4HSQA

Crystal structure of domains d2 and d3 of the major pilin spad from corynebacterium diphtheriae
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
272
structure length
272
Chain Sequence
KTEKTVKDADQNIQDAYTYTIKADAPTWGKDKKLTAFRFEDELDKRLDFQKVTEVKAGDTVLGTSDYTVNDPATDGNKLVVTLTDEGLKKVKSGDKMSLTFEVKRKEVGNTTELKNRADVIFNNPNTDKEVKNKTNEVVTYHGKLKVVKKDGKEAGKVLKGAEFELYQCTSAAVLGKGPLTVDGVKKWTTGDDGTFTIDGLHVTDFEDGKEAAPATKKFCLKETKAPAGYALPDPNVTEIEFTRAKISEKDKFEGDDEVTLVSEIKNIKQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A slow-forming isopeptide bond in the structure of the major pilin SpaD from Corynebacterium diphtheriae has implications for pilus assembly.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Cell adhesion
molecule keywords Putative fimbrial subunit
total genus 68
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hsqA02
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hsqA01
3FT3A 4P2OB 4X5XB 5IHBA 5HDQH 5T5FL 4KV5F 5I1GH 3HRPA 4UB0H 4N9GB 2YPVH 5TE4H 3TWCL 4P46B 3DIFB 5ALCH 1VDGA 3RRQA 3CVIL 5EZIL 4CVZA 3IFNL 1B6DA 4HZLA 4KI5D 4S1DD 4WO4D 4PJ7F 4S1DC 1T2QH 5GGTH 4OLXL 3JWOL 1OD9A 4PJGB 5D2LF 3E8UL 1KCLA 4XH2B 4JDVB 3BW9A 5B39A 4JLRA 3IU4H 4QKXB 4XVSL 1M6OA 4M5ZL 1HH9A 1J10A 2VO5A 3BPNB 5EU3A 3TLRA 1WCBA 4PJHA 2X41A 1RZ7H 2ZUVA 2QQNL 2AXGA 2UYLB 4XXCA 1EXUB 3RTQD 2W9EL 1YY8B 3VMOA 3FO9A 4TUOB 3MRKB 3U7WH 1YEFH 4X9FA 1MI5A 1Y18A 2KUTA 5A40E 3JV4A 4AH2A 5D7IE 2AI0L 1X5FA 4DWHA 2BNQE 4HMCA 2IPUG 5C92A 2R2BB 4PJFA 4QRSA 3AROA 4NUGL 2NY0C 4BSWB 4XX1E 4NQSA 4LMQI 2GAZB 5GJTH 3CLFL 1YEIL 2DQHH 3MLYH 5KVDL 2ZNXA 4UIMB 1R5VA 2WWMD 3WHE1 3DROB 1ZGLA 1SJVA 4RIRA 3DTXB 3WIHA 4X6CA 3D0LB 2ADJA 1CLOH 2C3GA 3O9WA 4NHUA 4PP1D 1JHTA 5JO5B 5D6DC 3V52L 2R4RL 1D5XB 4LQ1A 4Y19D 2IBBA 1JF6A 3CVIH 1BX2A 1N2RB 2HP4A 2XIDA 4H5SB 3VGDA 5E9DE 2M1KA 2FL5B 4X7SH 1UACH 4N9OB 1I9JH 1G9NL 2CO7B 2EIBA 5I1IH 3JWDC 1W2KT 1FYHB 5HDQL 2XICA 4E41A 3EO9H 2WBJA 3QDJA 3X14B 4MNQD 1BBJA 3UTSA 4JRYB 5SX4H 4N8CL 3ARBB 1IFHL 1AFVL 4OD2A 4FMFA 5IB3A 5M94B 4P2RD 5FYLL 4AG4H 4V1DE 3VGGA 4N0UA 5JOFB 5JW3L 3NGBB 4JFFE 3X13A 2RGSA 1ZK9A 2R2CA 4XMKH 2YD1A 2EXYD 