4HSJA

1.88 angstrom x-ray crystal structure of piconlinic-bound 3-hydroxyanthranilate-3,4-dioxygenase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 40
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hsjA01
1RUOA 3S7IA 3PNAA 2BEOA 3L2HA 3ETQA 2D93A 3KCCA 5D1IA 3RYKA 1J59A 4AXOA 3E6CC 3TNQA 1Y3TA 3FHIB 3EJKA 1UPIA 2ATFA 4BH9A 4AVBA 3FFQA 4QGMA 1RC6A 1H1IA 3RPQA 3CF6E 5K8SA 1O3QA 3OTFA 5FPZA 1V70A 3KGZA 3HT2A 4O9EA 4P9GA 5CVRA 1CAUA 4HSJA 4MGZE 2D5FA 2GU9A 1CAXA 4I02A 4YYOA 2VECA 5LRRA 4HVOA 3E6DA 2PYTA 4D7SA 1XE8A 4N9HA 5CU1A 4QX5A 2UYAA 1YFWA 2VQAA 4NVPA 5I8SA 1J58A 4LLOA 2BNMA 1RL3A 2I45A 3IWZA 3M3IA 5E1RA 1HW5A 4HBNA 2H6CA 1UD1A 3D0SA 4B29A 2OPKA 2GC0A 3WW4A 4Q0VA 1CAVA 4IEQA 3WW1A 1XE7A 1ZRFA 4IEOA 5KHJA 2IXJA 4DINB 2V09A 1OMIA 4QM9A 2K0GA 3LWCA 3NSTA 3RYRA 4E2QA 2BNNA 2XL7A 4XF4A 1ZZ6A 3LA7A 2XLAA 2XL9A 1X7NA 2IXIA 1YHFA 3DKWA 3DL3A 2GH2A 1NXMA 3C3VA 3GBFA 1O7FA 3MDPA 4JV4A 1UCXA 3H8UA 3RDIA 3OCPA 1UIJA 4QXKA 2HJIA 3U11A 4O9GA 1IPKA 3FWEA 3QOPA 4HN0A 4PJYA 2QVSB 2PTMA 5JR7B 5CADA 2E9QA 3EO6A 5BUVA 3WW3A 4XFFA 4KWJA 5LEKA 4R52A 3BALA 1QXJA 4E2SA 2P17A 2CAVA 4KWKA 3KGLA 1YUDA 3MYXA 1Q43A 2BYVE 1YLLA 3IDCB 2XKOA 3I59A 4LEJA 3U10A 5EZWA 5I8YA 1ZZ7A 1RGSA 4MUVA 1NE4A 3OD0A 3ES1A 5I0RA 3IDBB 4I09A 4QGNA 5JAXA 3E5UA 1JUHA 4IEVA 1I5ZA 1Q5OA 4QMAA 1LRHA 2B5HA 3H3ZA 1ZNPA 3NVCA 4X6RB 3S7EA 2FQPA 5JCTA 3RNSA 4QGLA 5FLIA 1Y9QA 4KWLA 2PAKA 5BY5A 5BXXA 3H1WA 4XFHA 4YARA 4OLLA 4Q0PA 1ZX5A 5JSOA 2BNOA 2ET7A 1SQ4A 3BPZA 4KL1A 5I93A 2ET1A 4IEZA 5FCCA 3HQXA 3ZDSA 4EWDA 2QNKA 4JVAA 3ELNA 2CGPA 3NL1A 3NJZA 2H0VA 2ZCWA 1OI6A 1RTVA 3H3UA 1LKNA 4BIFA 4XF1A 3S0MA 4MGKE 5FLHA 2PHLA 4LTAA 4F7ZA 1CAWA 3H7JA 5FPXA 1O3RA 4XF3A 1NE6A 3E6BA 4YRDA 3D82A 5FDBA 4E2GA 1ZRRA 3BB6A 4HN1A 3EQEA 4XFCA 3IBMA 2PA7A 4R8HA 4FBFA 1SEFA 3QACA 4Q0QA 3UKNA 4TLFA 4IEYA 5FQ0B 5LEJA 1LR5A 3TNPB 3NW4A 5FLJA 3FE5A 1GQGA 4PIZA 3O14A 4ZU5A 2IXKA 2EA7A 5C6CA 1XRUA 5C8WA 1YFYA 1LB2A 3MPBA 2MNGA 3SCHA 1O4TA 1Q3EA 4EROA 4UXAA 2ETEA 1QY4A 3PLQA 2WFPA 1EPZA 2GC1A 3FX3A 4LUMA 2N7GA 1UW8A 1DZTA 5I0SA 1G6NA 2IC1A 3LA3A 2Z69A 3NKTA 1EYBA 4IERA 3E97A 1H1MA 4UBHA 2EAAA 4AQ6A 1J1LA 4OFGA 2FMYA 2QDRA 1O5UA 3LA2A 4AVAA 3MZHA 2PHDA 1FXZA 3KSCA 3HT1A 4ORFA 3OF1A 3EBRA 3E5XA 4HLTA 2UYBA 4HMZA 2EVXA 4META 2PAEA 3JZVA 2WC2A 4CYDA 3UKTA 1NZCA 4MX3A 3WW2A 1ZREA 2IXLA 2XKPA 4MGIE 1PM7A 3ROUA 4FAGA 1ZRDA 2Q4SA 5EFUA 1X8EA 1ZZCA 3H1YA 3UKVA 3U0ZA 3I7DA 5JSRA 1PMIA 2XLGA 1VR3A 4F8AA 2MHFA 4XEZA 4IEXA 4JTOA 5AVPA 5KHGA 1I6XA 1GQHA 5I8TA 1ZZBA 2D40A 2MPFA 5BPXA 3LOIA 4Q29A 3BCWA 4IEWA 2GC2A 4XFGA 2Z2SB 3SCFA 1DZRA 4N9IA 2UY8A 1J3QA 2Y0OA 4J1WA 3SXWA 5FQ0A 3D0JA 2XGXA 2K9ZA 3KMHA 4I0BA 2HKXA 5JSPA 4ZU7A 3CO2A 2XLFA 3H9AA 5J48A 2PAMA 3E5QA 3HIFA 2UY9A 3H50A 3VHRA 3M70A 4AQ2A 5HI0A 4WZCA 1ZZ9A 4Z82A 4I0AA 2OYZA 1J3RA 4MZUA 1ZRCA 3LAGA 4PIXA 3DV8A 2CAUA 4LUKA 3CLPA 3I59B 4I3PA 2VPVA 5KBFA 2H6BA 4KU7A 3ACLA 4AVCA 3EHKA 4IEPA 3USSA 4XETA 2OA2A 1X8MA 3I54A 2C0ZA 4LULA 2GAUA 4YNIA 3IIAA 5KHIA 4I01A 2KXLA 1UIKA 3CL1A 1OD5A 4EWAA 2Q0AA 4HSLA 4XFIA 1U12A 1TQ5A 3H1MA 3SCGA 4K8FA 4BYYA 3LZZA 3G7DA 4FAHA 2O8QA 2Q1ZB 2QJVA 4XFBA 1WA4A 1L3JA 1IPJA 3OGJA 5J3UA 4EWEA 1YWKA 4JTNA 3BU7A 4IETA 3FJSA 1QXRA 1X82A 1YFUA 1EP0A 5I0UA 1YFXA 3ST7A 4YSFA 2PFWA 2BGCA 1ZZ8A 1EY2A 2CV6A 1ZVFA 3PVBB 3CJXA 5F1RA 4LA2A 3GYDA 4ONUA 1SFNA 3ES4A 2XHKA 4IESA 1VP6A 3RYPA 5J7MA 1CGPA 4HZFA 1CX4A 2B9UA 1CAWB 4WBBA 5BV6A 3FZ3A 4FT8A 4J1XA 4KU8A 5I0TA 5I91A 1CAUB 2O1QA 5KHKA 1WGPA 4LA3A 4IEUA 2GZWA 1O3TA 4Z07A 4XF0A 1CAXB 1VJ2A 1FT9A 4X6QB 2B8MA 1FI2A 4L2NA 1NYWA 3SMHA 4XFAA 3SHRA 2IXCA 3R6SA 2F4PA 2D5HA 2IXHA 3DN7A 1QWRA 4ZU4A 5T3NA 3N4MA 2GC3A 4PIYA 4A2UA 2OZJA 1O3SA 1CAVB 5KHHA 4MGYE 1WLTA 5LRSA 4GULA 4WVZA 4BHPA 3CEWA 4L11A 4D7TA 5E16A 4HVQA 2QCSB 2Q30A 4RD7A 4MV2A 4QM8A 4Q0SA 1OFNA 1O5LA 4HVRA 4Q0UA 1DGRA 2ZKLA 3B02A 2OZ6A 2DCTA 2PQQA 1J3PA 4H7LA 4XF9A 1DGWA 4UBGA 4EV0A 1RUNA 4MH0E 4I2OA 3H7YA 3RZZA
chains in the Genus database with same CATH superfamily
4FP3A 1JS9A 1GKBA 1S0IA 5FP3A 1RMU3 5F5QA 2BEOA 3VBUA 1PGL2 3ETQA 4YM0A 4V2WA 1NCRA 5EIYB 2YBPA 1BKZA 2D6KA 3RYKA 2Z42A 1UOBA 1J59A 4DMIA 3DXTA 5FFOC 4AVSA 3N7JA 4FXGB 1JYCA 3ZR6A 1O59A 3GDBA 4QQOA 2W92A 2LALA 1L7LA 4WVVA 2HWD3 2XVLA 3UL2A 2A5ZA 3O0WA 1OQDA 1UYXA 5HBAA 2KD7A 3MIHA 4AGVA 2XUMA 5KXEA 1O3QA 3OTFA 4UW3A 5FYIA 3WP3A 3GJBA 5FPZA 5B2GB 1W6MB 2VMEA 1PGW1 1V70A 3HT2A 1MS3A 4A44A 1JTZX 2Y26A 3WX5A 3BTYA 3U1XA 2ZX4A 4HSJA 2GP5A 4XAAA 4A4AA 1HB4A 2RS33 1DFQA 2PHUA 3QCWA 3SKJE 1LODA 1W0NA 4ARYA 2XQRA 4LHKA 1VBE2 2VECA 4CPBA 1QMJA 2SLIA 4NOTA 5F32A 4D7SA 1KXGA 3ZFGC 4AEMA 2A70A 2Q1MA 2EXHA 2NLRA 2W87A 1ZRIA 1YFWA 3WP6A 1TVGA 2G9GA 4NVPA 5I8SA 1WA6X 3VD5A 2W1SA 4BPZA 3VDAA 3I97A 5GJ6A 4Y22B 4H7MA 1W3XA 3AZXA 2PHXA 4DY5A 1HW5A 1XOYA 3D4KA 2WQ4A 3RZMA 1JH5A 4FSJA 1FNZA 5A3PA 5SV5A 2BPA2 2RDRA 4BQ3A 2W94A 1LNSA 1AR71 1CAVA 2W95A 4LR4A 4R4XA 2Q8DA 2W3JA 3MW4A 3WUDA 4EYUA 1JZ4A 2OPWA 4OUEA 1VBD3 2IXJA 2WQ8A 2Y6KA 1AYM3 3M1HA 4QM9A 1Y7BA 1QKQA 1Q8PA 