4HS6B

Hepatitus c envelope glycoprotein e2 fragment 412-423 with humanized and affinity-matured antibody mrct10.v362
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
221
structure length
214
Chain Sequence
b'EVQLQESGPGLVKPSETLSLTCTVSGDSITSGYWNWIRQPPGRALEWMGYISYSGSTYYSLSLRSRITISRDTSKNQYSLRLSSVTAADTAMYYCALITTSTYAMDYWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2-peptide
publication title Glycan shifting on hepatitis C virus (HCV) e2 glycoprotein is a mechanism for escape from broadly neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 214
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hs6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hs6B01
3G6JA 4DOHB 2XWJB 1UEMA 1MJJA 1E4KC 2HA1A 4EVNA 2NY2C 3M17A 2ED9A 5D1QB 4MA3A 4ZTPH 1KPVA 3S97C 5I75B 1KOAA 3RRQA 5JHLH 5D7LE 3RWCA 4NQDB 4PV8A 1BQUA 4RQQB 4U0RB 5GGTA 3BYTA 4WCYH 1D6VH 4Y1AB 2M26A 3B5GA 3QH3A 5F9JA 3UO1L 4H1LB 3FQNB 1HYRC 2WBKA 3TN0B 4S1QH 3WE6A 3R0NA 1NC4A 1H3PL 2NX5D 2G60L 1KCUH 3D39B 3QEGL 3HUJA 3DHMA 1OAYH 3PWPE 2YKLH 3GMNA 1CXFA 4UTBH 4M6NL 2V9QA 5DT1H 3BKML 43C9A 1NLBH 1IBGH 5EIVA 4F9PC 1UACL 2XTJD 3P0YL 1HIMH 1EFXA 1Z0MA 4H20H 5I1HL 3HR5B 4ZD3H 1RZFH 5K59F 4HEPG 3TWCH 3GKWH 4HCRH 4GT7A 3VXQB 4Y88A 3DTXB 1HHKA 1QSZA 4UQ2A 3BRFA 3SKOB 3UPAA 1IC7L 4KK9D 3QI9C 3X14B 4V1DE 3QDJB 4I5BA 5I2IA 3PDGA 1R5IA 1JZ7A 4G6FD 3T0VA 5KSBF 4YPJA 3LSOB 2LAAA 4YQXH 4WNQB 4E9LA 5JW3H 1U93A 5FUOL 3ULVF 3JTTB 3SE3C 1H3PH 2QEJA 5IFJA 2G60H 5GSRB 3C60D 4N5EC 2DQEL 3Q6FA 4P2QE 1UH2A 5I15L 5CILL 3VXRB 2AJZA 4U3XA 1UACH 3P0YH 3LHPH 2PCPB 4Z5RB 2G75A 1QR1A 3R06A 1JJUA 2ARJB 3AXLA 5I1HH 1VADB 3WIHL 1AD9A 4WRLA 2C9AA 5TE4L 4WO4A 2C3VA 4ZUTB 4LIQL 4JRXA 4YDLB 4PLKD 5IGXH 4AEHH 5LBSL 1T1XA 4Q6YA 4ZFFB 5IV2A 1VGKB 1A2YB 5AYUL 4Y2DA 4M3JA 4YPGB 3QI9A 3PIQA 1BZ9A 3KLDA 5BJTA 5I8CA 2CKBL 5HI4C 5HPOA 4MJID 3E1F1 5K9KB 2DBJA 2XZQL 1ZOXA 3PWPB 3MJ8B 2E3VA 5EU5B 3RNKA 4JPKH 2DQEH 4F57H 5EO9B 5HPMA 4BSVA 2OQJB 5CILH 2WBWB 1BFVL 1IZJA 4JAMA 3TJHC 4J23A 3QWRA 3CIQA 3WIHH 5JMRA 2C26A 5JHDE 4Y16C 4FFZL 1FNGA 1LDSA 4LIQH 4YAQB 4NOBA 1ZEAL 2LE9A 3WEXA 1T3FB 4MZ3A 3O3DB 5ADPL 1CF8H 1DUZA 4PYHA 4V1DB 2W0FA 3WN5C 5L7XL 4G6KH 1RUML 5FDYA 5F70A 2VL5A 3LN5B 2WSKA 1U8MB 4AENB 1VGEH 4OGXL 1P9MC 5I1DA 3RGVB 1U8QA 4S1SL 2R1XB 4IRZL 4JFFB 2YPLD 3DJ9A 4XMPL 1GC1H 5TH2B 2EH7L 2DBLL 2H32H 3EGSA 4K7PY 3RHWK 3D0LB 4OD1L 1YEIH 1XF2B 1DQMH 4P2QB 3IF1A 1T22B 3KYAA 3VDAA 4L8CB 4L3EE 4NGHH 4LKXB 3VXPB 3GSUA 1WISA 5I1IL 3EYQD 3Q2CA 2UWEA 3KPRD 1BFVH 3MOQA 4OCMC 3EYVA 3I6GB 1NH6A 4JANB 4DN3H 5DD3L 1O5DT 1PKQE 2BVQB 2QV2A 4MXQD 1BREA 3MRPA 3MRHA 3QJHB 4FFZH 2E27L 3CVHH 4Y16A 4KKLC 4LVEA 5E5MB 4ZSOE 1WIOA 4Z76B 5TE6L 2K7QA 3QIWC 2VB5A 4PJ8C 1XR8A 5L0QB 5L7XH 4HK0B 1DQDL 3MTRA 5EU3A 1B2WL 4JFPA 1MFCL 4RGMB 4K94C 3QRGL 4PP2B 3BJLA 2ERJB 4L8BA 1P9MA 4S1SH 2CXKA 2VE6B 3RIAK 4N0FA 3T65A 3GM8A 2VNCA 3JV5A 1Q9KA 3KR3L 1ZK9A 4A6YL 3L6FB 5E6ZA 1CT8B 5D5MF 2AJSL 4HLJA 3O4LA 4XZUA 4HKJA 5DK2A 2BVPB 3RVXD 3TBTA 2FD6L 1A7RH 3IFLL 1QEWA 4KROB 1M4KA 1HK6A 1TITA 3FQWA 5C0JB 1BFSA 3BPNC 5JHDB 1TDQA 3BKCH 1UM6H 1L0QA 2I07B 4BFGA 1E28A 3LRSA 4P59L 4LPCA 4YH6A 5J6HA 2BMKB 2NYYC 2GJ6A 3BWAA 3QIWA 5CCKL 3AB0B 4PJHE 1TJIL 4PJ8A 2WUCH 2Z92A 5EUOF 3FQRB 5HHPA 4LCCB 1FSKC 1B2WH 3BEWA 1MFCH 4XBEL 3QRGH 1D6EA 3SQOH 2YMXL 1PZ5B 1Q38A 1S7VA 5A3ID 3JWDH 1P7QB 4KKNA 3O3BB 2PTTA 1J10A 1NEZB 1LO0H 2R9HD 5JORB 4PRBB 2JIXD 3VFUB 3B3IB 3FN9A 3SDYH 4R7DB 3QFJA 1NFKA 5FK9A 4L3EB 5JR1H 1N59B 2BERA 5DGQA 3OR6B 3WIFB 2RIKA 5JQHC 4JHAH 5IG7B 1S9VB 2FD6H 4CMMB 3IFLH 4U7MA 4M43L 4NRYB 3TCXA 1PKQB 4GRWE 4QRPA 2APVA 2VZ1A 4OZGE 4MD0B 3S35H 4YHPA 2R0LL 1HKFA 2NY4C 4G43B 5FA4A 4ZSOB 3UTTA 4LK4A 4I0PD 4TOYH 4EI6A 1CGUA 1UB5B 3KLSA 5TDOA 1SJVA 4P59H 1QPXA 5E8EB 3MBEB 1NAMH 4RGNC 4WHYG 4P2YA 3BJ91 4UV7L 1JPSL 1UXWB 3TVMB 1IAKB 3TIEA 1WLHA 4I0KA 2H9GA 5DK3A 1DE4B 5AD0B 2FH6A 1SVZA 2EYSB 1X5JA 2ADGB 2GW5A 3BVNB 1MIEL 2BRRH 3OXRA 5DMKB 4R2GB 1A1OB 4GO6B 4Z7UA 3LKQA 1H3WM 4Y4KC 1QA9A 3HZYB 1A9EA 3CVIH 4PBWD 5DSCA 5DS8A 3UBXI 5JIPA 5EZJB 3T0AA 4M43H 1Z9SA 1EUTA 3T0ED 1I7RA 3BIKA 1FNSH 4JN1H 4M1GL 4ODBD 4UDTA 2KQMA 4X80H 5D72L 2A74A 1NGWA 3JTSB 5F71A 4RDQG 4DK6A 1KCSH 2NY3B 1AO7A 3D0VB 4PJHB 1HQ4B 4QXWA 3ARBC 1U8IA 3QPQC 2YC1A 3LKRB 4UT6H 4P0DA 1CDIA 4UV7H 2H3NB 3G9VA 1FYTD 3LS5H 5IFAL 5T3XD 4X9GA 5GZOD 3RDTB 4LFHD 3SE8H 3PL6B 2NX5B 2BNQE 3D25B 1I4FA 1MIEH 2HAZA 1HHGA 4NN7C 4HKZA 4XMLH 1A4KA 3K4AA 5GGRY 2AV7B 2BK8A 3S37L 2BHUA 3C6LC 4Y4KA 2D4DA 3QPXL 3I02A 2KKQA 4GRWB 4LVNB 5F93C 4MXWH 5D6CB 5FHAH 2A6JB 5L88H 3GSVB 1QBLL 3C9NA 1I9IH 2X4TA 2IADA 3S8WA 1C08B 2W65B 4TVPH 5IMOA 5DDHB 3OAUH 4OV5A 1ZT4A 1EMTL 2A0LD 2CO7B 3C8DA 3LY6A 3RWEB 2CLVA 1W0WB 4X6CA 4C56E 3ARBA 2YBRB 4WW2C 2X10A 2IGFL 4LSRL 3GRWL 4KWUA 2FX7L 3CCHB 4KRPD 1AGEA 5BZDB 4QT5A 4MHHI 1DLHB 1TQBC 5FYJH 5F9AC 1AI1L 3TPUB 5GS0D 3QXWA 1IE5A 3ARVA 5KSUA 3QO0B 4PYGA 1QPPA 3C60B 4YE4H 5ISZD 1W0VB 4DK3A 3V8OA 3FTGB 1PZUB 1QQDA 1QZ1A 1H3VA 2F5AH 1X4YA 3QEUA 2EH8L 5BMFH 3VW3L 2R4SL 2W1NA 5B38A 1QSFA 3SGEH 5DD5H 3AGVA 3S37H 3D87B 