3CSYA 1OD7A 1KB5L 1R3HB 2AK1L 5FYKH 3PQYE 5EUOE 3IGAA 4E42B 1NMAL 1CTOA 4M9OA 7FABH 5GSVB 3SCMA 1VENA 1QRNE 2PO6A 1UCTA 1RZJH 4PJXB 1AJ7L 2AK4A 2IQAA 3WIHH 2W59A 5C0JA 1F90L 3RY4A 5DJAA 1J05B 3FO2A 3B9KC 3WJJA 5ICXB 1ZHKB 3G5ZA 5BV7B 3ZDZE 1J1XH 4PJ5A 1V3JA 2K7PA 3TIEB 2BY1A 4KDTC 3PV7A 1L0YA 1Q1JH 4DGIH 3ULUH 5DFVC 4QRRD 1HNFA 5H35A 4NJ9L 2Z4QB 5GS2H 1AGEA 1UWEL 4UIKL 1JN6B 1TQCC 1QBBA 1U8OA 2B20A 1JRHL 2C4FU 1YUHB 4JN1L 4XCFL 5ADPL 4CVXB 1SHMA 4ODVL 4EN3C 3C6SA 3NCYS 1CK0L 4U1SB 1G7PB 1U2HA 2Y5TA 2CLZA 4QHLB 1EFXD 2P8MA 5I74C 3F62A 2HTKD 3V2AR 1MREH 4ZOCA 4N0RA 3LEVH 4AEIH 1JHKH 1RJYA 1ZT4A 3GMMB 4MX7A 4Y2DA 5SX5K 4RZCB 1JP5A 1XGPB 3BPCA 1TJIH 2WBJC 4XVJH 2YSSB 5SWSB 3G9AB 3MV9B 4NJ9H 1BVKA 1C08A 4Y4FA 5EOTB 1WTLA 3LS4H 1I7ZB 1Z6JT 4X98B 2QEJA 4OFYA 3ZE0E 3X17A 1NSNH 4D9QD 3OWEA 2IH3B 1WBYB 3HNSH 4PJEE 1M05B 2XA8L 4QXUL 1KCKA 3MGAA 5I1KL 5C07A 1WZ1L 1U8JB 1AQKH 2AJSH 2B5IC 2E27H 3WXVL 3EOYG 4HKZB 4NO5A 4JVUA 5D7KD 1IEHA 1KTRL 5F9WB 5K9KB 4IRJD 3X12A 2X4UB 2E3VA 1VFBA 4IRJC 3C8KB 3SDCC 2AI0H 1I3RB 4XI5D 1JF1B 4AMKH 5ITFB 2FLRT 1OTSC 4O2CB 3LHPH 3GUTB 2F8XC 2Q86B 4NPYB 4K7PX 3RIAK 4D0BA 3M1BA 5ANME 3RWJA 1RU9L 3G08B 2V2WA 4WU5A 3GKWL 5C0CE 5KBNC 3EGSB 4QXGL 3FT2B 4JRYE 3ARGD 4X5LA 5DDHB 3AMLA 1F4XL 4KXZH 2BK8A 4OFPA 3GKZA 4PJEA 1JPGB 3QIBC 4MGXA 5DFTA 5FUCE 4F2MB 1NLDL 4Z7UE 5IQ9B 4GKZB 3VMNA 5EUKB 4ODHH 5J3HD 3BAEL 4JFFB 1UB6A 3LSOA 5I1EL 5HDOA 4ZAKD 5C0AE 5TQ0L 3RGVA 1DTUA 2LABA 2X89A 1ZV5A 1U92A 2E7BA 1AHWC 4ZFZB 2XKNA 4JR9H 3T0BA 1A4KB 4HXBH 4K3EL 5EBLA 2BXYA 4I18B 4WHCA 2WP3O 1MRDL 4Z6AT 4PS4H 3MZGB 4WI5A 1F6FB 3MV7B 3BDYH 5GJTL 1CFVH 5DJCA 3P11L 1GC1H 1Z9OA 2W0LA 1G0DA 2BFVL 2AKRB 5F21B 2X4NB 1A6AB 1T0NA 5MENE 4JM2D 1XGUB 2H2SD 4OT1L 4P9MH 2YPKA 4PD4J 1CQYA 5F1IA 4PLKC 3IFOA 4PLKD 5FO9B 1R24B 3QDHA 1KNOA 1SY6A 2R1YB 1JPSH 3N50A 4UILH 2A74B 2AABL 2EDQA 4JO1L 1BECA 1AR2A 4MJ5A 1DN0B 3OGCB 4KQ4H 1CGXA 5GGUB 1SYSB 1KB9K 1C7TA 2X1XR 4OQTL 4B41A 1M7IB 1ETZB 2OP4L 3KPMB 4OIIL 4DZBA 5KSAD 2O5YL 2IANE 1IMHC 3OKNA 2COQA 4XVSH 5BS0D 3QISA 4O9HH 4H20H 3OR6A 4KI5E 5FHAL 1XR9B 5D7JC 4JFEB 4H1LG 4UOW0 5ESQA 5HHNB 1HI6B 3H9SA 2BMKB 