3NSTA 4E2QA 3BTXA 1OUSA 3BPSA 5JOWA 5JZGA 2BNNA 4CSWA 4XF4A 5A6YA 5FOBB 3O1RA 1RUG1 1ZZ6A 4D0QA 2LUWA 3CZJA 1JOBA 3N7LA 2XLAA 1HXS1 2RDSA 2XL9A 5F6LB 1W28A 1YHFA 1OA3A 5FYUA 2BOJA 4GALA 4RYDA 4JZRA 2W39A 2GNTA 3H8UA 2AREA 3OCPA 2XR4A 3POYA 1JW6A 2OS2A 1REDA 3FHAA 4QXKA 4W4ZA 4XACA 3OUJA 1W2UA 1V9U2 4O9GA 4YGCA 1H9WA 1IPKA 5FMDA 4E4SA 2NPIA 1NLSA 1U5ZA 1YXWA 1KJRA 3QOPA 2QVSB 4FVVA 4HN0A 4PJYA 3ZN4A 3O1UA 4QB6A 1VMJA 3ZSJA 3IB3A 3WP5A 3BU0A 3WT3A 1QJEA 3X29B 1OLMA 2LM3A 4XFFA 4K8RB 5GZFA 2W08A 1JZ2A 2VY0A 4AEJA 1XE0A 2P17A 2WQZC 1XYPA 3ABZA 4K9SA 4KWKA 1UYYA 2W2IA 3POWA 4Q5OA 5EJ1B 2XBO1 3MYXA 2ZEZA 1KD7A 4ZZ5A 1LECA 1FOD2 3ECQA 4LEJA 3U10A 2ARXA 3GZTB 3AP9A 5I8YA 2HWC3 4FOWA 4LQRA 1HB1A 1RGSA 4MUVA 5A7QA 3VZNA 2VTFA 1YQ8A 3VL9A 5FZEA 3ES1A 3ZN5A 5I0RA 2ZHMA 1ASJ2 4NJ4A 2P1BA 3IPVA 4OI2A 1QOTA 3FLPA 5EHDA 5CFCA 4CDXA 2RM22 3LOBA 4RR3C 1LRHA 1LHUA 1WCUA 1DYPA 5LCWL 1O4YA 2J1EA 3S7EA 5FO9B 3BTZA 2EIDA 1OF3A 2A6ZA 5DMYA 2FQPA 1ULPA 1BJQA 4Y1VA 4QGLA 3VHPA 1OXCA 1DGWX 4BCUA 3KM5A 1F2NA 1DCSA 5JXJA 1G8WA 1Y9QA 1VIWB 3LEMA 4XXPA 3VHNA 2G19A 1VBA1 2PAKA 3J7MA 2EXKA 4GZ9A 4OLLA 5A3WA 4M0HA 4XUTA 3GF6A 1W6NA 2BNOA 4WVMA 4XC9A 2YY1A 5GLVA 4YVSA 1SQ4A 1ZA4A 1RMU1 5DQ0A 3BPZA 4GWNA 4TSVA 4AHXA 4PBPA 3W21A 2ET1A 2VOTA 5EWSA 3ZMNA 1HQNA 1SLLA 4CDUC 2WWSA 5BNNC 1PMJX 3A0NA 1GZ9A 4HOOA 4MXVA 4AI9A 2HWF3 3PDQA 2ZZQA 5LY1A 2E7TA 3LCPA 3NL1A 2JG9A 4P14A 1OI6A 2HWD1 3GJAA 5JXIA 5BNPA 3CZUA 2WR9A 3J8F3 1PHMA 4N8MA 1W2AX 1H8TA 2JXAA 4JCKA 3VBRC 2WA4A 3ZSMA 3D6EA 3ZXJA 3S0MA 2Y6GA 4NHLA 2XJPA 3AFGA 4MGKE 2PHLA 4F7ZA 3H7JA 4E4DX 4ES9A 3MW3A 4JDMA 4XF3A 3ZYHA 3USUB 3BUCA 2HWE1 3FMGA 1C1LA 4NIHA 1GZWB 4B3NA 2RS31 4M3CE 1UMZA 3O5SA 4LBOA 5J37A 5FMOL 4E2GA 2A1XA 2VC9A 5IVFA 2F6BA 3IM0A 4FFFA 3AKSA 3HBKA 4HN1A 4UFKA 2VMIA 4XPVA 1C28A 5FWEA 1QQP2 3LPFA 4XFCA 4ZPIA 3IBMA 4L8QA 5IVJA 4R8HA 3WR0A 1YO8A 3I3MA 1DQ5A 1WD3A 3VBSB 3ORJA 2GMPA 4Q0QA 3T2TA 1X50A 3M7AA 4ISRA 1RHI3 3N9QA 3SH5A 4TLFA 1LTEA 2BU9A 3AMNA 3NO8A 4C1XA 1F9KA 3VDDA 4IE0A 4IEYA 1SCRA 4AEDA 1O8SA 2XWJB 2ZGMA 1HV1A 1BEV2 5C6CA 2EA7A 2G4IA 2ZACA 4B4PA 5C8WA 4WV8A 5FAXA 5FR3A 1AYM1 5L19A 2BBVA 1Q3EA 4UXAA 1H6XA 4AZZA 2G9FA 2ETEA 4S2DA 3TYJA 2XQXA 3LIGA 1DQ0A 3AC0A 3TEYA 1QY4A 1UYZA 1GNYA 1W9FA 1GP6A 2O0OA 4H14A 2WFPA 2A3YA 1RUF2 2XWBB 4L0PA 5ACA3 3ZXKA 4K40A 2GC1A 2JE9A 4ATFA 1H2KA 2A6VA 3CBNA 1HIXA 5AVAA 1AHSA 4XBLA 5LBFA 4AGRA 2XB6C 4CDQA 4LBQB 5L9VA 1DZTA 3LFMA 2YXSA 5CB7A 4UFHA 2IC1A 3K4DA 3LA3A 1V00A 5FY7A 4JKKA 3V0BB 3E97A 1W8NA 3PUQA 1J1LA 1WMEA 4OFGA 2JE8A 4AOCA 3P5BA 4AVAA 1W6QA 1FXZA 2J7MA 3HT1A 5IFPA 3ZFEC 1DQ1A 4AQSA 4A3XA 1QJU2 1PNFA 4NIDA 4J6GA 2ZBJA 2PHFA 3T0BA 4HLTA 3PVEA 2ZAHA 1AL21 2UYBA 3MHZA 3VKLA 1ENQA 2WT1A 3FLTA 3HVDA 4QPIA 3UGGA 1N1VA 3ZSLA 2HWC1 5FMBA 4ZXEA 1PNGA 1VBD2 4N43A 4YW5A 3UKTA 1NZCA 4MX3A 4YFWA 1RVF3 2X29A 4DB5A 2IXLA 4OI1A 1NX9A 4MGIE 1PM7A 4MHUA 1HRV1 4OUMA 5CKNA 2BBAA 2D98A 4IGPA 1ZRDA 2XVKA 1KS5A 5FZ3A 4OHZA 4D3WA 3POIA 2ZGUA 2DDUA 3RZJA 5F3CA 2P3IA 2VZOA 3IAPA 1CJDA 4YM2A 5LBCA 1REFA 5JSRA 5ISLA 4BQ1A 1D4M3 1PMIA 4XJ9A 3MIDA 4IEXA 3THCA 4XIKA 4D94A 1CX1A 4CEWB 2WA3A 1GU3A 2CDOA 1HQWA 2WO1A 1CD3G 1V6IA 4RN5A 4X8PA 5BPXA 1AR92 1WLDA 1FPN2 3W20A 4IEWA 3AP6A 4LPLA 2GC2A 4XFGA 3WXPA 3EXUA 2Z2SB 3AP7A 4DQAA 2UY8A 1NCQA 2VOXA 1QIQA 4J1WA 2VQ0A 1NOVA 2YU2A 3SXWA 4CPBD 5A3NA 2XGXA 3IKWA 5JOZA 2K9ZA 1GR3A 2JECA 1DYOA 2ZEYA 1QJX2 3O1OA 3T2OA 1RUJ1 5JSPA 1RUE3 5EPAA 5LB6A 5T5LA 5J48A 2FDHA 3J8F1 3E5QA 1BZWA 2HWB3 1L7QA 3HIFA 1MEC3 3N9OA 1W04A 5DUXA 1H4HA 3ZIWA 2I2SA 4AQ2A 1HJFA 4FTBA 1C8NA 3GZEA 4I0AA 3WG3A 4YVWC 2OYZA 2BFUL 3WQ7A 2R1DA 1GWMA 5IK4A 1Z7S2 3LAGA 1G9AA 4FPYA 4XUOA 3K3NA 3LDBA 1DLCA 1TZOA 3I59B 4G4FA 1RJ8A 4LUKA 4NAOA 2H6BA 4UT5A 1UOGA 5E89A 4CA9A 2W1QA 3NV3A 2MEV2 3NNJA 1FX5A 2WZR1 3OBZA 4OMDA 3USSA 5C8CA 5CFDC 4XBQA 5F2SA 2RS53 2VNVA 2WLPA 4ONUA 4LNVA 5KHIA 4DS0A 4I01A 4EZ4A 1O8PA 1RHI1 1MQTC 2HEYF 1X9TA 3PVOA 3BODA 1YNAA 2CYFA 2D3RA 4R9CA 1RJ7A 4EWAA 1W0OA 1XNDA 2VD7A 4PF1A 4JGYC 1CIWA 1XPWA 1TQ5A 2ZKNA 2R043 3H1MA 5F3GA 4E4ZA 1RUC2 3AL6A 2VW2A 4K8FA 5J98B 4D6RA 3LZZA 1IHMA 4XFBA 1H9PA 1WA4A 5DDJ3 3L2YA 1VPHA 4V2VA 5A32A 1L3JA 4G3YC 1X36A 4EWEA 5A7WB 3B94A 1YWKA 2WS93 5BNOA 3VKFC 2PLV2 3BU7A 2A6XA 5ACA1 3OGSA 3NRUA 1EP0A 3PMEA 5FREA 5KWRA 2DCZA 2ZPXA 2E33A 3MIEA 1I5PA 3UJQA 3ZXEA 4OI4A 2BGCA 2P37A 3U75A 4FTEA 2CV6A 1LHOA 4E8CA 4A41A 3GYDA 1ODMA 1S0JA 4COUA 2VCCA 2RR13 1FMD1 4KBZA 1K5MC 1HX6A 5IVCA 4Q4W1 3OJBA 1CGPA 4AF9A 4HZFA 4DY3A 4YZ1A 3W9AA 3OPTA 4M01A 3W5MA 2BV4A 3J7HA 1LEMA 4W6YA 4XDQA 2BW8A 3ZXDA 3FZ3A 4Q4Y2 4UW5A 1OH4A 4KU8A 1CAUB 1BCXA 5KHKA 1H2MA 3I2GA 5C9AA 2AENA 2VAUA 5FK7A 4LA3A 2GN3A 4RGAA 2GZWA 4LE3A 3VZJA 3WDTA 3WQ1A 2WL1A 1EAH3 4CCMA 1A78A 3U4SA 3NNMA 3HNYM 2WNVC 1OA2A 2OKXA 3QD6A 3BI3A 3W59A 3I2DA 3JQWA 2A75A 1GUIA 1W8FA 4M3CA 1RVF1 5C33A 4D7YA 1PMHX 1PIV2 1JZ5A 4XBNA 3CQOA 1BMV2 4XFAA 1SHWB 2IXCA 3TAYA 4YFZA 3M4FA 1XU2A 2LW8A 1JYIA 1QWRA 1NXD1 4C91A 4YZ5A 4RR3B 2GC3A 2YC4A 1YQ2A 1D4M1 2OZJA 4CCLA 3DYOA 5FZ1A 