5MHSE 3QWOB 3TBSB 3C6LA 3QPXH 1HXYB 5FGCE 4ZDHA 2J3SA 4KHXH 1YC8A 1H0DB 5KOMC 3MRKA 5GRJL 3E0GA 3I50L 4ELMF 5MEPA 4N8VG 3QNZB 4FMFA 4EQ2A 2CRYA 3GMMA 4QHNA 3VRIB 4F37F 3LPFA 4PJXF 1EMTH 4HKXB 5EN2A 4Q58C 3AAZA 1IAOB 3KPNA 5I9QC 4LSRH 4WW2A 3IGAA 4BZYA 5E2WL 1F4WH 1D5ZB 3VGHA 2AQ3A 5FOBA 4OCLC 3ZL4L 3I3DA 1RIVH 2WAHA 1SEBA 3QEHA 1U9KA 4LSPH 4WEBL 4NZTH 4HQQH 2YZ1A 1UWGL 4F7EA 2AK1H 3WO3B 3DX8A 2R4SH 3ZT5A 5FB8B 3P77A 4PRDB 1T7VA 3RKPA 3CH1A 1IRAY 1S9YB 1HI6B 1U8JB 1E4XH 5DVLA 2XIDA 1QLFB 3AY4C 5CZXD 2IBZY 1I8LC 4GG8B 3NFSL 3RQ3A 4BA8A 4GKSB 1ZE3C 2NR6D 5IKCA 5M95B 1FNEB 4PJGB 1YMHB 2C5DC 1JHKL 3QXDB 4ODSL 2YPLB 2A1WL 4K3HA 1KIQA 2J6EA 3HE7D 2XNAA 4IDLA 5IVZA 4Q2ZB 4KQ4H 1YNTA 5C3LD 3FQXB 3TEUA 3IT8D 1GZQB 3ROOA 2VDNH 3DETC 4U6HA 5E99H 5FGCB 3I2CH 4GUPB 4DKEH 2ED7A 4KQ3H 4ETQA 1AGBB 1IGJB 4YEEA 3VGGA 1F02I 4PTTB 4PY7B 4MCYA 3F65A 2DI8A 2X4UA 2ZUSA 1H15A 5KN5A 5DK0A 1GOHA 1T5XB 5DJ0B 5HHOD 1TQCC 1AQKL 3AY4A 4U6XA 3PWJA 4DTGH 1IC1A 3GSRB 1I8LA 5EH1A 4XNQB 1BQSA 4OLZL 5FM5O 5JO5B 1S9XB 1K8DA 3RIFF 4HUKB 3RWDA 3MLZL 3T1FB 3ORJA 3LS4L 3LV3A 4LDOB 1ZHKB 3K2UL 1SVCP 2LV4A 3OL2A 2QQLL 1IC5L 1JHKH 4CVXB 1A6WH 3C5JB 3MROA 5E2UH 1U2HA 4YGAB 4XP1L 2DQUL 1Z9MA 4FG6D 5B3JE 1A14L 4R7NA 3QNXA 4HGKC 1KB9K 2XA8L 3CUPB 3ARGD 2D03L 3KYNA 3UTQA 1MCKA 5F7MC 4LSQL 3HPLB 3NFNB 3WDJA 2VXQL 4G8GE 4QWWD 5I73B 3LKOB 2WV3A 4YK4C 1V8HA 3BKYL 4KY1L 5J6GA 1TCRA 2OK0L 4G5ZH 3KG5A 2LVEA 1UZ8A 4K3GA 2YK1H 4JREB 5DJ8A 2Q7NA 3KPSD 2FEEI 1G6VK 1XGYL 3V5KB 2DQFA 4K23L 1YPZF 2PTUA 5LAXA 1H3XA 4JM2C 1JPGA 3BESR 4CADA 3T3ME 2VC2H 1J05A 3UJJL 4XP5L 1RZIB 5B22A 1IC5H 1FYTE 2VLRE 1G9NL 3V52H 1J0KA 4FXGB 3X11A 3DRQB 3FB5A 3MRQB 4XP1H 4ONFL 1F3RB 2G9HA 2IG2L 3BGMA 4OSUL 3O45B 3CFEB 2D03H 1BZ7A 1DQQA 3T0BA 2OZ4A 2VXQH 3NPSB 2CR6A 4IRSD 3BKYH 2IJ0C 4KY1H 4LVHC 1Q0YL 5FKPA 1T80A 4PRHA 4RAVA 1VFOA 5C0ND 4A2MA 5H35B 4PGBA 4PJBF 2IPKB 4Q6IB 3IDGB 4G80B 2CUMA 4OUOA 1EO5A 1UA6H 2JB6A 5KVEL 1XH3A 1IT9H 3CSPA 3GBLA 4QTHA 5F1IB 3WCYA 4HH8A 1K4DA 1MQ8A 2PYFA 4JM2A 2CIKB 2A6DB 2ATPB 2CSPA 3DMMC 4XP5H 3NAAL 4LCIH 2NNAB 4OFYA 2QR0A 3VGBA 3GMOB 3TCLA 1BQLL 5I1JL 4YGVB 3DGCR 1X4ZA 3PXJA 5AZ2H 4O9HH 3DARA 1A6ZA 4OSUH 2CK0H 5D9SB 5ISZE 1XCTB 2Z8WC 2ITCB 1FIGL 3L1OL 5HHNA 4HS3A 5JNYA 3VDBA 4JKMA 4E0RB 3T0EB 3GSQA 4XAKD 4PGCA 5F6IC 5CP7B 4K8RL 4LU5L 2AV1A 4OJFL 4NC1C 3FRUA 3TNNB 4X83A 3QDME 5CSZA 5T1DH 3VD7A 1S7XB 2DLFL 2YD4A 4Y4HB 5CD3B 1TJGL 4FQQA 5C0GA 3G08A 4D0CB 5J9PA 4QXGH 2J8UE 1WJ3A 1MSPA 3SE9H 2Y06L 4M6AA 1FYTB 3DMMA 2VLRB 3NAAH 4TUJB 3HE7A 2ZOLB 2OR9L 3NFPB 5IB3A 5E95B 1MOEA 4IJ3B 4ISVB 4M5ZL 4AQOA 2PO6D 2EKJA 2B20A 1G6RB 1JPST 1UB6B 3EJJX 2Y7QA 5F7EL 1N2RB 1T89A 1WTLA 3IDMB 1YA5A 2FDBP 4U1MA 5DJ6A 4F33B 2VDQL 4U3CA 1NMCB 2IH1A 2PR4H 4K8RH 2DB8A 4LU5H 4Q9RL 1ZSDB 4K7FA 4OJFH 2HFEA 5GS2D 4NJAL 3V0WH 5GRUH 2QSQA 1LDPL 4YBQD 4F9LC 1RUPL 3BOVA 2O26U 2P8LB 2YRPA 1TJGH 3GI8H 4NKOB 3K8KA 1EZVX 3QAZB 2D9CA 4UBDD 3GHEL 1JNNL 2APTA 4PJIA 4U7SA 3U9UA 4KRPB 1WC7A 5D93C 5DHYB 3F5WA 4FZEH 1IGYA 3C09C 2MQCA 4G8IA 3L7FA 4M4RA 5LCVH 3BGFC 1BJ8A 4OZIF 4M5ZH 4WDIB 5ISZB 3ZYJA 5GRVL 5EOCL 4L9LC 3LEXB 5KSVB 2EDQA 4JFOB 1WWCA 3ZTNL 2HWZH 4YDIL 2V7NB 2VN7A 3LQAC 4KK8C 4PRPD 3HI1A 4PREA 3VXUD 2VDQH 4HAFA 3PDOA 4Y5XB 4DFHA 4OGYH 3LD8C 1ONQA 2BSSB 4XH2B 2DRUA 4FXKA 4Q9RH 1KIUA 1JUFB 1ZGLB 3QDMB 3DRTB 1EEZA 5KVMC 4NJAH 4X9FA 4PJEF 5HHOE 1YYML 2I9LB 3B9KD 4F3FB 1RUPH 4OKVA 3C08L 3GSXA 2VZUA 2X7LB 4XC3H 3GSNH 5I74B 1JFQH 4B7IA 2HJKA 2J8UB 1UM5L 2X42A 5DFVD 5ESAA 5I1KL 3WKMH 1IM9D 5GISL 5TJWK 5GZND 5F1NA 4XC1H 1JNNH 4RMWA 4KDWA 1NPUA 3D1MC 2CIIB 3MNZA 4IHOA 4P46D 1M71A 3VXMA 1S7SA 4ZNEA 3KJ4C 4G6ML 3QUYC 4FFVD 2AGJL 4OV6F 1HN1A 1PYWA 3UTPE 1S3KL 5FYKH 1ETZA 3QYCA 3SKJL 3V9FA 4DAGL 2EC8A 1LK2B 4OZHA 1UCTA 1IARB 2YN3A 3U0WL 4L9LA 4NC2B 2N7AA 1ES0B 1J0JA 4KV5E 2QADB 4Y89A 1B6DA 3SY0A 5B3NA 4MZ2A 3FB6A 5BRZA 5HJ3B 1T20B 3OAYH 1YN6B 4UILH 1CD9B 4Z77B 1C5DB 2NTSP 4G6JL 5EBWB 1FVEA 4LNVA 1GOGA 3ZE0E 4KU1A 4YWGH 4MJ5A 2R1WB 1UM5H 3THMH 1KLFA 4JFZL 2Q76A 3IJSB 3VFNA 5I1KH 3HA0A 3BN9C 4YDJA 3ZYOA 5ANMB 1HXMB 2CLRA 4R8WH 2NXYD 4GMTL 3VH8A 1MWAB 3QG7H 4BQ8A 3F7VA 1T21A 3ARFC 4FFWC 1NGQL 4G6MH 3QUYA 1D5BB 5FEBA 4WI6A 4X6BB 4FOMA 1NAKL 5DJCB 4R0LC 1H5BB 3FZUD 4NZRL 4WFGE 3SKJH 2FJHA 4KKAD 4MA7H 2M8XA 5HYIA 5JPMB 3U7WL 3C8KB 2BNRE 1U8OB 3CSGA 5DEGA 5GGSA 3MRBA 1MFEH 3D69A 4JFYB 4G7YL 4NC0B 1WBYA 4XI5D 1R3HB 1NFDA 5D2LB 4GRLD 5HHOB 3H42L 5E8OB 3G5YB 5DLML 3BP6B 1MHCB 4XPFH 2ARJQ 2JKXA 5D1ZD 3ARDB 2ZUXA 4OFPA 3JWOC 1KTDB 3B4NA 4FS0A 3RTQB 4JFZH 1L4IA 1KB5H 5DJ2A 3ULSA 4FRWA 5FCUH 3BEVA 1P53A 1U91B 2DD8L 3FOMA 2CGRL 4GG6A 4KUZL 1MCFA 5C2UB 1LVEA 3MLYL 1RUQL 1FAIL 3T2OA 3ARFA 3QQ9D 4PUBL 2V6HA 3QA3A 5D7IA 2BSTA 3L3DB 2V5MA 5I6XC 2UY7A 5CSGA 3ZTJH 3OHXA 3ARGB 4R0LA 4S1RL 1F3JB 3AS0A 4M93B 1LE9B 5DHVA 4EBQL 4D0BA 3OQ3B 5J3HC 1NDGA 4TN9A 4OQTH 1U58A 5EPMA 4NKIL 4OCWH 1KG0A 4LASL 3HNVL 3MBXL 3IXAB 3PQYD 1EDQA 1MHEB 3H42H 1WBZB 4JKLA 4M48L 4I3GA 3DXAD 2RR3A 3QCTL 3KPSB 4RMQA 4X6DE 5D8JH 4L8SC 4O02L 3OKEA 1X7QB 1NCTA 4WHTA 5E9DE 3IU3A 5K9OB 1MCCA 1ZS8B 