1EEUA 3X3GH 3QNYA 4H1LH 4PJEF 1R5WB 5JPMB 5GRYA 1OWWA 4ISVB 4X7DC 4LPVA 3OJDA 2A0LC 4P23A 1MH5B 1KPRA 3LQAL 4WI4A 5HI4D 4HAGA 2NW2B 2PO6D 1KPVA 1K8IA 3N06B 4G3YH 4LCUA 3MREA 4ZQKB 3MFFA 3VGHA 1B4RA 3OB8A 4ELMB 4ZFFA 5CUSH 2X5PA 3PP3H 5I1GL 1XEDA 2XNAB 1XIWD 2X4OB 2MHAA 1U3HD 3DRTA 4OGAC 2VXSH 1UH4A 4CVWA 1QSEA 4M7KL 1TVBA 4TSAH 4BQ8A 3O3BB 3FHQA 4OTXH 3KJ4B 3FCTA 4D94A 3BWAB 2E8YA 1CFTA 3QJHA 1AGFB 1DL7H 4L3EB 4NP4H 3MLUL 4HULB 1CFQA 1G6RL 1AO7B 3W0WB 1S7SB 2DI7A 3DYOA 1WAAE 5E70A 4F57L 3AC0A 2EH7L 1JTPA 2FBJH 3RZCB 1BAFL 5GRJH 3KLAA 3W5NA 3WN5A 1EFQA 1ZTXL 2DQTL 5SWZD 5IHZA 2B0SH 1EEZB 1MIMH 2HFFA 4IRZH 4FQJH 4PJGF 5D2LB 3B5HA 2BERA 3QBTB 3NFNA 1Y6KR 4JB9H 3CXHK 3VFUA 5F3BA 2A77L 2MKLC 3P9MB 3BT2L 5CEXA 2EH8H 5J7CC 3HUJE 4HHAB 2VLJD 3MZTA 1LE5A 4WW2C 5HHMD 3BISA 1WISA 4ZDHA 2XN9B 1D5BA 4MSWA 4Z7WB 2Y06L 4MWFA 3O3DB 1MJ7H 1S7XA 5JNYB 1BEYH 1NBYB 4JB9L 3WLWC 5EPMB 3N9GH 4P5MB 1OP9A 4L9LB 2B0SL 5F3HB 1LGVA 3GMNA 4U1IB 2ARJQ 3O8XB 3PGFH 1D5ZB 1A6WL 4HF5L 1MHPH 1JZ3A 4M43L 5KS9B 3KXFE 2ICEA 3WJLA 5D93C 3WL9A 4MDJB 3TNNA 4C83A 3MLSH 1IGTB 4NNPL 4N0FA 4PGJA 5TGBA 5F9AC 1EEYA 3V6OC 3FQTA 5MEOB 4K3DL 4KK6C 1AFVH 4MD5B 3UO1L 4KQ3H 3UPRB 1YPZB 2FJGA 1T1YB 4K8RH 3HRZB 4J23A 3WD5L 3RWHA 5CZVH 3O4LD 3BP7A 4I3RL 4J6RH 5E24E 1IGFH 3O9WC 1HEZB 3OQ3B 3WHXA 1JPTL 1RUPL 3SOBH 3O3UN 5D6DA 3HE6D 2X2YA 4XT1C 4MQXD 1MLCA 3FONB 1NFDE 5LGHH 3HHRB 3UBXI 2A38A 4Q9RH 5C8JB 1UJ3A 1T5XA 4HIHB 3GNMH 4DKDC 4C56B 3BEVA 1IC4L 3MV7D 2CXKA 3DUUA 4PJGE 4G80B 3A6BH 1I7TA 4R7DB 4BQBA 5C6WH 1DUYB 1JWUA 1KFAH 4CVUA 2C3WA 2YZ8A 2GK0B 3QQ9C 1ACYL 1NL0H 5A2LH 4IGBA 1N64H 4DGVL 2VE6A 5IUSA 4G8IA 4YXKH 3L5WB 3LKRB 4S1SH 32C2B 5IJKC 1JNHB 2MMXA 1KPUB 2L7UA 5D7SL 4XB7A 3RL2A 2J8UA 1EIBA 2WK2A 2HWZH 2A1WH 4GUPB 4X6DB 4KZDL 4XC1L 4NYLB 3ARGB 1NKOA 2DL9A 3O3EA 4HJ0D 4KJPC 1RK0A 2UZYB 4K3GA 5JIKA 3U9UA 4CMMB 5IBTH 2F5AH 1OARH 2ARJA 4G8GB 5DWUH 4FXGB 4G6ML 5JDJA 3BKCH 3TPKA 4P4KB 3S3PA 5KSVA 4FXKB 3CK0H 4GRWF 4J7RA 5J1AA 3S3SA 1G7LB 4HUVB 2AXFA 4FFYL 5HHPA 2ESVD 2BVPA 1YQ2A 5J12C 4LDLB 3P0VL 1BHGA 2XTJE 2NW3A 2I9TB 4Z7UA 5I76A 5T3ZH 1KLUB 3LKNA 4IRSC 1YN7B 4HBCH 2DI9A 4TNVK 2GY5A 