3ME2A 1I1EA 3NAPA 5KHHA 5K0UA 1A8MA 5G05L 1CJPA 4RHV1 4M00A 3AVSA 1QH6A 5DG1A 3WF1A 1WLTA 1YIFA 4WM7A 5M0TA 5LRSA 4AFDA 1YRZA 2RDNA 5CYYA 2CNAA 2ZX3A 4W6WA 4ISQA 5E16A 2Y6FA 2WKKA 4LBJA 3WNNA 1N47A 2BUKA 1CIYA 3SISA 4CDUB 2QQNA 5FP4A 5BNNB 4CXWA 4Q0SA 4GMP0 3UT0A 3KB5A 1RUE1 3I2JA 1OFNA 2WAAA 4QHOA 3TWIA 1O5LA 3OUIA 3DPRC 1OH3A 4Q0UA 4CE8A 1RUH2 1VBE3 2X05A 1WW5A 3B02A 2HWB1 1AYN2 2OZ6A 1IKPA 4H7LA 1MEC1 2QQKA 1DGWA 3MLKA 1WMXA 1PO22 4O61A 1ONAA 1ZBE2 3VBRB 3RZZA 5JZGC 4FI9A 3OY8B 2JG8C 1TNFA 2CHHA 4GH4A 1WZXA 1RUD2 3HPNA 3L2HA 1AR82 4IQPA 4CDWA 3KCCA 1HQLA 4KWUA 4I0WB 3D5OA 3IDAA 3AZWA 2CTVA 3FC0A 4LT5A 4K21A 5JPMB 2JDNA 3E6CC 3TNQA 3T2PA 1Y3TA 2Y38A 3O7OA 1IS4A 1DG6A 1LOGA 5FZCA 4YM3A 1OLME 4HKOA 2ATFA 5JUVA 1VRH2 4AVBA 3CIHA 3FFQA 2RS51 3B93A 5CG8A 1UPSA 3RPQA 4L97A 5K9YA 1WD4A 1JYTA 5K8SA 2C9AA 2HBUA 2RJ2A 1UOFA 4MLOA 4XYXA 1YYNA 2YZ4A 3WINE 3CMGA 3LEKA 4XQDA 5JIAA 2WFF2 4XJAA 2AEZA 5FUPA 2B4KA 1XJAA 3N7KA 1O6UA 5FRAA 4MGZE 3P3PA 2OUHA 4HXCA 5FMCA 3BTAA 5HCBA 5IUQA 4IDZA 4COWA 1CAXA 3WHTA 4QX7A 4QWNA 3WF3A 3E6DA 2VNGA 1V9U3 2VNRA 1UY0A 2TBVA 4P08A 3UGHA 4QX5A 2UYAA 1LENA 2BTVC 2VQAA 5DUUA 4RS5A 3JQXA 3I3QA 5JI9A 2UWCA 3JBG1 3NNLA 2AEYA 3VKNA 4LLOA 4AI1A 2IUWA 4MXWA 1RL3A 3AJYA 5JMCA 1F4HA 2H6CA 1UD1A 5HPOA 2VZRA 4YZ4A 2OPKA 3DUIA 1SACA 3I3EA 3WCRA 2CWSA 2R32A 2DVGA 1FOD3 4IE6A 4IEQA 4BU2A 3VBHB 4BIOA 1ZRFA 2RR11 2VG9A 4IEOA 4NWWA 5KHJA 5IATA 2VZQA 4DINB 5FZOA 3POBA 2VTXA 4PHZA 4OUSA 5ABJB 4R9AA 4BQXA 2DBIA 4PI2A 1YQ6A 3TN93 1PK6A 1ASJ3 1HRI2 2GSYA 2W68A 4HPKA 4XUPA 4FPEA 3ZFEB 4CVUA 5A6QA 4RGKA 1NQJA 2VZTA 3LA7A 2RM23 5L36A 2BDRA 5E6HA 3B5LB 3GHMA 5CG9A 4QHZA 2GH2A 1NXMA 3GBFA 5HCFA 4UWDA 1PVC1 3BKZA 1O7FA 4AI2A 2WINB 1UCXA 3RDIA 3AMHA 2HJIA 3Q8BA 3U11A 3AMPA 3AKQA 3KVBA 3KV6A 4QB1A 4QPWA 3RI8A 2RV9A 1WCQA 1QNWA 2P3KA 5FPVA 5FKBA 2XH6A 3WLUA 3BOPA 4IUGA 1F35A 4A45A 4TYSA 1REEA 4ZY9A 1U5IA 1RIRA 1QXJA 1VBB2 2BOIA 3BALA 4H3WA 4Q8LA 2PHRA 2ARAA 3AMQA 5F5CA 2D6PA 5L7OC 1FATA 1VALA 3VZLA 4Q26A 4L92A 2FD8A 1YLLA 2WZEA 2XKOA 3IDCB 3AZZA 1UZZA 1CR7A 2ILMA 3TB0A 1PZ7A 1AF9A 2ZGLA 3THPA 2VBPA 2OQ7A 5EZWA 2QZ2A 3AX4A 1NE4A 1ODNA 1W2OA 3WQBA 5FYTA 3J9SA 4I09A 3E5UA 3SEEA 1B35A 1POV0 2VZPA 1W6MA 2D6NA 5IHRA 1Q5OA 1GOGA 1MZ6A 1UAIA 2VR4A 2WO2A 1G86A 2WNUA 4QHBA 2E32A 3PL0A 4QPGC 3VDDC 3H3ZA 3QH6A 1YJKA 3NVCA 5F5AA 1AR62 2KM2A 1XNKA 1W6PB 2W0XA 4NWVA 3O0XA 3WF4A 3GZAA 3RJRA 2E26A 1YQCA 1ZM1A 5FLIA 3B3QE 4QQ2A 3DCQA 3T0DA 1QQP3 2W52A 3INAA 4UFIA 3H1WA 2FZ1A 1N3PA 1PGSA 4XFHA 3OG2A 3RG0A 2WT0A 4K3UA 1ZX5A 5JSOA 4KNCA 1VBC1 3ILNA 4FOVA 1Q8SA 4BJ0A 4CCKA 4Y22A 4AHWA 1ULDA 4PBOA 2Q8EA 3MIGA 3R4DB 3KV5A 4EN7B 3POEA 1RUI2 2DCYA 4KG0A 4YVWB 4IEZA 4EQVA 5C3PA 1S0FA 5T5JA 3HQXA 5F2WA 1ZBA2 3ZDSA 3ZVXA 4BQ4A 1ST8A 4XABA 1LOCA 2WRAA 4JVAA 3ELNA 4HETA 1MS4A 3MUZ1 3ZYGA 1BEV3 4JKMA 3R0RA 3R4UA 3T1MA 4Y5TA 3WG1A 3H3UA 5FZ4A 5DAPA 3WD5A 1LKNA 4BIFA 5CFDB 2QQJA 2E51A 2V4VA 3JU9A 4HKLA 1TMF2 3V56A 1QH7A 1IS6A 1GMMA 1W8TA 1MQTB 2R071 2NZ9A 2VZSA 1DQ6A 2R16A 4PLMA 5AC92 1RUF3 4Y20A 1KDMA 3D82A 4OZOA 1UMIA 2JDYA 4JGYB 5JIUA 2WWJA 5DPNA 3BB6A 2ZGKA 5IAVA 2P5BA 3C7GA 4P9XA 3M2MA 1W8UA 1Y9MA 4M3CF 1V9U1 4HONA 5E88A 5FUNA 4MO3M 3SLIA 3RI9A 1KITA 2PA7A 2GALA 2JDMA 3P6BA 3HQUA 5F6KA 3UKNA 1NUKA 2X09A 4B7KA 2Y60A 4H55A 4R9DA 3OYWB 4SBVA 1QJU3 2YROA 1G9DA 1W9WA 4LO7A 2IZWA 1DQ4A 5FQ0B 3TNPB 2JJ6A 3J7LA 4LBNA 4Z2WA 4LITA 2R6QA 3AB0A 1FOD1 2FCVA 3AYAA 1GQGA 5FLJA 4E27A 4PIZA 5IVBA 5IVVA 1XRUA 1JYVA 2K46A 3DF0A 3RZKA 2PQSA 3GBWA 2TUNA 1K5MB 4YW6A 3RQ0A 1ACCA 1ASJ1 3K46A 2J42A 2FCUA 4PF5A 4MGTA 3PU3A 4A6SA 4XZPA 3PLQA 3DYMA 3VBUB 3MICA 2RM21 1EPZA 3AMMA 3U78A 4LO5B 1E5SA 2PELA 2YDEA 1YCIA 2JIGA 3IIIA 4LUMA 4XQWA 3ZYIB 5KXDA 4Y1ZA 3WCSA 4CCNA 2EAKA 2WNVB 4JAAA 3NKTA 4XCBA 5FP8A 5LASA 3RZHA 5JWPA 2VO5A 4IERA 1FYUA 1H1MA 1WMDA 4TWTA 4UBHA 5LA2A 4AQ6A 1MS1A 4OHYA 2FMYA 2QDRA 4GD4A 2Y0IA 2BQPA 1AR93 3WVJA 1FPN3 4TTGA 1E5RA 1CQ9A 2QBXA 3TEZA 2JD9A 1A8DA 3LEIA 4HMZA 2EVXA 5FP7A 5FXWA 2ARBA 2ZOEB 5J1XA 1UZ0A 1QJX3 5A7PA 4META 4LBMA 5T5OA 2PAEA 4RQPA 4AVVA 1W8HA 3VD3A 3JZVA 2WC2A 1GFF2 1S4CA 1UN1A 4CYDA 5FY4A 1COV1 2Z5WA 1ZREA 1WLCA 3TN92 2QQIA 3ROUA 1TNRA 5FXVA 2B42B 1DP0A 3A22A 3KT4A 3USUA 1DGRN 4Y1XA 5DAVA 4ZKTB 3JD71 2FDIA 3FUQA 1Z7S3 3U0ZA 2ZTNA 1TG7A 3C8XA 3G6JB 3I7DA 2HYXA 5DZGA 4D6SA 2XLGA 4AFAA 3AYCA 1HB2A 4KMQA 3MV01 4F8AA 2IFWA 3DPRB 4XEZA 4CP2A 2ADEA 1QQP1 4JTOA 2W1WA 2UURA 3ZYBA 2MEV3 2VM9A 4DXTA 1GYKA 1GV9A 4Q4X2 2MPFA 5BNOC 3VBSA 5JZGB 5LA0A 2RJLA 3BCWA 2JG8B 2E7QA 1RUG2 5LA1A 2B46X 3SCFA 2VL4A 2Y6LA 1HXS2 2AYHA 1C3HA 3MEPA 5DZEA 1BEV1 2DU1A 1RUC3 2HKXA 5A80A 1ENSA 4UFMA 1H2NA 3POJA 1LOFC 3ZR5A 4QXBA 3H9AA 2PAMA 4JGZA 1SLCA 2VTXJ 5T55A 5A1LA 1BVP1 1NKGA 2D7FA 3VHRA 2D6MA 3M70A 2PLV3 3VLBB 5FKCA 4BXSV 3WP4A 2L9LA 1GWKA 4QKFA 2WIIB 3OUHA 1OC1A 4LKDA 5FPBA 1G9BA 1J3RA 2P6CA 1F8VA 4BMBA 4WM8C 3WEZA 3I4IA 4PIXA 1XYOA 2XMLA 4FCAA 5CBLA 4LBQA 4Y3OA 1XSRA 3M3OA 4AI0A 1XNTA 3CDZB 4KU7A 1LOBA 4Y4RA 5FBJA 2P3JA 3ACLA 3AP4A 4ZHNA 3MLLA 1NAEA 