA 1V1MB 3JPYA 3X2EA 4C4TA 3GBSA 1P2VA 1NV8A 1SC3A 1XMSA 2IOFA 4BWVA 5KMGB 4WERA 3QU2A 2LDBA 5KKCA 4D4HA 5F1OA 1GZ4A 4O0MA 2XB4A 1EAMA 1G8GA 3GMDA 1MBZA 3FKSD 3K9GA 1OZAA 4IHJF 4KWIA 3VR4D 3O4RA 2AW3A 3QHPA 4EEKA 5LXTB 1YBAA 1H8ED 4M98A 4U2CA 3FCEA 4WACA 2A1TS 2OCDA 2Q21A 3OEHD 1UWKA 4FXOA 4GWKA 4N0DA 4V38A 3X1MA 5BT8A 3PHBE 4UATA 3IHKA 1IN1A 1EP3B 2W2LA 1QDUA 3GBPA 2OCGA 2WIBA 3MPUA 2WUWE 2ZK7A 1TJPB 5EY5B 2JFPA 1GNVA 1N5OX 4O5OA 4F0JA 4RE5A 3UMGA 1W30A 4G65A 1IXRC 4LDAA 1KRWA 3WYAA 1A9PA 3K1AB 1GSOA 1IVSA 3DBLB 1UP7A 1U7PA 4BXOA 5IC6A 3O4FA 1M7BA 1IC6A 1JKMA 1JDNA 1U0TA 1WE2A 4FCVA 3ZH2A 2BHNA 1BE1A 3DYIA 2EV9A 4B47A 4GMFA 5LDDC 1Z5VA 1FMLA 2PD3A 1L5QA 3JVDA 5HQJA 3WK7A 4YJHB 3EF1A 1E5LA 4F5ZA 3TLKA 4ZT3A 3I45A 3D6JA 2B37A 4Q1AA 4WUTA 1B3BA 3FNQA 1OOEA 2ST1A 5E4JA 3VO9A 4R81A 2I6SA 4KLRA 1V7ZA 3P26A 1QIDA 4R2KA 3UJDA 1VKZA 1YC2A 2ECOA 4EA9A 1UBRS 3EWAA 2YIJA 1PEAA 3TDNA 4U0KA 3EVZA 4RIEA 4UUNA 4NIMA 2FUEA 1YO6A 3E3LA 3RU3A 2QYSA 4WADA 3PSAA 16PKA 5IJAA 1ZHOA 4UQOA 3RK4A 1DEHA 3AUFA 3ORHA 4OIFA 4A27A 5C1DA 5CDYA 1COWA 3L04A 1RWQA 1Z4LA 3CEMA 1TC2A 4HWRA 5C1IA 3KRTA 4KVGA 5EUMA 4R71A 5KHLB 1A1SA 1BJTA 3CT4A 2OFXA 2YCLA 4RQBA 4DJ5X 1AHPA 1XKLA 4QEDA 4AX4A 1DBWA 1B8VA 8ATCA 2XXAB 4MHSA 1A9SA 1BGWA 1XEFA 3O21A 1EFPB 4GIBA 1XELA 5I9SA 4C7BA 4CTKA 3CS3A 4LJ9A 5JR3A 2A30A 3PQEA 1B6SA 1ZGHA 1H9BA 4UMEA 4UVDA 3NAGA 4ZCQA 1WOMA 2F1OA 2B0CA 1K5PA 3KIPA 1Q3TA 4K6FA 5HIMA 3S3TA 2IBSA 1CS4C 3KZKA 4G97A 2WILA 4KP7A 4KFTA 4JELA 3WHLA 1GA4A 4QYSA 4E1AA 1VGQA 3C3PA 1MTZA 2ADOA 1GUBA 3R20A 3J81A 2LWIA 3NHMA 1VLZA 4J1NA 4DY6A 4ZEVA 3H19A 2GM9A 3MQ2A 2ZB2A 5JXHA 1IM8A 3GAFA 1B14A 2Q28A 2OVFA 1ACMA 5ER6A 5LBUA 1Q0QA 3CCBA 4JXZA 2O3JA 1T3SA 4Q7MB 5FI0B 2Z95A 1O7JA 2JGMA 2A88A 3ZJ4A 1WDMA 1FFEA 1GARA 3DDUA 1J56A 5BPHA 1V8FA 4EFKA 1IL0A 4LHXA 1PP4A 1XZMA 4NFHA 1NRXA 3VU8A 3QXJA 1LY1A 1YS1X 4JKYA 1CNMA 4Q7KA 3P0RA 3X44A 3A4NA 1H4TA 3W2EA 1K8RA 2CXNA 1RM4A 4MPDA 1Y6FA 3I62A 3EIXA 2J3LA 1VJDA 3C7DB 3WOHA 1S3SA 4L50A 4ZO9A 1F8GA 3RRJA 4NY1A 2D54A 3C3XA 1X7WB 2O8DB 3OE7A 2NNWB 5CX1B 5NLLA 4UPEA 3ASUA 5THXA 1LQTA 4LNUB 2NVUA 1R0SA 1DDIA 3FIJA 1L4GA 5DM60 1BE0A 1XSEA 2HQ1A 2J33A 1T3GA 3AUUA 1WB9A 1QU3A 5CJPA 2P4UA 3NVKI 3OWHA 1DLIA 2G1JA 1T0IA 4MI1A 2OGZA 4UUOA 6REQA 4PSDA 1CP2A 3IP7A 4HAYA 1RXYA 3RU7A 1X86B 1TEVA 1GJRA 5L4LA 3KFVA 5MHTA 2RHCA 2C31A 1SN7A 3D8TA 3HDYA 3NTOA 1PBTA 3B7PA 3FLEA 4C3VA 1CY1A 4DCPA 4D4JA 1Q3KA 2JGNA 5JS1A 1NUSA 3WLAA 4IYJA 5L95A 3N39C 1HYGA 1Z73A 1ECGA 3IDZA 2AMJA 2XJ9A 2ONJA 4JB3A 3UQZA 4E03A 1V5IA 2GFIA 4IVRA 4GX1A 4ZP1A 5CFZA 3PYLA 2OMKA 3T9DA 2A35A 3UIEA 3FKSA 3K70C 3KAKA 4TUYA 5JQGF 1KIAA 2KBFA 1H8EA 2MMCA 3WMEA 4D4MA 4ND8B 3QZUA 2RD2A 1W2WB 3UMMA 1XPRA 1SULA 4BKMA 1BO6A 3ZU6A 2C1XA 2Z8YA 3G2QA 4XYMA 1SUPA 1VCNA 3QKUA 4TVBA 1ZHFA 4FPXA 3F6PA 1Y3FE 2R8PA 3QUBA 5K2OA 1G9XA 1GG2A 2PL3A 2QRVA 3I42A 2ZRPA 2OXFA 4OHKA 3AWDA 2BGIA 1X9IA 3KS9A 3PUJA 1CQIA 4H7IA 2CNDA 4JJEA 1Q57A 1S0UA 2Q4EA 2V3WA 1DTSA 3KXLA 1OF1A 1NI4B 5CB0A 1VE9A 1SXQA 1Q74A 4J2HA 5TT0A 1GFWA 3D3WA 2NTJA 4TMXA 3Q8WA 4ZREA 3T7AA 2A5FA 4UM7A 2RGRA 4L28A 1ZK0A 1IH8A 2EL9A 2QRQA 4KIGA 4MVJE 4NESA 4WCFA 1VJCA 3P5SA 2VJOA 2P91A 2VZEA 2QUZA 1B8UA 2C94A 3GCZA 4TTPA 4HADA 3A2KA 1NY5A 1NOKA 5IZCA 3E9EA 4BQFA 4F1WA 3O1IC 3HYTA 4JWTA 3L8FA 5BWMA 1XQVA 4B3FX 2OXRA 4MI9A 4DR2B 4UUMA 3AJ8A 4G1VA 1Z6XA 4Q4AA 5ALXA 1JQJC 2WDPA 5DU2A 1JEQB 3KJQA 4Z1MA 3OC0A 4RTLA 4PTZA 1LW6E 2J0UA 3QELA 4IUDS 2XE8A 5TPZD 3TLGA 2KQUA 