3CFBA 1HKLL 2OL3A 2EEDA 1CICB 2PW1A 3VRIB 3CVHH 3E0GA 3JWOH 4BZ1H 5GGTL 4RISL 1PYWB 5IW1A 4PV8A 2I26N 5I75B 4OCMC 4EN3A 3JVGC 4QOKA 4LLYA 1N4XH 5IG7B 3BO8A 4Y2DC 2FH6A 2P44B 2QADD 3C6LD 4S1RL 5CZVL 1I3GH 2NY7H 2Q76B 3D2UB 3T65B 3LRSA 1ZLWH 3RY5A 2UV3A 5CFHA 4PRIA 5EG6C 4KROD 4PYHA 4JJ5A 5I19H 5MP6H 1FNAA 3MGOB 1G7IB 5FA3B 1MCFA 2Q7YB 5KZCD 1TDQA 1F4YL 4OGYL 4FG6C 2VLRE 3TT3L 3ARVA 2AGJL 1RUKL 3GSQB 3VFWA 2AS5M 1GVIA 2WIIB 3FFCE 3O81A 5EORL 1F3JA 4V2CB 4PJIB 4K7PY 1AC0A 1SM3L 4LPYA 3T8XB 4ODTL 4MB3A 4U4BA 2R0LH 4XVTH 3QUML 3RDTD 4BZYA 3PQYA 2J3SA 2G5BB 4Q6IA 3N0PB 4JHAL 5L8LB 3BKYH 4GXVH 1MHCA 1NSNL 3FN3A 2APTA 3P9WB 2Q8AH 3HC3L 5CZXC 2CD0A 2X1PA 2QADB 4NQXB 4OBRA 1I8LA 3UBXB 4B5EA 3ES6A 3FMGL 3QUKB 4K23L 1JNNL 4AK1A 2C3VA 5T1DH 1PW3A 4OGZA 1S9YA 4LHQB 5I8OH 2Z91A 3C5SB 5ESVB 3K4AA 5E6YA 3Q5YA 3PGCA 4J3WA 3STLA 1B2WH 4EUPH 1ZT1A 3IDJB 2BNRA 1XF2B 4W4NA 2GITA 4BH7B 5ERWB 4DKEH 4MNQE 5KVGH 5IVNA 3L5IA 3GMOA 2N7BA 4HS6A 2F53D 5F7UA 2C26A 3HR5B 1X5HA 1LP9F 2XXCB 3T1FA 1A4JB 5LWYH 2HYMA 2VZVA 1UQSB 4WEBL 4MHHI 5I8OL 4NN7C 2V6HA 4MJ4A 1J8KA 4S1QL 3ARBD 3SO3C 3VFGL 4OTXL 4CRPA 1WFTA 4QLRA 4ONGH 4DAGH 1K5NA 1UB5A 3O6ML 1F90H 5MEPB 1OAKL 4JO4L 2Y72A 1VFAB 2ZOKB 5CJXA 5JORB 4U6HB 4UT9H 1ORSB 1QP1A 4YO0B 1I3UA 5C0BD 3G6JF 1YEKH 1U8PA 2X4TA 4M6OH 5D4QA 3VFOB 3UTZB 4GAFB 3T09A 3I3DA 4M7ZC 4Q6IC 2LU3A 4WTWA 3ULVL 3VXRD 1TZHB 2D3VA 2DMCA 3MLXH 3HG1B 3DX6A 4PG9B 3D85A 4M03A 5DXWA 4N5EC 5CINH 3QUZA 2ED7A 2H32B 4L5FH 1OW0A 1LD9A 2ED8A 3WO3B 5FUOL 3VXRE 2ZKHL 4ODSH 1A1NB 4RBPK 1NGWB 5AD0B 3BKMH 4Y19E 2FO1A 5E8NB 1NC4D 3HAEG 4JFQA 5ACZB 3UPCA 1U8QA 3FB6A 4O5LH 5KSBE 5T1LA 1CVSC 2DS4A 2HLAA 2HN7B 4X6FA 2DLHA 4P4KC 2AERT 3QHFH 2EDJA 3VFTA 3FQXB 1AQDB 3L5JA 1I1AB 5GS0H 1OP3K 1MJ8L 2NY6D 2D31B 4A6YL 5KTEL 3V95A 2XQBL 3TGXA 4AT6B 3PUCA 4Y5VA 3TBVB 2CDFA 4GOSA 2PO6C 4LVHC 5L2KD 3L3KA 1GGCH 1A5FL 1D9KD 1V7MH 2BFVH 2Z8RA 2WBJD 4KWUA 4AYFA 4QRRB 1U95B 3K74B 3SY0B 3DRQA 4ZTOH 3U7YH 4Q9QH 4M7LT 5C0DB 5IFHH 2FNBA 3QEUB 5JW4R 3GSXB 5DD0L 3KPSE 4YGVB 1BIIB 2VDKH 1V7ML 4RFOL 4PJCE 3U30B 1GGBL 5KANG 3BWUC 1J0JA 1JHLH 5FYKU 4RGNC 3ZHKA 3PABB 5E95B 3GIVA 4LCWE 3CC5B 