1FBIL 1KPRB 3ULUC 5E8NB 1ROWA 4LHQB 5C3TA 3PGCB 2F54E 4UIMA 1JNHA 3IFPB 2LU3A 4IMLA 1RZJL 1S7UA 43CAB 2R2EB 1RUQH 2ZUQB 1FAIH 4DZ8A 1ZWIB 1KLGA 2FEEL 3L7EB 2ATKA 2BDNL 4H1LH 1HH9A 1T1ZA 5ESQB 1AKJD 1KTLA 2GKIA 3H2WA 3MLWL 1N8ZB 3RWGA 4GSDL 4PRPA 3GJFB 4X6EA 4EI5C 1A21A 4IRSB 1FL3B 4U1HA 3FN3A 1AC6A 1SJHA 2JCCB 4NKIH 5CEXB 1MRCH 4F2MB 1YC7A 5HGAA 1EJOH 3HNVH 1L7IL 4NRZA 4BM7A 4AL8H 3LB6C 3BT2H 4O02H 5BZWB 3RL2A 4YEFA 4E41D 4H0HB 5T1LA 4E42B 1T66D 3UMTA 1LEGA 1PFCA 2BXZA 1EBAA 3T77A 4MA8L 3FFCE 3NCCB 1UENA 2DQDH 1CICD 1U95A 2AEIT 4CU6A 2HLFC 1BAFL 2NZ9D 5J13B 5K9JH 2VDMH 2BC4B 2ZSWB 2FZ3A 1XF4A 3PWNA 4X7DC 2X4NB 4KI5F 4NHCH 2BDNH 3RGHA 3H9HB 5ICYA 4R4BB 5TGBA 3STBA 4HWEH 5E4EC 4KHTL 2H8PA 2BY3A 4GLRI 1XT5A 4GSDH 2CLZA 1P2CB 3X13A 3FQUB 1YDPB 5E2VH 2NY1D 4EI5A 3QG6B 1N6VA 2YN5A 3ZE2E 5ADOH 4FQCL 1MFAH 2DTSA 4LLMA 1JGEB 3PNWA 4LPXA 4JFQB 5IMLA 4AM0A 1K5NA 4M7LT 4U1KB 5GPRA 4JZJA 5F9DC 1L7IH 2P4AB 4LEXH 1JK8A 2H26B 4QO1A 4BFIA 3W5NA 2E7BA 2HJFB 2HTLD 3CZJA 5IHLB 4KJPD 2P7TB 3PABA 5C9JA 3CFJA 5LVEA 3O9WC 2F54B 3GSOA 5EULV 4PGDB 2PYED 1ZANH 5IFHH 3T1WA 2OL3B 2VLLA 5D7JC 1SYSB 5T1MB 1BAFH 1UZ6F 3U4EB 1QFHA 4ODXA 5JPNB 2FNBA 1GZPA 2BVUA 1A6VL 4ZS6D 1H8OA 1Y18B 4G9DA 4DW2L 5HYJD 4YNYA 2PO6B 4I3SH 4IRJC 1BF8A 1E4XI 1DFBL 1MRDH 3QCVH 2EXWD 4HHAA 3G5VA 4MXVE 1ZLWH 4DVBB 5EWIH 1UYWH 2XPGB 4LNRA 2OBGA 3HLAA 2YD5A 5FECA 1FLTX 4PJAF 4J3UA 4B0MM 1I3VA 5GRVK 1AY1L 4GRLA 3HUJE 4FQCH 4YUEL 2R23B 2B7DT 3Q5OA 3I9GL 1SYVA 2DQIH 1IEBA 3O3AA 3VFTA 1NCBL 4GXUM 1GGIL 2V2XA 4JLRA 3ZDZF 3O11A 4JO2L 4XVJH 3WO4B 1S5IH 3PGDB 4JY6A 5EZOH 4BKLA 3OAYK 5HVHB 5IEHB 2YPKB 3O2WH 4F7MB 1JF6A 3O9WA 1CFTB 4HUXB 1CLCA 2A83A 3FFDA 1KV3A 5D7JA 2P49B 2DJ4A 4WEMB 2MKLC 4UU9B 3MLSL 3F58H 4C58B 3TBWA 4OD2B 1A6VH 3OJ2C 4FFYH 4PP1D 4G42B 2KH2B 3MMEB 5IB4B 1NLDL 4S0SD 4Z78B 4IRJA 2MHAA 3GK8H 3O3UN 3BZFB 4MD4A 1R3LB 4N1CA 1QSVA 1EEYA 1XF3B 3B8SA 1C16B 2NY0C 4DVRL 3VXUB 4HFWB 1AY1H 3RBGA 4UNTA 4ZAKD 5IM7B 1XCQB 2JB5H 1OGTA 4KTEH 1B0GA 1NKRA 2VITB 4OF0A 2NW3A 1WF5A 1EUUA 2HT4C 3B9KB 4JR9H 2KZ1B 3RNQA 4YXHL 3O2DL 5ITBH 3PV7A 1A3RH 3TM6A 1FL5B 4JO2H 5HGDA 2DKMA 4X99A 3QNYA 1IM9B 5GS1B 3MCG1 4PJ7A 3M17B 5C2BH 4ELKA 4FQ2H 4MA3B 5EB9A 4LLYA 4P46B 4JKPL 2CJUL 1UJ3B 3L3KA 3QUZC 1GAFL 3HFML 5HGBB 1ZLVH 3FONA 1VPOL 3EDDA 3TJEL 4M8QA 5CJXC 1KEML 2FIRT 1AKJA 1F90L 3QH3B 2HVJB 5AYQA 35C8H 4FQHB 2IH3A 1R3IL 4TULL 3EYUH 2E5EA 1IGMH 4GRMA 2ICES 3V4UL 5LGJB 15C8L 4ODVL 2O5XH 5MEQA 1Q1JH 2Y4SA 5CEZH 1KXTB 3ZHDA 2W9LA 2VLKD 4WFFE 4YZFE 1BGXH 5HYSG 4E41A 3W2DL 2H6PB 1RQ5A 1FGVH 3T4YB 3B43A 1CXKA 4JZOB 1OARL 4YDVB 3WFEH 3NBNA 3LCYA 1CICA 2VRAA 1OAUL 2VAJA 3DYOA 4L1HA 3JUYA 4QRSA 2NY2B 1MHHA 4ZUUA 3AS2A 1Q9WB 3SKUD 1JL8A 3RWJA 2CJUH 4RIRA 3QEQA 1GAFH 1FFQA 1LHZA 2APBA 3I75A 3QUZA 4LLWB 1RURH 4POUB 1HINL 3F7PC 4M6OL 4X7EC 5CJXA 2P46B 2UY6A 4EJ1C 1QFPA 2XKUA 2F8VA 5KOVC 4IDJH 2PW2A 3E8UL 4LHUD 1YZZA 5IFJB 4ZTOL 1YEEH 1PLGL 5C0RL 5A2LH 3IXTB 5F1KC 1XGPA 3BD5A 2RFXB 4OCNC 2E6QA 3DV6A 3DURA 1W72L 3QQ4A 4Q74A 4OLEA 3QXUA 4GBXD 3O81A 1WV7T 4NT6A 1HE7A 2G75B 2UWEE 1I8MB 4Z7WE 3EO0A 2OP4L 5KSAD 4XCYA 3CC5A 2VTFA 3SEPA 1VFAA 4ZPVA 4HUWB 3PP4L 2R56L 5EUKB 2OLDA 1IGFL 4RSVA 3MRGB 5HYJA 1DQJB 4MVBD 4NBYB 4EQ3A 1RIUL 1HINH 1S78C 4MSWA 2D4FA 1BZ9B 1FN4A 3TBVA 1MJ8L 5I8CB 5DVNA 1KCVL 2X1OA 3I6KB 1OL0A 1G7PA 3ULVD 2OR7A 1YEGL 3QSKB 3VMPA 1FFNA 4Z95L 3U79A 1IEAB 1LQSR 1PLGH 3RNKB 3EYOA 3MLVL 3S96B 2YEZA 3V8CA 3HE6D 3G6DL 5HPMB 1VERA 3PQYB 3HCVB 4IM8A 1YY8A 2GSIA 3O4LE 5HI3D 2X4PB 1J5OH 3DXAB 4JO1L 1BX2A 4QHMA 5IJVA 1KJ2L 3TH2T 1RHHA 3TZVC 2OTUA 3ALPA 1XFPA 1FFPA 3U1SH 3VRLE 2A6KB 5IR1A 1IAII 1P7HL 3HI5L 3IRZA 4L5FH 5MP6H 2ID5A 3KS0H 2WZPD 4AEFA 5ACMA 2V5SA 1RZGB 3PP4H 1CBVL 1R5WB 3O0RH 1IGFH 1L9NA 3SOBH 4OCYL 4WUUD 2GJ6E 2VL5B 3BUYB 4YBHA 1ZHBA 4KJWD 5L6YH 3GZKA 1TVHA 4DGYL 4L8DB 5CBEA 1QO3A 2FRGP 3ILPA 3CSBA 1XZ0A 1ZT7A 4WFHD 1T7XA 4XGZB 3KNBB 3FO2B 5E8PA 3MA9L 1EAJA 3IKCA 4RGOH 4Z95H 4ZAKA 5E03A 5A43C 1XF1A 3IF1B 2HN7A 3QFJE 1ZLWK 1G9ML 3FT2B 3MFGB 4D94A 4GRWH 2HFTA 4AH2A 3EYVB 4BH7A 4JO1H 2HLAB 2VDOH 4Z7WB 5JW4M 4JM4H 4PJHF 4MQXD 4QRPE 1LEIB 4G6AC 2BCKA 2YXMA 3TZVA 5JLZA 5D7SL 2DQTH 1OCWL 4RCAA 3F7RA 3V0VB 1Y0LB 2ZZUT 5BQ7B 4PRNA 3UTTE 1RZKC 4HS8L 1BOGB 2X6MA 5ID1B 5IHBA 4FQJL 3MCKB 2X4QA 4OCYH 3WN5B 2P47B 1OP9A 5ITFA 3RVWC 3S36H 2P45B 1MPAL 4L8BB 4CL7A 3H3PL 4PG2C 5DEZA 1JZ6A 4H26A 2DDQL 1NANI 1MI5D 4NM8H 1YEKL 1U8KA 2C1OA 2FLBT 5C08A 4GRWF 1RMFH 4OZGF 4JKKA 1ZLSL 4PB0L 2NY1B 5IW6A 5EOQH 2MQ0A 2VLKA 3B9EA 1MAMH 2EE9A 1X5XA 1G7LA 3O4LB 5CMAA 3S4SG 3IVKB 3O6FC 1S5HB 1FC2D 1QBML 4KK6C 4M62H 5CP3A 2FBOJ 2NY6D 2A6IB 3CXHK 2X4RA 4JJHA 4XVSL 3RP1A 3RWFB 3AREC 4R9HA 1OAZH 1LP9F 1JZ5A 3JXAA 5KZCD 3OXSA 3IAQA 2PYEB 1T1WA 1JGLH 2BJML 2VABB 3DVFA 3QUML 3QHTC 4P9HL 5IESL 3MJGX 4HS8H 4M4PA 5IMMA 3BWAB 4WTZA 3EFFA 1EPFA 1RSFA 4U0QB 3W11D 3JV6A 1R3KA 4RGNE 3IJHA 4Q0XH 1I8KB 4P3DB 1NDMA 2PXYC 5CIPB 1MPAH 1A9BA 1KIPB 4LLQA 4LHUA 4PG2A 1IKFL 1ZLVK 4O2CA 5BS0A 3VFOB 2VDPL 1YEKH 4M1DL 4HJ0C 5I8OL 1UJTA 4YHML 1CFNB 4UTAL 4ENED 1WWWX 3EAKA 4GBXA 4N8CL 