3VDCA 3POGA 5FZ8A 3HNBM 2J1AA 3IMMA 4LULA 2GAUA 5LY2A 1JODA 3IIAA 2ENRA 5IJRA 3KCYA 2WO7A 2KXLA 1UIKA 2GNBA 3B7MA 3CL1A 1R64A 5IVYA 4Q1RA 1OD5A 4XXAA 4CCCA 2Q0AA 4IV1A 4Q4Y3 4XFIA 1RB8G 4KBBA 1OVPA 4CP9A 2ZX0A 2FDGA 4HFSA 2EIBA 2JEMA 2CWMA 4PQQA 2K2SA 3ILFA 2CGNA 4FAHA 5K0UC 2Q1ZB 1LGNA 1OQEA 2QJVA 2VCBA 4CZSA 1VBD1 2D6LX 4E9KA 3OPWA 2CGOA 2NM1A 1PIV3 4JTNA 4WVMB 5DUVA 2BWAA 4CUBA 4DXZA 1PZ9A 4IW3A 1QXRA 2WABA 5L73A 5AFEA 5FZ0A 5DZFA 4GAZA 1S1AA 4NUBA 1D2SA 1HLCA 1A3KA 2BWCA 1LGBA 2PFWA 3PJYA 3PVBB 5ANQA 1ZVFA 2IVIB 4GMP3 4EN9B 3CJXA 1SDDB 5A3LA 3NKGA 3VBHC 4YW3A 2EICA 3EB7A 5A70A 5BNPB 2WZ8A 2XHKA 3P1IA 3WQ0A 1DBNA 4FFHA 2YC0A 4CEWA 5ABJC 2G9ZA 2VXJA 2LTNA 3MLJA 3B9CA 1AR91 4N7IA 1FPN1 2B9UA 3VZOA 3MI8A 1ND2C 4GH4C 4FQZA 4CDWC 5BV6A 2YHJA 2HWE2 2PHWA 4FT8A 5I91A 1Y43B 3V0AB 4EE2A 3CJIC 1POQA 2J1TA 5L9RA 3R05A 5L7OB 2EALA 1WCSA 1O3TA 4Z07A 4XF0A 1SPPB 4LO4B 4HG6B 3KLSA 1RUH3 5LWBA 1AYN3 4AAPA 2CDPA 2HH9A 1SLAA 5FO8B 1V6NA 3URFA 1PO23 2V4AA 1ZBE3 4PDWC 2Y33A 1ULOA 2NN8A 2OUJA 4XMAA 3UGFA 3WZ1A 2ZHKA 3BOWA 4FP2A 2Y34A 2ZEWA 1R1ZA 2TNFA 5IK5A 2YPJA 4FTSA 1VE0A 1RUD3 4DRVA 1AR83 1GQPA 2D5HA 3DN7A 3I8TA 4ZU4A 5JOYA 4CU6A 4QPGB 3VDDB 3N4MA 4PIYA 4A2UA 4AEDB 4IL7A 1VMFA 3IDEA 4RGGA 4LE4A 4AWDA 1N1SA 2E6VA 3VBFA 1W9SA 4QD2A 4B8EA 2FMDA 2JDHA 2MEV1 1VRH3 2W47A 3ZFGA 4WVZA 4QDSA 5IAXA 1F15A 4L11A 4YW1A 3O1VA 1ZA7A 1BQPA 2UWAA 1PZ8A 3GZUC 1UNBA 4QX1A 4Q8KA 1W9TA 3T4VA 3WY6A 4BM8A 5IWFA 4BXFA 4HVQA 1ULGA 4CP0A 1LHVA 2QQPA 4AFMA 2VXRA 2WFF3 2HWF1 4U36A 2X5IC 4FPCA 2VZ3A 1UQXA 1RUC1 2AACA 4LK7A 2VUAA 3I2KA 4IV3A 2ZMKA 4UOJA 1OFSA 1W6OA 4LOTA 4L9BA 2C6SA 2PQQA 3N9NA 4UBGA 2R7EB 1OLQA 4MH0E 2VMCA 5A7WA 2FDKA 1QJY3 4AI3A 3N9PA 3ZFFC 2C26A 1UXZA 5EQUA 1MZFA 1YIPA 3Q8CA 5FZIA 3S30A 1U5YA 1GOHA 1JXNA 3I3DA 3PNAA 2D93A 3VB9A 1JUIA 5D1IA 5KXCA 4V1PA 1C8M2 4DRRA 1AL22 2P4EA 4AXOA 4EZHA 5LZ6A 4C0HA 1LCLA 1V6LA 1Z78A 3LD8A 3LSEA 3FHIB 4XZUG 3ZXFA 1UWWA 2C24A 3EJKA 4DZGA 4SLIA 4TN7A 1R092 1QOOA 1I9RA 1OD3A 3BN6A 5APAA 3NV4A 4BH9A 4EN6B 2XJRA 4KG8A 1AUYA 5FP9A 3AKRA 3OPZA 1TME2 1APNA 2V5DA 1H1IA 4AE2A 3VBOA 3IZOA 3B9IA 3CF6E 1NA1C 1PVXA 2QZ3A 2RMU2 1NLRA 1HRI3 5KC6A 3KZ4C 4ZS2A 3KGZA 4Q4Y1 4OHXA 2J1UA 1CAUA 5ERLA 3N9MA 5GZEA 5LBBA 4CEYC 2HEVF 2DFBA 3A21A 4MYEA 3CKHA 1UXXX 1OKOA 4Z8BA 1AXYA 2GU9A 3MFAA 3LKJA 1QJFA 4YYOA 2VW0A 4ASMB 2UU8A 2Z4FA 2WN2A 3P3NA 4HVOA 3PJQA 1XE8A 4N9HA 2WUHA 1DIWA 2GNDA 1C4RA 1PIV1 2GNMA 4NHYA 4NN0A 5C3SA 2Y6HA 3APBA 1CONA 2VBBA 5FXZA 3Q8EA 3HBZA 4Z92B 4G9SB 1POV3 3BIWE 2BNMA 2EXJA 2I45A 4N53C 5E1RA 5B4XA 5C4WA 2X10A 1VBB3 4HBNA 3ZYRA 4RR3A 1JZ3A 1EV12 3ZDVA 4B29A 2FDJA 4OHWA 1JBCA 4OCTA 3RWKX 1KQRA 2ZGTA 3CHXA 3VHOA 4XAEA 4Y26A 4OVEA 4JDNA 3HR9A 4AW7A 2YFUA 3S6PA 1MS8A 1RUJ2 3MBWA 3WNPA 4A6OA 4AFBA 5F7UA 2Y64A 3WW1A 2XDVA 2HLEA 1OBNA 1OMIA 4B1MA 5HV0A 2K0GA 3RYRA 2YV8A 3THTA 2DUOA 3PHMA 1LULA 1US2A 2XL7A 4DXSA 2XG3A 1BBT2 1CZSA 3VBUC 3RMXA 4LKFA 5KR7A 1NCRC 2GH8A 1UU4A 1RYYA 2YGMA 5FPAA 5L9BA 3ZYFA 4CDUA 4IXLA 4XW3A 5BNNA 3DKWA 1AR63 1K5JA 1FNYA 3T2QA 1KJLA 3MDPA 4JV4A 3T4HB 3LB9A 1IOAA 1UIJA 1IS3A 5FYMA 2JDAA 5LK5A 2VUDA 3C7FA 2WZR2 3QH7A 1PO21 2PTMA 4QX8A 3VBRA 5A33B 4PI0A 3ZIXA 5CADA 2E9QA 3EO6A 2CY6A 4KWJA 4QT6A 1RUD1 1UX6A 5LEKA 2H0BA 4NPMA 1DLLA 4AYUA 3RSJA 1RUI3 1UOJA 5FZ7A 2P6HA 4LIUA 1U5XA 4K20A 3KGLA 1R1A2 1ZBA3 4FQ4A 2ZGRA 1Q43A 5J09A 3NNGA 2RJKA 5FY1A 4NIAA 4NO4A 1ENXA 3OBRA 4DUWA 1R082 1C5HA 3SH4A 3UK9A 1ZZ7A 1VRH1 4DIQA 3QLQA 4RL7A 3GNEA 5FYSA 3OD0A 5A32B 3PUAA 1BXHA 3AK0A 1PM4A 3N9LA 1ZYBA 2ZXQA 5JR2A 5A3UA 4QGNA 1J83A 1V6KA 5BNOB 1Y9GA 1UF2C 4IEVA 1I5ZA 1L7RA 1ALYA 1TMF3 2A71A 1JHJA 4LBQD 4QMAA 5AC93 1RINA 2B5HA 4AG4A 1ZNPA 1S0CA 3WNMA 1W05A 2EF6A 2R062 2ID4A 2VUJA 3RNSA 1MPXA 1S2EA 3OGRA 2ZMNA 5FZHA 5C3RA 4RFRB 1T2XA 4Y5SA 3VD4A 1YI9A 2HBTA 2WO3A 5T52A 3VKMA 4MSVA 4KH9A 1FMD2 2DYCA 2XJUA 4BZ4A 5FOJB 2YMZA 4Q4W2 1PO12 2ET7A 3D8CA 3AP5A 3R4SA 1OOPA 1BHGA 3VZKA 3O0VA 2GP3A 4NRMA 5BNQA 1VLNA 4WM8B 4EWDA 5C9AB 4C90A 2QNKA 2ZABA 2CSGA 1KFUL 5FJKA 2JB4A 3NJZA 2YG0A 2EIGA 3TRSB 4COZA 3GHNA 3S5AA 2VVEA 1UX7A 3K51A 5JDBA 4XVHA 4DOUA 4Y1YA 5D21A 5HCHA 1WW6A 2ZEXA 4M3CB 2VU9A 2ZGSA 5FPLA 5A3MA 3WSOA 1DQ2A 1OUXA 1BYHA 1CAWA 3DXUA 3PTRB 1G7YA 2GN7A 4N7UA 4FOYA 4S2FA 1IQDC 1V0AA 2R1BA 3E6BA 1LHNA 4YRDA 1D4VB 3AXEA 4BLJA 2R041 5FDBA 3IN9A 2HEWF 1NY72 4S2GA 5FYYA 1Z0HA 1HN1A 3PUIA 4B4QA 2DCKA 3UYJA 3EQEA 1IS5A 4RQPC 3ZXAC 5K0UB 5DDJ1 2AH2A 2BZDA 4RHV2 4CXYA 2DF7A 1WWYA 4P00B 5FTTC 1V6JA 4UF0B 4QU2A 2WS91 1QJY2 3WDVA 1W06A 1UY2A 2VMGA 3A0KA 3QACA 1T6BX 5G04L 5CFCC 3C2UA 1NLQA 1J1TA 3U37A 4CDXC 1VBB1 1LOEA 2DV9A 4CCDA 4YG3A 4Q2FA 2OT7A 4C8DA 2VGDA 1SDWA 3SQOA 4LO8A 4GXLA 1CESA 4I3GA 1LR5A 2WSUA 5GALA 4CCEA 2D6OX 1HB3A 3NW4A 2NMOA 3FE5A 4DPNA 3AFKA 2J22A 3LSDA 1N3QA 2IXKA 4ZU5A 1BVVA 1YFYA 2J1RA 2WWUA 2MNGA 3SCHA 1O4TA 3RWNA 2RE9A 4Q4V2 2VQUA 4JC1A 4XJUA 3ZYPA 2QFEA 2OW4A 4YVSC 2YFZA 3UV9A 1F31A 1XXNA 3DEMA 2WDBA 3ZYJB 3RMYA 3KQ4B 1ND2B 4GH4B 4MADA 1MVQA 4CDWB 3PUHA 3LE0A 4MGSA 1W99A 1W0PA 3O1TA 