4HSJA

1.88 angstrom x-ray crystal structure of piconlinic-bound 3-hydroxyanthranilate-3,4-dioxygenase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
174
Chain Sequence
b'MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 40
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hsjA01
4LULA 1YLLA 3IBMA 4HSLA 3E6DA 1Q43A 4N9IA 4Q0SA 5I93A 2Z69A 4ZU7A 4AQ2A 2VECA 4QX5A 4ZU5A 2I45A 4PJYA 4XF4A 1ZZ9A 2GC1A 4MUVA 1NE6A 5KHJA 2WFPA 5JCTA 1QXRA 4UBGA 2PA7A 3QOPA 4WZCA 5E16A 5I0UA 5C6CA 1ZRCA 4E2QA 1UCXA 4XF1A 4QMAA 3SCGA 1SFNA 4LUMA 2XGXA 2D5FA 3H1MA 3WW1A 3WW2A 1O3TA 4IESA 1L3JA 3D82A 2VQAA 3H3UA 4EROA 1ZREA 2IXCA 4MH0E 1ZVFA 1ZRDA 2UY8A 4AQ6A 4H7LA 5BY5A 1CAXA 5C8WA 5CADA 1UPIA 1ZZ7A 5KHKA 3EBRA 4I01A 3KGLA 3I59B 4AXOA 1ZRRA 1FT9A 1V70A 2XKPA 4XETA 2Z2SB 4EWEA 1H1MA 4EWAA 1VR3A 4MGKE 5AVPA 1XRUA 1J3RA 2PHLA 1O3SA 3IWZA 1CAXB 1CAWA 4N9HA 1LR5A 3BCWA 3SHRA 4YYOA 1JUHA 5CU1A 4XF0A 1EPZA 4META 4K8FA 2CGPA 4XFAA 2GAUA 3NVCA 4IEZA 1CGPA 3E6BA 3PLQA 3MYXA 4Q0QA 1QXJA 4R8HA 2XLFA 1RUNA 4EWDA 1YWKA 2HJIA 3UKNA 1O4TA 4BYYA 3DN7A 4Q0UA 2MNGA 5F1RA 3CL1A 4KWJA 4QXKA 2XLGA 3FX3A 4FAGA 1SQ4A 3ST7A 4MGYE 3OTFA 2GZWA 2BNMA 4MX3A 3H7JA 2ET1A 2QJVA 5FCCA 3IDCB 5FLJA 4DINB 3NW4A 3MPBA 2EA7A 3EQEA 1PMIA 1YFUA 1FXZA 4PIZA 1O5UA 1X7NA 4ORFA 4Q29A 4A2UA 1EYBA 1NZCA 2QCSB 1DZRA 2K9ZA 3MDPA 1DZTA 5KBFA 3JZVA 4IEWA 3LA7A 4HN1A 2B5HA 2PAEA 1IPJA 2PAMA 2IXKA 3CEWA 3HQXA 1J59A 1DGWA 2OPKA 2PQQA 5CVRA 3TNPB 3ACLA 4O9EA 1PM7A 4FBFA 4XFGA 5EZWA 1VJ2A 3SXWA 5BV6A 1CAVA 4IEOA 3SMHA 4FAHA 1Y3TA 2GC3A 2IXJA 5HI0A 3RYRA 1I5ZA 2XKOA 3LA2A 2QNKA 1Q5OA 3FFQA 2PAKA 4YSFA 2EVXA 3R6SA 3ELNA 3CF6E 1YFWA 2PTMA 3FE5A 3N4MA 1G6NA 5J3UA 3D0SA 2B8MA 1NYWA 1ZZBA 3ES1A 4FT8A 4MZUA 1J1LA 1CAVB 1YHFA 3I54A 1U12A 3USSA 4QGNA 1CAUA 4QGMA 4XFIA 4J1XA 4HVRA 5JR7B 3HIFA 4PIXA 3RYKA 3RDIA 4GULA 2IC1A 3E5XA 4IEQA 3RZZA 3E6CC 2IXLA 3MZHA 2D5HA 4Z82A 3CO2A 2V09A 3HT1A 2Q30A 2HKXA 3E5UA 4XFCA 5BPXA 4ONUA 1UW8A 4B29A 3ZDSA 3LZZA 2BEOA 4AVCA 3G7DA 3B02A 1DGRA 5FQ0A 1O7FA 3H9AA 3LAGA 3GYDA 4I3PA 4IEUA 2H0VA 4UBHA 4EV0A 4Q0VA 1ZX5A 2XL7A 5I0TA 1XE8A 5JSPA 5E1RA 2O8QA 4CYDA 2FMYA 3NSTA 3HT2A 2EAAA 5FQ0B 4KL1A 2OYZA 3OGJA 3LOIA 4QM9A 1IPKA 3D0JA 3DL3A 4BH9A 2CV6A 5JSRA 5I8SA 3FWEA 4BHPA 3RNSA 2E9QA 3DKWA 5I0SA 1O3RA 1QWRA 1CAWB 3FJSA 1LB2A 2P17A 4L11A 1UIKA 1SEFA 2ZKLA 4XF9A 3E5QA 3WW4A 2K0GA 4HVOA 4F7ZA 4O9GA 4HSJA 3BALA 4F8AA 4E2GA 5LEJA 3KMHA 5J7MA 2OA2A 2ATFA 3FZ3A 5JSOA 4HN0A 4KU7A 3CJXA 2B9UA 3RPQA 1O3QA 3QACA 4I0BA 2UY9A 2PFWA 3PNAA 3BPZA 2ET7A 4HBNA 3EHKA 4LUKA 3U10A 5I91A 2IXHA 1EY2A 5EFUA 1RGSA 3PVBB 3FHIB 1NXMA 3KGZA 1WGPA 2D40A 4X6QB 4YARA 2BGCA 2MPFA 5J48A 3CLPA 1OFNA 5K8SA 3OCPA 2Q1ZB 3H1WA 3S0MA 3IIAA 5KHHA 3H1YA 1CX4A 2Q0AA 4LA2A 4ZU4A 2CAVA 2BYVE 2WC2A 3O14A 4WVZA 4AVAA 2GU9A 4D7TA 4XEZA 1YFYA 1GQGA 2ETEA 3UKVA 4L2NA 3DV8A 2QVSB 1J3PA 3LA3A 4XFFA 5BUVA 3M70A 5D1IA 4R52A 5JAXA 3TNQA 4AVBA 5I0RA 1X8EA 2BNOA 1YFXA 3ETQA 4TLFA 3EJKA 4BIFA 4HMZA 2VPVA 1XE7A 5FDBA 3SCFA 4Z07A 5FPZA 5BXXA 3S7EA 5KHGA 1QY4A 3OD0A 3NL1A 5FLIA 5LEKA 4MGZE 1OMIA 2H6BA 4HVQA 1UD1A 2GH2A 1CAUB 4WBBA 1RUOA 2O1QA 2XLAA 4XFBA 3KCCA 1LKNA 4RD7A 2XHKA 4I09A 3I59A 4KU8A 4PIYA 2N7GA 3M3IA 1HW5A 3RYPA 4XF3A 3ROUA 4E2SA 2D93A 3E97A 1RTVA 4LA3A 4IERA 2XL9A 1ZZ6A 2KXLA 4JV4A 1LRHA 1OD5A 2GC0A 2BNNA 4P9GA 4XFHA 5FPXA 4IETA 2MHFA 4UXAA 1Q3EA 3U0ZA 3IDBB 2UYAA 5I8YA 3SCHA 1RL3A 4NVPA 2FQPA 3WW3A 3UKTA 3GBFA 1ZZ8A 1I6XA 3S7IA 4IEXA 3BU7A 5KHIA 1X8MA 3VHRA 1X82A 3H50A 1WA4A 3H7YA 5I8TA 4YNIA 1O5LA 2F4PA 4KWKA 4X6RB 4IEVA 1WLTA 2IXIA 2DCTA 1ZNPA 4YRDA 4KWLA 5T3NA 1UIJA 5LRSA 2GC2A 4I2OA 4MV2A 3NJZA 4QM8A 4HLTA 3C3VA 1ZRFA 3EO6A 1J3QA 4Q0PA 4LTAA 1J58A 2PHDA 2CAUA 3NKTA 2Y0OA 2PYTA 1GQHA 3H8UA 1YUDA 4QGLA 3U11A 3ES4A 4LLOA 3I7DA 3L2HA 5FLHA 4D7SA 1RC6A 2ZCWA 1ZZCA 3OF1A 4J1WA 1FI2A 4JTNA 4IEYA 1TQ5A 4MGIE 2QDRA 2UYBA 4OLLA 5LRRA 4JVAA 4I0AA 4I02A 1VP6A 2Q4SA 4LEJA 4HZFA 4OFGA 1NE4A 1Y9QA 1EP0A 2OZJA 1H1IA 4IEPA 3H3ZA 2H6CA 3BB6A 1OI6A 3KSCA 2C0ZA 3LWCA 2OZ6A 4JTOA
chains in the Genus database with same CATH superfamily
3ZIWA 3ZSJA 1DCSA 3V65A 2BBAA 3B01A 3IBMA 3BKZA 2VZVA 2W52A 1ODMA 1JZ4A 4IV1A 5F3GA 1A34A 3H3LA 4N9IA 5CG8A 1MS4A 4HETA 3ACFA 2AZ5A 1PGSA 2OQ6A 4FXKB 4Q0SA 5I93A 2RS11 3MI8A 3ZXGA 1UNBA 1T6GC 5FJHA 1GKBA 1F15A 5FPLA 1QJY3 1LODA 1Z7S3 2I45A 2BOIA 5G05L 4HONA 2WL1A 3TN92 1RUH3 2GC1A 2WLPA 4MUVA 1PGL2 3MIFA 3MLKA 4NE9A 1GYKA 3NNLA 5C4WC 1EV13 2Q5TA 4QX2A 1QEXA 5GLVA 1OH3A 3IM0A 1E5HA 2XUEA 5C9AC 2PA7A 3QOPA 4MXWA 2RG4A 5FO7B 3ZXFA 5FZHA 1ENXA 1STMA 4BQ3A 2WZR1 4E2QA 2Z5WA 3WOGA 1UCXA 2QQWA 3WLUA 1UOGA 1UQXA 1Z78A 2XGXA 5A7WA 1EAH3 3ABZA 4RL7A 1QDCA 2D6KA 1CZTA 1R091 2YPDA 3H1MA 5IVFA 1O3TA 4IESA 1L3JA 3OUIA 3PTRB 1WLWA 3H3UA 4EROA 2IXCA 2XBO1 2YBPA 4LIUA 4C0HA 4YZ1A 1CWPA 4BJ0A 3QLQA 3OEAA 3CIHA 4GJZA 3U4XA 2R1BA 2C26A 3NAPC 5GKAC 3P5BA 3KV4A 4LPLA 1TMF3 1YQ2A 1U5XA 2WQ8A 3EBRA 1V9U1 1QJU1 2WS92 4BDVB 4DUXA 4AXOA 2A6WA 1ZRRA 4P9YA 1MVEA 3T4HB 3FHAA 4YM0A 2R6QA 2CGNA 1SLLA 1QH7A 1JOBA 