2EYRB 3CZFA 5C0AD 5L2KD 1CWVA 5J12B 2FYYA 1QBMH 3KLHD 3O6FA 4NKMB 5CJ8A 2ICWI 4OZFH 4QRPB 1AP2A 3MYZA 2P8MA 4YHPB 3AREA 2DIBA 2AXFB 3BPNB 5DR5H 3VMNA 4DCQB 1OOAA 4AIZA 2BJMH 2WBJC 1PQZA 1PG7W 4EI6B 2CDEA 4P9HH 1EH9A 1XGQA 1G0DA 1FLRL 4YXLL 1HILA 3VXTA 4ETYA 4O58L 4UT7H 1ADQL 1FSKB 3QIUC 5CJQH 2LU4A 1D5XB 4NQSB 2EDKA 5B4MC 3RUGF 5MEOA 3GI9H 4Z7VE 3TA3D 4X9IA 5DGRA 2IPTH 4U1SB 3QIBD 4M1DH 4FXLA 3VA2C 1VEPA 3H8NA 3KPMA 4LSVL 3WNLA 5GXBB 4XNXL 3UBXG 5LXGH 3DUUA 4YHMH 1A3LH 4HCRA 5T1KD 5H8DA 2VKWA 1TLKA 1QYGL 1QSFE 3OF6D 1FO0L 1QLRB 3DO3A 3F12A 4NQCE 4XBPA 3RVTC 4UUJA 1BBJA 2G2RA 1AD0B 5CD5D 2X09A 1Q94A 1AGCA 2JJVA 3A6CL 1NGWB 3NCMA 3GIZL 3MR9B 2VZOA 2B4CL 1AGFB 1BZQK 2WBJA 2UYLA 2IBBA 1YMMA 2NY5L 3T04D 1FAKT 1EGJL 4RGNB 5DMGC 4JFEE 3BZDA 4PJCB 2MQ3A 3NH7H 1ADQH 1D9KC 1QFWI 3QIUA 1S9WA 5KSBE 1OTSC 1A6UL 4EDWL 4HZLA 1INEL 4OM0L 3GUTA 1FL6B 1QNZL 2FATL 2ICWJ 2NTFB 5AUMB 4LPYA 1DBMH 4LSVH 4XNXH 4NO3B 5TF0A 4N68A 5JZ7C 1QYGH 4Y4KB 5B8CC 1TETH 2J7LA 4ZPTA 3HR6A 4NCC2 3UEZA 4R4FH 3C9NB 3HI6L 4O5LL 5E6ID 1EHXA 3NZ8A 4X4YA 1RD6A 1CDGA 4JCMA 5SWZA 3WFBH 3OKNB 1AIFB 5ERWA 3A6CH 3DX6B 3H7BA 3P30L 1GC1C 3EJZD 4IOFD 3REVA 5CWSB 4PG9A 1J1OL 3SKNA 1JWSA 2NY5H 3OKKB 2X2YA 1EGJH 3ARBB 3MJ9L 1U8NB 4G8FB 4JJ5A 4KDTC 1D9KA 4OCSL 2YD3A 4Z7VB 4EDWH 2O61A 4OM0H 1TFHA 5I17B 1A7PL 2FATH 4MJ6A 4WW1A 5IMKA 1DCLA 4WFHE 1UCBL 3QXAB 4NNXB 3RZWA 1IGTB 4MQ7A 4QF1A 1VKXB 1OB1B 1MCJA 3WIHA 4ODTH 3O6KL 1H3GA 4EXPX 1CCZA 3UYRL 3VGDA 3WIIL 2FIKB 1CGXA 4NQCB 1U36A 1IMHC 5GIRA 2EZ0C 1WZKA 1BQHG 3TBYA 3WSQH 4DEPC 3FQTA 5HVWA 3IDJA 3GMLB 4L1DA 4ONGL 4O5LH 1CG9A 3MQIA 5MEPB 5GGRB 5FF6A 4EN3D 5KSAB 3TFKC 3MOAH 3VFWA 2FJGA 1N6QH 2HFGL 3D3VA 1TZHA 1CLOL 4WWKD 2H32A 2GTZA 3HC3H 1GOFA 4U1GB 5FDWB 4JFEB 3PUCA 5BO1H 4MD5B 5F8RC 3MJ9H 3PJSA 4K9EL 5KSBB 3GBMH 2ZJSL 1E6OH 3GMRA 3RZCC 3G04B 1TQBB 3SQBA 1AGDB 1DEEA 5DC4B 3MYJB 4MQSB 1MI5E 4LDLB 2I9TA 1G6RL 3GO1L 1AC0A 2XWBB 4RRPG 5SX5H 5L2KA 5FGBC 4HIJA 4UT9L 4F7EB 3NN8A 2VDLL 2IMMA 3HE6B 3HNTH 4PD4J 3TV3H 1LE5A 3B2VL 4ALAL 1BD2D 5IB1B 1E4WL 5LQBH 1FPTL 4CUCA 4ONGH 2ZSVB 3VXOB 3FB7A 3CU7A 2CRMA 1CD1A 3JWDC 2HFGH 1KENL 1WCBA 4HS6A 1CLOH 3MFFA 1EEUA 5EUOA 4F8QA 4FQIL 3TPKA 4BUGA 3PE9A 4CMHB 5CLTA 4WUUB 4XPHL 3DYPA 4TSBH 1HYSD 4PJ5D 4K9EH 5I9QB 2R0KL 2WUBL 1JNLL 5T3XH 1IAIL 2OSLA 5E2TL 5GS0L 5T5FL 3QIBA 5LGHL 4YFEA 3RZCA 1OAQH 3GIVA 1KIQB 3N1MC 3H9SD 2XQBH 2FWOA 5FV1L 4LCWD 5IVZB 3X3GH 4HUVB 5J1AA 1G6RH 4HULB 1EXUB 3G6AA 5SWSA 3MRDB 4X7TA 5FGBA 2X1PA 4X5WB 3VXNB 3KYOA 4U6HB 1CLZL 2DIAA 2X70A 4KJQD 4M7KH 1CD8A 4N9GB 2XA3A 4GW5A 5J89A 3LN4A 4Z7QF 4ALAH 1DSFL 1E4WH 2DWEB 2Y72A 4MCYB 1FPTH 5IT2H 1JV5A 1UEYA 2FJFA 3T3MF 4PRHE 2D7PA 2Z35A 4KJYA 4U6XB 4JN2B 1EV2E 2DQHH 3MLTA 3PWJB 1A6AB 3OKYA 4FQIH 1S7TA 4O2FA 1CE6A 1N64L 3E2HB 4KRMB 4XHJC 4XPHH 2LU7A 3BPCB 5FKAA 1FGNL 1LD9A 2R0KH 1GHFH 2X1QA 1I3RA 1I1RA 5E2TH 1LO2H 4FNLH 1QSED 5GS0H 4JRWA 5LGHH 2EDXA 3PF2A 1MI5B 2H2PC 1IGCH 4R7NB 4W68A 1PVHA 3VWKC 4WU7A 4ZFZA 1F11A 5DJXA 4IOSD 1TENA 3KYNB 3MLXL 3CPLB 1MFBH 3U0TB 1REIA 1U8HA 1G84A 5GRYA 1I75A 4JQIH 1NAMA 1CD0A 1LO4H 4HWZB 1MUJA 1PD6A 3TYGL 5EDXA 1UZ8B 3GSWB 3L3HA 4RBPH 3EO9L 1KNOB 5EORL 3ZKNC 3EOBA 3P0GB 3S5LG 2RHEA 3MXWL 4F7PB 2GK0B 1TPXC 2CKBB 1WAAF 2XG5A 2R29H 4NFDA 1MH5A 1PG7X 2DQJL 4NQED 2V7HA 1DLFL 1BFOA 2HRPH 2FBJL 3FT4A 2B2XL 1EA9C 4Q9CA 2YSSA 3IFNH 3HPJA 4KAQL 1U3HD 2H1PH 1NGZA 5L8JB 1HZHH 3UZVB 1EVUA 4XTRC 5DI8A 3U82B 4RFOH 1T1YB 4QXUH 4R90H 4F58L 3VXSD 5D5MB 3DUSB 4K3EH 6CGTA 4ACPA 3MLXH 2HT3D 5C0AB 1DQQB 4LVOB 5DMJB 4GAYB 2W38A 3RWIB 4XHQA 5F89A 3QHZL 4NWUL 3HG1A 1K8IA 1NKOA 3QDAA 3RU8L 3D48R 4BQ9A 5DQJB 4EN3A 5BOPA 3SBWC 1I3GH 3MRCA 2J8UF 3TYGH 4PRHB 3CXHJ 2BNUB 1J18A 4DGIL 1AHWB 1QP1A 3PV6B 3ARWA 1LWRA 4F15C 4OD3H 4NC1E 3EO9H 4POZD 1FC1A 3I6LD 5DJZB 5EORH 5IBLD 4HXBH 1I9JH 3MXWH 4NN5C 1JGUH 1ZT1B 1SMOA 2DQJH 4XBGA 4AT6A 5L9DH 4QTHB 5DZLA 4U1NA 3U2SA 3O6LL 1K4DB 3PP3H 4JM2B 4P5MA 5LJYH 5E4IA 1MIMH 1MWAH 3WXWH 4KAQH 4XWOC 1G7QA 2QR0B 5HHXL 3TCLB 3TA3B 1M1SA 2OJZL 4B50A 4U1JA 5CFHA 3L3IA 1DDHA 4F58H 1CFVH 2Q1EA 3V6OC 4EKXA 1HSAA 4JRYD 1XIWC 4HFUL 3MZGB 4HXAL 4QEGA 2HMID 5T1KB 1QRNA 4X0KA 5DJDA 1P7KA 2I60L 3QHZH 4NWUH 3BW9B 2IANA 5DRXB 3SN6N 3CU1A 4L4VD 1IGIH 3FO1B 2AV1B 4JCLA 5GGQL 5K33A 3SBWA 2SEBB 2FECI 1C7SA 2VMFA 2I24N 2NW2A 1JI1A 2NXZD 4LCUA 2X4SB 1DUYB 2UZIL 1YECH 5E7BA 5ETUB 4A6YB 4KZEL 2W60A 1HH6A 1RU9L 4IS6B 3VFPB 2XTLA 1GJIA 1YY9D 3QUXC 2HFFB 3MV7A 4K71C 5JXED 4PGEB 4S0TD 5BW7C 4JFXA 3S9DB 3GMPA 5DQDL 3VWJD 4WGVB 4MWFA 2VLME 3DBXB 3FL7A 4GQ9L 2Y7QB 3V6OA 5F7WC 4MLSA 4OZHE 3DV4B 3UAJC 5KJRL 5DRZA 1D5MA 1QFWL 3CGTA 2P8PA 5SX5K 2IH1B 1BD2E 5E6IB 2AJUL 2WM0A 4ELME 4KK5C 2WLZA 1BVKA 4R97B 4XPTL 2R0ZH 3O2VH 5HHQA 4LLVB 4YC2C 7FABL 5JOPE 1I9RL 1BLNA 3SE4C 4ZODA 3OPZL 5DUBB 1NC2A 4HPYL 1T04B 3SDCD 2Q3ZA 4PJ5E 5DO2D 5IEKA 1WTGT 1WUNT 3QCUL 4XCCL 4KV5F 3QUXA 1Z9OA 3LAFA 3T8XA 2VZTA 4KVCH 3EO1A 4CJ1A 2IFGA 2IALA 2R2HB 1I8IB 3RWHB 4NM4L 2DM4A 5BW7A 3L3JA 1L7TL 1FVCB 1A6TB 1EX0A 2APWA 2H2SC 5I1AA 4PRIE 5MI0B 3ZE0F 3LEVH 3PDOB 1FZJB 4RMTA 1N7ML 2AJUH 