2R4QA 3IEMA 1MB0A 1FDIA 3BBLA 3Q12A 1U8YA 3X1XA 1XTRA 2NU9A 4LA4A 1XZNA 2H92A 5E3JA 2A78A 1PUXA 4DJJA 2Z5LA 4B6EA 1NQAO 1D0VA 1KHTA 1PIWA 3HM9A 5EIBD 1R4NB 1OX5A 4BPRA 3BJEA 2NUTA 3G2HA 1CEEA 2YYAA 3H2JA 1VMKA 5IDVA 3WZLA 5JS7A 1OLUB 2X8AA 2HGSA 1Q83A 3FAKA 2PWBA 4F93B 2TMGA 1XZDA 5ILGA 2GK6A 5JYEA 3L8MA 4RGYA 1MJ5A 1RAEA 2JCBA 4K05A 5IYZF 1PJ2A 4ZQEA 2PX0A 3E22A 3BCHA 3DR5A 4NCAA 1V1MA 1RM5A 4LJSA 2P9ZA 2VR1A 3IGFA 1G7SA 5KMGA 3CVYA 1PJ4A 3HU1A 3IILA 4I1UA 3O8CA 1V1JA 2X2PA 1JEAA 1GL7A 1REQB 4MR9B 2YWFA 3RGWS 1CVLA 2FOLA 4Q01A 3DZBA 3RV3A 5FWYA 2G5TA 2VNSA 2WAYA 5LXTA 1KGSA 1CY8A 1OTHA 4I5FA 4JYZA 1C41A 5BNFA 2JS7A 2HK7A 3W5VA 4UD2A 1H2ZA 1V26A 2A9RA 2OQ2A 1NOIA 2D62A 2E0IA 3HKBB 3G8DA 4JZYA 2NO4A 3C39A 3KQOA 3H6KA 1JA9A 4Q1EA 2YKGA 4KIWA 1C3JA 2ZBRA 3I30X 3JRNA 4GKJB 4NCXA 4H9GA 3TRDA 1A7UA 4ENTA 2G36A 1OXMA 4A5OA 3K1AA 4EYKA 1FP4B 1LI4A 2HLDA 3DBLA 3I8SA 3JPWA 3RU2A 3U4GA 1W35A 1E9VA 3IPLA 1RRPA 3ZCVA 2ABWA 1Z0KA 5H80A 4FR2A 4YJHA 1D1SA 2FE4A 4YX9A 3I6MA 1KXZA 2BZGA 4WRRA 1ZRMA 3EXHB 4ZMSA 3VKUA 4V3BA 1RBYA 1NJ1A 3CPSA 5EKTA 5A7FA 1O89A 3GNLA 4NS1A 1WETA 4E6PA 3B1FA 4YTEA 1IRXA 1NLFA 2WJJA 3FOBA 3HUUA 1A50B 3GUZA 4JLVA 2XA1A 4D8WA 3RVBA 3RASA 4B44A 3NHBA 4I5EA 2J41A 1TAQA 1SB9A 1Z6PA 5CCBA 2H3EA 3A9RA 3NORA 2MSCB 5T5QA 5ALIA 2FPPB 1NQTA 2QHXA 2VDQB 3QTBA 1FLAA 4YO7A 2GAIA 1YBHA 3H05A 4B3GA 1V43A 3PT9A 1NVTA 1JVBA 1QGAA 2CNKA 3DQPA 1NT4A 2PRSA 3PDJA 4F3KA 4R1MA 1ZMOA 2R2AA 2H1LA 1LDGA 4NMMA 1O94A 4BUJA 1EFPA 3M3HA 3ZWWA 3BZWA 4QYIA 3AFHA 1LDNA 3I0MA 3ZWYA 4TL7A 3FZNA 4GT1A 4UVIA 3RVMA 1Y37A 3MXTA 1E2EA 3EYWA 3IVCA 4MB6A 5KX5B 1U3DA 1OLSB 3AZOA 4B3MB 5EUBA 5B30A 5JCJA 1SB8A 4YAIA 1QF6A 4QZVA 2L0XA 3PHIA 5AJVB 2C07A 1Z2AA 2ZQ5A 5HIIA 2G1KA 3E1KA 4HRXA 3AY6A 2I7XA 1QIGA 1TC1A 3AR2A 1XJWA 1N5IA 3HN2A 3L0SA 4QPJC 1C1XB 3ROZA 1H85A 4WXPA 3OFND 4FE3A 4OO3A 4UVGA 4PGAA 4DNOA 4DKJA 4OEHA 4BP8A 3SLKA 3U17A 2ZJFA 1P0PA 1N2ZA 3TLJA 1T8RA 4PYIA 4S1OA 1XAJA 2DE0X 4MIKA 3ZN2A 2O3TA 4Y1RA 2P6UA 4IGFA 1CJCA 1VXRA 1XD2B 2G06A 4GEGA 2EP5A 1W5EA 3ZHBA 1FB5A 1J9ZA 3RBZA 2YZ7A 4DYHA 4E22A 2QW0X 2JGEA 3ESAA 1TW3A 3LFUA 4AP9A 2W8BB 4H0CA 5DHRA 4AX8A 1QIEA 5K0TA 4C7OB 4CQMD 3KM0A 1Z5WA 2ZWAA 5SZKB 3IMFA 5TPZA 1X7WA 3FYTA 4B8YA 121PA 1UKAA 2GDZA 2NXCA 3H2GA 4J91A 5CX1A 3WKDA 4JZKA 4BZZA 5K8IA 5IT0A 4DEXA 4LNUA 1JFSA 4MV0A 2C96A 4EX6A 3UMCA 4MWTA 3TTSA 3COZA 3EPRA 1WKCA 3Q3GE 5ECDA 3EOAI 3OEED 4JJAA 5IN4A 1OLXB 1WZIA 3SYNA 1IZYA 4MA5A 4BLVA 4E5KA 1USIA 4J0KA 1B7GO 2NQTA 3ZU2A 2AVDA 2XE6A 1DEOA 2PA0A 1Y42X 2V6GA 1SCNE 3OOJA 3PWSA 4BNZA 4BDTA 1KQFA 5B1EA 4LQLA 1IBMB 1BXGB 3TFWA 3NHPA 3R9XB 3MRVA 4CIYA 4HMPA 1VI2A 3G0GA 2MHCA 1NXTA 4KKVA 5TEWA 4Z3KA 4YLEA 4QC2A 2I3GA 9ATCA 1R10A 4QT0A 1XGKA 4KR7A 2NU6B 1OV4A 2J48A 1MAAA 4H7EA 4YCCA 1ZMTA 4WQMA 1I7NA 4LBZA 2J59A 2P0AA 2J9YB 4MPRA 5AXCA 3PIIA 2EKLA 4FYPA 3DF9A 4ND8A 5K0BA 3AILA 3QF7A 2OTCA 2NZ8A 3FZGA 2PUTA 5E2BA 4FB4A 1N7HA 4GQIA 4AY4A 1OFUX 3W79A 1KDYA 3JARB 3OVMA 1JEOA 1VJGA 4MJ3A 4Q9KA 2P5SA 1Q7GA 1DIAA 3F7NA 1XNJA 2HJ9A 2BKUA 1P1RA 3BTUA 4GYJA 4MULA 4DQLA 2AD5A 1EUDA 2ENWA 1UANA 4KQCA 2XPCA 1DBRA 3T0IA 1C3LA 1P0IA 1X9HA 3ILXA 4BX0A 2LIVA 2YR0A 3FHOA 1ZIOA 5JQGB 1NBMD 3V7NA 4KTTE 3PHLA 1KMCA 1C9KA 3BX1A 5A5EA 1QLHA 4L08A 4R69A 1DIRA 3A1CA 5AESA 3GDWA 1Z7EA 4HWOA 3GLHB 3UA3A 2C84A 2WUDA 3I4FA 3PVZA 1CUHA 2B34A 3P0IA 4OQPA 3SYRA 4RO0A 2C5EA 4J0DA 4QUAA 3QLVC 3WOVA 3N0RA 3WADA 2ZGVA 1T25A 4D6XA 2E4XA 2IT1A 2IOQA 3UBTA 2PGLA 4KLCA 3TIFA 