1LEDA 3V64A 5D8AA 3U14A 3ZXLA 2D43A 3CJIB 3WNLA 1W6PA 3F95A 4LO6B 4XDOA 1OQ1A 1SFPA 1NG0A 1EAH1 2ADDA 2WAOA 2N7GA 2JG9C 1SLTA 1UW8A 5FBZA 5I0SA 4S2HA 3AKTA 2CU5A 2DU0A 2DVDA 4DO0A 3WNKA 5BNPC 1B09A 1EYBA 3ALQA 4ES8A 1CVNA 4PLNA 5FIXA 1H8TC 1ND3A 1SLIA 1YEWA 4Q4X3 3SEPA 4F3JA 2NP0A 1O5UA 4PDWB 3LA2A 2Y6JA 4DNYA 3MZHA 3KSCA 2VQTA 3LF7A 4ORFA 1PGL1 1RUG3 1RUI1 3OF1A 4YVWA 1OURA 3SNMA 3W5NA 1UO9A 3KHBA 1RITA 1JU3A 5GLWA 1SCSA 1HXS3 1UU5A 1C1FA 1WBLA 3VN4A 3PURA 4NAMA 1CPNA 4HANA 5EXOA 1DGLA 5FO7B 4GJZA 2ZZJA 3I2OA 1WCKA 4GWJA 5CFDA 2AC1A 3K4ZA 4LHSA 5DAQA 2SBAA 1W9YA 2VULA 1JYWA 1TMF1 3RGBA 2BJSA 3HQRA 1V6OA 2WT2A 1MQTA 3H0OA 3JBG2 4PQ9A 5A7SA 4CUCA 5AC91 1LJ7A 2Y8KA 3D3AA 4IV1C 3OD4A 3OBTA 1URXA 1X8EA 3UKVA 4AEDC 2X5IB 5H9PA 1XSQA 3ASIA 3TBDA 4BLIA 3NJXA 1VBE1 2MHFA 4JHZA 2RS12 5C7GA 5KHGA 1GQHA 5I8TA 3ZX7A 1BK0A 2GDFA 4BDVB 4Q29A 3ZFFB 1UZWA 3WNXA 1OSGA 3ZSKA 5J36A 2F4LA 5GZDA 4ZZ8A 4HPKB 4D8MA 5JLVA 5H9QA 1UZYA 4YW2A 2LRPA 4N9IA 3WUCA 1D7PM 1J3QA 1NQDA 2Y0OA 1S2BA 3I2HA 5DUWA 1K42A 5FQ0A 4JRAA 1SBEA 1KEXA 3D0JA 1IG3A 4CDQC 2A6WA 2Q1FA 4NHXA 1PVC2 5FPUA 4I0BA 1LESA 2V5YA 1D0HA 3ITQA 4ZU7A 3CO2A 1K3IA 2XLFA 4XJWA 5EV7A 4AL9A 1W39A 3ZKUA 1I3HA 1W2TA 1K5MA 2QQUA 2UY9A 3H50A 4ATEA 4B1LA 3A4UA 3ACIA 2JX9A 1EUUA 3OEAA 5T50A 5HI0A 4GA9A 3LDRA 3KT7A 1NA1B 1LU2A 2QUOA 5KC5A 3POSA 1S0BA 3KT1A 1XB9A 4MG2A 3ACHA 4XMIA 1AJKA 5LBEA 3MF9A 5FK8A 5T5PA 4CEYB 3DV8A 4QPIC 3ZN6B 1W8ZA 4I3PA 1F5FA 4DFSA 2QQOA 4LKSA 1XQNA 5F37A 1VB4A 3O1SA 3W58A 3NQHA 2WNVA 4A7ZA 4N43C 4AVCA 4IEPA 1JMUB 3Q9OA 4GB32 2OA2A 4NROA 2C0ZA 4XETA 4OQ9A 4URAA 1RXFA 4YNIA 2XJQA 3V65A 5IFTA 1B35B 5F8PA 3MUY1 3VZMA 5FXXA 2YU1A 3GBGA 1UL9A 3GXUA 5FYVA 2WNUB 3SH3A 1FV3A 4LBLA 4BMEA 4N53B 2HWE3 4HSLA 5CKQA 5DN2A 4YPJA 3MF6A 4LORA 1CZTA 1ENRA 1U12A 2OVUA 1QDCA 4BE3A 5GLTA 3GM8A 5J96B 4QDQA 2D97A 4XCAA 4BYYA 2B45X 1JZ7A 4W6XA 1C5IA 5A7OA 2O8QA 1BLZA 3VBFC 2WBKA 2PN5A 3FL7A 4P9JA 1WLWA 4TXWA 3WDXA 2V72A 1G9CA 1IPJA 5J3UA 4M0NA 3TN91 1VBC2 4IETA 5A6ZA 5BYNA 1FV2A 3FJSA 2ZX1A 2FBEA 5I0UA 1NCRB 1NCQC 1YFXA 1GSLA 4C0BA 1IZ3A 3ST7A 1SBFA 1UKGA 1GLHA 2BRTA 4XUNA 5DG2A 4YSFA 2OX0A 2AZ5A 4PCRA 4IV3C 3ENRA 5EJ3A 4AK3A 4DUVA 5F1RA 3DPRA 3ZLIA 5IK8A 4NE9A 5C3QA 2DBNA 3GGLA 2Q5TA 4FPKA 3AYDA 5JOXA 2FHRA 3Q8FA 3RYPA 4BQ5A 5J7MA 1F5JA 4Q4X1 3FLRA 4ITCA 4LMFA 1XNAA 2VOKA 1GBGA 5EP9A 1W8OA 2JG8A 2P3YA 4GIQA 4KGQA 4WBBA 4YLZA 1W90A 4WVWA 3JUUA 4URTA 2JD4A 2R072 3AZVA 1GP5A 1PGW2 3B01A 2VE1A 3ZXGA 4Y20B 2BGPA 1MR5A 3HEIA 1JYNA 2O1QA 3NNFA 4CCOA 1WGPA 1M4WA 4BQWA 2JKBA 2WYSA 1GZCA 5FZ6A 3VDBA 4XURA 5FZDA 3RJ2X 1VJ2A 4CU8A 1NZIA 1TEIA 5FV3A 5C8CC 1FT9A 4X6QB 2DWRA 1RXGA 3JXSA 3LIHA 3PTYA 4LOSA 4L2NA 3AZYA 1NYWA 4XE9A 3SMHA 1H1AA 3VBOC 3SHRA 4UAPA 4LJHA 1TE1B 2YPDA 3R6SA 1GZTA 4ARXA 2F4PA 3FBYA 3DGTA 1GZWA 1A34A 2A3XA 3N3HA 1C8M3 2IFRA 5A6XA 4PT6A 1AL23 2D44A 1O3SA 5GM0A 5FJHA 1AR72 1CAVB 3M3CA 4AEKA 2JICA 3B00A 3OGVA 4PLOA 4Q27A 5FZFA 1R093 5A3TA 4P9IA 1PX4A 2E31A 3WOGA 4GULA 4NIIA 2O14A 4NRPA 4BHPA 2DVFA 1AVBA 1TME3 1LGCA 1JHNA 3FN9A 1KDKA 5FZBA 1HRV3 2RMU3 2XONA 3ZPYA 5C4WC 2Q30A 3AL5A 3H42B 4MV2A 4A3ZA 4AGGA 3ZM8A 4HK9A 2ORXA 4QM8A 2D3SA 1OF4A 4BK5A 3OB8A 3S57A 3HJRA 1VAVA 4FPFA 5CNAA 5C3OA 1LOAA 4FFGA 2JDUA 3L9JT 4HVRA 1JOPA 1UY1A 4FXKB 1DGRA 3TOJA 1SLBA 5GKAC 1GOFA 4A7YA 4HT1T 4EV0A 4XF9A 5FZLA 1RUNA 1AX0A 1SMVA 5K7PA 2YBSA 1UY4A 2NQYA 1A6CA 1RUOA 3S7IA 4GWMA 2DUPA 3ZMOA 1Q8QA 4X8NA 3IT8A 1UZVA 5EYYA 1VAMA 2WNOA 1RUF1 4NPRA 3WHUA 3TEWA 5KXBA 1CWPA 3H8XA 2OIIA 2W5FA 1QF3A 2E63A 3CU7A 3M3EA 1EV13 5C9AC 4HL0A 4NIGA 2CL2A 2B9VA 2ZHLA 2XBO2 5LW9A 1W3VA 1IKQA 4A7KA 4YZ3A 5FWJA 2VCAA 3A23A 3RS6A 1RUJ3 1UPIA 2JKXA 4R9BA 4Y33A 1LU1A 4RQPB 1JI6A 4FPHA 5CIRA 3V0BA 4QPYA 5H9RA 1E57A 3A7QA 2PXJA 4O7XA 1OHFA 4U2AA 1COV2 4JQTA 4QGMA 1HV0A 1RC6A 3PU8A 4XTPA 1FAYA 3KD4A 4YG0A 5IW0A 4MOAA 4JX0A 3IPVB 1BBT3 5CFCB 1QJU1 5HXMA 2C9KA 5CVRA 5FY5A 4O9EA 4P9GA 3GALA 4CDXB 3KHCA 2OXBA 1VRBA 3M8LA 3N35A 3WF0A 3V0AA 3JD72 1UKRA 3OOXA 3EMRA 5L7OA 4JRLA 2D5FA 3K4AA 3M3QA 2EIEA 3VD9A 3VV1A 2R49A 2ZGNA 1SPPA 3NAPC 5JVVA 5T54A 4W50A 4I02A 5LRRA 2XJTA 2QQMA 2PYTA 2VBDA 4FO9A 3LGRA 1VBA2 3BIEA 4P5YA 5CU1A 4WM7C 4W8JA 3VL8A 3HOBA 4CTEA 4JDOA 2WZR3 2NYYA 3AM2A 1S0GA 3AVRA 5FZMA 1W6NB 1X33A 2IWGB 4GJYA 3K3OA 4YVSB 1WW7A 1RMU2 1ULCA 2VJXA 4QAWA 1J58A 5FZKA 4YG6A 5A1AA 1P8JA 3VUOA 2RDQA 4FPOB 1AX1A 1IGOA 1S55A 1SZBA 3IWZA 3M3IA 4KQ7A 4Q1PA 2V73A 1AJOA 3D0SA 4QPGA 3I3BA 5ANNA 3C7OA 1R1A3 3KV9A 3NJVA 2GC0A 2B39A 5A3OA 4Q0VA 3WW4A 4E4HA 1GANA 4TZDA 2QQVA 2JG9B 5CEHA 1R083 1XE7A 2HWD2 3PVNA 4JGZB 4AAXA 1S2KA 2V09A 4UFJA 2C4XA 5F39A 4H2AA 1H8TB 5FY8A 3LWCA 1GP4A 1OOPC 1D2QA 5LA9A 2D3PA 4L99A 4B4RA 5CA6A 5FYCA 3N7MA 2JIJA 4IE7A 3MIBA 1QXPA 1MACA 3WG2A 4D6QA 1X7NA 2RS32 2IXIA 3MIFA 4LKEA 2XOMA 3DL3A 4FFIA 4COYA 3C3VA 2PHTA 1N3OA 1QJX1 4QKBA 5FYZA 2R063 1DDLA 2ZJCA 1SG3A 2BGOA 4OQ8A 5EJZB 3SITA 3JB8A 5GZCA 4HKWA 1IQAA 3FWEA 3O12A 1FMD3 1CPMA 3T3YA 2VNOA 4ZONA 2GMMA 1PO13 4Q4W3 5JR7B 1SBDA 1NT0A 4AFCA 4ASKA 4Z2AA 5BUVA 