3LDBB 3KLSA 1HINH 3VXMA 5E6IB 2P24A 2AJZB 3U0WL 5EC1B 4NGHH 1EA9C 3RL1B 4KZDH 5L7XH 3ARRA 3BGMB 2ICES 2VDQH 4EIGB 2O5ZH 2YMXH 2CIIA 3G5VA 4BZ2H 2K1MA 2R56L 2EIZA 5FUOH 3NPSB 2IAND 3CDCA 3QUZC 4PJHF 2VABB 1OTSD 2XY2A 3IFLL 5LCVL 1EVUA 1IGMH 1S7WB 1EBPA 1NFIA 1WGOA 4UV7L 3W9EA 1BF8A 4U6YA 2GT9A 3IDXH 3VA6A 4DN4L 3PL6C 3UC0H 3PL6D 3RWEB 3TN0C 3WXVH 2C7UB 2LVEA 2XACC 3C87A 5F9JA 1S9KC 1OT1A 4ZXBB 4RWHA 3KR3L 1Z5LA 3QULA 2QBWA 3PXHA 5D7LD 1AKJB 1S7RB 1WTGT 1A9BB 3LRGA 4KJQC 4Q0XH 2PYEB 1UENA 3OKDA 3VXQB 4F7TB 4OCSH 4HV8B 5I71B 1B9ZA 2FJHB 4XZUB 3TO2A 1MHEA 1NGZA 1HILB 4ZTPL 4HJGB 3EUUA 5DJ8B 1AI1H 1NDGA 3F7VB 2BHYA 3AVEA 5DR5H 1M7DA 2GJZB 2MQCA 3L3OA 1J1OL 5HHXH 4WENB 2VZOA 4O4YH 2Z93A 3GRWA 4ZS7L 3ZLQC 4MJIA 1MHPL 3MCKA 4TUJA 4JFPB 5DVMA 5CEYB 4QYOB 1S9WB 3LZFH 3EJYC 1T20A 4F80A 4XAWH 3ULSA 5FF6A 1T83A 2XG4A 3HUJA 4U1NB 4JRXD 2XYCA 2EEBA 1YJDL 1FGVL 3QDGD 2A6JB 2NNAA 5GHWH 3VXPA 3O9WD 3TA3A 4PJIE 2Y06H 1WT5A 2NY4B 4UIKH 2HJLA 2D7PA 3O0RL 4UI2A 2EYRB 4N1HB 3OGOE 4BQCA 5IV2A 2XWTA 4Z76A 2GK2A 3I75B 4DOHE 4G7VH 5GGRY 1YJDH 5EWIH 1VESA 1NLBH 3O11B 3L3DA 1AH1A 2AEPL 2Y4SA 2F15A 2X7LA 1BVZA 4JKLA 5DVLA 1YNTB 1VACB 2AVGA 3RWIB 5DTFA 2WIMA 2GSIB 1JGUH 3RTQB 3VFGH 3HI5L 2BNRD 4PGDB 3ZL4H 5DK2B 2PF6A 4LHUD 4MCYB 1CQKA 3BPNC 4JKPH 3NZHH 5E2TL 1XIWC 4S2SA 1SEBB 1WWAX 2FEEL 1FFOA 2J6EL 4HUWB 1JWSB 5MP6L 3CDYA 1NEZA 2OCFD 5E0QA 2ZG2A 3V0VB 4OCSL 4XPAL 3EOBA 3IF1B 3IKCA 5DMKB 1CG9A 3ZTJH 4JFFD 4QT5B 4W6YB 1I1YA 5GSRA 4WY7L 5DRWB 1KJ2A 5DQ9A 4EVNA 1R3KB 3QCTL 4HW6A 4IOSD 4NC1E 3RJQB 4WDIA 1QO3A 3PDOA 3EYVB 4GW1A 5MEQB 3TNMB 4FS0A 4P23C 4U7SA 4YHZL 5JQHC 3E1F1 3VH8A 1ADQL 2IQ9H 3EDKA 3JV0A 3MJ9H 1UEYA 3EYOA 3ME0A 1DQTA 4YR6A 3AB0C 2VWEE 5GJSH 3B9AA 1FYTA 2JE8A 3C9NA 3NZ8A 2E9WA 4UUJA 1BD2A 1RZFH 2OS7A 35C8H 2VXTL 4LFHD 3GSWB 2OMNA 2HG5A 3K4DA 3CLFH 4FZ8H 1HXMA 2ZUQB 4KY1H 1QRND 12E8L 2WZPD 1Z0MA 4HK3J 5GRZA 1I1AD 5JPNB 2FX8H 3H9HB 2J12B 3FOLA 3S36H 4X6EA 1U8NA 1KC5L 5I18L 3IVKB 1GOHA 4N90D 1PLGL 1FO0B 1NKRA 2F9BT 5DRNB 2F58L 2FHCA 3ARDD 4FQIL 4JGUA 2ATKB 2P48B 3OV6A 4ZG1A 1DLHA 1II4E 2MPAL 3L7FB 3QPQD 3AXLB 3QXUA 1C5CH 2RAMA 4NQUA 5C71A 1QR1B 