2EXXA 3ETGA 2G0AA 3K0CA 1HX7A 1JG6A 2HREA 3UMSA 1JEQA 4W4TA 4TYQA 2CK3A 1KRXA 2BR4A 1LRKA 1AHHA 2JRLA 3FWNA 1T5HX 4FX5A 4D96A 5AI8A 3E5MA 1SURA 4RWZA 3I9KA 2EQ5A 3UCEA 5AUPB 3VNSA 1RP7A 4RKRA 4EVRA 3ONEA 2DFPA 3KE9A 2IGTA 1R4NA 2A5GA 1ZOPA 3VPDA 3JRWA 3MAGA 5LD2C 2ONCA 3L0OA 5AFSA 1WXXA 4EW2A 2W6ZA 1KDRA 4EHNA 1OLUA 1XYGA 3NHSA 3PNPA 4IIJF 3L6DA 3TRJA 4L3VA 3MQFA 1T9GS 1THZA 1KZ7B 3ECCA 4JGBA 4QYTA 1MMFB 4X1KB 4EG1A 1EESA 3ENQA 4M1TA 5I9BA 3ZVNA 1DKOA 2B3TA 5T6BA 5I8WA 1PLKA 2PY6A 1ULAA 5UKDA 4CM1A 1F9EA 1NSFA 2F9MA 4KFRA 4MR9A 1REQA 3AUJB 1XVVA 3CF2A 3RYTC 2XVYA 2RK3A 1C8VB 1GEEA 1Z5GA 2OB2A 2FWAA 4L0CA 4EG4A 3THWB 4CCSA 3F1LA 3OCXA 4ND7A 3HKBA 5T64A 1DAFA 1J9GA 1X8XA 2GYWA 4JFAA 1KDOA 1PZHA 1HYBA 2HK8A 3PNLA 4CUZA 3FSEA 4HF7A 1EK1A 2PR7A 1RI2A 1FYFA 4RSRA 1EH5A 2Q7DA 3VR6H 3L6EA 4M0MA 3WFIA 3C0KA 4RL6A 1QM5A 1UBSB 4PHGA 1FP4A 2RH8A 5E2AA 5F3RA 3VSEA 4KXQA 3CF0A 4UXIA 4HT3B 3R3UA 3KWFA 3OOYA 4J2OA 4LWOA 3T52A 5BP7A 1A2BA 2WIAA 3R0IA 4Y18A 2R8EA 2QLMA 4COKA 2WTUA 3GT0A 1QCYA 9GPBA 3LV8A 4LE1A 4QWMA 3OESA 1CJMA 5FTJA 2XLCA 4ZOCA 1KF0A 3H1FA 4DA6A 1T1IA 3RVOA 4ETMA 5LUAA 3L6RA 2E82A 5CNKA 2XZDA 3ELDA 3WR5A 3EXHA 1JHOA 1VMAA 5DSTA 3H9GA 4PVCA 4E46A 4E94A 4NDNE 3WYEA 4BBJA 4D43A 2IPNA 4AECA 5TLSA 2ANCA 5CK5A 2CNOA 4NG4A 5KNBD 2BM0A 2X2EA 3E8MA 3EIEA 3QVKA 3VUFA 4Q19A 2ZIFA 1ZKMA 3KKOA 4GZ6A 4YMVA 2R97A 3WDMA 2O8EB 4WFJA 3R7SA 3LYLA 2RBKA 3M4YA 3WLRA 1CVIA 2FPPA 4D3SA 4ETWA 1G2PA 1VE1A 4X5OA 3H8VA 4LHZA 1TECE 3T5TA 3J81k 3CR7A 1HFJA 2D7CA 1TIBA 5KVSA 1FUYB 1P7VA 2J5RA 3TDMA 5AQ1A 4OU5A 3IB6A 4UNIA 9ABPA 4YRQA 2I29A 1IY8A 1OZHA 3F5QA 4ETIA 2YWHA 5HTOA 4PZCA 1LPNA 1HMPA 1FVHA 1KVSA 3AUKA 3R44A 3WIVA 2ZXUA 1UF9A 3CN9A 4INAA 1K8ZB 1XA0A 4UAUA 1WVGA 2IS2A 1H2EA 1PLLA 2V9CA 3R8XA 1XZPA 1ZIDA 3I4LA 5KX5A 3K09A 3DDZX 2PXCA 1OLSA 3GXBA 3BWEA 3NNDA 4CT0A 3PNMA 3GHHA 1AS2A 4CYMA 1P7ZA 1X1AA 3DGFC 5COQA 5C32A 2WQ6A 5E4TA 1U6JA 3D3QA 2AHRA 4FNGA 3LC7O 4UBJA 5EOVA 4LXIA 1SXHA 4RABA 4OHOA 4U8GA 1TD9A 5CAEB 3UT5B 3W90A 5BR4A 1W34A 1V16B 1E1CB 2JCSA 1BU8A 1C7QA 2P2LA 1SA0B 1RYHA 1GNTA 4HGNA 5CCEA 4PG6A 3WGTA 2FOIA 3OF2A 2YNMD 1M2OB 1YJCA 1ZNYA 1UM9A 4G8CA 4NFYA 5K6RA 1M6NA 1PDVA 2O2ZA 1B1AA 1ITZA 3BKWA 3PICA 4HN4B 4MYTA 1ZSVA 3LT0A 1XPJA 4U39A 4XXHA 4YS6A 3URKA 3T1YB 2Y77A 4W1QA 2DOKA 2QPTA 3CEAA 1M0TA 5AKZA 3ZKWA 1XD2A 3PKJA 4M54A 5FB3A 3UKOA 2F55A 2G6TA 2C4HA 4FEAA 3K31A 4GNRA 4MHOA 1NVVR 2IU0A 3U3ZA 4B45A 1XE3A 5IRCD 4Z4IA 5CD1A 2HV9A 1OXXK 3B82A 2WSBA 4J0EA 1CJKC 4OI4A 3R76A 2R1VA 2AFVA 2W8BA 4MV1A 3G82C 2Y1CA 2Z0MA 4OXRA 3V3KA 1YIAA 3ND9A 4PHCA 5KVQA 3DEHA 5DYYA 4D0RA 2QBYB 3G0CA 3HP4A 5AIAA 2FWJA 2QMOA 3PNQA 4A7PA 2X2FA 4X54A 6AT1A 2GILA 2J3JA 5JLAA 1RBZA 3DEYX 3OKAA 2OLEA 1QYWA 1C9EA 2JFUA 4L3OA 5BN4B 3SN6A 1KZGB 3ZE6A 4QT4A 1DVRA 3AQ4A 4U1RA 3B60A 3BJIC 5EZQA 1KYVA 1ABBA 1G3RA 2IP4A 4FUQA 1VKOA 4Y67A 1FJ2A 2JIMA 3HYNA 4U02A 5A3SA 3I2YX 1CQPA 1DGQA 4W1RA 1DO2A 1RAGA 4POAA 5CXXA 1WY7A 2G9RA 1QHYA 4Q6WA 1XC7A 3MOIA 4BLQA 3BH6A 3I6QA 1BXGA 4QD3A 2D2EA 5HBGA 1QRRA 3PCXA 3G2JA 5AVVA 1SUBA 2IYOA 1UFKA 1JLLB 2P68A 3TBFA 3F5MA 4A23A 2Q41A 4NONA 1SQFA 2ZWMA 3C6KA 4IJ5A 3DFFA 1KU6A 3OCWA 2ORWA 2NU6A 3OTOB 2PQ0A 4R2HA 4GBJA 1F60A 2E85A 4DANA 4DJFC 3WNBA 4BKRA 5JCPA 1ATIA 1WCWA 3O4JA 5I47A 3AI1A 2WIFA 4DA8A 1E3SA 3ZYCA 5BW4A 1UXJA 4Z4HA 1SKBA 1CFJA 1Y9DA 2NP6A 3P5BA 3C1OA 4J9VA 3ZDXB 2VAVA 3JARA 3N6XA 3G8CA 2QQ0A 3ZWQA 1SHTX 4AO8A 1P0QA 4M21A 5CB8A 4PYRA 4FHZA 1NSTA 4UMVA 1YC5A 2BZ1A 