3SNMA 5CB7A 2GNTA 3NO8A 4EWEA 1G9DA 1H1MA 4CU8A 1AR73 1S2EA 3GNEA 2NP0A 1HRV1 4IE5A 2EXKA 2PHLA 3ZYIB 1RHI1 4CDXC 1O91A 2D6PA 1CAXB 4FFHA 1BEV2 3TEZA 4E4ZA 4WM8C 5FMOS 1QIQA 1RUI1 1AR93 1KDKA 2E7AA 2JDPA 3ACGA 5FZ7A 2WT0A 3VZJA 2IVJA 1WW7A 3F2ZA 4EN7B 5G04L 5IFPA 4CCKA 4XFAA 1PO23 3AVSA 1XU2A 2BWCA 2JE9A 3LDRA 4RA0A 5JZGA 1BVP1 4E8CA 4FPYA 2GAUA 5DN2A 1T6BX 3VBSA 3WG4A 4YW4A 5FO9B 1VBA3 5HPOA 3WDYA 1M4WA 1W2TA 4CDQA 1QXPA 4QU1A 5F3EA 3OYWB 1ZBA3 1YC61 3UGHA 2JWPA 2D6OX 1JZ3A 1VBC1 4FQ4A 1RITA 3UKNA 4GXLA 4Q0UA 3T30A 4DMIA 1W0PA 3NNGA 5K0UA 2W94A 4XBLA 3VDAA 3Q8BA 4B8EA 5ACA3 2BVBA 4CE8A 1MZ5A 1S2BA 2HBTA 4YFWA 5BNOB 1SQ4A 3AMPA 4AHYA 4CPBA 1Q8VA 1NY71 4TSVA 4TXWA 4Y20A 4M00A 4YVWA 2ZABA 3H7JA 4A42A 5C3SA 2GMPA 3K51A 1BZWA 5IFTA 4H2AA 2ZS6B 4DINB 2BBVA 1CVNA 1PMIA 4BPZA 1JTZX 3CJIC 4DFSA 2JX9A 2P37A 1PMHX 1V6NA 1VMJA 1XQNA 1V6JA 2QCSB 3WF3A 4CCEA 5A1LA 2J1SA 2B7YA 3IN9A 4JKKA 4HN1A 2YMZA 3KV6A 2XJTA 4NIAA 4CU7A 1UZ0A 5AC93 3ZN4A 2R49A 3VB9A 2RR13 2ARAA 3IAQA 1JODA 4RGAA 1DGWA 2JICA 2YFZA 5EXOA 1P8JA 2VUCA 5HCFA 2VBDA 4C1XA 5C5UA 3GJAA 4HK8A 2RVAA 4XFGA 1WW5A 1PIV3 1RUH2 2WO2A 5FUPA 3RWNA 5BV6A 2QQIA 4KMQA 5HBAA 1AR83 1RXFA 1DGLA 1EUTA 3SMHA 4CCJA 3O1VA 1GP5A 3NV1A 3WR0A 5HI0A 2IFRA 1I5ZA 2HEWF 4MXVA 1UMHA 2XKOA 2X8KA 3FFQA 1Q5OA 4JDOA 3VBUB 3UT0A 2PAKA 4P9JA 2GMMA 2VOXA 3JD73 1W9WA 2PHXA 2PTMA 3FE5A 3BOWA 4XIOA 4QPIB 1Q8OA 4Y1UA 1VBB3 3SEPA 1W9SA 2E33A 3N4MA 1W99A 2DVFA 1EAH2 3O1OA 2B39A 4FT8A 3UYJA 1R1A3 1J1LA 2RMU1 2X5IB 3AJZA 4MZUA 4UW4A 1H6YA 1SFYA 4CP9A 3IKWA 3VL8A 1H2NA 4NIHA 4W6YA 3USSA 3KCYA 4QGMA 1J83A 2WO1A 1NCRA 5DDJ2 3ZO0B 4HVRA 3VZKA 2BGPA 5JR7B 1HXS3 2YBKA 4PIXA 2D6LX 1LHVA 4WZFA 5F8PA 2EALA 4GULA 1FNYA 1X9TA 3WV6A 3ZXAC 3AKQA 2Y6GA 1TMF2 3W5MA 2W1SA 4PBOA 3AZXA 2DTYA 3M3CA 5DG1A 5IVJA 2ZPXA 3ACIA 2D5HA 2VUJA 3VBRA 4QKBA 1OF4A 4XAAA 5LA1A 1WUVA 3KT1A 4WM7A 1JZ5A 4YW6A 2Q30A 5CKNA 3E5UA 4XFCA 2P4EA 3SC7X 4ONUA 1UW8A 2BRTA 2BEOA 1AR72 4AVCA 2BFUS 3G7DA 2HWB2 1W6QB 2DCZA 2R7EB 1W6MB 3VKOA 5FQ0A 2VW2A 4XQDA 2YZ4A 2XR4A 1MQTA 3HBKA 3N9NA 3WCRA 5LCWL 1PX4A 3RJRA 1AYN1 3N36A 4FOQA 4Y1VA 2ZX0A 3GYDA 2Z4FA 4I3PA 4IEUA 4XXPA 3I3DA 4XOGA 4GJYA 3U14A 2DU1A 2JG9B 2RS13 3GZUC 2VVDA 1FNZA 4Q0VA 2E53A 3L9JT 1BK0A 3KS7A 5IWFA 5GZCA 2XL7A 1XE8A 4YGBA 4WV8A 2GALA 5L7OB 4MG2A 3MLJA 4KNCA 2VOWA 1UWWA 1D2QA 1ZBA2 1GZTA 3THPA 2DVGA 3I3BA 2JDYA 3OGJA 3LOIA 1W8HA 4IV3C 3LEKA 5LB6A 5JOXA 3GBGA 2WZR3 4YW1A 1RJ7A 1YYNA 2W1QA 4PCRA 3POGA 1TNRA 2RJKA 2W5FA 2WWSA 4XTPA 3O0VA 5ACA2 4W65A 1FPN1 1R093 1Y9GA 2RJLA 2W39A 3Q9OA 3DUIA 4NHMA 1LOEA 5JZGC 2WYFA 5LK5A 2CL2A 3KQ4B 2HH9A 3ZFGA 2XBO3 3ILFA 1CAWB 4ZKTB 1LHOA 3B94A 2WFF1 2C24A 2P17A 1LOGA 3ENRA 3ZKYA 1RXGA 4LJHA 3KHBA 4OYUA 4V2VA 4XF9A 3AKSA 4Y33A 5FMDA 1S4CA 3QCWA 5EP9A 3ZKUA 1JYNA 3DECA 4FO9A 2NLRA 2D98A 2E7TA 3ACHA 4UOJA 1JZ7A 1V9U3 3LGRA 1QJU3 4Y3OA 4HSJA 1IOAA 1SBEA 2WQZC 4JKLA 2D97A 1REDA 4XZPA 5AVAA 2ZHKA 2XWJB 3VKMA 5AC92 1I5PA 4GH4C 3R4UA 2RR12 2CTVA 3OJBA 1LULA 1YJKA 4HKWA 1SMVA 1GZCA 4QB6A 1S0GA 3WF1A 5JSOA 4YVWC 3WNKA 3ME2A 2EIBA 1HRV3 2CNAA 3LIGA 2RDNA 3EXUA 3OBRA 5H9SA 4GB31 3VBHB 1RHI3 2GNBA 4AEKA 2DCJA 3K3NA 4YZ3A 3PIJA 4I0BA 2X29A 4MOAA 1RUI3 4N53B 2W91A 3PNAA 5H9RA 3LDKA 3C7HA 3PVOA 4A7ZA 4CSWA 4D6SA 4JGYC 2B42B 4NPMA 3FHQA 4LUKA 1H9WA 1AR62 3SH3A 3WNMA 1QJZA 3ZYHA 3JD72 3RZLA 1XSRA 2Y6FA 3C8XA 2WAOA 2YV8A 3UNPA 4X6QB 1VBB2 1LHNA 3OOXA 1O6UA 1PMJX 4XJAA 1W9FA 4YARA 3V0BB 4K8RB 4XCBA 3DCQA 2O8OA 2P3KA 4MVTA 4A45A 1CIWA 1VBC3 5FXZA 2VNVA 1OFNA 4M0HA 2V5YA 4EN8B 2VZSA 3LSEA 1DGRN 2WZ8A 3S0MA 2E51A 1RUG2 1NA1B 4Z2WA 1RVF1 2CAVA 2HWF2 3FN9A 3Q8CA 4PDWB 5DAVA 3LE0A 3WP3A 4AVAA 2GU9A 4M3CB 4S2DA 4AFAA 4XEZA 3VDDA 1O8PA 2XVKA 4WVVA 1XNAA 2AEZA 4OULA 3VBFB 2CWMA 2NQYA 3LA3A 1LJ7A 5LBFA 5BUVA 2KM2A 1SBDA 4AVVA 5ABJC 4UFLA 4AGRA 3NJVA 5IVYA 2EF6A 4UFIA 3WF4A 4C91A 5I0RA 4D94A 2WNEA 4K21A 2XB6C 1YFXA 2Q8EA 1OLRA 2D3RA 1REFA 1LOAA 1OOPA 5IVCA 1ULGA 2GP5A 4L97A 4JRLA 2JECA 3JB8A 4Z07A 1PVC1 2MEV1 5BXXA 2VMFA 4U36A 2DVDA 2CY6A 1X50A 4HXCA 2RS12 5JI9A 2ZACA 4MGZE 4AEDA 4HVQA 4JGZB 2OW4A 1CIYA 5ANNA 3OY8A 5FWJA 2KA3A 1NQJA 2P3IA 1M06G 2EIEA 4BQWA 1HV0A 3VBRC 5K4LA 4L8QA 4C8DA 2DBIA 3KZ4C 5C3PA 3T1MA 3ON7A 3LPGA 1UMZA 4B3NA 3KCCA 4X8NA 1N3QA 3Q8AA 2VNGA 4AI2A 3DEMA 3U4SA 3RYPA 1Z0HA 3J7HA 4WVMB 2OPWA 1KD7A 1MQTC 3HBZA 5FYYA 2ILMA 1F35A 4CUAA 2VMCA 5DUVA 3ZFFA 2AACA 4RYDA 1LEDA 4RQPB 1YRZA 1HQNA 2RMU3 4EZ4A 2J1VA 3GF6A 1R092 4DUVA 4QPGB 3S5QA 5C8CB 4FSJA 4K6BA 4AI8A 5APAA 1WCQA 3SLIA 3WUDA 5IYYA 4YW3A 5JXHA 1VRH1 4LE4A 4XAEA 4ISRA 2GH8A 3U0ZA 2XJQA 2WSUA 4YGDA 5DG2A 1NX9A 3W58A 1H0BA 1QQP1 2RS31 3WUCA 3U75A 1SDDB 4D3WA 3KCXA 1MS9A 4IEXA 1QJU2 4JKMA 3OPTA 3PHMA 5LBEA 2CGOA 1PZ8A 5KHIA 3AXDA 4FTBA 4YWAA 1CJPA 2QQLA 4FPJA 2ZGSA 2CSGA 1EPWA 4W4ZA 2ZGMA 3ZSMA 1WA4A 3H7YA 1XNBA 5CFDA 4QXHA 3ZFGC 2HWC1 3TRSB 3MW2A 4KWKA 4X6RB 3MIEA 2Y60A 2E31A 2YB7A 5F6LB 5FZIA 1H30A 4COYA 5A1FA 1LHUA 1ZNPA 1AYN3 1PZ9A 4KWLA 5JVVA 1D4M3 2WWUA 3APBA 2ZZQA 1UX7A 2Q8CA 2JDUA 3EO6A 4Q0PA 4Q4X3 1I9RA 