1B4JL 4FTVA 4XMKL 1NFDE 4HIIA 3IYLW 8FABA 1OF2A 5C0EA 4OKVB 1I1AC 4NQEA 4WWKB 3OKMA 2VUYA 5FO7B 3V7MA 3EDFA 2R8SL 4H0IA 5ESAB 4TQEH 2Q6WB 1B90A 1A7NL 2HJLA 2OL3L 3MGAA 5C09A 4HPYH 3OV6A 5JTWA 1HSBB 2ADIB 2VXVL 5D2NC 4N0UA 2B0SH 1T5WB 2XKSA 1E6JH 2Z91A 5EC2B 1ND0A 4EDXB 4H5SA 3KS0J 4NJ9L 4XCCH 5D93B 1QLEH 5MERA 1WIPA 2ZUTA 4P2RA 5C8JA 2J4WL 3BGFB 2F58H 4HIEB 4K8RD 2YA0A 4W6YB 5F72S 2FR4B 4OZHB 2DM7A 4L9LB 4FZ8H 4K07A 4Y8DC 1T0PB 2YD8A 4LBEB 4YHIA 4ODUA 1BVLA 1BD2B 4Z7NF 2CMRH 4HIHB 4YHOL 4ELMB 3P9LA 5I8EB 2D9QB 3LD8B 2EDYA 3SY0B 1N7MH 3C5SB 3U0PB 1B4JH 4XMKH 3CFKB 4OI8A 1HKLH 2DF3A 4U1LB 3VA6A 1UG9A 4PJXB 1MJUH 4Q97A 1FVEB 3A67L 3DSFH 1BOYA 5C7XH 2V9RA 4MJ5B 2Z8RA 3ZDYE 3MRIA 2AJXL 2I27N 3VFMA 5IHZA 4RBPK 3MV01 4HGWA 4PJ5B 2P5WD 3MODH 4NPYA 1T03L 4D0DB 1OSPL 4QYOB 2HKHL 5KTEL 3EHBC 4H25A 3HS0B 4NJ9H 3BISA 1XMWA 3H9SB 3KJ4B 4FN0A 3QUYB 5DRNB 3QDHA 3EYFB 4LCWB 4UOJA 2PKDA 1D5IL 3V5HB 1FH5H 3OTTA 3P4LA 3AMKA 3V6ZA 4PRIB 4RFEB 4X6DF 5DEGB 3E3QC 1WEJH 3MRBB 4L4VA 5IROC 2VOTA 4HC1L 4ONHA 4Y8AA 1UH4A 1MNUH 1MCLA 2P24A 5GSVA 2VDRL 5GS2H 4OAWB 3IDNB 3UZEA 4PR5A 1AXSA 2J8HA 2XN9D 4M03A 5IQ9A 3BH9B 2ADFL 4OZ4A 3A67H 2ZG1A 4H8WL 2ZUVA 3ZKMD 1RK0B 4MB4A 5F3HB 1BBDL 4Z18A 1YPZE 2AJXH 2O93L 5DQ9B 1AJ7L 1ORQB 4MAYC 4X8JA 4XX1E 4YIQA 1RAMA 3ULUE 3DO7B 1TZGH 4PV9A 1OSPH 1E27B 3MACL 3SDAD 2E7LC 4TTDD 5KTEH 1QSEB 3PP3K 3QA3B 2IFFL 1MHPL 5IB2B 4MDIB 4R0LB 1SY6H 3MGTA 2CKNA 1JE6A 4GJTB 4P4KC 1GVIA 1NDGB 4TNWF 5IROA 1U58B 4MDJB 2WK2A 1PDKA 1P4IH 1XF5B 3L3OA 4H88L 4HC1H 1SHMA 4P5TC 5FO8B 4OBRA 3W5MA 1KJVB 1FVDB 2R1YA 3CMGA 5SWQA 4YHKH 1JHLL 1F58L 2ORBL 1T83C 2ILLA 4H8WH 4NO5B 2DKUA 4YHLH 1OAKH 3A6BL 1BBDH 3PWLB 2C4FU 3MX0A 2VZSA 2X89D 2XG4A 3BSZH 4EEEA 3T09A 4MAYA 3OKOA 4IMLB 2DJUA 3WUWG 1U3HB 5IVXA 2APXA 3JBG7 2EXYC 1C5BL 1PBYA 2E7LA 4DZ8B 4WHYH 3U7YH 2F53A 1BJ1J 1P1ZA 3S35X 3WL9A 2IFFH 5CGYC 1MHPH 1N5YH 1A5FL 4IIQA 5K9QI 5BV7C 2ZNXA 3KLAA 4X9BA 1QHOA 2VO5A 4JPVL 1T2JA 3MRFA 4NBXB 4Z0XB 3Q5YA 4CNIB 4YXKH 3STLB 3QQ3B 2C3XA 2X9XA 3RKDD 1YUHB 3VCLA 4AEIL 4NRXA 1TTGA 4QOKD 2X9YA 4B5EA 4P5TA 1TTFA 5DC0A 3RI5F 5HHME 4HX1A 4ZUWA 2PW1A 4HIXL 2VQ1A 3EOTH 4HWNA 4XNUL 5HYQA 4L8SB 5CJOL 2HTKC 1WQVT 1YPZB 4L9DA 5TDNA 1JGVL 4HMDA 2NMSA 3A6BH 3WJJC 2DLIA 2GITA 5F96H 5TQ0L 3T4AA 2BVEA 4MXVF 1KT2B 1NBVL 2UZYB 4MS8C 3C5ZD 3KXFD 4JB9L 3I3EA 1C5BH 5TPWH 3GNML 4PJFE 3HUJF 4JO3H 5IBTL 4NUJB 1F8TH 3I84A 1A5FH 3V4VH 1RFDH 2OYPA 4JRYB 1KYOK 2Z9TA 3TO2B 4YDKL 4JY4A 3X13B 1BJMA 1FV1B 3DWTA 3RVUD 5KAQF 1YN7A 2FHBA 4NBZB 1U6AH 3BP4B 3VFRA 1JZ8A 1N4XL 1ZXQA 4OGAC 4AEIH 5FYLE 4EIGB 5DZNA 3AS3A 1RZ7H 3BYYA 4Y4FC 5D1QD 1G7IB 5DUPL 4HIXH 3ROLB 2NXZB 3O41B 3ALWA 4LCYA 4NQDD 5CJOH 3FO9A 4J8RB 1JGVH 4OB5H 5IP4A 2Z0BA 3EOAB 3GSOB 3CX2A 3RVVC 1N3NA 4P2OC 1LGVA 1NBVH 4PJ7E 1T4KA 1MJ7L 3TN0D 4JGJA 3MGOA 2PF6A 1Q9LB 2QL1A 5DD1H 4KI5D 3NACH 4P23C 1EHLH 4FQLH 2YA1A 1FORL 5F9WC 3TO4C 1CZ8L 4XAWL 4ZXBD 1NFIB 5IBTH 3VWJB 5JW4R 2Z4QA 1B0RA 3CFBB 5E4EB 5BCAA 3Q1SL 2OXHA 4J2XA 5ACZB 5TDPA 3KYKH 1HHIA 2RCSH 4LRIA 2GSGB 4GW1A 5C0DA 2XWTB 3GSNA 3HLAB 4K2UH 3M8OL 3MSPA 4GXVL 4O4YH 5HHVL 3AU1B 5HHMB 2XN9A 1IEBB 4HKBA 5IHUL 4PJEE 1I7ZB 3CXDL 1CE1L 2V2XB 1HQRA 5AWNL 4KTDH 4JLRB 2RQ8A 2JJSC 5D1XD 3L9RB 5KS9A 4BKLB 1RIHH 3MOBL 4J4PD 4OGZA 2MPAL 3SDCB 3NCBB 1QFOA 4TUKL 1KCRH 2YRLA 4P2OA 3QDGA 3S37X 4J1UA 3QEQE 1YEFL 3DSNA 1NCCL 4N9OB 4PJFB 2AK4A 4P23A 5J57B 1VCAA 1CZ8H 1UT9A 2X4OA 2AXHA 2VXUH 2HKFH 4GS7C 4YZFF 4Y0GA 4X7SL 1QG3A 3IETA 3ZHKA 4NNPH 4GFTB 2QKIB 3V5DB 3E6HB 1F6AA 3G5XB 1K2DA 3DIFB 3M8OH 4WU5B 1JGDB 3MRNB 5HHVH 4NCDA 1NGPL 2AW2A 2YPVH 2YS4A 4YO0B 5D7LD 1FP5A 5IHUH 2C3GA 4U05A 3W9DA 3ES6A 5AWNH 3X17A 2MJWA 6FABL 2JELH 3STZB 5C9KA 2JJSA 4OTXL 3QNYB 2M1KA 4HSQA 4YX2H 1K4CA 3WFHB 1MFDH 4I2XE 1BF2A 5EU4B 4RWYL 3JV4A 4CW1A 5C0CD 5CEYB 1HHHA 5HY9B 4DN4L 1IVLA 2OTWA 3MRLA 3PWPD 3NABL 4OLYH 4K3DH 4CVZA 5EG6C 1DN0B 4XWGH 4K94L 3LDBC 3D5OF 1OSZB 1J8HA 2VAAA 1NBYA 1IM3B 4Z0BH 5T5NF 3B8YA 3SJVE 1X5IA 2P5EA 3FO0L 1GGUA 4X7SH 2UWEF 3KPOB 5DMYA 3PWUA 5TQ2H 5MEQB 2DOCA 2W0LA 5I18L 1KB5A 4HWBH 1FJ1A 3UBXB 5I75C 1P4BL 3GBNH 3KAAA 4Y19A 3HAEG 4PJEB 3CNKA 4N0RA 1JNJA 4U0RC 4K7PH 1OTUD 5EA0H 3EDEA 3DX9B 5J4MA 1MEXH 3UJIH 4V1DD 5I19L 1UXSA 1OGAA 1KSRA 2ADJA 4OTXH 3MUHL 4DUVA 2C7UA 4MA1C 2P5WB 3QULB 1WBXA 4MAUH 4ZUUB 1VA9A 3HZMA 3B6SA 4RWYH 1JZ2A 1KN4H 4AG4L 4NWTH 2A9MH 2E9BA 3TT1L 3NABH 4OQTA 1ZHNA 3HRZB 2QQKL 2GT9A 4D8PA 1S7WB 4P2QD 5CIPH 2EDOA 4YR6A 3ECBA 5BXFA 5H37G 2C1PA 1CL7I 3ABZA 5F7DB 3QZWG 4UIKL 4WY7L 2XWJA 3DOSA 2DI7A 1CDBA 3OGCB 1D3CA 5D70H 5L2JA 1EFQA 3CSYB 4MNQE 3T0XA 3VRLF 5D1QA 2YOCA 1P4BH 5AG8A 4WFEE 1CGVA 4NQDA 2WWMD 4RQQA 4D3CH 4OLUL 4U6VL 2VXTH 3QFDA 4Y1AA 1Q72H 4I0CC 3KDMB 4H1LA 1JRHI 4I2XB 2GAZB 4XCYB 1ZKAA 2E9JA 3W0WE 2AABL 4KDVA 3TN0A 12E8H 3BRGC 4ZPVB 5IJKC 1MCOL 1JWMA 3VI4E 5BOZG 3SDAB 3D39A 5SX4I 4AG4H 1UQSB 3OJVC 1JYXA 1GXEA 4XCNB 4S1DC 5BVPL 3SJVB 1JF1B 1INQB 4J12A 5E8DL 5JW5B 1G7MA 1GGTA 1CK0L 4UIKH 2BOBA 2ZG3A 3HR5A 4XNYL 5IK3B 5C08E 2BVOB 4FQXD 4YDLC 4AIOA 5FFLA 4GMSH 3DTXA 4WV1C 2L0DA 2GSIB 3KPLB 5IW1A 