4Y7DA 4AZVA 1A76A 3KUXA 1DUSA 1JGTA 2DFDA 4G3XA 4PNZA 5JPIA 2JI6A 4JODA 5F7ZA 1K4YA 3DZKA 1R00A 5IVKA 1Q1EA 2AE2A 1AO3A 4JKIA 3WQHA 1D9ZA 4PR0A 2IDJA 4UBNA 3HB9A 4EF4A 1LBEA 3D02A 5CLGA 1OH7A 3AEZA 2Y1DA 4B80A 3KOYA 2BCEA 4OJNA 1V3TA 2UXBB 3SQOA 4UQPA 3TI9A 3S28A 2ZUBA 4DA9A 3H17A 1CKEA 4PLZA 3TQFA 3WHIA 4DIFA 5A9SA 3GLHA 3EEIA 4KUEA 1XLTC 2P4HX 4NXMB 2DBRA 1HPLA 3ZBQA 3EGXB 5ALJA 3TIGA 3EBPA 1GRCA 1GUFA 1S89A 2FK8A 2OCLA 4TUYF 2REBA 3ZCPA 2I87A 2FF7A 1AUXA 4YWHA 2H2IA 1FYXA 1ONBA 1GGJA 4G85A 4D9JA 4NNPA 3ETCA 1BS1A 2AN1A 3GD5A 2QTZA 4MV6A 4R84A 2P5YA 5EIHA 2J6IA 2C2BA 3ZW8A 5JHHB 5JASA 4P0PB 3H3FA 4AUMA 4BQRA 3BPSA 5C4IA 4KITB 1RM0A 1Y6RA 3G1TA 2I1VB 4ZVVA 1WZNA 2X8BA 1HDEA 1MEEA 3EBLA 2LTAA 3NTUA 5GOZA 3T1QA 1LGYA 2W22A 2UZAA 3FOAA 1ZMRA 1TZCA 3CLRC 3RROA 1SU8A 2GCGA 3HLTA 4ZAZA 1S7CA 1XZCA 3D8RA 4I9HA 3BMNB 4FGJA 2QMUA 2QT1A 3GVXA 1Y3BE 3AHCA 3I3OA 3G5UA 1A69A 2G08A 3E9MA 1M6WA 2PL9A 3WWCA 4UXHA 4PO1A 1S8FA 1CX9B 3RFXA 1S3IA 3PGMA 1JA1A 4RAQA 3GNQA 2OC4A 2PGIA 2DULA 2EHDA 2ZVQX 4DNPA 5GZ3A 2PRZA 4AP5A 1SCBA 2FU5C 3I92A 3KO8A 3PXGA 4FW8A 4RESA 1PFKA 1C8KA 5LMUB 4RJJA 4E13A 1DRKA 3OTQA 3R5HA 4Q34A 3KR2A 4N0EA 1KC3A 1WXDA 2YNMA 3EWNA 4KLNA 2ZS9A 3EHEA 3OD5A 2HSJA 3THWA 5G3ZA 3S2GA 2I55A 1UDWA 3HG7A 3W34A 4KODA 5KWEA 3MA0A 1BHJA 1PKEA 1Y9JA 5H82A 2H4XA 3DVAB 3IQZA 5F98A 1YZHA 1YU9A 1Z5OA 3SSNA 3GCGA 1KH3A 2GUWA 4RDIA 2BI8A 1JZQA 1YZUA 2XSZA 1QNFA 4K9PA 3B3FA 3UYLA 1DDOA 3V8QA 5MFZA 1C5KA 2ZAIA 5IM5A 5J59A 4BB0A 5CVTA 1O3YA 3AFOA 3H8JA 2DCMA 2DTXA 3CLKA 1JMKC 1S5PA 3I3SR 4MQBA 4F7WA 3T5PA 3CX3A 4XFKA 2D1RA 3VZDA 3FX2A 1V96A 2X22A 4AXBA 4PPGA 3REQB 1NVUQ 4YHHB 5BO5A 2M6RA 1JXMA 2P2ZA 4K6GA 4AMYA 4CTJA 2XKBA 2PIAA 3TJZA 5E1DA 3OIFA 5DB4A 2Q3BA 4YRGA 2DRIA 2QTGA 4BLWA 2LCFA 2Y3IA 4R54A 2GPWA 4HGRA 2QG4A 3OTHA 3FTEA 3EIOA 1ECCA 2CWDA 3F74A 1P4GA 5CRIA 4BECA 1ZKDA 2B4YA 3OO0A 5LXTF 3K4HA 4DZTA 1KEVA 5I7EA 2O8EA 1VXOA 1PNVA 2Q0QA 3GYBA 1RRFA 2OV1A 1WHSB 1NAIA 3KYDB 3GOQA 5E95A 1EDDA 5K4HA 3QPBA 4BVAA 2PUCA 3VJLA 1FSFA 2WOJA 3DT8A 1A9ZA 1E0KA 1MVLA 4YK7A 4Z4EA 3WGGA 3BWYA 2PQ2A 4BLUA 3ZU3A 1Z34A 4YUZA 3MUFA 2QORA 5E1MA 5DYNA 5TT1A 3MF4A 1BD3A 3O1HB 4X7RA 3V8MA 5DJ5A 3U5TA 4L9RA 3EPJA 1E2DA 1YZYA 4PQGA 2HHHB 3TLMA 3QXHA 3FH0A 2P7IA 4O2AA 4DM3A 1AD2A 1NVBA 2BLLA 1VHJA 4AWBA 4DMCA 4BKUA 4F1KA 4PF1A 2J3EA 3SQLA 1E3DA 4P4LA 3VNQA 2P79A 4WZBE 4ZV7A 3N0WA 4EA6A 2IRWA 3ZV4A 5AW4A 1HQYE 2VF8A 3F47A 2Q5FA 4F5WA 4B7AA 3IAUA 1Q7EA 3IVRA 3O8DA 5CAEA 3OY2A 5TSDA 3LHKA 3OWOA 3MLBA 4Q39A 1HT1E 3CIFA 1KPGA 1SA0A 2XY4A 3OIYA 3WDSA 3ZDQA 5JAPA 2JGLA 1AB5A 1M2OA 4J0FA 4L5JA 3RKSA 1XCJA 2YS6A 4IIDA 2APJA 1E0JA 3E70C 1BA2A 1JR6A 3PR3A 1AUQA 2BGKA 3F7OA 1TPYA 4DB4A 2OM6A 4KR9A 1AJEA 2OESA 1ULTA 4WN9B 4I1SA 4BWYA 1X80B 1FPQA 1C9YA 2DFVA 2XQVA 4ZQFA 3OPQA 3WL4A 3H5VA 1XMJA 2XXJA 3RLIA 3SIWA 2JFGA 1E5XA 3W5CA 4PPFA 5E3HA 4XGNA 2EX0A 4RMIA 1EFHA 3A14A 3KUCA 1N9KA 2V0NA 2XTMA 4BATA 3DLCA 4C20A 2QBYA 3CLSD 2CN1A 4JBYA 1O96B 3UMJA 2E9SA 4WY8A 3ZQ4A 4EPVA 1YAJA 3RG2A 5HPYB 2D8AA 3C6BA 4GVXA 4NR0A 4BBPA 4EA8A 2ZKIA 1RWOA 2FHSA 4OREX 2V9PA 1GPJA 1SBYA 3ZVRA 3JQRA 1UH5A 2FV8A 4CN9A 4BNLA 3H2KA 4KGVA 2OC9A 4C22A 2Q2NA 4JOCA 4Q18A 4LYYA 3V9AA 4QODA 2PS0A 4MZXA 4X85A 1VC2A 5E6UA 2D4AA 2XDYA 2QE7A 1DC5A 3LNTA 2GPBA 5A05A 1NF8A 1P6UA 3SYKA 4UARA 2XUGA 4I19A 4AUEA 5KSYA 4WOJA 1EWVA 1NXPA 1XDWA 1E7YA 2QS9A 2OO7A 3SZUA 5FFFA 2C04A 2HA5A 2VDNB 4FGZA 4QOIA 3WDKA 3ZWCA 3EQ9A 4D9EA 1JLLA 3NBAA 2XUPA 1VLQA 4K1XA 1Y6ZA 