2R041 4LTAA 1J58A 2XPJA 1GFF2 4RS5A 5FYUA 1HIXA 2IFWA 3KT4A 1LCLA 4CUCA 4PBPA 4A3XA 1UYZA 1UYYA 1WCKA 3H8UA 4XZUG 1YUDA 5GLWA 1SCSA 1UZZA 3KD4A 3ES4A 1CX1A 4LLOA 2JKBA 4AWDA 3I7DA 1HB4A 1ND3B 5A3UA 5F37A 3IPVA 1S0JA 2ZOEB 4CP0A 1APNA 1UU6A 1DQ0A 4IEYA 2QQKA 3VUOA 2VZRA 2QZ3A 4N43A 1FPN3 1NY72 4GZ9A 1QHDA 4QX7A 4I02A 2O14A 2VBPA 4IE0A 5FV3A 1DDLA 1DU3D 4OHYA 5FZAA 1C3HA 1C5IA 4A6SA 1PK6B 1Y4WA 3H8OA 2Q4SA 2UWAA 2WFF3 4YPJA 3MF9A 4NRQA 1NQDA 1XNCA 4OFGA 3UV9A 3L2YA 1NE4A 3K4DA 3S5AA 4NRPA 5DZFA 5KXBA 3AP9A 3IZOA 1MZEA 5FMOL 4PI2A 2DVAA 2VMDA 4JDMA 2HEVF 1DQ4A 1YCIA 2ZZJA 5E8AA 3KLSA 3FMGA 2JDNA 2B46X 1JZ6A 3RZKA 2C0ZA 1V0AA 3VBUC 2VMIA 5FZBA 1JW6A 2QUOA 4R9AA 5LWBA 1ZRIA 2OZ6A 4Q4Y2 1VBD1 4JTOA 4MGSA 3UGGA 3W21A 2W1WA 2LRPA 2LS6A 1VMHA 3PDQA 2JDZA 1K5JA 5CIRA 2VCBA 2QE3A 4A4AA 5F7UA 4CXXA 1QOSA 3USUB 4GB33 3WDXA 3NV3A 4QHOA 5FYVA 1CZSA 4YW2A 1YQCA 5C4WA 3BVCA 5B2GB 2XJSA 4UF0B 2BU9A 3BGAA 2ZKNA 4ZU5A 4HANA 1TVGA 5C9AA 4XF4A 2OVUA 3SISA 2HWD2 1NE6A 1WLDA 1JU4A 4FPEA 1A78A 1LU2A 2WFPA 5EV7A 3O1PA 1K42A 2RDSA 4LORA 2NYYA 1JYCA 1O4YA 3AZYA 4UBGA 5IATA 4K1ZA 5F9TA 1B35B 1OLME 2EIDA 2EXIA 3JBG2 4XF1A 2RMU2 4QMAA 3FBMA 4XIKA 1FOD2 1L7LA 4AEDC 2XDVA 2ARXA 2YHJA 1NCQB 4QD2A 5FYZA 1D7PM 1DGWX 1F8VA 2W46A 4E4HA 2PHWA 2DUPA 2FBEA 3I4IA 3AYDA 1RVF3 2VQAA 3NAPA 5KC5A 4JHZA 5FREA 3VZNA 1WD3A 3B93A 3DPRC 2VE1A 4LHLA 3ZR6A 1L7QA 2EXJA 4YM2A 5GZFA 1QJEA 4CCOA 5JLVA 4CEYB 1AJKA 3VBOB 4H7LA 5T5PA 4GKYA 3VGIA 1N47A 5FPUA 5C8WA 4AE2A 5CADA 5F39A 1UPIA 4LXLA 4XQ4A 5KHKA 2FDFA 4GD4A 4F3JA 3RVHA 3GCWA 3I59B 5EJ3A 3C2UA 4MYEA 1PGW1 3HVDA 5D2AA 1LGCA 3JCIA 2JXAA 4WM8A 1VR3A 4MGKE 4KWUA 1BXHA 1PVC3 1D4M2 2ES3A 2MEV3 4OVEA 1J3RA 5ISLA 4ASMB 2VH9A 1PHMA 2RS52 3JQWA 1TE1B 1GWKA 1O3SA 4Q4X2 3I3QA 1LR5A 3KV9A 5FXVA 2W95A 3LSDA 5A33B 3SHRA 3PU8A 1W2AX 4Y22B 4XF0A 1EPZA 4META 3U78A 4COUA 2CGPA 2BOJA 4CCDA 1H8TB 4Y26A 5ANQA 4CRQA 3BTYA 1REEA 4LBJA 5IVVA 3NVCA 2VMHA 3ZLIA 2VVFA 1RUE1 1ND2C 4N7UA 2Y6KA 2A6VA 3MYXA 2XUMA 3T1LA 1QXJA 4QKDA 1JYIA 2AR6A 2VZ3A 4R8HA 2VULA 2XLFA 1RUNA 1YWKA 2HJIA 2VR4A 1O4TA 3I2DA 1N1VA 3N3HA 4BYYA 5J1XA 3HJRA 4NIGA 1WW6A 3AMMA 4XILA 5HCAA 4OI4A 3TEYA 4RS5C 4Q27A 2BV4A 4TZDA 2BFUL 3GZTB 3VBSB 1VRH3 4AG4A 5IK4A 5CEHA 5JPNB 5IJRA 4B4QA 3VBHC 1IKQA 1QQP3 2RS33 4HKOA 5FCCA 3ZYGA 2WUHA 4BMBA 1IS5A 1SDWA 1K12A 1XNKA 2FHRA 3MPBA 3NW4A 4RR3C 1YFUA 4L9BA 1FXZA 2AH2A 2C5DA 4AW7A 4LR4A 4MHUA 3LFMA 2VO5A 5IHRA 2CDPA 4GAZA 4ORFA 1CPNA 1EYBA 4IQPA 2JB8A 5KBFA 1DZTA 4BQ1A 3ZXEA 5FAXA 4OUMA 4DY5A 4UYBA 4EN0A 3T2QA 4CPBD 1XYPA 4CP1A 2LTNA 1W6NA 4FVVA 3OGGA 3HQUA 4Y20B 2HWC3 1IZ3A 1MR5A 2DCYA 3AYAA 1MS0A 2OPKA 4M3CE 5CVRA 1OF3A 4NHXA 3OBTA 3ZXKA 3B9IA 1OQEA 3WVJA 3RI9A 4FBFA 5EZWA 3J7NA 1X36A 1RUF1 4XACA 3P3NA 1CAVA 4IEOA 2R043 1NA1C 3ILNA 4CUBA 5EIYB 3AZZA 3NV2A 1IGOA 3RYRA 2WLQA 4D7YA 3INAA 3RJ2X 3ZSLA 5LZ6A 1QOOA 4CVUA 1T2XA 2JDAA 3LA2A 3VBFC 4A44A 1W2UA 4YSFA 3SEEA 1LECA 2EVXA 2ZX2A 5E88A 4MGTA 3QD6A 2ZEYA 1G6NA 4HPKB 4FXGB 1ULDA 1NYWA 2IVIB 4FOWA 4AHXA 1W05A 3ZMOA 2R32A 1YHFA 1LNSA 1W04A 2OKXA 1JMUB 4QGNA 1CAUA 5J96B 3I49A 2RM21 2CHHA 4C90A 2KR2A 2A73B 3M1HA 4QX0A 2PHTA 1H2MA 3BYWA 2AREA 4IEQA 4JGZC 4E8DA 3E6CC 3SH5A 3DGTA 2RDRA 2VJXA 3PVEA 4K3UA 4Y4RA 2ZXQA 1J84A 1RUJ1 3B9CA 1HX6A 3K4AA 2V09A 2BDRA 1VPHA 4ZY9A 4AQSA 4LO4B 2C6SA 4Q4V1 5LA0A 3V0AA 2TNFA 4ZXEA 4QX3A 5A3NA 3MIGA 1RIRA 4CU9A 3ZDSA 5F5QA 1NCRB 1VBD3 2WO3A 5KR7A 3B7MA 1PVC2 2MEV2 3B02A 4Q1RA 4EYUA 2ZGPA 1DGRA 5FP7A 3MIDA 1HB1A 1GOHA 1W90A 3ZN6A 5F6KA 4LT5A 1GANA 2R062 3LAGA 3M3EA 2ZGKA 3LEGA 5FPBA 3TEWA 2D44A 1NT0A 4XUOA 3WXPA 4LBNA 1ZBE1 4UBHA 1CONA 4PQ9A 1SLBA 3NMBA 4Z1VA 1UXZA 3MFAA 4IV3A 5JSPA 3S6PA 2O8QA 3O12A 2HWE2 2P6CA 4BLIA 2FMYA 4CYDA 5GM0A 1ZA7A 4E4SA 2EAAA 4B1LA 5FQ0B 3WDUA 4KL1A 2OYZA 1WBFA 3SKVA 3UGFA 1Y9MA 2BQPA 5T55A 2CV6A 4FPGA 1GU3A 2FMDA 1XC6A 4FCAA 5I8SA 2AUYA 2E7QA 3V56A 5IK8A 2D6NA 2E9QA 5I0SA 3AB0A 5D21A 1QU0A 5FYBA 1O3RA 1V6LA 3MW3A 2GNMA 5FZDA 5FZGA 1QWRA 4JZRA 3FJSA 4HFSA 2DV9A 4QQPA 4BA6A 4EQVA 2PLV2 2LW8A 4BXFA 1AXYA 2EIGA 2DYCA 2C1FA 2VZOA 1HLCA 3E5QA 3DYMA 2K0GA 3N9LA 5FY1A 2A6XA 1JBCA 3RRDA 3O1RA 3O1TA 3WP4A 4GH4A 2RDQA 1CZVA 4LBLA 3NKGA 3C7GA 4E2GA 4QB2A 3D6EA 1DF0A 4LBQB 1AYM1 1RMU2 5EWSA 2YXSA 4Q8LA 5LATA 2OA2A 4NIIA 3FZ3A 3A0KA 1ND3C 3NNMA 1COV1 4HN0A 4KU7A 1V6IA 2B9UA 3VD9A 4JGYA 1US2A 2VZTA 1SLAA 2FDGA 2J1TA 2WKKA 4B4PA 1WMXA 2WNUB 1MZ6A 2R042 5CKQA 3OSDA 3RZGA 3BPZA 2J42A 3T4VA 3ZSKA 2IUWA 4QX8A 3U10A 3PMSA 4CCLA 1EY2A 3DXTA 5A7NA 1RGSA 4CP2A 4D69A 2RHPA 3ECQA 3A22A 3IAPA 3KF5A 2R30A 1IS3A 2D40A 1C4RA 5BNPC 1QJY2 1RUE3 1Z7S2 1G86A 4Y5SA 5FZ0A 2WNOA 4Q8KA 3N9MA 4GWNA 5FP3A 1KJRA 5F5IA 1DQ5A 1EV12 3WX5A 1AL0G 2DWRA 3CLPA 4YW5A 3OCPA 3VD7A 5FY9A 3ZYPA 4ZONA 3ILRA 1PZ7A 5CZKA 3IIAA 3PUHA 5GALA 5KHHA 3H1YA 2Q0AA 3GGLA 4LA2A 1R081 1XPWA 4D7TA 5ABJA 1KS5A 1MVQA 2VQ0A 2WABA 1QF3A 1YFYA 1GQGA 2H0BA 2RV9A 2VL4A 4XPVA 3AMQA 5A3LA 4FTEA 2DUOA 3WG2A 1RUC1 2VTFA 1AF9A 3J4UH 4EN6B 1AZDA 2OS2A 4ISQA 3MO4A 5BNNC 3ZPYA 2VNOA 1SG3A 4CA9A 2WN3A 3J26N 