1IILE 3QDJA 1CGSH 5A16B 1RY7B 4XB7A 4OIBA 1BQHB 4J4PA 2XKNB 3LSOA 5HDOA 5E0QA 2B1HL 4WNQA 2AABH 3D2UD 3JTTA 3OG6B 3Q3GB 5E1AB 2HH0H 5GSRA 3ILQD 2YR3A 1NCUA 2O5ZL 1ZHBB 2ENSA 2V17L 5KANI 2ITDB 1TVHB 3QR2A 5ACLA 1H9VA 1PEWA 4ZO7A 3OX8B 4Z7UF 3VXRA 2VZ3A 1F2XK 3NCFB 3ILPB 2PCPA 5E8DH 4Z5RA 2LVCA 3U48A 2ARJA 1FDLH 1VADA 4XNYH 4M3KB 3EZ8A 3Q6GL 4MNQB 4ZUTA 4O51B 2WINA 1NL0L 1B88A 1P4LB 4JO4H 1V7NL 4QOKB 3V6FB 4NYLB 2DTML 2W91A 5ALCL 1A2YA 4WV1A 2WQRA 1OLLA 4PLJC 4BH7B 1KEGL 1DVFC 3OB0H 4YPGA 4AYFA 4WI9A 5DJYA 3GDBA 4HJJL 1UM4H 3RGVC 2J5LC 4LSDA 4N0YH 3W0WB 5FCSH 5A2JH 4EOWH 1FZOA 1N0XH 5K9KA 1J0YA 3C5ZB 2D31B 3PWPA 4UQ3B 5EU5A 4OCXL 1IC4H 4KPHL 1V3KA 4H0GA 3P4NB 1FFOB 1RK1B 5EO9A 2VISB 2ZOKB 5B39G 1V3MA 1KPUB 1MCSA 1NCDH 3R4DA 4M00A 3CDGA 4WIQA 4H26B 4PTUB 1C12B 1U8KB 1U3JA 2MFNA 4PJAE 3T3PF 5I0ZA 4JDVB 4YAQA 1T6VN 4ZFOA 1Q0XH 1OVZA 5CMAB 1T3FA 1J88A 3O3DA 4V1DA 2NY3D 1RULH 1YNKL 3LN5A 3MV8E 3IS1X 2XV6B 1DVFA 3ZDZE 4HJJH 4AENA 5CLWA 1CS6A 1X5ZA 4NO0D 3RGVA 4LOUC 3OXSB 5I76B 4DKDC 1T1WB 2R1XA 4JFFA 5TH2A 1TJHL 3B5HA 1MY7A 2FGWL 3D0LA 3N1GC 4Z7VF 4P5KB 3RDTD 3PL6D 5C0CE 1F6FB 2J1KA 4GAGL 4OCXH 1YMME 1T22A 5EU6E 4KPHH 2EYTB 1C1EH 3WFCH 4L8CA 3IJHB 3VXPA 4QRTB 2D7TL 1P5VA 3BP7B 4KROC 4ZXBB 2FX8L 3UTOA 3ULVH 4J3VA 3C6SB 3I6GA 3HC4L 4JANA 2GHWB 1Q9OB 1CFSB 4R96A 1KYOJ 1TZIB 1ZVSB 2VXSL 4WO4C 3VD4A 5E5MA 4Z76A 4ERSL 5KVGL 4DKAA 2Q8AL 2F74B 4HK0A 4Y2DC 1QBBA 1AP2B 1YNKH 3VDCA 2V9TA 5D1XB 5C07E 4QY8B 4XP6L 1M6OB 3FOLB 4NO2B 1NUNB 1A64A 1PX3A 3UO1H 3PHOB 3LRGA 4WW2F 5SWZE 2VE6A 2GCYB 3HB3C 4L3AA 2Z31D 1TJHH 4G9FA 3ARUA 1MLCB 3S5LB 4UDUB 1GGCL 1XGQB 2FGWH 3L6FA 4GKNA 1EO8L 1F5WA 5CBAB 4XCEA 1CT8A 1HILB 2GFBB 3QEGH 4HLZG 2BVPA 4XVUD 4M6NH 4NN6B 3T2QA 3WUZA 4IOIA 1NGYB 2PXYB 4BH8B 3BKMH 5MEOB 3HC4H 3HZVA 4XTRD 4N90E 1A7OL 1MCWM 4PJAB 5JHDA 4RFNB 4BUHA 1GIGL 2VWEC 4KKBC 1TVBB 3EFDL 1YEJL 3MBEC 5JDSB 2BMKA 2Q8AH 5KVFL 1X5LA 5D7LB 2FO4B 3MV8B 3F12B 1ZLUH 3DGGA 3VG0L 4G8EB 4LCCA 3TVMC 1IC7H 3O8XC 4CU7A 1Q94B 3VD5A 1WGOA 1PZ5A 1P7QA 2Q7YB 3O3BA 1NEZA 4M1CD 4PRBA 5FUOH 4M5YL 5C0CB 3VFUA 4R2GC 5EU6B 2BNQD 3B3IA 4HBQA 4JFDD 1EO8H 3WFDL 4L3EA 1N59A 3OR6A 5MENE 3WIFA 4AMKL 5BVJB 5IG7A 1NUGA 5LWYL 2BY2A 1S9VA 4ESKA 3QIUB 4CMMA 3HRPA 4NRYA 1PKQA 5I15H 2R2BA 3GMQB 4G43A 1GIGH 2IF7A 4ZSOA 3G5ZB 3IDXL 2V2TB 2OZ4L 3EFDH 5TE4H 4CBPA 1XIWD 1NUFA 3BXNA 5E8EA 3MBEA 5LBSH 3NCYP 4ZPTB 2VN4A 4C54A 5C07B 3MV9E 4C56D 5AYUH 1UXWA 3LMJL 3TVMA 1IAKA 2CDFA 4ODWB 4OLWL 2JE8A 3O8XA 5J7CC 1M7IA 1DE4A 4NUGL 2DN7A 3K3QA 5AD0A 3H7BB 2EYSA 2CKBH 3REVB 1RHFA 1LO5B 3QISA 4PG9B 2UUDH 2ADGA 2EDBA 4M5YH 3BVNA 4LQFL 1JMZA 2E9WA 2XZQH 5D71L 1A1OA 4TYUA 5D6DA 3GM0A 4F7TA 2ZKHL 5LWYH 2XTJC 4LVNC 3HZYA 5EZJA 1N0LA 5MHSD 2O61B 4OCRL 5JQ6L 4JPIB 5KW9L 5DJAB 1G9EA 2KL6A 1ED3B 4LPTA 1P6FA 5DWUL 1U8LB 4TNVK 3D0VA 4KK9C 1ZEAH 4PJHA 1HQ4A 1URLA 2HT2D 5B8CB 1GL4B 1VDGA 1CL7L 2ICCA 3FQTB 3LKRA 5ADPH 3IDJB 5EIIB 3VFSB 1CG9B 1RUMH 5H94A 2H3NA 5FF6B 1T2QL 3VRJB 2DQGL 4OLWH 3VU2A 4W6XB 4I1NB 2FJGB 1L6ZA 4OGXH 4XNZB 1JYNA 3OB0K 3RDTA 3C60C 4IRZH 3MUGB 2NX5A 3HMXL 2K1MA 4XMPH 3D25A 1QFUL 2CQVA 5MENB 2EH7H 2DBLH 4N0CD 4QRQB 4OD1H 2R4RL 2CDGA 5A2KH 1K6QL 5F21B 5A40E 5ALBL 1PEZA 5HI5D 5I1IH 5FUZL 4APQD 3GSVA 3L5JA 5KW9H 5DD3H 4FQXB 4I4WB 1C08A 4PLKC 4HIJB 2IQAB 3NN8B 1OPGL 5DDHA 3SO3B 3CVHB 5FM8A 4W81A 2QSVA 3DECA 3H0TB 2E27H 5M94B 3MV9B 3RWEA 5TE6H 2R0WL 1W0WA 1JTPA 2YBRA 2XFXB 3BKJL 4DEPB 1QKZL 1Z3GL 1DQDH 3BZ4B 3WS6C 2DQGH 4RMRA 3DX7B 3ESVF 5BZDA 1DLHA 1J0ZA 4JM2F 3TNMA 3TPUA 2GJZB 3D2UB 4UAOC 5D4QA 5INDA 4HS6B 4U6YA 3QO1A 4EUPG 3QO0A 2DLTA 3HMXH 3C60A 4LL9A 1W0VA 2BXYA 2ARWA 1QFUH 3FTGA 3KR3H 4A6YH 4NQXB 4PJ9D 4XNMA 1K6QH 4NOFA 2AJSH 3QWOA 3TBSA 4QGYA 1HXYA 5DYOB 5CUSL 4X4XB 1H0DA 5E1HB 2EDDA 1ZA3B 3QNZA 1EZVY 1H3TA 3G6AB 3BQUD 2OS7A 1R5VB 1F4YL 5F97E 2VLJE 2IBGA 4HKXA 1A02N 5E6YA 1EJ6A 5H2BB 3BFOA 3HG1E 3VFGL 1IAOA 1JMXA 5CCKH 1TJIH 4W6WB 3K0WA 1LP9E 1MFNA 1D5ZA 3WS6A 4MJIA 1T0NB 4XBEH 1JPFB 4DFIA 1I9EA 2YMXH 3W39A 4KGJA 1J87A 5DURD 5FKAB 5J06A 3EYQC 2GY7B 4PRDA 3ZKQD 4G8GD 1I3RB 5KAQG 1S9YA 1W72B 3DVNB 1U8JA 3SCMD 4MXQC 4OZFA 3WNNA 1QLFA 1CR9L 3BRDA 5I8KL 5IVOA 4C83A 1FZKB 4ZFZB 4ZFGL 2R0LH 1OWWA 3UDWC 2CPCA 3UYPA 4TVPE 1F4YH 4GKSA 4RWHA 1U8HB 3LQAL 3RA7L 1QRNE 4Y4HD 1FNEA 5HD8D 1NAMB 3NZHL 5DRWB 3K2MC 4PJGA 1YMHA 2IANE 3RPIA 2Y1VA 2DM3A 4NO0B 1JPSH 4PY8I 2DYPB 3QXDA 1ZLUK 2YPLA 2VLRD 5FYJE 3SDDD 4NSKA 2V7HB 1ACYL 3FQXA 3U36B 1GZQA 3B2UC 4JFDE 2QQQA 3V4PL 4ZOEA 1WSST 2F8OA 3DI3B 4GUPA 3KPRA 4OLXL 4IEFB 3AM8A 3RUGE 4PTTA 4LKCB 2GI7A 5DI8B 4PY7A 3ZT7A 4OZGB 3IDYC 5I16B 4JREC 4NIKB 1T5XA 5DJ0A 1KJ2B 4M1GH 2D2OA 1IZKA 4ZO8A 3VWKB 2NPLX 2QSCL 3GSRA 3ZHLA 2VLJB 4XNQA 5D72H 1M05B 3UDWA 3V6OE 1S9XA 5JO5A 1J1XL 1T0MB 1I7UB 3T1FA 3HG1B 4WUKL 2IPUG 1LP9B 1ZHKA 3HKFA 3X12B 1ADQA 2DQCL 4V2CB 5A3IC 4CVXA 2D3VA 3C5JA 2R9HC 5IFAH 2Z31B 3ME0A 1MELA 3QRFM 3H6JA 3UPRB 4AT6B 2FSEB 3LOWA 3CUPA 1RUKL 2OJEB 2COQA 3D6GA 3U4AA 3NFNA 3HPLA 3NPSC 4JHWL 3LKOA 2UUDK 4OZHF 1ZMYA 4PRAB 4P3WA 4MJ4A 3WUWB 5F6HJ 2Y23A 3LZFL 4U1JB 1MVUB 3AMLA 3L3IB 