3WW3A 1IPSA 3N36A 4LHLA 1QEXA 4DEVA 1MZEA 4R52A 2EXIA 4WZFA 4JKLA 4E2SA 1JU4A 2CAVA 1C8M1 4IV1B 1Z7S1 4M4RA 2KA3A 4CP9B 1YUDA 2ZMLA 2A7AA 4YW4A 2BYVE 1MS5A 3I59A 5CAZA 2WLQA 4CU9A 1R091 3PIGA 4K7JA 2J1SA 3S5QA 3RVHA 3ZO0B 1T6GC 4D69A 1AYM2 1Q56A 1Q8VA 5AFBA 1TME1 4RS5C 2ZGQA 3IDBB 1EPWA 5C5UA 5JAXA 1JUHA 4XDPA 1K12A 1KFXL 2C1FA 2RMU1 4M4PA 2RVAA 4FPLA 4QDRA 1DHKB 5E8AA 4X6RB 1YI7A 4QKNA 5FY9A 4GKYA 5JPNB 1AL0G 3AXDA 3B69A 3BGAA 5JCTA 4CDQB 4KWLA 4YGBA 4OYUA 3UESA 2VW1A 1JZ6A 5FY0A 5BY5A 4RHV3 4UFLA 5BXXA 3QBQA 2C5DA 2E7AA 4Q0PA 4YARA 4KGGA 2LROA 2PLV1 4P5HA 1PK6C 4LBKA 4NRQA 4KL1A 1W6QB 5IYYA 3Q8AA 5I93A 4R4ZA 2ZGPA 5DAWA 2ES3A 4AHYA 1EV11 4QQHA 4QX2A 5D8AC 4NMIA 5FCCA 2XJVA 2HYKA 2VZVA 2QQWA 3I2FA 4CCJA 2WSVA 4QPIB 5F3EA 3OGGA 3VKOA 3MGUA 2CGPA 2W91A 4UYBA 2YGLA 2H0VA 4BB3A 4LK6A 2HWC2 2ZCWA 1RTVA 3NV2A 1XBFA 2A3WA 2FCTA 4N43B 2GMEA 2WJSA 3MO4A 2VUCA 3ZPOA 1ND3C 2BERA 4Q4V3 4AVTA 4XF1A 5FLHA 1XNCA 4LTAA 1BBT1 1HRV2 4XIOA 4YW7A 5FPXA 1O3RA 2ORZA 2E53A 3KF3A 4F83A 4P9YA 1NE6A 3ACGA 2Q8OA 4Y5Z0 3AJZA 1WCDJ 3K2OA 5IVEA 1ZRRA 2QQLA 1KS4A 2JDZA 3K75B 3KV4A 3VBFB 2VVFA 3NWKA 3ZFGB 5A33A 5DXDA 2P34A 3MPPG 4FBFA 1SEFA 1BMV1 1B35C 1S0DA 3LFIA 3RRDA 3VGIA 1O91A 5FUIA 4UW6A 3HWJA 2WNUC 4INDA 3KS7A 1AZDA 1NCQB 2DTYA 1QJZA 4XHBA 1R1A1 2WN3A 2WZPP 2HWF2 5FMOS 3KF5A 5LEJA 1HKDA 3LDKA 4GMP1 1VMHA 4RFT0 3HAGA 3NMBA 1G9FA 3JCIA 2VH9A 3O14A 1R081 2DCJA 4IV3B 3RZGA 1W6OB 3J8F2 2I07B 1LB2A 3MPBA 5CZKA 3BVCA 1DZQA 2VMDA 5JXGA 4EROA 3MFCA 1U0AA 1H8VA 1W03A 4XJZA 5FZ9A 3IAQA 3HMYA 3VD7A 3JBG3 1C57A 3JB4C 4AR2A 2JDKA 3C7HA 3ETPA 2JE7A 5F9TA 1GNZA 4P9WA 2R061 3FX3A 1QU0A 3FUOA 2XUEA 5FZAA 2XVGA 3ATGA 5LK7B 1G6NA 1RUH1 2YBKA 3SKVA 4OZXA 1LOFA 2JWPA 1AYN1 1DYKA 2Z69A 3FHQA 4I30A 4RA0A 5K4LA 2RS13 4IE5A 5JI7A 1OPMA 1KGYA 2EAAA 5DABA 5C8CB 1PO11 5GZGA 1ZBE1 4TLGA 3LPGA 1QOSA 3OY8A 5GLUA 3VBOB 1OT5A 4DEQA 4YGEA 2PHDA 5JMOA 1RHI2 4AQTA 1UYPA 1AR81 2I74A 3EBRA 5F3IA 4COVA 3E5XA 4ET7A 4XQ4A 4WM8A 2XXZA 4YGDA 3ILRA 3ACFA 2Z79A 1PVC3 4YWAA 4MVTA 1N1TA 1US3A 2Q8CA 4CP1A 1S0EA 5IK7A 2QE3A 3WW2A 4YM1A 2XKPA 3GCXA 4FAGA 4EJRA 2LS6A 3DKQA 4OMCA 4LHNA 5ACA2 4HK8A 2Q4SA 1AXKA 2WFF1 3KWVA 5H9SA 5C4WB 4IGOA 5EFUA 2JDPA 4JQRA 4LLFA 3H1YA 1ZZCA 3T09A 1NY71 1W2NA 3POFA 3WDWA 2A6YA 3FFZA 3K48A 1K45A 2X53S 3WF2A 1D0GA 1QDOA 1JOJA 1VR3A 4Y24A 4BA6A 1EUTA 3ON7A 2F17A 1VB2A 1ULEA 5AVPA 1I6XA 4UF0A 2VZ1A 1ZZBA 4O65A 1QJY1 2VMHA 4GB33 2D40A 2YB7A 1M06G 4BQYA 4EN8B 3NJYA 3LOIA 5C70A 1F4AA 1XU1A 2WYFA 2VMFA 1ULFA 1SFYA 2W9XA 3LQCA 1DZRA 3T30A 2NMNA 3ZKYA 2QKDA 2YC2A 2XPJA 3DECA 2DVAA 4KI5M 3OBAA 3KMHA 4LXLA 2FZ2A 3VBHA 1HJGA 1X9PA 2OQ6A 5IT6A 1OKQA 1QNYA 3MW2A 3UJOA 2AGSA 3UETA 4Q4V1 3T08A 1RVF2 1VAKA 5ABJA 1IG0A 1XC6A 1UMHA 4K1ZA 1VBC3 1YQ5A 2ZS6B 1HRI1 4WZCA 1ZZ9A 1AXZA 4Z82A 1ND2A 5LATA 3ZFEA 1JYXA 2DUQA 2VVDA 4QXCA 1CZVA 3ZSEA 1MZ5A 2BVBA 2ERFA 4YZ2A 2DVBA 2PMWB 4MZUA 1ZRCA 3CJIA 4FPGA 5CISA 4CUGA 2CAUA 1UY3A 3LEGA 1D4M2 5A7NA 5FZGA 3NV1A 2BP6A 3CLPA 2VPVA 5KBFA 1MS0A 2TEPA 3NAPB 4C1WA 3H3LA 2XJSA 1STMA 1HN0A 3EHKA 4WM7B 4B7EA 4MGQA 1X8MA 3I54A 3I49A 2QTWB 5D2AA 2DFCA 2IVJA 4PDWA 4XHXA 3J26N 1WBFA 1POV1 1OLRA 2BFUS 1CN1A 2R073 3K77A 5JXHA 1QHDA 4OI0A 4QXHA 4QX0A 1WKYA 3AKPA 4XTMA 1J84A 3KVAA 3OSDA 1HDKA 4J25A 5FYHA 3SCGA 1RUE2 2R30A 3DYPA 3G7DA 1OVSA 4BK4A 1E5HA 5A1FA 1JZ8A 5C5TA 5B4NA 1OA4A 2HWB2 1H2LA 1KRIA 5GLZA 1MEC2 2ZGOA 4MHRA 3OGJA 2W1UA 3VBSC 2XHNA 2ZX2A 4BOWA 1QGLA 2ZAAA 4DXRA 1OOPB 2BVVA 4BISA 3BYWA 1X82A 1YFUA 4QQPA 4CU7A 4P9LA 3O1PA 2W46A 2B7YA 4XOGA 1MVEA 1N1YA 1AR61 4Y4YA 2X5IA 4QX3A 1E5IA 1ZZ8A 4QU1A 1EY2A 2VOVA 4UW4A 1AR73 3HD8B 2QDNA 4LA2A 4NPLA 1OPOA 1Y4WA 1SFNA 1XYNA 2JB8A 4JGZC 2RS11 3ES4A 4ZXKA 5C71A 3AYEA 2RHPA 2R0HA 2VCMA 1VP6A 4IESA 2J1VA 4NHMA 2RS52 4P02B 4EN0A 2O8OA 3U4XA 1PX3A 1H0BA 4QQLA 1CX4A 1BK1A 1H4GA 3ZFFA 4AHZA 1CAWB 4CUAA 3U07A 3H8OA 5F5IA 2X8KA 2JENA 4CXXA 2YUEA 1DU3D 4J1XA 2KR2A 5I0TA 1W8WA 3MV11 3TEXA 1ZBA1 3J7NA 4NR1A 5I0DA 4QKDA 4UI9L 2R042 4IEUA 3HNMA 1H30A 3ZOIA 2P2KA 3HN1A 4RSUA 1CAXB 5TSWA 1H6YA 5DDJ2 1AX2A 3PIJA 4K1YA 4E8DA 4Z1VA 3IMNA 2B8MA 4XJ8A 1FI2A 2WS92 3WV6A 4RS5B 1DF0A 1YC61 5HCAA 3GCWA 1LAJA 3O1MA 3E1F1 5DAXA 3CNAA 1NA1A 3WDUA 1LHWA 4GWIA 1GICA 4MXWB 4JHTA 2DTWA 2IXHA 2WNEA 5T3NA 2DURA 4FOQA 4OULA 4BWOA 4CEYA 4K6BA 3FBMA 4JGYA 3ZN6A 4AI8A 3UNPA 2XBO3 1V6MA 2UWBA 2AUYA 1WMFA 1YJLA 3F2ZA 4GKXA 3WG4A 5CKMA 2AR6A 4IGQA 1WUVA 1WW4A 3I2IA 4W65A 5EYXA 2RR12 4MGYE 2ARCA 5SV8A 3WNOA 4LIVA 3T1LA 5FZOB 3RZLA 4GB31 1MS9A 3T0AA 1COV3 3SC7X 3CEWA 4FPJA 2RG4A 4IE4A 4NHKA 2A73B 2VZUA 3EYPA 3J4UH 1XNBA 4OHVA 2FDFA 1PK6B 4D7TA 4GQ7A 4ASLA 4DUXA 1Q8OA 2QCSB 4N90A 3OYWA 4RD7A 5HV4A 4N53A 4XILA 4Y1UA 2ZHNA 5D8AB 2VOWA 3JD73 5FYBA 3OEBA 3PUSA 3RFRA 2YYOA 2ZA9A 4A42A 1GNHA 1EAH2 3C7EA 4BQ2A 4ZS3A 1UU6A 3KQRA 2G1MA 2ZKLA 1GWLA 3KCXA 2R0FA 3HN3A 2DCTA 4CEWC 1J3PA 3WDYA 1JN2P 1VBA3 4XUQA 3H8RA 4CRQA 3THDA 3PMSA 5HXVA 4I2OA 1O4ZA 1ND3B 3H7YA 4QB2A
chains in the Genus database with same CATH topology