2OR9H 1L7TH 3G5XA 4ENED 4KZEL 2WZAA 4TSBH 2E7LA 2HLFC 3SDYL 2DQFB 3I2CH 5JUEH 1QLFA 4U1JB 5J6GB 4K9EC 1KTLA 5IHLB 2V2TB 3KYOB 1C16A 3MO1B 3VXNB 5E9DD 1FVCA 4HWBL 3EOAB 4JPKL 4BSVB 2A6DB 2R2EB 4LAJH 3T4AA 5CBAB 1RHHA 3GHEL 3BP6A 5J9PA 3PWPB 2PUQT 5GS1A 4GW5A 2APFA 1JRHI 3QI9C 3VXMD 1QFPA 5D5ME 5GZNC 4GRMB 3SKNA 3WJLC 1H15A 3FB7B 4D3CH 4KQ3L 1VPOL 1U93A 4JREC 2VLRA 2R0WL 3SE8L 3CUPA 4ZODA 2M8XA 5IJVB 1CL7I 1ZHBB 3RNKB 4G6MH 2C9AA 3L6FB 1RD6A 2XN9E 3QO0B 3SKJL 1MCIA 3TZVC 3NPSC 1SJEB 3MACL 3QQ9D 1QA9A 1QVOB 5DK3A 1FV1A 1BFOB 3FB5A 4XX1G 5A2KH 1A14L 1MQKL 4LCCB 1B4JH 1INQB 1A0QH 3IDYC 2F53B 3U6RB 2W0FA 2AJYL 2AQ2A 3KPSD 2AW2A 3TBWA 2DIBA 5I9QB 4RBPH 1AGCB 1MJJB 1I4FB 2BNQA 2BY3A 4GKNA 3OAZK 1HHJB 2EYSB 4HMDA 3FFCA 1KFAL 2DQUL 4N0CC 1ULVA 5IB5A 3WCYA 4OV5B 3KG5A 2GCYB 2NXZD 5DRZA 5BRZD 3LEYH 3IU3A 5GS0D 3EJZD 3HAEA 3ECBA 1P7KB 2VC2H 4KVCH 3VFNB 1MFNA 3EYQD 1W72L 3I3EA 5LAXA 3DV4B 4YX2H 1HQ4B 4KDVA 4OZ4A 4KAQL 1UA6L 2H1PL 5E9DA 2FZ3B 1DBJL 2DOCA 4U7KA 1HHGB 2X4PB 3ZE0F 5E8DH 1PG7W 1JWMB 5IVXF 5EN2A 4M61B 4DZ8B 1GPOH 3MGTA 1QSFE 4E41E 4DOHB 1ZWIA 4G43B 4Y5XB 5JXEA 4WTZG 1S9XA 5A3ID 2FBJL 2NPLX 4HC1A 5FCUH 1ZT7B 4GAJH 4Y5VC 1FE8L 4HPYH 1GAFL 2FSEA 1P4LB 5L8JB 4OCLC 3QDMA 1R6VA 4ODXB 1GXEA 1JNNH 1FIGH 3U0PB 3PWLA 3SE9L 3NCBB 1DVFB 3VXUA 4J3TA 3CZFA 4V1DB 1SYVB 5BVJA 3AS2A 4JHWH 4D9QE 4NBXB 3MXVL 4FG6D 3OG6B 1T6WA 1T0PB 1QRNA 3CMOL 1LK2A 3CZJA 1MCDA 2DQJH 4JPWH 3QCUL 4KUZL 2ED9A 3RWCB 4LVOB 2IFFH 2HJFB 1I1RA 4XMKL 4YK4B 1KN4H 1J18A 1L0XA 1YEGL 2J6EA 3G6AA 3V6FB 4P3DA 4F7PB 1R5IA 4H26B 1D5MA 3A6CL 3IJHA 4PY8I 4J3XA 1K8DB 5E6IC 1K6QL 3K4ZA 3L5HA 3OPUA 3HC4H 4OKVA 3OHXA 4KK8C 4F3FA 4O2FA 3HR6A 4OLYH 5E00A 5IB1B 1KEMH 3QFDA 1QPXA 1G6RA 1Q0XH 3O2VL 4QRUA 5IW6B 1I9JL 4GBXB 5H37H 5F1SA 1U8IB 1UWXH 2PNDA 3D39E 5DGQA 3U46A 3GJEB 4GW4A 2R0KL 5C0IB 4NO2B 4P0DA 1L9NA 4R2GD 3I9GH 4X0KB 1RZKL 1QEWB 4MAUL 5B38G 1FRGL 1M7XA 3RWGB 3KR3H 3T4YA 3FQWB 2KBGA 5IGXH 3O6FB 3OXSA 4M1GL 1AXIB 5FV1L 5DJ6A 3BXNB 5J6HB 2DM3A 1YMMD 2H41A 2XTJD 4XBGB 1I1FA 5FKAB 4NCC1 3GIZH 4Q74A 3MJ8B 1N3NA 1GL4B 3FOMB 3O3AA 3BKCL 1OTUD 1YEDB 4W68A 1FG2B 3WUWB 1FP5A 4GSDL 2OZ4H 2WQRA 