2OVBA 2OZVA 1HQCA 3TLCA 4TS4A 1SVIA 1YDEA 2I6GA 3K0BA 1IOZA 1R5BA 3KLMX 3WAGA 3ADDA 1QE3A 5C5EA 2CVOA 2EAUA 2HADA 3S1AB 2WAMA 1HETA 2VH1A 3UJNA 4F2DA 3MHTA 3IDQA 4IGIA 3WMRA 1Z7WA 3IT2A 3DV0B 3FGZA 2H6EA 2M98A 2GBIA 2O3RA 3F6RA 2IE8A 2CFSA 4Q02A 1QK4A 1W1WA 2BMVA 1ZINA 4QA9A 5ALTA 5B3AA 5DBOA 4A8JB 1JUDA 1C7FA 1KORA 4Q21A 4EWLA 1OVMA 1SOUA 3ESRA 5K0ZA 1PSZA 5CR9A 2MYUA 3T94A 1X87A 5DKFA 2A0UA 3HYCA 3K8YA 2FPKA 3HCBA 4G1EB 3MSXA 5BNZA 3H6HA 4UTPA 2HZBA 2BISA 3P0FA 2ECKA 4LRXA 5AVQA 5CDGA 4W63A 4QQRA 1ZJZA 4EG0A 1LA2A 1IE3A 4H1TA 3L7JA 1V1RB 5BORA 3A04A 2Z6VA 4DPKA 1C0LA 3IJEB 3IIJA 3F4LA 4LK2A 3PGVA 2CMFA 2C3OA 4FYHA 3NNNA 3QKWA 5LQAA 2YW2A 1CZKA 3ROTA 2AFIA 4URXR 2HFJA 5IHXA 1ENOA 1U0OC 1VSUA 2DPGA 3PX3A 2DYKA 4MRMB 4V02A 3HGQA 4PN7A 3Q7RA 4WNCA 4QDZA 2ZJZA 3TVDA 2RHMA 2H7YA 4J4BA 4LC1A 1FQKA 4M1KA 4YUVA 4J4HA 2FETA 3TXXA 2A1TR 5CDUA 3HI6A 3NTQA 1Q95A 4JYCA 4ABTA 3I58A 4AJOA 4ZV9A 3ZHRA 3U7GA 2JLXA 1G6Q1 3H2SA 1K6EA 5D8DA 3CUWA 4JYMA 2D4HA 4DFDA 1QZZA 2F9LA 2YVLA 1IJFA 5JZSA 1VCIA 2DG2A 2FYTA 3AL3A 3QJ5A 4B6FA 1QYDA 4L0MA 4MYCA 4B74A 2YDYA 3VFDA 5L6MB 2NM0A 3Q0IA 4LRSB 5E0KB 2XGGA 3CW9A 4AS2A 5I7RA 2ZP1A 2Z6AA 2EZ9A 1POXA 2ZETA 4QU0A 4DKXA 2CE2X 1U3FA 2M32A 1UJMA 3BMNA 1QGDA 1Y5NA 2WJIA 3C3MA 3E1GA 3K9LA 4Q9HA 1J0CA 1IHDA 1QRTA 2O1EA 4ERXA 1CU1A 2K6GA 3Q2KA 5TS3A 3K35A 4PSAA 1QQTA 4P4SB 4XYGA 2FEXA 3MS4A 4NDAA 4GLFA 2C2GA 3QX8A 2WQ7A 4NPHA 2GN9A 2IXEA 4GH5A 3I1YA 4JA2A 3WSVA 5LQSA 5GIOE 4M0KA 4KSBA 4Y0NA 4ZMBA 3PVSA 3B48A 3AEKB 1U2RA 2GEDA 3GHYA 4D9MA 2Y0PA 1LPSA 2E4AA 3D3JA 3LCJA 2I3AA 2WU4A 1XRJA 3OSZA 3RAPR 1LUAA 3JX9A 3D0QA 5JTTA 1KARA 2GEKA 4Z8YA 1E66A 1D4FA 1VB3A 5G0VA 3JY6A 4ZPXA 3ROKA 2FLVA 3DVAA 1Y3AA 3LGAA 1UOPA 4NABA 3OX3A 1D1PA 1Q1BA 4M7WA 2Q5IA 2B2CA 1QIHA 5IW8A 2HLNA 4AZ0B 2HMYB 4L0DA 4O02B 1CXZA 4JLNA 2XYHA 2Q3HA 1V6AA 2H51A 1BCSB 3V6LA 1L7XA 4RK7A 3G6WA 2AQHA 3I5YA 3QEBZ 2CLMB 1OC4A 4HWGA 3T1VA 1B0AA 3M83A 1QO9A 1ZWLA 3REQA 1OH5A 4MW6A 1VTKA 2D1QA 2GZMA 1JB1A 2WKPA 3RYIB 2GJSA 3AEUB 4OQFA 3TXAA 1GGHA 1PO7A 2ZYSA 1LJLA 2WPDD 3AF6A 4E21A 4EB8A 1DJQA 3U7EB 1W4CA 1K7SN 2VHVA 3VQTA 3L0IB 3H0CA 3DXXA 1KY3A 2BMDA 3BK1A 1BFDA 3EC7A 3U9SA 5KBYA 4TRNA 3U9TA 3IESA 3VZCA 3KYDA 1WHSA 1GT91 3SS8A 3CVXA 1L4HA 3I5AA 5C7YA 2PGNA 1TZKA 4U6SA 5ECWA 5BXQC 4M53A 5AMXA 3RUFA 4XGKA 1BRMA 3A31A 2J6HA 4N7MA 4FIDA 1DRVA 1N0HA 1RXWA 1G2IA 4UNRA 1DX9A 1U1DA 2VOJA 2QV0A 1U99A 4V1CB 1D5WA 1CZOA 5F1YA 2W6JD 1ZY2A 2QTFA 2IWRA 3WO0A 4W6ZA 5EXDA 2H2GA 3V4PB 2GTPA 2D7JA 4YCNA 2E4VA 3F4KA 2I4LA 4KR3A 5HA5A 2CYCA 4YRBA 2B35A 1ULBA 2ENUA 1Z35A 3H0EA 3CO5A 1S8NA 1UIMA 2DC1A 3E7WA 4WA7A 5TGTA 1E77A 3BEOA 1AT1A 3B1YA 3TINA 4L73A 1KMQA 4YQFA 1M34E 1OT5A 3BK2A 2FSPA 4HOYA 4JSTA 3PC8A 3BXZA 4H1HA 2JFZA 3JYPA 4EDHA 4EH1A 4ZVMA 4KC0A 2GAFA 2HQSA 3HO8A 2VUUA 4ZU1X 1UAAA 4URFA 2FEPA 5EMLA 1GFSA 1Y8QB 3RHFA 4D81A 1U6KA 3BORA 3EXG1 1D03A 3ZCUA 4WN9A 5HKKD 4BN5A 4PN3A 2F3RA 4LISA 4JI2B 3H9QA 4DIMA 2PUDA 2PLNA 4AJJA 3FMVA 4C0XA 1G4UR 1M8PA 1V8ZA 1P5HA 5ADWA 2XWPA 1YE5A 3NC4A 3DBHB 4PFSA 1UBUS 5LWQA 1BQ4A 1E5QA 4C0AC 3UKJA 5ICGA 3GPLA 2OCIA 4NQRA 1O96A 2QLLA 2GCIA 1J5PA 3JAMA 4KQMA 3E61A 3MCUA 1HO3A 3B1JA 3AB7A 3GP3A 4CM9A 5KU7A 5KX5F 1THGA 1X0VA 2O07A 4RTRA 1RVV1 3Q7SA 3JV7A 4QQNA 3OOEA 1JEYB 1XTBA 3PS9A 3W2TA 4UEJA 2EW1A 1A82A 1CNFA 2HU5A 2W6OA 2XAUA 4G36A 4F1JA 4ZEOA 3D4OA 4CCAA 4CN8A 2QEQA 3HXPA 4O5AA 4IKOA 4OD0A 5BQ5A 1AN9A 1W4AA 1R27A 2HXGA 5IJ9B 3GLFE 3D6VA 4HZGA 4H35A 3MCTA 1S2NA 3DL7A 