4FP3A 1GKBA 1S0IA 1RMU3 5F5QA 2BEOA 3VBUA 1PGL2 3ETQA 4YM0A 1NCRA 1BKZA 2D6KA 3RYKA 2Z42A 1J59A 4DMIA 5FFOC 4AVSA 3N7JA 4FXGB 1JYCA 4QQOA 2LALA 4WVVA 2HWD3 2XVLA 3UL2A 2A5ZA 3O0WA 1OQDA 5HBAA 3MIHA 4AGVA 2XUMA 5KXEA 1O3QA 3OTFA 4UW3A 3WP3A 5B2GB 5FPZA 1W6MB 1PGW1 1V70A 3HT2A 1MS3A 1JTZX 2Y26A 3WX5A 2ZX4A 4HSJA 2RS33 1DFQA 2PHUA 3QCWA 1LODA 4LHKA 1VBE2 2VECA 1QMJA 2SLIA 4NOTA 4D7SA 1KXGA 3ZFGC 4AEMA 2A70A 2Q1MA 2EXHA 2NLRA 1YFWA 3WP6A 2G9GA 4NVPA 5I8SA 4BPZA 5GJ6A 4Y22B 4H7MA 3AZXA 2PHXA 4DY5A 1HW5A 3D4KA 2WQ4A 1JH5A 4FSJA 1FNZA 5SV5A 2BPA2 1AR71 1CAVA 4LR4A 4R4XA 3MW4A 3WUDA 1VBD3 2IXJA 1AYM3 3M1HA 4QM9A 1Y7BA 1QKQA 1Q8PA 3NSTA 4E2QA 5JZGA 5JOWA 2BNNA 4XF4A 5FOBB 1RUG1 1ZZ6A 2LUWA 3N7LA 2XLAA 1HXS1 5F6LB 2XL9A 1YHFA 1OA3A 4GALA 2W39A 2GNTA 3H8UA 2AREA 3OCPA 3POYA 1JW6A 4QXKA 1REDA 4E4SA 1W2UA 1V9U2 4O9GA 4YGCA 1H9WA 1IPKA 2NPIA 1NLSA 1U5ZA 1YXWA 1KJRA 3QOPA 2QVSB 4FVVA 4HN0A 4PJYA 3ZN4A 3ZSJA 3WP5A 3WT3A 3X29B 2LM3A 4XFFA 5GZFA 2W08A 2VY0A 4AEJA 2P17A 2WQZC 1XYPA 4K9SA 4KWKA 3POWA 2XBO1 3MYXA 1KD7A 1LECA 1FOD2 3ECQA 4LEJA 3U10A 2ARXA 3GZTB 3AP9A 5I8YA 2HWC3 4FOWA 1RGSA 4MUVA 3VZNA 3VL9A 3ES1A 3ZN5A 5I0RA 2ZHMA 1ASJ2 3IPVA 4OI2A 1QOTA 3FLPA 5CFCA 4CDXA 2RM22 3LOBA 4RR3C 1LRHA 1LHUA 1DYPA 1O4YA 3S7EA 5FO9B 2A6ZA 2FQPA 1BJQA 4Y1VA 4QGLA 3VHPA 1DGWX 4BCUA 3KM5A 1F2NA 1G8WA 1Y9QA 1VIWB 4XXPA 3VHNA 2PAKA 1VBA1 2EXKA 4OLLA 4M0HA 5GLVA 3GF6A 1W6NA 2BNOA 4WVMA 2YY1A 4YVSA 1SQ4A 1ZA4A 1RMU1 3BPZA 4GWNA 4TSVA 4AHXA 4PBPA 2ET1A 5EWSA 3ZMNA 1HQNA 1SLLA 4CDUC 2WWSA 5BNNC 3A0NA 1GZ9A 4MXVA 2HWF3 2ZZQA 2E7TA 3LCPA 3NL1A 2JG9A 4P14A 1OI6A 2HWD1 5BNPA 3J8F3 1PHMA 1H8TA 2JXAA 4JCKA 3VBRC 2WA4A 3ZSMA 3D6EA 3ZXJA 3S0MA 4NHLA 2XJPA 3AFGA 4MGKE 2PHLA 4F7ZA 3H7JA 4E4DX 4ES9A 3MW3A 4JDMA 4XF3A 3USUB 2HWE1 3FMGA 1C1LA 1GZWB 4B3NA 2RS31 4M3CE 1UMZA 3O5SA 4LBOA 5J37A 5FMOL 4E2GA 2F6BA 3IM0A 3AKSA 4HN1A 2VMIA 4XPVA 1C28A 1QQP2 4XFCA 3IBMA 4L8QA 4R8HA 3WR0A 1YO8A 1DQ5A 1WD3A 3VBSB 2GMPA 4Q0QA 3T2TA 1X50A 3M7AA 4ISRA 1RHI3 3SH5A 4TLFA 1LTEA 3AMNA 3NO8A 4C1XA 1F9KA 3VDDA 4IEYA 1SCRA 4AEDA 2XWJB 2ZGMA 1HV1A 1BEV2 5C6CA 2EA7A 2G4IA 2ZACA 4B4PA 5C8WA 4WV8A 5FAXA 1AYM1 5L19A 2BBVA 1Q3EA 4UXAA 2G9FA 2ETEA 4S2DA 3TYJA 1DQ0A 1QY4A 2O0OA 4H14A 2WFPA 2A3YA 1RUF2 2XWBB 5ACA3 3ZXKA 4K40A 2GC1A 2JE9A 4ATFA 1H2KA 2A6VA 1HIXA 5AVAA 1AHSA 4XBLA 4AGRA 2XB6C 4CDQA 4LBQB 1DZTA 2YXSA 5CB7A 2IC1A 3LA3A 1V00A 3V0BB 3E97A 1J1LA 1WMEA 4OFGA 4AVAA 1W6QA 1FXZA 3HT1A 3ZFEC 1DQ1A 4AQSA 4A3XA 1QJU2 1PNFA 4J6GA 2ZBJA 2PHFA 4HLTA 3PVEA 2ZAHA 1AL21 2UYBA 3VKLA 1ENQA 2WT1A 3FLTA 4QPIA 1N1VA 3ZSLA 2HWC1 1PNGA 1VBD2 4N43A 4YW5A 3UKTA 1NZCA 4MX3A 4YFWA 1RVF3 2X29A 4DB5A 2IXLA 4OI1A 4MGIE 1PM7A 4OUMA 1HRV1 1ZRDA 2D98A 2XVKA 1KS5A 4OHZA 4D3WA 2ZGUA 2P3IA 1CJDA 4YM2A 1REFA 5JSRA 4BQ1A 1D4M3 1PMIA 4XJ9A 3MIDA 4IEXA 4XIKA 4D94A 4CEWB 2WA3A 1HQWA 1CD3G 1V6IA 4X8PA 5BPXA 1AR92 1WLDA 1FPN2 4IEWA 3AP6A 2GC2A 4XFGA 3WXPA 3EXUA 2Z2SB 3AP7A 4DQAA 2UY8A 1NCQA 2VOXA 4J1WA 2VQ0A 1NOVA 3SXWA 2XGXA 3IKWA 5JOZA 2K9ZA 1GR3A 2JECA 1QJX2 5JSPA 1RUJ1 1RUE3 5T5LA 5J48A 3J8F1 3E5QA 1BZWA 2HWB3 3HIFA 1MEC3 5DUXA 1H4HA 3ZIWA 2I2SA 4AQ2A 1C8NA 4I0AA 3WG3A 4YVWC 2OYZA 2BFUL 3WQ7A 2R1DA 5IK4A 1Z7S2 3LAGA 1G9AA 4FPYA 4LUKA 3I59B 4G4FA 1RJ8A 2H6BA 5E89A 3NV3A 2MEV2 5CFDC 1FX5A 2WZR1 5C8CA 3USSA 4XBQA 2RS53 2WLPA 4LNVA 5KHIA 4DS0A 4I01A 1RHI1 1MQTC 2HEYF 3PVOA 3BODA 1YNAA 2CYFA 2D3RA 4R9CA 1RJ7A 4EWAA 1W0OA 1XNDA 4JGYC 1CIWA 1TQ5A 2ZKNA 2R043 3H1MA 4E4ZA 1RUC2 2VW2A 4K8FA 5J98B 3LZZA 1IHMA 4XFBA 1H9PA 1WA4A 5DDJ3 3L2YA 5A32A 1L3JA 4G3YC 1X36A 4EWEA 3B94A 1YWKA 2WS93 5BNOA 3VKFC 2PLV2 3BU7A 2A6XA 5ACA1 1EP0A 3PMEA 5FREA 5KWRA 2DCZA 2ZPXA 3MIEA 3UJQA 3ZXEA 4OI4A 2BGCA 2P37A 2CV6A 1LHOA 3GYDA 1S0JA 4COUA 2RR13 1FMD1 1K5MC 1HX6A 4Q4W1 3OJBA 1CGPA 4AF9A 4HZFA 4DY3A 4YZ1A 3W9AA 4M01A 1LEMA 4W6YA 4XDQA 2BW8A 3ZXDA 3FZ3A 4Q4Y2 4UW5A 4KU8A 1CAUB 1BCXA 5KHKA 1H2MA 5C9AA 2AENA 4LA3A 2GN3A 4RGAA 2GZWA 4LE3A 3VZJA 3WDTA 3WQ1A 2WL1A 1EAH3 1A78A 2WNVC 1OA2A 3QD6A 3W59A 3I2DA 3JQWA 2A75A 4M3CA 1RVF1 5C33A 4D7YA 1PIV2 4XBNA 1BMV2 4XFAA 2IXCA 3TAYA 4YFZA 3M4FA 1XU2A 1JYIA 1QWRA 1NXD1 4C91A 4YZ5A 4RR3B 2GC3A 1D4M1 2OZJA 3ME2A 1I1EA 3NAPA 5KHHA 5K0UA 1A8MA 1CJPA 4RHV1 4M00A 1QH6A 5DG1A 1WLTA 1YIFA 4WM7A 5LRSA 4AFDA 1YRZA 2CNAA 2ZX3A 4W6WA 4ISQA 5E16A 2WKKA 4LBJA 1N47A 2BUKA 4CDUB 3SISA 5BNNB 4Q0SA 4GMP0 3KB5A 1RUE1 3TWIA 1OFNA 1O5LA 3DPRC 4Q0UA 1RUH2 1VBE3 1WW5A 3B02A 2HWB1 1AYN2 2OZ6A 1IKPA 4H7LA 1MEC1 1DGWA 3MLKA 1PO22 1ONAA 1ZBE2 3VBRB 3RZZA 5JZGC 3OY8B 2JG8C 1TNFA 4GH4A 1RUD2 3L2HA 4IQPA 1AR82 4CDWA 3KCCA 1HQLA 4I0WB 3D5OA 4LT5A 3AZWA 2CTVA 3FC0A 4K21A 5JPMB 3E6CC 3TNQA 1Y3TA 2Y38A 3O7OA 1IS4A 1DG6A 1LOGA 4YM3A 4HKOA 2ATFA 1VRH2 4AVBA 3FFQA 2RS51 3B93A 5CG8A 1UPSA 3RPQA 4L97A 5K9YA 1WD4A 5K8SA 2C9AA 4MLOA 4XYXA 1YYNA 2YZ4A 3WINE 4XQDA 5JIAA 2WFF2 4XJAA 3N7KA 5FRAA 4MGZE 3P3PA 2OUHA 3BTAA 5HCBA 5IUQA 4COWA 1CAXA 3WHTA 3E6DA 2VNGA 1V9U3 2VNRA 2TBVA 4QX5A 2UYAA 1LENA 2BTVC 2VQAA 5DUUA 4RS5A 3JQXA 5JI9A 2UWCA 3JBG1 3VKNA 4LLOA 4AI1A 