4QX1A 1X8EA 4QQOA 5FTTC 5BYNA 3EJKA 1ULPA 1A6CA 1H2KA 1BJQA 1N3OA 2VPVA 4HMZA 5JIUA 1UYXA 3AP5A 1W8WA 4SLIA 4NROA 4W50A 2Z79A 1B35C 2ZGUA 3SCFA 3VDDB 2ZHNA 5KHGA 3CZUA 3FUQA 4E27A 4OHWA 3OD0A 2XHNA 5C3RA 1NCQC 5FLIA 4CEWC 3MIBA 2JG8B 1PVXA 4R9DA 1SPPB 1UZWA 5CFCB 4INDA 3VKFC 5FOJB 1RUF3 3K2OA 2DU0A 2ZGOA 2VOTA 2O1QA 5HV0A 5D8AB 2VW1A 4TYSA 3M2MA 2XVLA 4XFBA 1OOPB 3AM2A 3T3YA 2DURA 1LKNA 5T5OA 4ZHNA 2XHKA 1N1TA 1AR92 4I09A 4CEYC 2N7GA 1HV1A 3VBOC 2WA3A 1U5YA 3SKJE 3I2KA 2A3YA 1PO22 1AHSA 1FX5A 2W87A 4Y1ZA 1O8SA 5LA2A 4B7KA 4COZA 5FZLA 2UURA 2ORZA 4LA3A 4QXBA 1CQ9A 1VBA2 1ZZ6A 3UK9A 1SHWB 3W20A 2NN8A 3O1SA 1GWMA 2ZGNA 4P9GA 4AI3A 4FTSA 5L9VA 4IETA 4BB3A 3BIWE 4AFDA 1Q3EA 2FCVA 2OX0A 2RM23 3FBYA 3IDBB 4DOUA 5I8YA 1GZWB 1OUSA 1UAIA 5A7OA 4HOOA 5H9QA 1WD4A 3WW3A 5L9BA 3UKTA 3HOBA 1ZZ8A 1K3IA 1ALYA 1GOFA 3S7IA 1SLCA 3ZFFB 1ENRA 4OI0A 1HQLA 4YZ2A 2NM1A 4XUQA 5HXVA 3OYWA 1RUJ3 1H8TC 1ZA4A 1KQRA 4I30A 5T50A 1GBGA 2XXZA 4Q4V3 1PGW2 1UMIA 3VD5A 2ZMLA 5JXIA 1H1AA 3H50A 3I3MA 1V6OA 2Q8OA 5T5LA 5IUQA 2AGSA 2VD7A 1GMMA 1H9PA 3QH7A 5C70A 2ZGTA 3ORJA 2QQJA 3J8F1 4LMFA 2OQ7A 4DRRA 4MV2A 2R1DA 4QM8A 1KS4A 2QTWB 3M3QA 4G9SB 3VDCA 1ZBE3 1WCUA 1N1SA 1N3PA 2PHDA 1PNFA 3J9SA 5L36A 1IG3A 2D3PA 2G19A 3NKTA 3MF6A 2Y0OA 4HK9A 1FMD1 2Y6HA 1HJGA 3FLPA 4JX0A 3R05A 1RUE2 3GALA 4RGGA 1W3XA 5EQUA 4X8PA 1PIV2 2ZMNA 5I0DA 2YDEA 2DVBA 4QGLA 2WO7A 2A6YA 2VZQA 3AL5A 4CDWB 1AR82 1POV1 1ASJ1 3IIIA 3LF7A 3N7KA 3L2HA 5J36A 4CDUB 3FLRA 2LALA 2Q8DA 2ZJCA 1PO11 1ZZCA 2DFBA 4J1WA 3KV5A 3WQ1A 1FI2A 4EZHA 4YW7A 3VHPA 4HG6B 2Q1FA 4R9CA 1W9TA 2UYBA 1AL21 4Q4W1 1W06A 1VIWB 2VU9A 4P14A 2QDNA 1R1A2 5A32B 4DEVA 4JCKA 4KGGA 1XOYA 2D3SA 3G6JB 4IGQA 3PTYA 1YO8A 1VB2A 4LEJA 4N8MA 4Q1PA 1PM4A 5FZMA 3VBUA 3I2IA 4D8MA 4DNYA 1IS4A 1EP0A 4Y5Z0 2WAAA 1HXS2 2OZJA 1H1IA 3C7OA 3ZFEB 1GICA 1NLSA 5CYYA 3T2TA 3WP6A 1BKZA 1X33A 4N43B 4B1MA 2YG0A 3VV1A 2FDIA 3U07A 4XDQA 1AYM3 3RMYA 1S55A 3S57A 1OA3A 1OQDA 4IGPA 3SQOA 1COV3 1XBFA 3FLTA 3TN91 1E5IA 1MPXA 1G9AA 1PGL1 3VN4A 2P34A 1AXZA 5FZOA 1RUF2 1DFQA 1TNFA 2Z69A 3R4SA 5DUUA 4YG6A 4AQ2A 1YI7A 1K5MB 4A7YA 3GM8A 1E5RA 1QGLA 2XJRA 4JC1A 3CKHA 4PJYA 1H4HA 2XMLA 4QPYA 3FUOA 1W3VA 4NUBA 4BCUA 5JCTA 1QXRA 5LK7B 2OIIA 3HN3A 5IT6A 4AEJA 4LO7A 5I0UA 1UU5A 1OPMA 1FYUA 4GWIA 1ZRCA 4XUTA 4BIOA 1W6QA 3SCGA 5J98B 3LKJA 1W6MA 4LUMA 3DKQA 4YVSB 3DPRA 4NIDA 3N9OA 3GZEA 2JE8A 2D5FA 4M0NA 4LNVA 3BI3A 3RSJA 1Q8SA 4ZS3A 1Q56A 2RM22 2JG9A 2WZR2 4V2WA 5B4XA 1JZ2A 4OHVA 1G7YA 1R083 3VKNA 1UF2C 4RFRB 5FZ8A 2WS91 3AVRA 3K77A 1JI6A 1W6PA 2DCKA 5L7OA 1C57A 1B09A 5A6XA 4CZSA 5FO8B 1RUC3 3WINE 1RUJ2 1UXXX 4GQ7A 1ZZ7A 2XBO2 4I01A 5FY4A 2X05A 3KGLA 3O1MA 3NQHA 1A8MA 1JHNA 2W68A 4Z8BA 2DDUA 4RFT0 4XETA 1MZFA 4AOCA 1BEV1 5FZCA 2WNVB 4JDNA 1KDMA 2B4KA 1V9U2 1DQ6A 3D4KA 3EMRA 4EWAA 5AVPA 1BYHA 2QZ2A 2A3XA 3H8RA 2Y6JA 4RHV1 4NWWA 3AKTA 4XHXA 3IWZA 1POV0 3Q8EA 3MICA 3ZM8A 1CAWA 4N9HA 3TWIA 1KGYA 4XE9A 3BCWA 3IT8A 3BUCA 4YYOA 2YC4A 2G9GA 1JUHA 3NNJA 4YZ4A 2ZMKA 3OGVA 1ND2A 4TN7A 1HRV2 4K8FA 4JQRA 4EJRA 1KXGA 2YC0A 4NHLA 4QB1A 1RHI2 4HKLA 4BK4A 3NV4A 4BM8A 4NR1A 1OVSA 4CDXB 1RUI2 4RSUA 1UN1A 1CGPA 4WM8B 5GZDA 3RZMA 3O0XA 1XB9A 3PLQA 1F2NA 5IAVA 2Y33A 1HQWA 1ULOA 4Q0QA 1HDKA 5F2WA 4AR2A 4YM3A 4NN0A 1JZ8A 2QQPA 5BNOC 1NLQA 2W3JA 2WZPP 1RUD1 1IG0A 5HXMA 4EWDA 1U0AA 3F95A 3DN7A 3ETPA 2B9VA 2C9AA 2R0HA 1XSQA 1S2KA 4KWJA 3VBHA 3FX3A 1IPSA 1VBC2 3LD8A 1WMDA 3ST7A 5FZEA 4MGYE 4XYXA 4RR3A 1GNYA 1ODNA 1NZIA 1V6MA 2GZWA 4KG0A 2ET1A 2ZGRA 1S0EA 2QJVA 2YGLA 3THDA 3IDCB 5FLJA 3WQ0A 3VZOA 1DLLA 2EA7A 3CZJA 4FFGA 1F4AA 4PIZA 3PUIA 3V0BA 4SBVA 3WZ1A 1DZRA 2K9ZA 1WBLA 2X10A 3MDPA 5F3CA 5IW0A 4IEWA 2B5HA 1HKDA 2PAEA 4UT5A 2XWBB 3K75B 1IPJA 5M0TA 2PAMA 1GQPA 4J6GA 3I2OA 3MV11 3CJIB 4P5YA 1J59A 1GSLA 1NA1A 3TNPB 5A6YA 2W9XA 4PDWA 4KBZA 4O9EA 4XJZA 4YG0A 5FMBA 3J8F3 4E4DX 4M3CA 2A3WA 4OMDA 5JXJA 3HAGA 4GMP1 4OZXA 3VBFA 1D0GA 5C3OA 2K2SA 5JI7A 4AFCA 3AZWA 2YC2A 4MGQA 4QPIC 2OUHA 3W59A 4S2FA 3WG1A 4CCMA 4FAHA 2GC3A 1WKYA 5LW9A 1FMD3 3HNYM 3PU3A 5FIXA 2ZHMA 2X5IC 2PN5A 5BNQA 1SCRA 4C0BA 1C8NA 1MACA 1Y43B 2J7MA 3ELNA 4KG8A 2J22A 1C1LA 1POV3 1ASJ3 3ZIXA 1LTEA 5J3UA 5FK7A 1WW4A 3D0SA 2B8MA 1AVBA 1PO13 5DDJ1 1IQDC 3LIHA 4A6OA 2E6VA 4LKFA 4ASKA 1CAVB 1DYKA 1YQ6A 4FPLA 1E5SA 1F9KA 4GWMA 1U12A 4JGZA 1AL23 4IV1B 4Q4W3 4XFIA 1OLQA 1OKOA 3EYPA 4IXLA 1UX6A 3T09A 3CMGA 2BVVA 3J7MA 3HIFA 4QT6A 3RYKA 4UFKA 2W2IA 3RDIA 3GZAA 4AI9A 2IC1A 2JG8C 1CJDA 5KXDA 4K9SA 3WP5A 5CFCC 4YFZA 5CAZA 3ZYRA 2BJSA 3POEA 4NAOA 3WD5A 1G9CA 4WVMA 2JJ6A 1TME1 2HWB1 4XHBA 5D8AC 4Z82A 3H8XA 4NAMA 4A41A 3HT1A 1FATA 2W1UA 2VZ1A 3WNNA 3KHCA 4BQ4A 5BPXA 4MXWB 4RQPA 2JG9C 1ZM1A 3LZZA 3OPWA 3OGRA 4UWDA 5C8CA 2HYKA 1RYYA 5A7WB 4P08A 1O7FA 3TN93 2Y8KA 5L7OC 2C4XA 5AFBA 3UJOA 3K46A 2R16A 5FMCA 3POWA 3T2PA 3VKLA 1WZXA 1UY3A 3WY6A 2JENA 1LESA 2Y34A 2V73A 1AYN2 5I0TA 4V1PA 3VLBB 1WMFA 4CCNA 4Y5TA 1C8M1 2OXBA 5E1RA 3WT3A 3VDBA 2VBBA 3UJQA 3ZMNA 1D4VB 2F4LA 3ZYBA 2JIJA 1F4HA 1US3A 4LHSA 2E26A 4QM9A 1IPKA 3D0JA 3MIHA 1EUUA 4UW5A 4TTGA 4MHRA 5FY8A 