4IH4A 1EFRA 4IG4A 4OL9A 3VISA 3AVYA 5GVSA 3SJAA 2VNHA 3DLIA 1ECFA 2BEWB 3C87A 2PJZA 3PE3A 4HLUC 3A1FA 3H3XA 2FR1A 3QYJA 1GPUA 5I7WA 1RBMA 5K4GA 4XIGS 4LIPD 1B8NA 2NZVG 3U3MA 2O2GA 3S1AA 1QCCA 5C35A 3C85A 4BNMA 5JJLA 5EERA 1SVLA 1ISIA 2E55A 3FFTA 3DV0A 5LSAA 3OZDA 3ZG6A 4BP9A 4ND3A 5FLKA 1TYAE 3OIUA 4N0QA 3F8SA 1L4FA 2QN2A 2XTAA 3BQMB 4E88A 5B1HA 621PA 5BW6B 1P9RA 2Z9BA 1USWA 3MM4A 3NBKA 1CUFA 3VPFA 4R3WA 4KXVA 5KHAA 4A8JA 5IG2A 2HBQA 1GRNA 2P1RA 1Y1QA 1KI8A 1SZDA 5B4TA 1ISPA 1E58A 4JQSA 4DG8A 1PQYA 1KP9A 2XVZA 3EGVA 2HWYA 3MMNA 4FYJA 3NXKA 2AK2A 3CKKA 1PFYA 1FFDA 3GOHA 3L7LA 3I09A 4GZMA 2A7XA 3QRWA 2F59A 1J0BA 1KJQA 4KAJA 2VQFB 5JECA 1JR2A 4KAXA 3RT7A 5EFOA 1OYVA 4C4SA 2FR0A 3AFMA 3RV4A 1QQAA 2C4KA 3Q1KA 1V1RA 4WOPA 4ZN6A 1VYVA 3AERB 2CXOA 4P53A 4IHQA 4RHXA 5DP2A 4X6UA 2IPXA 3FVQA 3IT1A 2VT2A 3URMA 3GGGA 4CU2A 3GVHA 1A5TA 2QGNA 4KMSA 1DQNA 1PK8A 4YRIA 5LQMA 4JX9A 4AJEA 1Y5IA 3FKQA 4INOA 4CHTA 5FNZA 2MYNA 3RLFA 1F8XA 2RHWA 1CBUA 3R3SA 3EDQA 4J7XA 3LL4A 2Q3EA 1DFHA 1PTJA 2ZSDA 1SK9A 2VWHA 3LUPA 5BSFA 5IBCA 1ADCA 1JU9A 4WCVA 4CMKA 1JALA 5F2OA 2UU9B 1Y82A 2DKOA 1K5GA 2C03A 2XI4A 4PC7A 2MCFA 1VRCA 2VJPA 3LLMA 4EZIA 4EO4A 1UBHS 4RS4A 4ZAYA 4F06A 1S7GA 3VTFA 4ZCLA 4C4AA 4GNKA 5I4KA 4JNKA 5K3EA 1LWNA 3I5XA 1YIOA 2UXDB 1MO3A 1Z4KA 4R2WA 4ES6A 1PR3A 3C1TA 2G8NA 3LBIA 4NSNA 3LC1O 1POWA 1DC7A 4ND4A 2O8DA 1O97D 1WD5A 5J5CA 4PC3A 2UKDA 3FOCA 4PX3A 1Z2EA 4RYLA 1U94A 3FDFA 2CF6A 3DP9A 2XOKA 3ECAA 2F4NA 4P4SA 3PDUA 4PAMA 4OHVA 3CPEA 4P3PA 4XJVA 4OG2A 4JI6B 1L6IA 1TCBA 1UMDA 4WXMA 1U80A 1BNCA 1MOQA 3D7KA 4X3PA 4DS3A 4K9KA 5CEJA 4RDHA 4FBGA 3EXEB 3K6SB 4D3FA 2CCGA 1E2IA 1J20A 1HEYA 2BFCB 2VHZA 3AEKA 3BK7A 3RUEA 1P73A 1R0XA 2P90A 4O63O 4RF2A 4FJ0A 1JSRA 4URYR 2X5XA 3EGEA 3JYNA 4GS5A 3OY7A 2KYRA 1PR9A 3FGNA 1AF4A 2QDKA 3CE9A 3D0RA 4YMWA 1F7UA 4TMVA 3KQMA 2JI8A 1O4VA 3D4BA 2B21A 4K2AA 4AJLA 3B9BA 2EU8A 2AN4A 4RORA 4EGAA 2VQ6A 3W5SA 3HADA 2ZJ7A 3L7AA 2J1LA 3ROPA 4PO8A 4IPTA 4Z3OA 1KTVA 4QUIA 5TQJA 4AZ0A 1TMKA 1BEZA 3ZLJA 3V42A 2JFNA 1P19A 1DXOA 1BCSA 2WTXA 3EULA 3VPXA 4F91B 5AVWA 3O2JA 1WCXA 4W8OA 5T57A 3W6NA 3WGMA 3PUVA 1G5PA 1MV5A 2HDNB 1TRHA 4CMAA 5DH9A 2L2QA 1NIPA 5F77A 4E0BA 5HNKA 2OYRA 3W8EA 4IF4A 3QBVA 3RYIA 2QM0A 3AEUA 4JBWA 5BQXA 5KB3A 4YMUA 4P82A 1C4OA 4MUIA 3E18A 1YXMA 3TIVA 4O6VA 4DDKA 4JYAB 1M83A 1JH8A 1TM1E 2DFLA 2OBMA 2OQIA 2PSHA 3M7IA 3R3ZA 4OJKA 3T12A 3WL5A 1OW3B 2DJ5A 3NC1C 4WZAE 4XM2A 5AJTA 3USZA 3TS1A 5AW3A 4V24A 4CIAA 2MIIA 2ZOSA 1O8CA 2GAAA 4WBNB 4P0QB 4BV3A 2B8NA 4AY3A 4QUJA 4AMUA 1QFXA 1UFQA 5D5HA 3VHRA 1Y4UA 4TTAA 2NYAA 4HUJA 5JXIA 3OURA 1MVNA 3OT1B 4E07A 3WAJA 1GPWB 1WG8A 2F43B 2ZI5A 3WMGA 4RDXA 1NDHA 4KO1S 4CLDA 1CY6A 4EQ6B 5K20A 5AHXA 5DBGA 4G89A 4Q66C 3BIOA 3K0AB 1VE7A 2BBWA 1TKAA 1JA0A 1Z07A 2VJLA 3BJZA 3F49S 3DE1X 1IVNA 4P38A 3WXBA 4A10A 1W36C 1XV5A 4PZ0A 5C34B 1HDIA 4GPIB 4NV3A 3SZOA 3GFFA 2Z8XA 3FLBA 4X1OA 2XMPA 3IKLA 3G8YA 4UBKA 3LUGA 2LXNA 1OILA 3CRNA 3RSZA 5B6IA 1DIHA 3DFZA 2PMBA 3LM8A 5AKYA 3L0DA 3KSDO 2VJDA 2ZJ0A 1KSGA 2WMDA 4D79A 3V8EA 1PVOA 1NN1A 4L8WB 4ZHQB 1FXWA 2NGRA 4ALIA 3LXMA 3PFFA 3QUAA 1EGHA 2ZR0A 3DWFA 4OMDA 3MWGA 4FT4A 4E11A 5AI9A 5G40A 3T9CA 3ZOKA 1Q3HA 1U3TA 1R3UA 2ZTSA 3G9XA 3WNQA 5JISA 1D4AA 4LOIA 4P5DA 2VP0A 2AV6A 3U3RA 3I34X 2P4QA 2IZ0A 1X38A 4DWWA 2ZE8A 2O2YA 4YAEA 4O08A 3ZEIA 3FHCB 2WABA 1MX1A 1N2XA 4FOSA 2QI9F 4MUMA 4TTVA 4D9CA 1H66A 3ELYA 3O9ZA 5EJFA 2Q4OA 3ANTA 4RA6B 4EYOA 3CRRA 3WMWA 1LF5A 4G01B 3DBHA 2Q6VA 4UU1A 2OXCA 