4MXWA 1RL3A 3AJYA 5JMCA 2H6CA 1UD1A 4YZ4A 2OPKA 3DUIA 1SACA 3WCRA 2CWSA 2R32A 2DVGA 1FOD3 4IEQA 3VBHB 4BIOA 1ZRFA 2RR11 2VG9A 4IEOA 4NWWA 5KHJA 4DINB 4OUSA 5ABJB 4R9AA 3TN93 1PK6A 1ASJ3 1HRI2 2GSYA 2W68A 4HPKA 4FPEA 3ZFEB 1NQJA 3LA7A 5L36A 2RM23 3B5LB 3GHMA 5CG9A 2GH2A 1NXMA 3GBFA 5HCFA 1PVC1 1O7FA 4AI2A 2WINB 1UCXA 3RDIA 3AMHA 2HJIA 3U11A 3AMPA 3AKQA 3RI8A 1QNWA 2P3KA 2XH6A 3WLUA 3BOPA 4TYSA 1REEA 1U5IA 1RIRA 1QXJA 1VBB2 3BALA 4H3WA 4Q8LA 2PHRA 3AMQA 2D6PA 5L7OC 1FATA 1VALA 3VZLA 4Q26A 4L92A 1YLLA 2XKOA 3IDCB 3AZZA 1UZZA 1CR7A 2ILMA 3TB0A 1PZ7A 1AF9A 2ZGLA 3THPA 5EZWA 2QZ2A 3AX4A 1NE4A 3J9SA 4I09A 3E5UA 1B35A 1POV0 1W6MA 2D6NA 1Q5OA 1MZ6A 1UAIA 2WNUA 4QHBA 1G86A 4QPGC 3VDDC 3H3ZA 3QH6A 1YJKA 3NVCA 1AR62 2KM2A 1XNKA 1W6PB 2W0XA 4NWVA 3O0XA 3GZAA 3RJRA 1ZM1A 5FLIA 3B3QE 4QQ2A 1QQP3 2W52A 3INAA 3H1WA 2FZ1A 1N3PA 1PGSA 4XFHA 3RG0A 2WT0A 4K3UA 1ZX5A 5JSOA 4KNCA 1VBC1 3ILNA 4FOVA 1Q8SA 4Y22A 4AHWA 1ULDA 4PBOA 3MIGA 3R4DB 4EN7B 1RUI2 2DCYA 4KG0A 4YVWB 4IEZA 1S0FA 5T5JA 3HQXA 3ZDSA 1ZBA2 3ZVXA 1LOCA 4JVAA 3ELNA 4HETA 1MS4A 3ZYGA 1BEV3 3R0RA 3R4UA 3T1MA 3WG1A 3H3UA 3WD5A 1LKNA 4BIFA 5CFDB 2E51A 4HKLA 3JU9A 1TMF2 3V56A 1QH7A 1IS6A 1MQTB 2R071 2NZ9A 4PLMA 1DQ6A 2R16A 5AC92 1RUF3 4Y20A 1KDMA 3D82A 4JGYB 5JIUA 3BB6A 2ZGKA 4P9XA 3M2MA 4M3CF 1V9U1 5E88A 3SLIA 3RI9A 1KITA 2PA7A 2GALA 5F6KA 3UKNA 4B7KA 4H55A 4SBVA 4R9DA 3OYWB 1G9DA 1QJU3 2YROA 4LO7A 2IZWA 1DQ4A 5FQ0B 3TNPB 2JJ6A 4LBNA 4Z2WA 5FLJA 2R6QA 3AB0A 1FOD1 3AYAA 4E27A 1GQGA 4PIZA 1XRUA 3DF0A 3GBWA 2TUNA 1K5MB 3RQ0A 4PF5A 1ASJ1 4XZPA 3PLQA 3VBUB 3MICA 2RM21 1EPZA 3AMMA 4LO5B 2PELA 2YDEA 1YCIA 4LUMA 4XQWA 3ZYIB 5KXDA 4Y1ZA 3WCSA 2EAKA 2WNVB 4JAAA 3NKTA 5JWPA 4IERA 1FYUA 1H1MA 1WMDA 4TWTA 4UBHA 4AQ6A 1MS1A 4OHYA 2FMYA 2QDRA 2Y0IA 2BQPA 1AR93 3WVJA 1FPN3 1CQ9A 1A8DA 4HMZA 2EVXA 2ARBA 2ZOEB 1QJX3 4META 4LBMA 5T5OA 2PAEA 4RQPA 4AVVA 3JZVA 2WC2A 1GFF2 1UN1A 4CYDA 1COV1 2Z5WA 1ZREA 1WLCA 3TN92 3ROUA 1TNRA 2B42B 3USUA 3KT4A 1DGRN 4Y1XA 4ZKTB 3JD71 3FUQA 1Z7S3 3U0ZA 2ZTNA 3G6JB 3I7DA 5DZGA 2XLGA 4AFAA 3AYCA 4F8AA 2IFWA 3DPRB 4XEZA 4CP2A 1QQP1 4JTOA 2UURA 2MEV3 1GYKA 1GV9A 4Q4X2 2MPFA 5BNOC 3VBSA 5JZGB 2RJLA 3BCWA 2JG8B 2E7QA 1RUG2 2B46X 3SCFA 1HXS2 2AYHA 1C3HA 3MEPA 5DZEA 1BEV1 2DU1A 1RUC3 2HKXA 1ENSA 1H2NA 1LOFC 3H9AA 2PAMA 4JGZA 1SLCA 5T55A 1BVP1 2D7FA 3VHRA 2D6MA 3M70A 2PLV3 3VLBB 3WP4A 2WIIB 1G9BA 1J3RA 1F8VA 4BMBA 4WM8C 3I4IA 4PIXA 1XYOA 4FCAA 5CBLA 4LBQA 3M3OA 4AI0A 4KU7A 1LOBA 2P3JA 3ACLA 3AP4A 3MLLA 4LULA 2GAUA 3IIAA 2ENRA 3KCYA 2KXLA 1UIKA 2GNBA 3B7MA 3CL1A 4Q1RA 1OD5A 4XXAA 2Q0AA 4IV1A 4Q4Y3 4XFIA 1RB8G 4KBBA 2ZX0A 4HFSA 2JEMA 2CWMA 2K2SA 3ILFA 2CGNA 4FAHA 5K0UC 2Q1ZB 1LGNA 1OQEA 2QJVA 4CZSA 1VBD1 2D6LX 4E9KA 2CGOA 2NM1A 1PIV3 4JTNA 4WVMB 5DUVA 2BWAA 4DXZA 1PZ9A 1QXRA 5L73A 5AFEA 5DZFA 1S1AA 1D2SA 1HLCA 1A3KA 2BWCA 1LGBA 2PFWA 3PJYA 3PVBB 4EN9B 1ZVFA 4GMP3 3CJXA 5A3LA 3NKGA 3VBHC 4YW3A 5BNPB 2XHKA 3WQ0A 4CEWA 1DBNA 2YC0A 5ABJC 2LTNA 3MLJA 3B9CA 1AR91 4N7IA 1FPN1 2B9UA 3VZOA 3MI8A 1ND2C 4GH4C 4FQZA 4CDWC 5BV6A 2YHJA 2HWE2 2PHWA 4FT8A 5I91A 1Y43B 3V0AB 3CJIC 3R05A 5L7OB 2EALA 1WCSA 1O3TA 4Z07A 4XF0A 4LO4B 3KLSA 1RUH3 1AYN3 1SLAA 5FO8B 1V6NA 3URFA 1PO23 1ZBE3 4PDWC 2NN8A 2OUJA 4XMAA 3WZ1A 2ZHKA 3BOWA 4FP2A 5IK5A 1R1ZA 2TNFA 2YPJA 4FTSA 1RUD3 4DRVA 1AR83 2D5HA 3DN7A 3I8TA 4ZU4A 5JOYA 4QPGB 3VDDB 3N4MA 4PIYA 4A2UA 4AEDB 4IL7A 3IDEA 4RGGA 4LE4A 4AWDA 1N1SA 2E6VA 3VBFA 4B8EA 4QD2A 2FMDA 2MEV1 1VRH3 3ZFGA 4WVZA 4YW1A 4L11A 1BQPA 2UWAA 1PZ8A 3GZUC 4Q8KA 3WY6A 4BM8A 4HVQA 1ULGA 4CP0A 1LHVA 2QQPA 4AFMA 2VXRA 2WFF3 2HWF1 4U36A 2X5IC 4FPCA 1RUC1 2VUAA 4IV3A 2ZMKA 1OFSA 1W6OA 4L9BA 2PQQA 4UBGA 1OLQA 4MH0E 1QJY3 4AI3A 3ZFFC 1MZFA 1YIPA 3S30A 1U5YA 1JXNA 3PNAA 2D93A 1JUIA 5D1IA 5KXCA 4V1PA 1C8M2 4DRRA 1AL22 4AXOA 4C0HA 1LCLA 1V6LA 1Z78A 3LSEA 3FHIB 3ZXFA 3EJKA 4DZGA 4SLIA 1R092 1QOOA 1I9RA 3NV4A 4BH9A 4EN6B 2XJRA 4KG8A 1AUYA 3AKRA 3OPZA 1TME2 1APNA 1H1IA 4AE2A 3VBOA 3B9IA 3CF6E 1NA1C 1PVXA 2QZ3A 2RMU2 1NLRA 1HRI3 5KC6A 3KZ4C 3KGZA 4Q4Y1 4OHXA 1CAUA 5GZEA 4CEYC 2HEVF 2DFBA 4MYEA 4Z8BA 1AXYA 2GU9A 3MFAA 3LKJA 4YYOA 2VW0A 4ASMB 2UU8A 4HVOA 3P3NA 3PJQA 1XE8A 4N9HA 1DIWA 2GNDA 1C4RA 1PIV1 2GNMA 4NN0A 3APBA 1CONA 3HBZA 4Z92B 4G9SB 1POV3 3BIWE 2BNMA 2EXJA 2I45A 4N53C 5E1RA 5C4WA 3ZYRA 1VBB3 4HBNA 4RR3A 1EV12 4B29A 4OHWA 1JBCA 3VHOA 1KQRA 2ZGTA 4Y26A 4OVEA 4JDNA 3HR9A 4AW7A 3S6PA 1MS8A 1RUJ2 4AFBA 3WW1A 1OMIA 2K0GA 3RYRA 2YV8A 3THTA 2DUOA 3PHMA 1LULA 2XL7A 2XG3A 1BBT2 3VBUC 3RMXA 1NCRC 2GH8A 1UU4A 2YGMA 4CDUA 4IXLA 4XW3A 5BNNA 3DKWA 1AR63 1FNYA 1KJLA 3MDPA 4JV4A 3LB9A 1IOAA 1UIJA 1IS3A 5LK5A 2WZR2 3QH7A 1PO21 2PTMA 3VBRA 5A33B 3ZIXA 5CADA 2E9QA 3EO6A 2CY6A 4KWJA 4QT6A 1RUD1 1UX6A 5LEKA 2H0BA 1DLLA 4AYUA 3RSJA 1RUI3 1U5XA 4K20A 3KGLA 1R1A2 1ZBA3 4FQ4A 2ZGRA 1Q43A 5J09A 2RJKA 4NO4A 1ENXA 3OBRA 1R082 1C5HA 3SH4A 3UK9A 1ZZ7A 1VRH1 3QLQA 4RL7A 3GNEA 3OD0A 5A32B 1BXHA 3AK0A 1ZYBA 4QGNA 1V6KA 5BNOB 4IEVA 1UF2C 1I5ZA 1TMF3 1ALYA 2A71A 4LBQD 4QMAA 5AC93 1RINA 2B5HA 4AG4A 1ZNPA 1S0CA