1W8TA 1NOVA 1UY4A 3QBQA 2FCUA 3OUHA 5LBCA 2YY1A 4BH9A 2HYXA 3CQOA 2XQRA 3VD3A 3FWEA 3MBWA 4QU2A 3PVNA 1C28A 2WT2A 1BK1A 2VOVA 4IV3B 4XJUA 1NUKA 5FBJA 3MFCA 2FCTA 2JB4A 1ULCA 5E89A 1UZYA 1LB2A 5FPAA 2WS93 1WCSA 2WINB 4S2GA 1OXCA 5A7PA 5FYIA 4L11A 1SFPA 2IWGB 3B69A 1FPN2 4UW3A 2ZKLA 5F32A 3AL6A 5CNAA 4D6QA 4IGOA 4DQAA 1S0IA 3I2JA 3WQBA 4NJ4A 4JQTA 3T0BA 5FOBB 5JZGB 3OUJA 4K20A 2WBKA 5FFOC 4O9GA 4AEMA 1IKPA 2VCAA 4IE6A 2WFF2 3NNFA 1ND3A 3CNAA 4XCAA 3CBNA 4GMP0 4CDQB 4I3GA 2PELA 2QKDA 3PUAA 4M4PA 4CDWC 1BEV3 4N53C 2EAKA 5J7MA 2ATFA 1OSGA 4P9IA 1FAYA 1NAEA 5DZGA 1GP4A 4P5HA 5FWEA 1O3QA 2C9KA 4RHV3 5K0UB 1AR61 3VZLA 1UOBA 4NO4A 4ZPIA 1W8NA 2UY9A 2PFWA 2PMWB 3FL7A 2VAUA 3NRUA 4S2HA 4IDZA 4XBQA 4BQYA 1FV2A 3JUUA 5BNPA 2ET7A 3N9PA 4HBNA 3AFKA 1QKQA 1CESA 3EHKA 4YVWB 5FKBA 5FYCA 3WQ7A 2ZAHA 5F5CA 5I91A 1ULFA 4GB32 5CKMA 1URXA 2Q1MA 4BISA 4FFIA 3RFRA 1OKQA 3KGZA 1W9YA 2WN2A 3D8CA 5E6HA 4P00B 1LEMA 2A5ZA 1PO12 2E32A 2VUAA 4JRAA 1W0NA 1RUG1 5T5JA 3ZYFA 4PDWC 3OD4A 4ZXKA 1BQPA 1OH4A 1RUD3 2HWF1 4AZZA 5K8SA 1S0CA 4N7IA 2Q1ZB 1JS9A 3GHNA 3H1WA 3A4UA 1AL22 1OVPA 4PLNA 4Q4W2 4R9BA 3USUA 2YYOA 4BLJA 1MS3A 2GN3A 1O59A 2XONA 3WDTA 4FP3A 4AFBA 4N90A 4UF0A 5IVBA 2BYVE 2WC2A 3O14A 4WVZA 4QHBA 4ATEA 5FY0A 5BNNA 3W5NA 2ETEA 3C7FA 5DUXA 2GN7A 3UKVA 3BTAA 1JHJA 4BQ2A 2JIGA 4L2NA 3DV8A 3OG2A 1K5MC 2QVSB 4AFMA 1RVF2 1VLNA 1UY0A 3M70A 4YM1A 4Z2AA 5HV4A 3IB3A 4RN5A 1ENQA 4UFMA 1B35A 2XG3A 3TNQA 3CU7A 1XYNA 2BNOA 3ETQA 2YBSA 4TLFA 4BIFA 4AI0A 3M8LA 1NCQA 4CEWA 5LY2A 5ABJB 5FUIA 1S1AA 1JOPA 4FQZA 5F5AA 1MEC1 3TAYA 1RINA 3KVAA 3NL1A 1U5IA 4CP9B 5LEKA 4YVSC 1UD1A 5IAXA 3AP6A 4FP2A 4GMP3 2J1EA 3KWVA 4O65A 4YGCA 4CEYA 4QAWA 3VBOA 1SZBA 1RUOA 4UAPA 3UL2A 5F3IA 1XXNA 2RJ2A 2YPJA 4LHNA 2ZX4A 4RQPC 5EYXA 4RD7A 4KU8A 1K45A 1OT5A 2YU2A 3I59A 4BMEA 1LOCA 5C8CC 3M3IA 4QPGC 4FI9A 3HEIA 3FFZA 4XBNA 2JD9A 3RI8A 5KWRA 2AENA 2PHRA 1ZYBA 3VBRB 1C1FA 3ROUA 3H0OA 4E2SA 3A21A 2ZBJA 2BZDA 4WM7B 2D93A 1RTVA 4LIVA 3MW4A 4IERA 2XL9A 3N35A 4OI2A 5DDJ3 5ERLA 4DXSA 4PF5A 2BERA 4XABA 1SBFA 2A6ZA 4JV4A 1OD5A 2GC0A 3WCSA 2WNVC 5FPXA 1JYXA 1MQTB 5K9YA 3WHTA 2BUKA 5A33A 4OHXA 3RQ0A 3PUSA 4Y22A 3K3OA 5A1AA 2F6BA 4CCCA 4CXYA 4QPWA 3M7AA 3SCHA 4AF9A 1H8TA 2Z42A 4NVPA 3RGBA 2FQPA 5FK8A 2A71A 2L9LA 5HCHA 3GBFA 1I6XA 1DIWA 4FPKA 1VRH2 4KBBA 3BU7A 3LEIA 4QKNA 3WG3A 1D0HA 1X8MA 1TME3 2HWB3 2BPA2 1XJAA 1JYWA 1QQP2 2RS32 2HLEA 4ZZ8A 1X82A 3VZMA 2GP3A 4FPOB 2VUDA 4B4RA 4BWOA 4GIQA 3I2FA 3DYPA 1KFXL 2F4PA 2VY0A 4RHV2 2ZEWA 1AX2A 2IXIA 1H6XA 1QH6A 2CDOA 3ZYJB 3HPNA 4YRDA 1GNZA 2V4VA 1S0DA 3I2HA 5T3NA 3PURA 4KI5M 1YIFA 4I2OA 4HLTA 3C3VA 1UKGA 2VVEA 2EXHA 2BTVC 1J3QA 3HD8B 4CU6A 2HWC2 3ZFGB 4M3CF 3THCA 1W39A 1W8UA 1VMFA 2CAUA 1KJLA 2R071 3IMMA 5A3PA 5C71A 1GQHA 1BHGA 1BCXA 1C8M3 2VG9A 2X09A 2BWAA 3A0NA 5EHDA 3U11A 1I1EA 2NMNA 1W6OA 4C1WA 1BMV1 1RUD2 1WMEA 2VTXA 1NXD1 1RC6A 4BXSV 5F2SA 2YGMA 2FZ2A 2ZCWA 4LBQD 3HNMA 4Y1XA 2JDKA 1PK6C 4XMAA 4JTNA 1JXNA 4Y1YA 3HWJA 2QDRA 1VBE1 5DAWA 1Y7BA 2CYFA 2V4AA 2WSVA 3P1IA 2DUQA 1GLHA 5LRRA 4P9WA 2P6HA 1VP6A 2WT1A 3N7JA 3BTZA 3N7MA 5L9RA 4LO6B 3WF0A 3B00A 3AK0A 4IE4A 4PI0A 4QKFA 1NKGA 2VC9A 5HCBA 3BODA 5L19A 2ZA9A 4Q4Y1 2D7FA 3BU0A 3LDBA 3MHZA 4XQWA 2CWSA 4QQ2A 2QQVA 1DLCA 1GR3A 2GMEA 1OQ1A 1OI6A 3JQXA 3LEMA 4HPKA 4O61A 3ZN5A 4Z92B 1OD3A 2WRAA 3RZHA 3LWCA 2W47A 1HRI1 4K7JA 4XUNA 4RGKA 3WNOA 4XVHA 2O0OA 1IQAA 3DF0A 4LULA 3MUY1 1YLLA 4HSLA 2WWJA 3E6DA 1Q43A 3ITQA 4LK7A 3LCPA 2HWD1 2ID4A 1AR63 5KC6A 1VBD2 1XNTA 4DO0A 4ZU7A 1I3HA 4IL7A 5JMOA 1XU1A 2VECA 1ONAA 3MUZ1 4QX5A 1W8ZA 2AEYA 3OGSA 4IV1C 4ES9A 3I3EA 3RS6A 1ZZ9A 5DABA 3IDAA 4ATFA 4AVSA 3MV01 3ZXJA 5KHJA 3JBG1 1VAMA 4L0PA 1FOD1 3T2OA 4DEQA 1QJFA 2QQUA 5FXWA 3T0AA 3J7LA 5DZEA 2VCMA 4WZCA 5E16A 4LBMA 5C6CA 4LOTA 1U5ZA 1RUG3 5FZOB 1UZVA 1SFNA 2WR9A 2HWF3 3AP7A 5FYSA 5JIAA 5GZEA 5A6QA 5FJKA 5FZ9A 5A7SA 5JDBA 2NZ9A 1HB3A 2ZGQA 3SITA 3WW1A 3WW2A 1QOTA 2FZ1A 1F5FA 1UOFA 1JU3A 3D82A 2WYSA 1OUXA 3ZXLA 1ZREA 4MH0E 3ASIA 1ZVFA 4AEDB 4Q26A 1ZRDA 2W92A 4XDPA 3OY8B 3PL0A 2HBUA 4DS0A 1OHFA 2UY8A 5A80A 3ZXDA 4AQ6A 1YNAA 3D5OA 4K1YA 3POBA 1TEIA 3GHMA 1TME2 5FP8A 1CAXA 4UI9L 4ET7A 5BY5A 2YROA 4LBOA 3DPRB 1GNHA 4M01A 1D4M1 4GWJA 1V6KA 4CUGA 1VAVA 2RS51 4AQTA 2ARCA 2I07B 2TBVA 1FT9A 1V70A 2XKPA 4Q4X1 2Z2SB 1DHKB 1OA2A 3WDWA 5JOWA 1OA4A 3KM5A 2VGDA 5FZ1A 4LHKA 1XRUA 2P5BA 1W6PB 3VL9A 1MEC3 4NPLA 5A70A 3MLLA 4URTA 4W8JA 5GZGA 3JU9A 1QJX1 5AFEA 4BZ4A 1F5JA 2SLIA 4NPRA 3O7OA 5CU1A 4YGEA 5IK5A 3AJYA 1AX0A 2XJUA 2XJVA 2YU1A 3ZOIA 4CTEA 1C8M2 3N9QA 5BNOA 3AMNA 3BOPA 4IEZA 5IK7A 3E6BA 5C5TA 4QQLA 5CG9A 1NLRA 2J1RA 3POJA 3RG0A 4LBQA 1UY2A 2GSYA 4NOTA 5JMCA 3VBSC 2ZEXA 3N7LA 4WVWA 3MPPG 3PIGA 3HMYA 1QDOA 3MGUA 4CDQC 4URAA 2MNGA 5CFDB 3OPZA 1ND2B 5F1RA 3CL1A 4QWNA 4QXKA 1QMJA 4XUPA 5LASA 1LAJA 2XLGA 2WNUA 3M4FA 1AXKA 1WWYA 4TWTA 4FAGA 1LOBA 5T54A 2XOMA 1O4ZA 1H2LA 2XH6A 1BBT1 3OTFA 5K0UC 1LGNA 2BNMA 2IZWA 4GKXA 4MX3A 1G9BA 1LGBA 2FDHA 4IW3A 3ZR5A 2A75A 3KF3A 5FY7A 4RS5B 3EQEA 3GCXA 2ZGLA 1SLTA 1O5UA 2ZX1A 5T52A 1X7NA 2XJPA 4Q29A 