2GFBB 2QQLH 5CJQL 1BJMA 4QWWC 2VLJE 4J4PA 2Z31B 2FX9L 3F8UB 4QCIA 4XVUD 3WFBH 2CK0L 5HHOE 4JPVL 3QPXH 5TDPA 1FLTX 2UWEE 1WZLA 4QHMA 2BVYA 3ZKXB 3OL2A 2YPLD 5E8PA 2DD8H 1QFWH 2DTMH 3R4DA 3IETB 2VQTA 5CD3B 4JRXE 4NGHL 2QQKH 1CDCA 1CE6A 1LEGB 2V9TA 4I0PB 3V0WH 1JZ4A 4J12A 4XNZB 4A2MA 3VW3H 1EHNA 3VA2C 3RDTB 1CFSA 4X7FC 2XN9D 3CD4A 3L3IA 2EDOA 1RJLB 4MQTB 3TWCH 4UB0L 1MFEL 3C5ZA 3DVNB 1H8NA 4XNYH 3OG4B 1M71B 1QBAA 4JFZH 3HN3A 4JHWL 5I1KH 1GHFH 5HHVL 4DN3L 2FB4H 5L6YL 5H8DA 3HZKA 2NX5B 4JN2B 4I0CC 4XNQA 1S5HA 5CJXC 5DVNA 1KCUH 4XAKE 3BGAA 3ZZ1A 5EZOL 1KENL 1V3LA 3MNWB 1ZS8B 5TQ0H 4Z95H 3JV5A 2ZJSL 4N0YL 1DBAH 2JTDA 4PJCB 3CFKA 4QRPA 1CR9L 2R1WA 5BS0A 3HS0B 4Y7MA 1N59B 2G75B 1NEUA 5L0QC 1KXTB 1FZMB 4MDIB 4U1KB 5H94B 1SVZA 3VRLE 5IVXB 5I73C 2IPUK 5DZ9A 1RZIA 3G6DH 3KJ6H 1BOYA 4AEIL 4QRTB 4HLJA 3GSOB 5TH2B 2ENSA 2A6IA 2P5WB 4ODVH 4X9BA 1MUJA 1WWCA 4LLVA 4AMKL 2VIRA 3U36B 4L3EE 1YEGH 1A1MA 4X4XA 3QUMB 3UTPE 1CGUA 1FL6B 4Q97A 1J7VR 3K2MC 2BY2A 1P1ZA 1OAZH 1OQXA 1FG9C 3QUZD 4P57A 1MIEL 2A77H 1LE9A 5E1AA 3WLBA 1TTGA 4ZSOB 2HFGH 2DQTH 2CGRH 1RVFL 1FLRH 1IKNC 3QEGH 2AJYH 1UADC 1CBVL 5C2UB 3GMRB 4TSCH 2X4SB 4MLSA 1D9KB 1OAXL 5CAYB 1LEIB 2K3TA 4WO4C 1K85A 5J57B 4KK5D 3IDGB 1ZANH 2CIKA 2NX5E 1QSFA 4KK5C 4G5ZH 2KZ1B 1UXSB 1LO4H 4Y8AA 1WAAA 5AYUH 3BH9B 2XKUA 1LWRA 1G7HA 2D7OA 4M7KH 3LMJH 1W72B 5ICZB 4JAMB 5BMFH 2AK4D 3OR7A 2DM2A 1A7OH 1NGQL 1RURL 3DURB 4P46A 4X4MA 5D96B 5IBLD 1Y0LA 1TITA 5DJ0A 3OKLB 4IRSB 1A3RL 4KROB 5FO7A 1N8ZB 3DX7A 5E8OA 3VFRB 3MCLH 1KLGA 1AIFA 4QHNB 2VH5L 3ETBF 4MAYC 5HHOD 1JNJA 3QIWD 5D1QB 3SDYH 3O4LB 1VGEL 3PHOB 5FOBB 3QA3A 1RUMH 5CP7A 2R8SL 2HAZA 4YFLF 1KB5B 3NPZB 1PSKH 3ZDZF 1RZ8B 1D6VL 4RNRB 5IQ7L 1BOGB 1FNEA 3DBXA 5BVPH 5DQJA 2B4CC 5M95B 5EO0B 1FYTE 4M8VA 4CU8A 3FQRA 3LH2H 5J89A 3S4SB 1EJ6A 1TZIB 5GZND 3N85H 5D72H 4XI5C 5D2NA 2AGJH 1PKQA 3HLAA 1EV2E 2G5RA 5L88H 4AQ1B 1KELL 3P2TA 4G6FD 4ETQA 3SKJH 3B2VH 3PWUA 2R2BA 4JZOB 3SE8H 2W60A 2ZCLL 5DJXA 4F33A 5C70A 1HYSD 2O5XL 4MJID 3DROA 1T22A 4HJJH 2OMBA 4HUUB 2W92A 5HSFA 2ADJB 2R4SH 4EBQH 3MRQB 3OBAA 3TN0D 4HWNA 1JHTB 5HDBF 1WC7B 2VLJB 3JBG7 1VGKA 2ZCKH 5LGJA 1BBDL 4OZFH 1FJ1B 