1DDHB 1TXKA 3RY5A 1QBLH 1RJLA 2GIYA 2ICEA 4I0PC 4PY8J 1UVQB 3QDMD 4I3RL 5L8KB 3ZDXF 4Z7OE 4X0KB 3FN0L 3V5KA 5DJDB 4I13B 1FNHA 2PUQT 4WI5A 4QHLB 5C6WH 1EGJA 3HMWL 4HD9A 2EIZA 3M45A 1FHGA 1WWAX 1RZIA 1FRGL 1K3ZA 2DQCH 3P73B 2IGFH 3GRWH 4FTVE 4MCZB 4RMSA 2FX7H 4F15B 4FXGA 4QTIL 2X9WA 5EOTB 4ZUSB 4GXUN 2Y07L 1MCWW 4LCUB 3JWOL 1AI1H 2JIXA 4JHBA 3MPCA 2BNQB 4JFDB 3O45A 2EE3A 3EJYD 3CFEA 5FA3B 3WV0A 1FNFA 2BRQA 5T5NG 2VL4A 2E6JA 1KGCE 2I5YL 4JHWH 3L5WB 4OLVL 3RUGB 2EH8H 4N0UE 3T0EC 4YHYC 3VW3H 4M7JL 4Y5YB 2W9EL 3LZFH 2QADD 2AJVL 1HHJA 4XXDB 4CN6A 5CZVL 3MV11 3V2AR 1FZMB 5H35A 1PW3A 5GRJH 3I50H 4MWFB 4P57B 2IPKA 4Q6IA 1HOCB 3IDGA 1NFDF 2A38A 4I0PA 4PB9L 4G80A 3D18B 5CHNB 4KTYA 1XIWB 5DRZB 3TIDB 4S2SB 4XRCB 1EHNA 3QUMB 4WHCA 5F1IA 4FQ1L 4C56B 1O7SA 1MCIA 4X9HA 2A6DA 2ATPA 4TPRL 1BVKB 3MJ9A 2CRIA 3ZE1F 4UNUA 5GZOC 4ZMAT 4P2CG 3MA7B 5E2WH 1MVFA 3GMOA 5HHQB 5CKAA 1OM3L 1TMCB 1FG2B 2FEDD 3CDYA 2Y07H 3NA9L 3ZL4H 2ESVE 4J3TA 3JWOH 4XB8A 4YGVA 1GGBL 2ZCKL 3ULUL 1Y6KR 5D9SA 1XCTA 4WEBH 4PLNC 2ITCA 5D7IF 4EZMA 1UWGH 2I5YH 3NCEB 1LK3L 4LLDA 1CDYA 2ZCHL 5D2NE 4RISL 2Y6SD 4OKDA 4M7JH 3T0EA 3LH2L 5CP7A 3MCLL 4K71B 2AJVH 4G7VL 2MKWA 3MLRL 5GRXG 1JBJA 1DBAL 3WLWD 3TC9A 3FHAA 1A4JB 5I1GL 4BQBA 4Y4HA 5CD3A 2A0LC 5I1AB 3UCRA 5GJSL 4RX4D 1U8PB 3NFSH 4UNVA 3ARDD 4D0CA 3ZDYF 3S88L 3RTQD 4KRPC 4TPRH 4FTVB 1RJYB 5I71B 3BI9X 1FYTA 4HIIB 4JE4B 3CMOL 4MNGA 5FGSA 4TUJA 2ZOLA 4GKZA 3NFPA 4F7CB 4BSWB 3OKMB 3K74B 4ODSH 3NA9H 4ISVA 4YC2B 2DL2A 3B9VA 2A1WH 1GGBH 3UTPD 4K3JL 1G6RA 2HJLB 5EZIL 1AR1D 3F7QA 4NHUB 1UB6A 1N2RA 4HK3J 3IDMA 3WLBB 4RAUB 1JPTL 2Z91B 3MRRB 4Y5XC 2ZCHH 4F33A 3ARSA 4APQB 3LKSA 4LF3B 1XGRB 3MCLH 1CDUA 4KUCF 3LQZB 1FO0B 3MLRH 1DBAH 2L4OA 4PBVC 5I74C 1INDL 1BMGA 2EKSB 4POYA 2P8LA 1AQKH 5CZKA 2BZDA 4NKOA 2EDRA 5F88B 4LAQL 3R1GL 4OLZH 2AEPL 5EZLB 4Z7QE 1IKNC 1RVFL 4ZQKB 5IB5B 4ODHL 3MLZH 1LEKB 3LS4H 4YFDB 1EERB 3TT3L 3K2UH 3MNVA 3ULUF 3CMOH 2QQLH 5DHYA 1KCLA 4GW4B 2ESVB 4PS4L 3MNWB 3ZLQC 1I1AB 4XT1C 4JQXC 4WDIA 4D9QE 5CINL 5ISZA 2G5RA 2IAMD 5IHZB 4LSTL 4HT1L 2DQUH 1A14H 3L3GB 3LEXA 4QXTB 4M7LL 1B6UA 2IWGA 4PJ9B 4WFGD 5KSVA 2XA8H 3CFDB 5D2NB 2V7NA 3L95B 2BNRD 2EDEA 4LSQH 5M7QA 4CAGA 5IIEB 4Y5XA 2AJ3B 2BSSA 2Z8SA 4AY0A 3KJ6L 3IU4L 1JUFA 1ORSB 3QDMA 5CZXC 2RAMA 3DRTA 5I1CL 1GGYA 1N5AB 2OK0H 3R0MA 3BQUB 1VHPA 4P99A 4L3CB 2WIMA 1IL1A 2NR6C 4WENB 3TESA 2J8UA 3R1GH 1XGYH 1DBKL 5FYLL 3WNOA 4YHZL 5ICXA 1RVFH 4K23H 4MJ2A 1IKNA 2R69L 3R8BB 2P24B 1CFQB 1MAJA 3S36X 2CIIA 1II4E 4PR5B 3UJJH 3HAEB 3UTSD 5HGGS 1GCFA 3HE7C 1IQWL 2XQYG 1WAAE 2EDFA 3L5XL 1EVTC 1G9NH 2E7CA 5CINH 4JQXA 1X4XA 4LSTH 4ONFH 4F37K 3RJDA 4I77L 5DURB 3WHXB 2IG2H 2E8ZA 2Z93B 3X3FL 3VJ6B 1T89C 3RX5A 4G8GB 4OIIL 1VFBA 4D2NA 1AE6L 3EIFA 4M61B 3SCMB 1UKTA 5E00B 4HH9B 3KJ6H 32C2B 3CLEL 1MAKA 1Q0YH 1T20A 5E94B 5HJ3A 1JZ4A 1YN6A 2FB4L 5I1CH 3V7AE 1LO3L 4Z77A 1C5DA 1XGUB 1BP3B 5EBWA 2CD0A 4HV8A 3QZWB 5DMIL 5E9DD 2R1WA 5GJTL 1DANU 3SDXE 3IJSA 5FYLH 5KVEH 4HDIB 5ANMA 4HUUB 1HXMA 2YUVA 2F54D 1DBJL 3OWEA 2EDHA 1MWAA 2DMKA 2R1YB 2OR8A 2PNDA 3P9MB 4FG6C 3VFVB 4NKDB 5JW4N 3SDDB 4D9LL 4X6BA 5DJCA 1BQLH 1H5BA 3ARGC 4HJGA 4PJFF 5A2IH 5I1JH 5FXCH 4M93C 4I77H 3BPLB 5B38G 5JPMA 2Q86B 3C8KA 4CGTA 1U8OA 1FIGH 4OIIH 4QNPE 1S7QB 4KVNL 3L1OH 5JOFB 2ZWLT 1R3HA 5D2LA 4DQOL 3OJDA 1MCDA 5HHOA 5E8OA 3G5YA 1LO3H 3BP6A 3CAFA 1MHCA 3ARDA 3BP5B 1KTDA 2BHYA 3QQNA 2DLFH 3FT3B 5DMIH 1WZMA 1CLYL 1EO7A 4P4KB 3RTQA 4N5UA 3IFOB 3PWVB 3BUTA 2X5PA 3FFCD 3VCLB 4FABL 4MNHA 4NRXB 1U91A 2LTQC 2W07A 4ZUWB 2ZUQC 4PJ7F 5GHWL 2Y06H 5EC1B 2VQ1B 1F4HA 4KKCD 3RX7A 1G7HB 2ZPKL 1BIIA 3VGEA 2OR9H 3HZKA 3L3DA 3MRMB 3VGAB 3D85D 4JDZB 5KS9E 3ARGA 5FYKE 2XICA 5IBUG 1F3JA 3DROB 3RIFK 2N7BA 5F3BB 4IRSC 2XXCB 5F7EH 2JK5B 3JZ7A 5ENWB 4KVNH 1CXEA 2QSTA 1AH1A 5C0NC 3OKDB 4GKOA 3IXAA 3MJ6A 4L4TE 5HDBE 1DEDA 1AXTL 1WBZA 3GJEB 3KPSA 5JIIA 2FHCA 3P4MB 5IWLC 5BV7B 1LDPH 1ZV5A 2VIRA 5FM4A 4JY4B 3WS3A 4W4NA 3SDXB 5K9OA 4QCIB 1ZS8A 2F8XC 2FO1A 1KPRA 1MQKL 1OD9A 3PGCA 3MJ7B 3IFPA 5J13C 1WWBX 2F19L 4R4ND 3GHEH 4Y7MA 1NBZA 3NCYS 4HPOL 1PY9A 2IEPA 4YBLC 43CAA 4X98B 2R2EA 1UFUA 5C0BE 4O2EB 2JJUA 1B0WA 2PTVA 3OR7B 1ZWIA 3L7EA 2A73B 4U2ZA 5JUEL 3SGKC 2XZCL 3S98A 5HGHB 5GGSY 5ESQA 2BFVL 1N8ZA 2VSCA 3IDUA 3JSSA 4JPWL 2YUWA 3BDYL 3EZJB 5F7UA 5EOCH 4G3YL 1R0AL 4R26L 4IRSA 1FL3A 3ZTNH 4YDIH 4YHNB 2JCCA 5CEXA 5T3ZL 4F2MA 2FX9L 2F9BT 1YJDL 1QVOB 5B39B 1B0RB 1HHIB 5BZWA 2IQ9L 1FE8L 1I7TB 1YYMH 4K55A 5E08L 5IWLA 3DPBA 4E42A 3GSNB 2P5EE 3C08H 4JY5L 4OF8A 5C86A 2I25N 4JHZA 5ILTL 5GISH 1JHTA 2F19H 1KLUB 4PGZA 2NY2D 3P11L 4Y4FB 1A1MB 2ZSWA 4Y19E 4LFHG 2PO6C 2X4NA 2BP3A 4BZ2L 2WANA 5JUEH 3H9HA 3BAEL 4R4BA 5KS9B 2AGJH 3SGKA 1OGAE 5C1MB 2BFVH 1S3KH 3WBDA 3E6FB 1SQ2N 4DAGH 1P2CA 1PG7L 2MNUA 3AVEA 3FQUA 1R0AH 3U0WH 3LIZL 5EBLB 1R24B 3QG6A 4Q7DA 1J0HA 5KVDL 3M1BB 1JGEA 4JFQA 4L4TB 3CFIC 4U1KA 1F4XL 2FX9H 4P23B 4YBQC 1YJDH 3TO4B 1SBBA 2H26A 3BH8B 3CK0L 2HJFA 3F6IA 4E5XB 2BSRB 3WO4C 2B39A 2P7TA 4G6JH 4UBDC 4HG4K 1F6AB 4PGDA 1SEQL 2DL9A 4I48B 4Z7NE 3FCTB 4NQUA 3NMEA 1NMBL 1UH3A 1SYSA 3KWWA 5T1MA 4A2LA 2KUTA 3U4EA 