4PC6A 1R12A 1WW3A 1IM5A 2QUIA 1T9CA 3BD8A 3HU5A 4O2AF 4BJ6A 1I3KA 3C7CB 4BUCA 1IYZA 3G1UA 3K20A 4MW0A 4ZVPA 3UAGA 3S2FA 2ZUVA 4MKZA 1TO2E 3EA0A 1EFVB 1PJ3A 1JWLA 4KYTA 1P8AA 4QGSA 4WLNA 5F7XA 1PHPA 1SVKA 3PVCA 3M49A 5ITVA 2PO7A 4KLAA 5IJ9A 1VL1A 3BFKA 3FCSB 1CRZA 1XTVA 1F12A 4QO7A 1L5GB 3SHWA 1Q2UA 1TMOA 3CTMA 3EMBA 3EBOA 4UZEA 2FUNB 4ZO8A 5B37A 5FUMA 3D59A 3AVQA 2W98A 2QSYA 3L1VA 4LZAA 4FC6A 3ROXA 1E59A 2IYYA 3OC6A 1WP4A 3MAJA 4YMTA 1Y1SA 4MVJI 3TECE 3E3OA 4I3GA 1FUIA 4Q05A 5FWDA 4FFMA 5A04A 4V3CA 3FPKA 5HFNA 1NF9A 3K2EA 3STHA 2V7UA 1FTGA 3JVVA 3PPWA 3KYIB 2G72A 3V1UA 3VKVA 2BONA 2I1QA 4MCJA 1RMYA 2EWWA 3SC4A 6GPBA 5HWSA 1ISGA 1R0RE 1S3FA 3WYGA 3ZGLA 5AUQA 2YV2A 4RF5A 4C76A 1VLLA 1YBFA 3FM9A 3KTOA 3T7JA 3ADBA 2VYCA 5CIYA 5JADA 1YVRA 4GXTA 4R0MA 3AHIA 2FG7C 1P0MA 2EG5A 2ISSD 3KJXA 3FMOB 3NH6A 3WS7A 2QU7A 3ZW7A 1W44A 1QKIA 1GPBA 3DEZA 1FDRA 3SD7A 3TR6A 4I36A 4GVLA 5AJZA 5EG5A 5K8TA 3N2GB 2CVPA 1SC9A 3LFHA 4XEHA 2P8JA 3EEFA 1A5ZA 5DYGA 2B94A 2OWEA 1E3QA 2JD2A 3NVMB 2F17A 2J32A 4M7OA 3B6JA 4QJBA 4G8JA 1TM3E 3S2ZA 2R6R1 4EJSB 2WVHA 1N8SA 1TEXA 3VU1A 2ZLBA 2BM9A 1T9GR 1Z6QA 2PZ8A 2PMDA 1W75A 2REOA 3AERA 4OFXA 3RG8A 3ZLTA 2GA9A 3BUSA 4AYWA 2XDAA 1XWFA 4CEJA 1RWVA 3LP8A 1N36B 1MCZA 2QTWB 4HAIA 4J43A 4MGZR 4BGIA 3CW2A 4CLRB 4MO2A 2VXYA 2GUGA 3PQ6A 5J2UA 5BR1A 2NZYA 3F9IA 1VSQA 1MQ9A 2Y6VA 3TJMA 3D2CA 4NBWA 3WJ1A 2FMUA 3DBOB 1N0UA 2UZIR 4L4RA 4WIAA 4LJKA 5DGCA 3BM5A 1EGMB 2YXBA 3UAYA 1UAGA 3L6CA 1L7NA 4H1WA 1FY2A 4AZWA 1F2UA 3BFJA 1W47A 4F4JA 4KIFA 3I2JA 1BMTA 1OD6A 4K6KA 1EINA 1PK9A 4Y6LA 1LC0A 1QFYA 3OMLA 5JIBA 3D3NA 4MVJH 5B4UA 2AQKA 4R41A 5KAMA 1HFKA 3W6PA 2OZLB 2ROQA 1T9AA 4LAFA 3T9BA 1ISRA 2R44A 1PNTA 2C59A 1ZC4A 1W46A 3DTNA 1JHPA 5FOXA 4PRZA 4BLPA 5FEMA 2FFBA 3DHVA 3KUDA 5BSTA 1KYYA 3RANA 2NVWA 3SU8A 4MKGA 3HUTA 1U63A 5HX7A 3HJNA 4HN2A 2BMEA 2VEDA 5G53C 4FOPA 1SBCA 2DWPA 3FNEA 3OZCA 4R3UC 3CSUA 4LCBA 3PC7A 5TIIA 2QLNA 3L0ZA 4HEA6 5LCXA 4C7JA 5BPFA 2WIGA 2CLCX 2Q3FA 4JLDA 3RTEA 1SXIA 4UJ3A 5K0FA 2EGHA 2W7TA 3BXGA 4AKEA 1H65A 1QQ5A 3EXEA 1UXOA 3MINB 3OQIB 4LHWA 3OQJA 2DGDA 4RW0A 3MCVA 2BFCA 5DNCA 5F9MA 2JD0A 5C5IA 2EJUA 4KQ9A 4X71A 1UFOA 2VJBA 4Y9TA 2ZIZA 3A9VA 1OI3A 3M0EA 2DB3A 1E9AA 4LTNA 4R1SA 4BZXA 4AN4A 3IOEA 4ZCPA 3FUCA 3QI2A 3E27A 3GQBB 3P0EA 2CCKA 1A8PA 4RFSA 5B3KA 7MDHA 3DCIA 2OM2A 4KAAA 5LMCA 1OWMA 4NHEA 3WC4A 1ZMBA 3JVEA 4FWBA 5FXMA 3EZYA 1HLDA 4O4HB 1EK6A 2XB2A 2LZ0A 3NJRA 3B7GA 1N75A 2RCNA 3WRXA 1K68A 5EMNA 1XDBA 4AN1A 2MTBA 4H3KB 1YDHA 4DDUA 3KEMA 1CUYA 1EVYA 4PGMA 3DLHA 1YVPA 3SJUA 2H31A 5FEUA 5K0EA 3TOXA 3CISA 4PU0A 1MO6A 3TFOA 1QIKA 4NEGA 1XF9A 5FR2A 2Y67A 4M1OA 3B2QA 4DQUA 2VSYA 4HUQB 1N5RA 1F4PA 1EFCA 4FOOA 3FLAA 4L4UA 3A2NA 2XDWA 5DTIA 2IF0A 5G0SA 4HDOB 4OHRA 1C9MA 3IHWA 3N8DA 4R9VA 3TNFA 4EARA 4Z54A 3AG5A 4E3WA 3W1WA 3NU1A 4HX5A 3MBOA 3EE6A 1TF5A 1U7UA 2OFWA 4HDAA 1R0BA 4JS0A 2HIGA 2G28A 2NO1A 1M75A 1WXFA 1YRYE 1ZVJA 2DH5A 4YJ2B 4WBNA 2YOGA 1PQUA 4NL4H 4JUDX 3W1VA 2FJPA 2Y93A 2D1TA 4QQFA 3U7QB 1RI5A 4Q3BA 3JTEA 2Q9CA 3OT1A 4MVXA 2W2VA 4TQAA 2IUYA 5ALWA 1TQDA 2YHSA 3F8WA 3FRIA 3R3HA 2BJWA 3WL6A 1UBOS 1ZCBA 5LD2B 1DARA 5A2QA 3TB4A 3K0AA 3QG1A 1QE5A 1OASA 2Z1DA 3HUFA 2NSJA 3HKDB 1BVRA 3GJ7A 3UK0A 3VU0A 5JEDA 1Q1GA 4MJ7A 2I6XA 1FMFA 4ND6A 2X7XA 1G5TA 5CJ2A 3I12A 3TCKA 3DO8A 1AVTA 1E5VA 1T5TA 3JYHA 1KYIA 4XFDA 3I6BA 5EE3A 3TSWA 1MVOA 1N2CE 1XVUA 3DP7A 3EUFA 4P7FA 3UF0A 4WXYB 3E2PA 4HTFB 3KSMA 4BKQA 5DT9A 1YOBA 4JJ7A 1WXGA 1N9GB 3M5WA 4ZOEA 1ES9A 2TMDA 