1HN0A 2CU5A 1NZCA 3AKRA 4PF1A 5EYYA 4A2UA 3C7EA 3JZVA 1UU4A 3RMXA 3ZVXA 3LA7A 4OHZA 2WJSA 1VALA 4RR3B 1AJOA 3HQXA 2IXKA 3CEWA 4ARYA 5A6ZA 3IPVB 1IHMA 3EB7A 4W6XA 2GNDA 5JPMB 1GUIA 5EPAA 4PT6A 4QPIA 2PQQA 4P9LA 3ACLA 2EICA 4LOSA 3GDBA 1YI9A 1PM7A 4LBKA 5K7PA 3B3QE 4AGGA 2AYHA 1VJ2A 2X5IA 3SXWA 4LITA 1JOJA 3OB8A 1Y3TA 1W0OA 2IXJA 3O1UA 2F17A 2R073 1CPMA 5FKCA 1LOFA 2QNKA 3WNLA 4Q2FA 3R6SA 3PMEA 4DUWA 3CF6E 1YFWA 3HNBM 3ZPOA 1W2OA 4ITCA 1DBNA 3GBWA 5LY1A 1V00A 4LQRA 2QQMA 1ZZBA 3ES1A 3JB4C 3CDZB 3VHNA 5SV5A 4AAXA 2QQNA 3W9AA 2ZEZA 1VRBA 1G8WA 4A3ZA 4XW3A 2LROA 1XYOA 1VBE3 2JG8A 2TEPA 3I54A 4L99A 4ASLA 1SPPA 1J1TA 5CFCA 5CISA 2K46A 3UETA 4J1XA 3LPFA 3DYOA 5GLUA 1OLMA 4OI1A 3AYCA 3NJXA 1DZQA 2ENRA 2ZHLA 5C4WB 1E57A 1R1ZA 5D8AA 1LENA 3E5XA 4AYUA 3RZZA 3HN1A 4EE2A 4TLGA 2IXLA 4DB5A 5C9AB 4OMCA 1NCRC 2P3JA 4Q4Y3 1JN2P 1R64A 1IS6A 5LBBA 2VXRA 2OT7A 3MZHA 2VOKA 4FPHA 1CR7A 3CO2A 2LUWA 2R061 2HKXA 4NMIA 1UOJA 3Q8FA 3I2GA 3WDVA 1HRI3 4B29A 1ACCA 3WSOA 4DXZA 1JUIA 2FDKA 2DFCA 5FYHA 3ALQA 2VMGA 1MEC2 5EJZB 2DBNA 4WM7C 4AHZA 4XXAA 3H9AA 1D2SA 4Q4V2 3AKPA 2JDHA 2HWD3 2QFEA 2NMOA 3LB9A 2H0VA 1HJFA 4DRVA 2HWE1 3U1XA 3X29B 1GZWA 1SLIA 3NAPB 5DAPA 4ZS2A 2ZX3A 4XC9A 3ZX7A 1HN1A 1ZX5A 4EV0A 4MSVA 1WA6X 2YFUA 1AUYA 3JBG3 5DAXA 2VQUA 3LOBA 1FOD3 2PHFA 4GALA 3NSTA 3HT2A 1ZBE2 4QDSA 3TBDA 3T0DA 3TOJA 4MLOA 2V72A 1Q8QA 3AP4A 4DY3A 4LLFA 5FPVA 4COWA 3DL3A 3P6BA 2UWBA 4H7MA 4P02B 5JSRA 3AXEA 4BE3A 3KQRA 5DMYA 1W03A 4D0QA 2G4IA 2RE9A 4Y4YA 3LQCA 4J25A 4BHPA 3RNSA 2PLV1 1OBNA 3DKWA 1KFUL 3V64A 4LKSA 4PHZA 5C33A 4MO3M 1CN1A 3IDEA 2FD8A 4QDQA 3CHXA 1UY1A 5IVEA 3A7QA 3NWKA 2TUNA 1G9FA 1Q8PA 3WNPA 5JOZA 3LFIA 3AMHA 2OUJA 5FZFA 1ST8A 3AFGA 1UIKA 2I74A 1UL9A 3BN6A 1SEFA 2PQSA 3WW4A 4HVOA 1QNYA 1RMU1 3AYEA 4F7ZA 3QH6A 4I0WB 4Y24A 5GLTA 4CDWA 4N53A 4AHWA 5J37A 4JAAA 2VZUA 3R0RA 2A1XA 3BALA 4CDUA 4F8AA 2VZPA 1F31A 1QNWA 2D6MA 5CA6A 2BP6A 1BLZA 2RS53 1FV3A 4ES8A 2WNUC 5LEJA 3KMHA 2WDBA 4G4FA 4QXCA 5FP9A 1RJ8A 3HQRA 5A3WA 3CJXA 5JXGA 1HB2A 2P2KA 3RPQA 3QACA 4Q5OA 4YLZA 1GV9A 5A32A 1QJX3 3VD4A 1AYM2 4UFJA 4NWVA 4XURA 4YG3A 2NPIA 5A7QA 2YUEA 1QJY1 1Z7S1 1COV2 5FZ6A 1KITA 3KVBA 1RUH1 2R072 2ZTNA 2IXHA 5EFUA 1EV11 1OC1A 3PVBB 3FHIB 2DTWA 1L7RA 4H3WA 3ZFEA 1ULEA 4BK5A 1NXMA 1WGPA 5LA9A 1BMV2 2ADDA 1AX1A 5FY5A 2P1BA 2X53S 1GWLA 1UPSA 4LO8A 4XJ9A 2G9FA 4QDRA 2BGCA 2UU8A 3MEPA 1DQ2A 2MPFA 5J48A 4JHTA 2VTXJ 3WHUA 4XTMA 3TYJA 3WNXA 5DAQA 5FYMA 1EAH1 1YJLA 2ADEA 2PXJA 4OQ8A 4KQ7A 1W6NB 1VBE2 1YIPA 4U2AA 2XQXA 4OCTA 5FZ3A 5BNPB 1W8OA 1UO9A 2WQ4A 1CX4A 3R4DB 4R4XA 3P3PA 1K5MA 4ZU4A 4XDOA 1LOFC 4L92A 1C5HA 5A3OA 4LKDA 1BBT3 2SBAA 3GJBA 4P9XA 2VNRA 3POSA 3POIA 1J3PA 2QQOA 4XFFA 5JWPA 1R082 1TMF1 1XNDA 2JDMA 5D1IA 4R52A 4DPNA 2FDJA 3VDDC 5JAXA 3AX4A 4AVBA 1CD3G 1HRI2 3UESA 2GDFA 3OBAA 4A7KA 3GXUA 1JYVA 1RUC2 1H8VA 1VAKA 1XE7A 5DUWA 3I8TA 4YVSA 5FDBA 1KRIA 1H4GA 2Y38A 1AR71 4FPCA 5FPZA 5BNNB 2V5DA 3S7EA 3BPSA 4M4RA 3I97A 1QY4A 5KXEA 2JEMA 1OOPC 3RWKX 2A7AA 2JE7A 5CBLA 2UWCA 1OMIA 2H6BA 4EN9B 4ARXA 5FP4A 3VHOA 1AR91 1UKRA 1UYPA 2GH2A 1LHWA 1YQ8A 2W08A 1CAUB 2VW0A 4XJWA 4WBBA 4QPGA 4XJ8A 1GZ9A 1YEWA 4BQ5A 3AC0A 1ENSA 1PO21 1JYTA 5FXXA 3T08A 5FR3A 2G1MA 2XLAA 2BGOA 2ERFA 4OZOA 3K4ZA 4CEWB 2QBXA 5FRAA 1VBA1 3DXUA 4KH9A 4IUGA 4PIYA 5A3MA 3THTA 4NRMA 1HW5A 4UW6A 1W2NA 2ORXA 4XF3A 1ZBA1 1PNGA 2Y64A 4BU2A 4AAPA 2WNVA 5C3QA 3E97A 4OQ9A 2WZEA 3V0AB 5L73A 2JKXA 4B7EA 2D43A 3PJQA 1DYPA 2P3YA 2KXLA 3POYA 3H42B 2ZAAA 1LRHA 3RZJA 2J1AA 5JR2A 2BNNA 1DYOA 4XFHA 3ZN6B 1MS1A 4AGVA 5ACA1 2KD7A 2MHFA 3PJYA 3ZFFC 2VXJA 4UXAA 3WF2A 4K40A 3ZDVA 3U37A 2WIIB 3A23A 4MADA 4XMIA 3TEXA 3WEZA 3NJYA 2UYAA 1RL3A 1KEXA 1VE0A 3S30A 5J09A 1XE0A 4G3YC 4PQQA 4CDXA 4KGQA 5TSWA 1OURA 1A3KA 4R4ZA 4H55A 3VHRA 1DQ1A 3OBZA 3KT7A 5C7GA 3O0WA 1MS8A 5JUVA 3OEBA 5DPNA 2Y6LA 2W0XA 2R063 4FOYA 3D3AA 1GP6A 1POQA 1WCDJ 3HR9A 4DXRA 5I8TA 4YNIA 3KB5A 1O5LA 5AC91 5EJ1B 5JOYA 2RR11 5KXCA 4IEVA 3BTXA 1N1YA 4DZGA 2LM3A 1QJX2 1WLTA 1S0BA 2DCTA 3E1F1 2Y26A 4NHKA 4BOWA 5LRSA 1UIJA 5FUNA 2GC2A 3NJZA 5CFDC 1PX3A 4DXTA 1RB8G 4FFFA 4UFHA 3PUQA 1W28A 1ZRFA 1PIV1 2HWE3 2R0FA 1W8FA 4HL0A 1TZOA 2VMEA 4LE3A 1AR81 4COVA 4FPFA 4CDUC 3TB0A 2ARBA 1LU1A 2PYTA 3J8F2 1S0FA 5FZ4A 3K48A 4PLOA 4AI1A 3AZVA 4IE7A 1X9PA 4YZ5A 4BQXA 2DF7A 4DIQA 2Y0IA 5FBZA 1JH5A 1VB4A 3JD71 2I2SA 2XVGA 1PK6A 3JXSA 2B45X 5FZKA 3POFA 4GH4B 4PLMA 5B4NA 1SACA 1VBB1 5FLHA 4GA9A 4D7SA 1FMD2 2BW8A 1YQ5A 4CXWA 2E63A 1DG6A 1R1A1 1OFSA 2J1UA 3CJIA 2WA4A 3OF1A 5DXDA 1GOGA 1YXWA 1ASJ2 1OPOA 1TQ5A 4LK6A 4MGIE 5GLZA 4AL9A 4E9KA 2PLV3 2HEYF 3M3OA 3ATGA 4LKEA 4D6RA 4OLLA 4JVAA 3O5SA 4I0AA 1A8DA 2JD4A 4JGYB 3ZSEA 1BBT2 3IMNA 1HXS1 5FYTA 2G9ZA 5SV8A 3ZFEC 3BIEA 1W6OB 1WLCA 1NG0A 4H14A 4HZFA 4N43C 4AK3A 4ZZ5A 2VCCA 4LO5B 1TG7A 1Y9QA 1DP0A 3SH4A 1RMU3 4O7XA 1BVVA 4NHYA 5GJ6A 5H9PA 4OUSA 4IEPA 4F83A 3H3ZA 2H6CA 4OUEA 3BB6A 4QQHA 4FOVA 2VQTA 3KSCA 5A3TA 5DQ0A 4AVTA 2A70A 2PHUA 4HT1T 2AC1A 1MS5A 3B5LB 4W6WA 3FC0A 4QHZA 3URFA 2VM9A
chains in the Genus database with same CATH topology