2ICWB 5C0BB 2DKSA 5DTFA 4NZUL 4GMTH 2ZP0T 3W9DB 3ES6B 1Y18A 1NJ9B 1F4AA 3UTSE 3ZSTA 1XR9B 2PO6A 1MF2L 4X6FA 2AERT 4Y1AE 3QI9D 1NGQH 5DZOA 1YNLL 4RNRA 1K4CB 1HWHB 3HN3A 1NAKH 1WVZA 1VACB 1NGXA 4NZRH 2XPGA 4R3SB 4WHDA 1RZKL 4WJ5A 1F42A 1AFVL 1RJCA 2YRZA 3BZEB 3MRLB 1X5AA 3D39E 3U7WH 1CIUA 2R23A 3QJFB 4GAJL 1IFHL 2QQNL 5TE7L 5ICZA 1VEOA 4G7YH 5D7KE 3MREB 5CSBA 3B9KC 4N5ED 1X9QA 3U46B 3LQMA 4WFFD 5EO1B 3CK0H 2P5EB 4GS7B 5DLMH 5DFVC 3Q0HA 3PGDA 4HMCA 3PWUB 3OZ9L 3UTZB 5GZNC 5IEHA 2YPKA 4F7MA 3QWRD 1CFTA 4OF5A 4HUXA 3RHWF 4NQVB 4ZTPL 4P46C 4DZBA 3BX7C 1UJ3C 3SPVA 1U92B 4Y19B 5JHLL 5EFIB 4UU9A 2DD8H 4FFVC 3VI4F 1DJSA 2CGRH 2FL5A 4NDMB 1D6VL 4OD2A 4WCYL 4KUZH 5ESVB 3QBTB 3MLYH 1JN6B 4U31A 3MMEA 5IB4A 1OGAB 5FO9B 2IAMB 4Z78A 4PUBH 1NCNA 1SY6A 4S1QL 4KMTL 3FB8A 3WNMA 3BZFA 3EBAA 1R3LA 3GGWB 3LKPA 5HI4D 4S1RH 1XF3A 5IF0B 5A2FA 1C16A 3K8LA 2BNRB 4BQCA 1OAYL 1KB9J 5KG9A 3VXUA 2YKLL 4MX7B 2X44D 4ZNCD 4EBQH 5IM7A 4GAJH 1XCQA 1IFHH 2QQNH 4HC1A 4LEOB 5DT1L 2VKXA 2VITA 1IBGL 4HUMB 4JZJC 3F7YB 4LASH 3MBXH 3B9KA 4H20L 4M48H 1UGNA 3QCTH 1FL5A 5DD0L 4ZD3L 1RZFL 3OZ9H 3TWCL 1IM9A 5GS1A 3GKWL 5L2JB 3TJHD 4HGMA 3BIAX 4HCRL 3RIAF 2NXYC 1FBIH 1LMKA 3OKLA 1WT5C 4WTWA 5K93A 4P46A 4BQ6A 3LKNA 1UJ3A 4Y16D 4PFEA 5HGBA 1R6VA 4UOW0 1RZJH 3UTSB 3QFDB 4M8VA 3WXVL 3SGEI 1KIRB 4D9RE 2HVJA 4QRRE 3FZUC 3TYFB 4FQHA 3K8MA 5HSFA 1NCWL 1EEQA 4KKAC 2YD2A 4YQXL 5JW3L 4MA1B 2OM5A 4KMTH 3U6RB 1JTTA 1VESA 1JWMB 5LGJA 3MLWH 4XI5C 2EEDA 1T7ZA 4GRLC 2DICA 2K9UA 3EDJA 2RJMA 3VE0B 3QT2A 3O4LD 3LHPL 2W0KA 5D1ZC 1G7MB 2W9DL 4X6DB 2H6PA 2EIDA 5JW4Q 3MO1B 3T4YA 2BOBB 4JZOA 4YDVA 5DD0H 5E9DB 1HDMA 5I66B 3G6JE 1M7DB 4QHUB 5IGXL 1E4KA 4AEHL 4OUUA 4MA8H 1Q9WA 1PSKL 3P4OB 1WT5A 3KPPA 4KFZC 5IW1B 4LLWA 2Q8BL 4KKLD 2NZIA 3QQ9C 2GJ6D 3QIWD 4PJ8D 3WXVH 1NCWH 5ID0B 3VD3A 3DVGA 3PG2A 4KHTH 2LFGA 3K80A 5KANG 4JFFE 1F97A 1R3JB 4NCC1 3RPKA 1HEZB 1SJXA 3WDIA 2HVKB 3IXTA 4JPKL 4F57L 2RFXA 1DANT 3QFJD 1AQDB 2VDKL 3SKMB 5DD6A 4F9PA 5E70A 1I8MA 4DUWA 2W9DH 5D1ZA 1GSMA 3ZYZA 4QRPD 5L8LB 3DNKA 1S9KC 3ARPA 2WIIB 2WINB 3FFCB 3O4OC 5INCB 4DWHA 2H41A 4HUWA 3UTTD 1CF8L 1PSKH 5EUKA 5C0IB 3PHQA 4WV1B 4G6KL 3MRGA 1DQJA 2Q8BH 5DJYB 4QRRB 2NYYD 1VGEL 5J1SC 3W9EB 1V3LA 3D85B 3I6KA 4DW2H 3OB8A 1RJZB 3GB7B 4LLUB 1GC1L 1DFBH 1FZOB 2X05A 4C59B 5LG1A 1YEIL 4UI2A 3SE3A 1IEAA 1DQML 4G9FE 4EUPB 5GGVY 1FQ9C 4XPGL 3S96A 2KZWA 4NGHL 3PQYA 3HCVA 4YUEH 5CEZE 5DFTA 1Y6NR 4UOW1 3KYMA 2X4PA 3I9GH 1A1NB 3BHBB 3DXAA 1YEDB 2VDKH 1BWWA 1F6LL 3CDGB 4DN3L 2XXMB 1MCPL 3LPGA 1ITCA 1NCBH 1T66C 3K81A 1GGIH 3REWB 3G6JB 3FRPG 2A6KA 3DI2B 4UV4L 1CICC 4N8VA 5CJBA 3CVHL 4ZFOB 1VENA 4LSUL 2NZ9C 2DMCA 1MJJB 2RBLA 2NY4D 2W92A 4EVNB 1RZGA 3IAPA 3VH8G 1R5WA 4JRXE 1KPVB 1AO7D 3PDDA 3RWCB 3BUYA 4PV8B 1DVFB 3MLSH 3MUY1 4RGND 4L8DA 1C5CL 2NLJA 2PETA 2J5LB 5F9JB 1NLDH 1AR2A 3T2NL 4XGZA 4QHKI 4OIAA 2NY1C 3KNBA 3FO2A 3WE6B 1NC4B 4XPGH 4I9WD 3HUJB 2DJSA 4DVRH 3GMNB 3FT2A 1A7RL 2HTLC 2VYRE 4Z7WA 2HLAA 43C9B 4KJPC 1SJEA 1MCPH 4Y4KD 1Z6JT 1LEIA 4R96B 3BKCL 1EFXB 4YXHH 3O2DH 1UM6L 5FUCC 4UV4H 3V0VA 1Y0LA 3U30C 5BQ7A 4LSUH 2VWEE 2APFA 1BOGA 5ID1A 4PJDA 1HHKB 3MCKA 5F7KC 4ZS6C 2WUCL 3WN5A 4UQ2B 4JKPH 1S7RA 4HF5L 3HFMH 3GFUA 1P6AB 1VPOH 3ARBD 4I5BB 5I2IB 2EO1A 2EXWC 3TJEH 2VSDA 3QPQD 1C5CH 3SQOL 1R5IB 4X7CC 1KEMH 1F90H 3JWDL 3T2NH 2RGSA 1I85C 2YUXA 1LO0L 4MYWB 4G9FB 1U93B 1R3IH 4TULH 4GKNB 3SDYL 3V4UH 3QB7C 15C8H 4XCEB 5JR1L 2AQ2A 4ODVH 4P49A 4JHAL 3B2UD 5J12C 4C4KO 4HWBA 5IOPA 3IVKA 3Q6FB 1S5HA 3ZT6A 4CU8A 4IOIB 2DWDA 2A6IA 1QSFD 4JZNA 3ELAT 3HZVB 4NQCD 2AJZB 3RWFA 1WFOA 3C6LD 3S35L 3G9AB 3W2DH 5AAWA 1KXVC 1QR1B 3R06B 3AXLB 1OARH 2PYEA 2XZAL 1AD9B 2VABA 4TOYL 4WO4B 2C3VB 4JRXB 1OAUH 4QHKJ 4FHBD 1NAML 2N4IA 1T1XB 1NCAL 3DGGB 4PP1C 3RJQB 5IV2B 4Y2DB 4HF5H 4JFED 3I3BA 1I8KA 2DLGA 4P3DA 3QI9B 2EEBA 3PIQB 5CIPA 4RAHA 2WLYA 4M6OH 5BJTB 4WI4A 1KIPA 5HXMA 1CYGA 3T2PA 5D96C 1QD0A 3VFOA 3L5IA 1I85A 4V2BA 4L29A 2BRRL 2FHFA 2NX5E 2OMBA 3VI3E 3E8UH 4ZAKC 1CFNA 4ZTOH 1SBSL 2EYRA 2Y5TA 5C0RH 3CVIL 1BIHA 4EXKA 4NKMA 1W72H 4BSVB 2XTJE 1FNSL 2R2BB 4JN1L 2WNGA 5F8QC 2AXGA 4NFCA 2AXFA 4JAMB 4X80L 2FGZA 4XX1G 2VJXA 2JJTC 1MCHA 2XZAH 4DCQA 2OP4H 4OF3A 4XP9L 4HG4J 1KCSL 1FNGB 4J3SA 1A22B 3BXNB 3WEXB 3UYOD 1NCAH 4UT6L 2R56H 1DUZB 1I1YA 2W0FB 1KELL 1KN2L 2CDFB 1RIUH 3O8XB 3LS5L 1M7IB 5E5RB 1D5XA 4NQSA 1MJ8H 5I1DB 1KCVH 1MCRA 3MRJA 4AK1A 1U8QB 3SE8L 1NMAL 1YEGH 4U1SA 1ZA6A 4NQTA 3EGSB 2R39A 2EECA 4XMLL 2L7UA 1SBSH 2YWYA 4F7TB 3MLVH 1XAUA 5T33L 3F6LA 5SV3A 3G6DH 1QLRA 1U2CA 4MXWL 3GSUB 5FHAL 5L88L 1AD0A 2UWEB 1I9IL 5IVNA 4GH7B 2BOCA 1KJ2H 1O0VA 2B8OT 4TVPL 4U33A 2ZUUA 2BY0A 3MR9A 2JJTA 3MRPB 3OAUL 3MRHB 4XP9H 1AGFA 2FLRT 1ZVYA 3HI5H 4IBLT 4Y16B 2QHLA 3NIGE 3NVQA 1CBVH 1XR8B 4PJCA 1KELH 5H94B 1KN2H 5EU3B 4JFPB 2ZUYA 5FYJL 4DGYH 4WWID 1FL6A 3H3BC 4MJIE 1NMAH 2EICA 2NTFA 5AUMA 4YE4L 4JFHD 4N0FB 3T65B 1Q9KB 2F5AL 3MA9H 2CDGB 4NO3A 5BMFL 4GBXC 5DD5L 2UVEA 2QLVB 5T33H 2XTJB 4Z7UE 1G9MH 4XZUB 4HKJB 3MLUL 5DK2B 4KHXL 3TBTB 3DETD 4LSSL 1QEWB 4U6TA 3FQWB 1MCEA 5KSAC 5F1OB 1X6NA 3OKNA 1AIFA 5JOEA 3BD3A 1KACB 3DX6A