4YXWD 4BO9A 4HZUB 3UTDA 1GWNA 5BW8A 1TZMA 1FXSA 2ZAMA 3B1ZA 4DXHA 3D4LA 2XH8A 1D6JA 3B52X 4KPUB 1D6SA 1ZGCA 4F8JA 4XA8A 4YQEA 4ZTUB 2PBLA 3U7FB 3JD4A 4JUBA 1ZJJA 2QZ9A 2VYND 3C3BA 3G02A 3VOAA 4B4KA 3JQPA 1YJBA 1YUBA 2ATEA 4INJA 4LRQA 3UOAB 2G70A 1HOTA 1IEXA 4Z0PA 1Z2PX 2IIPA 2B1RA 1H1DA 1EVZA 1PSWA 3BN3A 4RA6A 1C80A 1XCPA 2EBFX 3BC1A 3FROA 4GDMA 3KE8A 2R60A 4Q9NA 5DN6A 2AUTA 3BICA 1I9GA 2FZGA 4PXAA 4BEVA 2YZ2A 5DW0A 5IC4A 3UHAA 1VCHA 5LYJA 1P1HA 3U3OA 1MB2A 1ZRNA 3L7OA 1ISFA 1N1DA 1YHZA 2ZRKA 3FHLA 4FYVA 1EFVA 1G6OA 2W58A 4WEOA 2OV8A 2Q1TA 2JHFA 2Z4SA 1KMNA 2H65A 3G9TA 3WHKA 5BQ3A 2O5VA 3G13A 5KC8A 3JQFA 1D7AA 5LZ4A 2L42A 2PM8A 3PEFA 2IV7A 3SC6A 5LZ9A 4KW7A 8LDHA 2PKEA 3SZRA 4BO4A 3IPRA 4QU9A 1JLMA 4R0NA 2YTZA 3UPUA 3DAPA 5C8XA 4IS3A 3N28A 3OZGA 1N3LA 5IBPA 2WC1A 3GT4A 4E14A 1QBKC 1K86A 5FBHA 2II6A 3CZ9A 2J0QA 1PAUA 2GYUA 2OUIA 2N46A 3H1TA 3RT9A 4ZCMA 4FNOA 3ZHTA 1NI3A 4PXSA 1O5IA 3U26A 2IS4A 4RMNA 521PA 3HJAA 1V45E 1FDUA 5HOQA 1JAZA 2AR9A 3B2NA 5CT5A 3R75A 4F72A 4DVJA 3B2EA 3AM4A 1NXWA 2QB5A 1QMPA 2F3TA 2GD2A 3BTSA 3IAS1 3PFWO 4Q3NA 4OHZA 4CR8A 3PEYA 2I71A 1JMVA 3C14C 3TDKA 3U4CA 3W78A 4H3VA 1AK9A 2V96A 3HLYA 2CL5A 1BWQA 4BB5A 4IHKA 2NUPB 1JNYA 1J06A 3N2GA 3S2IA 4JBNA 3RGGA 4BMSA 2UVPB 1NLMA 3D8UA 4I1RA 4HGZA 2NAPA 2QR3A 1ML3A 7ABPA 1EBBA 1KI3A 1W96A 1GQ2A 1E2LA 2OXIA 4B83A 1BVUA 4NZMA 2Y2UA 4BNDB 1Z06A 5HKBA 3LO5A 3DEAA 5J1TB 1B3RA 1TFUA 3AGQA 1E6EA 4ZZ0A 1W73A 3FPCA 1K88A 5INTA 3KKEA 3NHUA 4ZOLB 4CLRA 1N7GA 1YDGA 2ZBEA 2P2CA 4RD4A 4JI1B 3RSLA 5E1OA 5TQVA 4MGEA 4A0FA 5AKJA 1INLA 4NNJA 4QUGA 1QONA 3P9SA 3C4JA 3M81A 2HF9A 4Y0AA 3USCS 2LUOA 5JEEA 1U9IC 3KBOA 5AR1A 5IARA 4FFNA 1JDJA 3MBKA 3RUAA 2YHIA 3KB1A 5FBWB 1L8AA 3GZJA 1G7CA 1BRTA 1FSSA 4ISCA 4PGGA 3AM5A 1WCV1 3EJWA 5DXFA 5JS2A 3UANA 4F84A 4FC7A 4CLOB 3SJCA 2DF8A 5JAMA 3CBGA 1S2MA 3K0HA 1AKVA 1G3UA 4KDFA 5KNDH 1DAKA 2QAJA 4P5EA 3LPLA 4Y2QA 5CDFA 4QLAA 3CX4A 4DV1B 4C88A 5ARDA 1F51E 3OKCA 4CKWB 4OBWA 3QPVA 4MUXA 3B8EA 1HZZC 4XSGA 1GXSA 1V0JA 1R1DA 3K15A 1G0NA 3R1IA 5CXQA 4F6LA 1JJIA 2JIQA 2VZ0A 5IKMA 4UFNA 1J1UA 1BWPA 4MIYA 2JJMA 5J40A 3RSSA 1VE6A 4FGSA 2PCLA 2QQGA 3C7TA 3SE7A 2BDTA 3IP1A 4ENSA 1X7DA 2HC9A 3S7TA 3A2MA 4G0OA 3SQWA 2Z04A 5KTPA 3D4IA 4ENVA 3QPAA 3R6WA 4S1WA 1Y34E 3MINA 1GN8A 2RAUA 1I6LA 4RACA 3EMDA 3SPXA 2FPSA 3LZCA 3LXUX 4DJDC 2RGBA 3NOOA 1R8XA 2Q5JA 1QG6A 1UZNA 1VBNA 2J46A 2HJSA 4IF6A 4P3KA 5AKKA 4ZAFA 5CA0A 3PNSA 4JLUA 5ENVA 3HCPA 3ZK9A 2K2QB 1OXVA 1AZTA 3QVUA 3OZAA 3GQBA 3I32A 4O3FA 3V48A 2J5QA 1OIXA 3IP6A 2VYFA 2BGWA 3QX9A 3AJDA 3ES9A 1D7OA 1TJYA 2WVGA 2FRDC 4OHXA 1RABA 5J2TB 4M8NE 4I9NA 4O4HA 5JSKA 4EBFA 1TU3A 2CEKA 2BHLA 1XZIA 1ZX1A 2XGSA 1QX4A 3CG4A 4LYJA 5EIBC 3SXJA 3UFBA 5J47A 4GOLD 2IYNA 1KI4A 4RVFA 3KKQA 3L8DA 5FOTA 1Q0PA 1RIIA 4DV7B 3ZHQA 3TL6A 2ZIAA 3M2PA 4QBGB 4Z5XA 4HUQA 4MIOA 2BELA 1W85B 3LWBA 5FI3A 9LDBA 5JH7B 3ROMA 5E9AA 1RVDA 1RZRA 1N6RA 4AUNA 2JCGA 1Q11A 2IHUA 1ESMA 3EEYA 4IIHA 1Q12A 2OL4A 4L5YA 2BGGA 3D0OA 2FPXA 4UUAA 5EZ5A 5A4FS 3NJ8A 3PZRA 4IFEA 3PIRA 5ENDA 4AZ3B 5ABPA 5CFRA 3E4DA 2BBTA 5KSOA 2HMVA 2Z8ZA 3ZUGA 2WD9A 2PT7A 3B9PA 3R3VA 5JCOA 1NSYA 1Z0FA 1HT3A 4YJ2A 1RHQA 4BWFB 4OVKA 1I2DA 5C1PA 4EY5A 1TEZA 3LW7A 5FNVA 4CKBB 1RYZA 1YFZA 3GQVA 1F0PA 2DT5A 3IO5A 2Z2IA 3U7QA 2UDPA 4X90A 1PV4A 4MGHA 4EOGA 2BMWA 2EJBA 2F48A 3PNBA 1BW9B 1PGJA 3JQBC 4DJTA 2W4MA 1WIWA 3SS9X 3NFYA 1II8B 5CLFA 1GYQA 2X5JO 1AGNA 3HKDA 5AK5A 4KQ6A 4B3XA 3TGPA 5K3BA 2F8TA 3ZY5A 3ESBA 4J7UA 4QNMA 4F4CA