3ZSJA 3V65A 3B01A 3IBMA 2W52A 4IV1A 4N9IA 5CG8A 1MS4A 4HETA 2AZ5A 1PGSA 4Q0SA 4FXKB 5I93A 2RS11 3MI8A 3ZXGA 1T6GC 1GKBA 1QJY3 1LODA 1Z7S3 2I45A 3TN92 2WL1A 1RUH3 2GC1A 2WLPA 4MUVA 1PGL2 3MIFA 3MLKA 1GYKA 5C4WC 1EV13 2Q5TA 5GLVA 3IM0A 5C9AC 2PA7A 3QOPA 4MXWA 5FO7B 3ZXFA 1ENXA 2WZR1 4E2QA 2Z5WA 3WOGA 1UCXA 3WLUA 1Z78A 2XGXA 1EAH3 4RL7A 1QDCA 2D6KA 3H1MA 1R091 1O3TA 4IESA 1L3JA 1WLWA 3H3UA 4EROA 2IXCA 2XBO1 4C0HA 4YZ1A 3QLQA 3U4XA 2R1BA 3NAPC 5GKAC 1TMF3 1U5XA 3EBRA 1V9U1 1QJU1 2WS92 4AXOA 2A6WA 1ZRRA 4P9YA 1MVEA 4YM0A 2R6QA 2CGNA 1SLLA 1QH7A 3SNMA 5CB7A 2GNTA 3NO8A 4EWEA 1G9DA 1H1MA 1AR73 3GNEA 2NP0A 1HRV1 2EXKA 2PHLA 3ZYIB 1RHI1 4CDXC 1O91A 2D6PA 1CAXB 1BEV2 4E4ZA 4WM8C 5FMOS 1RUI1 1AR93 1KDKA 2E7AA 2WT0A 3VZJA 1WW7A 4EN7B 4XFAA 1PO23 1XU2A 2BWCA 2JE9A 4RA0A 5JZGA 1BVP1 4FPYA 2GAUA 3VBSA 3WG4A 4YW4A 5FO9B 1VBA3 3WDYA 1M4WA 4CDQA 1QXPA 3OYWB 1ZBA3 2D6OX 1VBC1 4FQ4A 1RITA 3UKNA 4GXLA 4Q0UA 4DMIA 1W0PA 5K0UA 4XBLA 4B8EA 5ACA3 2BVBA 5BNOB 1MZ5A 1S2BA 4YFWA 1SQ4A 3AMPA 4AHYA 1Q8VA 1NY71 4TSVA 4Y20A 4M00A 4YVWA 2ZABA 3H7JA 2GMPA 3K51A 1BZWA 2ZS6B 4DINB 2BBVA 1CVNA 1PMIA 4BPZA 1JTZX 3CJIC 4DFSA 2JX9A 2P37A 1V6NA 1XQNA 2QCSB 1V6JA 2B7YA 3IN9A 4HN1A 2YMZA 2XJTA 5AC93 3ZN4A 2R49A 2RR13 4RGAA 1DGWA 2JICA 5EXOA 5HCFA 4C1XA 4HK8A 4XFGA 1WW5A 1PIV3 1RUH2 5BV6A 3RWNA 5HBAA 1AR83 3SMHA 1DGLA 3NV1A 3WR0A 5HI0A 2IFRA 1I5ZA 2HEWF 4MXVA 2XKOA 2X8KA 3FFQA 1Q5OA 4JDOA 3VBUB 2PAKA 4P9JA 2GMMA 2VOXA 3JD73 2PHXA 2PTMA 3FE5A 3BOWA 4XIOA 4QPIB 1Q8OA 4Y1UA 1VBB3 3N4MA 2DVFA 1EAH2 2B39A 4FT8A 1R1A3 1J1LA 2RMU1 2X5IB 3AJZA 4MZUA 4UW4A 1SFYA 3IKWA 3VL8A 1H2NA 4W6YA 3USSA 3KCYA 4QGMA 5DDJ2 1NCRA 3ZO0B 4HVRA 3VZKA 5JR7B 1HXS3 4PIXA 2D6LX 1LHVA 4WZFA 2EALA 4GULA 1FNYA 3WV6A 3ZXAC 3AKQA 1TMF2 4PBOA 3AZXA 2DTYA 3M3CA 5DG1A 2ZPXA 2D5HA 2VUJA 3VBRA 1WUVA 3KT1A 4WM7A 2Q30A 3E5UA 4XFCA 4ONUA 1UW8A 2BEOA 1AR72 4AVCA 2BFUS 3G7DA 2HWB2 1W6QB 2DCZA 1W6MB 3VKOA 5FQ0A 2VW2A 4XQDA 2YZ4A 3WCRA 1MQTA 3RJRA 1AYN1 3N36A 4FOQA 4Y1VA 2ZX0A 3GYDA 4I3PA 4IEUA 4XOGA 4XXPA 2DU1A 2JG9B 2RS13 3GZUC 2VVDA 1FNZA 4Q0VA 2E53A 3L9JT 3KS7A 5GZCA 2XL7A 1XE8A 4YGBA 4WV8A 2GALA 5L7OB 3MLJA 4KNCA 2VOWA 1D2QA 1ZBA2 3THPA 2DVGA 3OGJA 3LOIA 4IV3C 5JOXA 3GBGA 2WZR3 4YW1A 1RJ7A 1YYNA 4PCRA 1TNRA 2RJKA 2WWSA 4XTPA 3O0VA 5ACA2 4W65A 1FPN1 1R093 2RJLA 2W39A 3Q9OA 3DUIA 4NHMA 1LOEA 5JZGC 5LK5A 2CL2A 3ZFGA 2XBO3 3ILFA 1CAWB 4ZKTB 1LHOA 3B94A 2WFF1 2P17A 1LOGA 3ENRA 4XF9A 3AKSA 3QCWA 4FO9A 2NLRA 2D98A 2E7TA 1V9U3 3LGRA 1QJU3 4HSJA 1IOAA 1SBEA 2WQZC 2D97A 1REDA 4XZPA 5AVAA 2ZHKA 2XWJB 3VKMA 5AC92 4GH4C 3R4UA 2RR12 2CTVA 3OJBA 1LULA 1YJKA 4HKWA 1SMVA 1GZCA 1S0GA 5JSOA 4YVWC 3ME2A 1HRV3 2CNAA 3OBRA 5H9SA 3EXUA 4GB31 3VBHB 1RHI3 2GNBA 4AEKA 2DCJA 4YZ3A 4I0BA 2X29A 3ZIWA 1RUI3 4N53B 5H9RA 3PNAA 3PVOA 4A7ZA 4JGYC 2B42B 4LUKA 1H9WA 1AR62 3SH3A 1QJZA 3JD72 2YV8A 4X6QB 1VBB2 1LHNA 4XJAA 4YARA 3V0BB 2O8OA 2P3KA 4MVTA 1CIWA 1VBC3 1OFNA 4M0HA 2V5YA 4EN8B 3LSEA 1DGRN 3S0MA 2E51A 1RUG2 1NA1B 4Z2WA 1RVF1 2CAVA 2HWF2 4PDWB 3WP3A 4AVAA 2GU9A 4M3CB 4S2DA 4AFAA 4XEZA 3VDDA 2XVKA 4WVVA 4OULA 3VBFB 2CWMA 2NQYA 3LA3A 1LJ7A 5BUVA 2KM2A 1SBDA 4AVVA 5ABJC 4AGRA 2EF6A 4C91A 5I0RA 4D94A 2WNEA 4K21A 2XB6C 1YFXA 1OLRA 2D3RA 1REFA 1LOAA 1OOPA 1ULGA 4L97A 4JRLA 2JECA 3JB8A 4Z07A 1PVC1 2MEV1 5BXXA 4U36A 2DVDA 2CY6A 1X50A 2RS12 5JI9A 2ZACA 4MGZE 4AEDA 4HVQA 4JGZB 2OW4A 3OY8A 2KA3A 1NQJA 2P3IA 1M06G 1HV0A 3VBRC 4L8QA 3KZ4C 3T1MA 1UMZA 4B3NA 3KCCA 4X8NA 1N3QA 2VNGA 4AI2A 3RYPA 1Z0HA 4WVMB 1KD7A 1MQTC 3HBZA 2ILMA 5DUVA 3ZFFA 1LEDA 4RQPB 1YRZA 1HQNA 2RMU3 3GF6A 5C8CB 1R092 4QPGB 4FSJA 4K6BA 4AI8A 3SLIA 3WUDA 4YW3A 1VRH1 4LE4A 3U0ZA 4ISRA 2GH8A 2XJQA 2WSUA 4YGDA 5DG2A 3W58A 1H0BA 1QQP1 2RS31 3WUCA 4D3WA 3KCXA 1MS9A 4IEXA 1QJU2 3PHMA 2CGOA 1PZ8A 5KHIA 3AXDA 4FTBA 1CJPA 4FPJA 2ZGSA 1EPWA 2ZGMA 3ZSMA 1WA4A 3H7YA 1XNBA 5CFDA 3ZFGC 2HWC1 3TRSB 3MW2A 4KWKA 4X6RB 3MIEA 5F6LB 1H30A 4COYA 1LHUA 1ZNPA 1AYN3 1PZ9A 4KWLA 5JVVA 1D4M3 3APBA 2ZZQA 3EO6A 4Q0PA 4Q4X3 1I9RA 2R041 4LTAA 1J58A 2XPJA 1GFF2 4RS5A 1HIXA 2IFWA 3KT4A 1LCLA 4PBPA 4A3XA 3H8UA 1WCKA 1YUDA 5GLWA 1SCSA 1UZZA 3KD4A 3ES4A 4LLOA 2JKBA 4AWDA 3I7DA 1ND3B 3IPVA 1S0JA 2ZOEB 4CP0A 1APNA 1UU6A 1DQ0A 4IEYA 3VUOA 2QZ3A 4N43A 1FPN3 1NY72 1QHDA 4I02A 1DDLA 1DU3D 4OHYA 1C3HA 1C5IA 1PK6B 2Q4SA 2UWAA 2WFF3 3MF9A 1NQDA 1XNCA 4OFGA 3UV9A 3L2YA 1NE4A 5DZFA 5KXBA 3AP9A 1MZEA 5FMOL 2DVAA 4JDMA 2HEVF 1DQ4A 1YCIA 2ZZJA 5E8AA 3KLSA 3FMGA 2B46X 2C0ZA 3VBUC 2VMIA 1JW6A 2QUOA 4R9AA 2OZ6A 4Q4Y2 1VBD1 4JTOA 2JDZA 5CIRA 2QE3A 1QOSA 3USUB 4GB33 3WDXA 3NV3A 4YW2A 5C4WA 5B2GB 2XJSA 2ZKNA 4ZU5A 4HANA 5C9AA 4XF4A 2OVUA 3SISA 2HWD2 1NE6A 1WLDA 4FPEA 1A78A 1LU2A 2WFPA 5EV7A 2NYYA 1JYCA 1O4YA 3AZYA 4UBGA 4K1ZA 5F9TA 1B35B 2EXIA 3JBG2 4XF1A 2RMU2 4QMAA 3FBMA 4XIKA 1FOD2 4AEDC 2ARXA 2YHJA 1NCQB 4QD2A 1F8VA 1DGWX 2PHWA 2DUPA 2FBEA 3I4IA 3AYDA 1RVF3 2VQAA 3NAPA 5KC5A 5FREA 3VZNA 1WD3A 3B93A 3DPRC 4LHLA 5JLVA 2EXJA 4YM2A 5GZFA 4CEYB 1AJKA 3VBOB 4H7LA 5T5PA 4GKYA 3VGIA 1N47A 5C8WA 4AE2A 5CADA 1UPIA 4XQ4A 5KHKA 4F3JA 3I59B 5EJ3A 3C2UA 4MYEA 1PGW1 1LGCA 3JCIA 2JXAA 4WM8A 1VR3A 4MGKE 1BXHA 1PVC3 1D4M2 2ES3A 2MEV3 4OVEA 1J3RA 4ASMB 2VH9A 1PHMA 2RS52 3JQWA 1TE1B 1O3SA 4Q4X2 1LR5A 3LSDA 5A33B 3SHRA 4Y22B 4XF0A 1EPZA 4META 4COUA 2CGPA 1H8TB 4Y26A 4CRQA 1REEA 4LBJA 3NVCA 2VMHA 2VVFA 1RUE1 1ND2C 4N7UA 3MYXA 2A6VA 2XUMA 3T1LA 1QXJA 1JYIA 2AR6A 4R8HA 2VULA 2XLFA 1RUNA 1YWKA 2HJIA 3I2DA 1O4TA 3N3HA 1N1VA 4BYYA 1WW6A 3AMMA 4XILA 5HCAA 4OI4A 4RS5C 4Q27A 4TZDA 2BFUL 3GZTB 3VBSB 1VRH3 4AG4A 5IK4A 5JPNB 4B4QA 3VBHC 1IKQA 1QQP3 2RS33 4HKOA 5FCCA 3ZYGA 4BMBA 1IS5A 1SDWA 1XNKA 3NW4A 2FHRA 3MPBA 4RR3C 1YFUA 4L9BA 1FXZA 2AH2A 2C5DA 4AW7A 4LR4A 4ORFA 1CPNA 1EYBA 4IQPA 5KBFA 1DZTA 4BQ1A 3ZXEA 5FAXA 4OUMA 4DY5A 4EN0A 1XYPA 4CP1A 2LTNA 1W6NA 4FVVA 3OGGA 4Y20B 2HWC3 1IZ3A 1MR5A 2DCYA 3AYAA 1MS0A 2OPKA 4M3CE 5CVRA 3ZXKA 3OBTA 3B9IA 1OQEA 3WVJA 3RI9A 4FBFA 5EZWA 1X36A 1RUF1 3P3NA 1CAVA 4IEOA 2R043 1NA1C 3ILNA 3AZZA 3NV2A 1IGOA 3RYRA 2WLQA 4D7YA 3INAA 3RJ2X 3ZSLA 1QOOA 3VBFC 3LA2A 1W2UA 4YSFA 1LECA 2EVXA 2ZX2A 5E88A 3QD6A 1G6NA 4HPKB 4FXGB 1ULDA 1NYWA 4FOWA 4AHXA 3ZMOA 2R32A 1YHFA 4QGNA 1CAUA 5J96B 2RM21 4C90A 2A73B 3M1HA 2PHTA 1H2MA 2AREA 4IEQA 4JGZC 3E6CC 3SH5A 3DGTA 3PVEA 4K3UA 1RUJ1 3B9CA 1HX6A 2V09A 4AQSA 4LO4B 4Q4V1 3V0AA 2TNFA 3MIGA 1RIRA 3ZDSA 5F5QA 1NCRB 1VBD3 3B7MA 1PVC2 2MEV2 3B02A 4Q1RA 2ZGPA 1DGRA 3MIDA 3ZN6A 5F6KA 4LT5A 1GANA 2R062 3LAGA 3M3EA 2ZGKA 2D44A 3WXPA 4LBNA 1ZBE1 4UBHA 1CONA 4PQ9A 1SLBA 4Z1VA 3MFAA 4IV3A 5JSPA 3S6PA 2O8QA 3O12A 2HWE2 4BLIA 4CYDA 2FMYA 5GM0A 4E4SA 2EAAA 5FQ0B 3WDUA 4KL1A 2OYZA 1WBFA 2BQPA 5T55A 2CV6A 4FPGA 2FMDA 4FCAA 5I8SA 2AUYA 2E7QA 3V56A 5IK8A 2D6NA 2E9QA 5I0SA 3AB0A 1QU0A 1O3RA 1V6LA 3MW3A 2GNMA 1QWRA 3FJSA 4HFSA 2DV9A 4QQPA 4BA6A 2PLV2 1AXYA 2EIGA 2DYCA 2C1FA 1HLCA 3E5QA 2K0GA 3RRDA 2A6XA 1JBCA 3WP4A 4GH4A 4LBLA 3NKGA 4E2GA 3D6EA 1DF0A 4LBQB 1AYM1 1RMU2 5EWSA 2YXSA 4Q8LA 2OA2A 3FZ3A 3A0KA 1ND3C 1COV1 4HN0A 4KU7A 1V6IA 2B9UA 4JGYA 1SLAA 2WKKA 4B4PA 2WNUB 1MZ6A 2R042 3BPZA 3ZSKA 3U10A 3PMSA 1EY2A 1RGSA 4CP2A 4D69A 2RHPA 3ECQA 2R30A 1IS3A 2D40A 1C4RA 5BNPC 1QJY2 1RUE3 1Z7S2 1G86A 4Q8KA 4GWNA 1KJRA 1DQ5A 1EV12 3WX5A 1AL0G 2DWRA 3CLPA 4YW5A 3OCPA 3ZYPA 3ILRA 1PZ7A 3IIAA 5GALA 5KHHA 3H1YA 2Q0AA 4LA2A 1R081 4D7TA 5ABJA 1KS5A 1MVQA 2VQ0A 1QF3A 1YFYA 1GQGA 2H0BA 4XPVA 3AMQA 5A3LA 4FTEA 2DUOA 3WG2A 1RUC1 1AF9A 3J4UH 4EN6B 1AZDA 4ISQA 5BNNC 3ZPYA 2VNOA 3J26N 1X8EA 4QQOA 5FTTC 5BYNA 3EJKA 1A6CA 1H2KA 1BJQA 1N3OA 2VPVA 4HMZA 5JIUA 3AP5A 4SLIA 2Z79A 1B35C 2ZGUA 3SCFA 3VDDB 2ZHNA 5KHGA 3FUQA 4E27A 4OHWA 3OD0A 1NCQC 5FLIA 4CEWC 3MIBA 2JG8B 1PVXA 4R9DA 5CFCB 4INDA 3VKFC 5FOJB 1RUF3 2DU0A 2ZGOA 2O1QA 5D8AB 2VW1A 4TYSA 3M2MA 2XVLA 4XFBA 1OOPB 3AM2A 2DURA 1LKNA 5T5OA 2XHKA 1N1TA 1AR92 4I09A 4CEYC 2N7GA 1HV1A 3VBOC 2WA3A 1U5YA 2A3YA 1PO22 1AHSA 1FX5A 4Y1ZA 4B7KA 4COZA 2UURA 4LA3A 1CQ9A 1VBA2 1ZZ6A 3UK9A 2NN8A 2ZGNA 4P9GA 4AI3A 4FTSA 4IETA 3BIWE 4AFDA 1Q3EA 2RM23 3FBYA 3IDBB 4DOUA 5I8YA 1GZWB 1UAIA 5H9QA 1WD4A 3WW3A 3UKTA 1ZZ8A 1ALYA 3S7IA 1SLCA 3ZFFB 1ENRA 4OI0A 1HQLA 4YZ2A 2NM1A 5HXVA 3OYWA 1RUJ3 1H8TC 1ZA4A 1KQRA 4I30A 5T50A 1GBGA 4Q4V3 1PGW2 2ZMLA 1H1AA 3H50A 1V6OA 2Q8OA 5T5LA 5IUQA 2AGSA 1H9PA 3QH7A 2ZGTA 3J8F1 4DRRA 4MV2A 2R1DA 4QM8A 1KS4A 3M3QA 4G9SB 1ZBE3 1N1SA 1N3PA 2PHDA 1PNFA 3J9SA 5L36A 2D3PA 4HK9A 3NKTA 3MF6A 2Y0OA 1FMD1 3FLPA 3R05A 1RUE2 3GALA 4RGGA 4X8PA 1PIV2 2ZMNA 2YDEA 2DVBA 4QGLA 2A6YA 4CDWB 1AR82 1POV1 1ASJ1 3N7KA 3L2HA 5J36A 4CDUB 3FLRA 2LALA 2ZJCA 1PO11 1ZZCA 2DFBA 4J1WA 3WQ1A 1FI2A 3VHPA 4R9CA 2UYBA 1AL21 4Q4W1 1VIWB 2VU9A 4P14A 2QDNA 1R1A2 5A32B 4JCKA 4KGGA 2D3SA 3G6JB 3PTYA 1YO8A 1VB2A 4LEJA 4Q1PA 3VBUA 4DNYA 1IS4A 1EP0A 4Y5Z0 1HXS2 2OZJA 1H1IA 3ZFEB 1GICA 1NLSA 3T2TA 3WP6A 1BKZA 1X33A 4N43B 3VV1A 3U07A 4XDQA 1AYM3 3RMYA 1S55A 1OA3A 1OQDA 1COV3 3FLTA 3TN91 1G9AA 1PGL1 3VN4A 2P34A 1AXZA 1RUF2 1DFQA 1TNFA 2Z69A 3R4SA 5DUUA 4YG6A 4AQ2A 1YI7A 1K5MB 4A7YA 1QGLA 2XJRA 4JC1A 4PJYA 1H4HA 4QPYA 3FUOA 4BCUA 5JCTA 1QXRA 5LK7B 2OIIA 5IT6A 4AEJA 4LO7A 5I0UA 1UU5A 1OPMA 1FYUA 1ZRCA 4BIOA 1W6QA 3SCGA 5J98B 3LKJA 1W6MA 4LUMA 4YVSB 3DPRA 2D5FA 4M0NA 4LNVA 3RSJA 1Q8SA 1Q56A 2RM22 2JG9A 2WZR2 4OHVA 1G7YA 1R083 3VKNA 1UF2C 2WS91 1W6PA 2DCKA 5L7OA 1C57A 1B09A 5FO8B 4CZSA 1RUC3 3WINE 1RUJ2 4GQ7A 1ZZ7A 2XBO2 4I01A 3KGLA 1A8MA 1JHNA 2W68A 4Z8BA 4RFT0 4XETA 1MZFA 1BEV1 2WNVB 4JDNA 1KDMA 1V9U2 1DQ6A 3D4KA 4EWAA 5AVPA 1BYHA 2QZ2A 2A3XA 4RHV1 4NWWA 3AKTA 4XHXA 3IWZA 1POV0 3MICA 1CAWA 4N9HA 3TWIA 4XE9A 3BCWA 3IT8A 4YYOA 2G9GA 1JUHA 4YZ4A 2ZMKA 1ND2A 1HRV2 4K8FA 4JQRA 4EJRA 1KXGA 2YC0A 4NHLA 1RHI2 4HKLA 3NV4A 4BM8A 4NR1A 4CDXB 1CGPA 1RUI2 4RSUA 1UN1A 4WM8B 5GZDA 3O0XA 3PLQA 1F2NA 1HQWA 4Q0QA 1HDKA 4YM3A 4NN0A 2QQPA 5BNOC 2WZPP 1RUD1 4EWDA 1U0AA 3DN7A 2C9AA 2R0HA 1S2KA 4KWJA 3VBHA 3FX3A 1VBC2 1WMDA 3ST7A 4MGYE 4XYXA 4RR3A 4KG0A 2GZWA 1V6MA 2ET1A 2ZGRA 1S0EA 2QJVA 2YGLA 3IDCB 5FLJA 3WQ0A 3VZOA 1DLLA 2EA7A 4PIZA 3V0BA 4SBVA 3WZ1A 1DZRA 2K9ZA 1WBLA 3MDPA 4IEWA 2B5HA 1HKDA 2PAEA 2XWBB 1IPJA 2PAMA 4J6GA 3CJIB 1J59A 1GSLA 1NA1