2JKXA 1D5XA 2WMPA 2XTLA 3QUXA 4KI5C 4WV1A 4LLAA 4FP8L 4IRJB 3GBNL 4LF3A 1J87A 4DQOL 2X1OA 5CGMA 3HI6L 2Q6WA 4PRDA 5DD1H 4TOYH 1JI2A 3EYQC 3NH7H 3WS6A 1PX4A 3UTSB 3ZTNL 1LP9B 2FR4A 1X3DA 3LEXB 4XNUL 4D8PB 2YR3A 2WM0A 5C09A 4OD2B 2HMIC 1MRCH 3DI2B 4FQ2L 3VWJC 5GGTA 3K8MA 1EHLH 4Z1PA 1HWGB 4PR5A 3I6LD 4NKDA 4QRPD 5I16A 1TNMA 3MV9D 1EK3A 1MFAH 4ZUTA 5F6HJ 5KVEH 4U6VH 4UOW1 1ZHLB 3PWJB 5D7IF 2IAMC 3EDDA 2LAAA 4PTUB 2IAMD 5GISL 1B3JA 2PXYC 3N85L 2D4DA 2VDNH 4XPBL 2HFEB 5C9JB 1N0LA 1MCRA 4RRPG 1AQKL 4LSTL 4PREB 5C0FA 3FO2B 5EWIL 4WTZA 4CN1A 4UT6H 1GZPB 4OM1L 4JCLA 3VDBA 1C8PA 2VLME 1MVUB 4XWGH 3T3ME 1NJ9A 3U2SA 3QZWG 4UU9B 1FNLA 4PY8J 1CGYA 1IL1B 4LLMA 1P84K 3WFEL 1ZA6B 2RFXB 3ARQA 5EZIH 3OKOA 3FRUB 4PJAA 4PJDB 1GGUA 1IC7L 5KSBB 4XHQA 2MCPH 1XF4A 3IS1X 2Y5TB 1FDLH 1UM6H 3I50H 3MNVA 1CL7H 1HZHH 4JM4H 4Z7VA 3S3JA 1A8JH 2V7HB 1V3MA 4ZFOL 5F7DB 4PJFE 1H8OA 5EU6E 4K8RL 2QSVA 1Q94B 2VDPL 1FN4B 4P2RB 1J0IA 3T3PF 3TBYB 2VYRE 5C0CD 1KT2B 3WDHA 5HHXL 5ENWA 1V7NH 4OJFL 1CXHA 2YD9A 4G9DB 3GHBL 2UZIH 5F8RC 4QNPE 1XT5A 3RP1A 5T3XD 2UY7A 4OZHA 3KYKH 2NY1B 1KJ2L 4Y4HD 1DCLA 1PG7L 4X98A 3GZKA 2Z0BA 4GKSB 3NGBC 3SDCD 3V5HB 3QHTC 3F58H 2Y23A 2EICA 1HDMA 2VLLA 1ADQA 4PJ8C 3T0EC 2FJFA 1AD9A 4U33A 5C0RL 4L8CB 4R2GC 5DRXA 4LAQL 2AEPH 2HTLC 1UJ3C 3Q3GA 2X9WA 1H3PH 2I5YH 4UTAL 4NNYB 1RY7B 1JNLH 4BSJA 4LSSH 5K9KA 4PRAA 1NAKH 2VLKB 3ALXA 4WV1C 1HOCB 1VFBB 3PWVB 5F9WC 1IQWL 3CU1A 5C7XL 2QV2A 4F7MB 4AENA 3LKPA 2DLGA 3S37H 3OX8B 1XR8B 2JK5A 4KHTL 3IFLH 3T04D 5EIQA 2WUCL 3T0VA 2DQCL 1BWMA 3VD9A 2X70B 4XCEB 1I9IL 3QXAA 2EYTB 5EUOA 2GTZA 2P7TB 1CGTA 2JIXB 1JTOA 3PGDA 4LLWA 1ORQA 1FNSL 3W82A 4HK3N 2RCSL 1IT9L 4P4RA 1AGDB 1UVQB 3RGVC 4OAWA 4HXAL 3ARXA 4HQQL 5CJQH 4JFFA 4HH8A 2UY6A 1MLBB 2SEBA 1CT8B 4C58B 3BP5A 4GG8B 3SGJC 1YN6B 3DOSA 3TP4A 4X7TB 1G7MB 3SDAA 3SDXE 2G9HA 3QWOB 1EEQA 3MLWL 5EZJA 1DLFH 1CGSH 2XKNB 1I8KA 4ZOBA 3VE0B 3MV01 1RHFA 5EB9A 1GGBH 1WFNA 2HT4D 4AEEA 5HXMA 1T21B 1U9KA 2Y9RT 1L7IL 5D5MB 3BEWB 3H6JA 3SO3B 4JCMA 5C0BE 3ROOB 3D18B 2UUDH 3AAZB 3B6SB 4RA0C 4WI3A 1TZGH 5KSUB 2AKRA 5HI3C 3QHZH 1QLEH 4NM4L 3PWPE 3VXRA 1JPFB 4M62L 4OF6A 3IFOB 3D0VA 2Q1EA 2ZUSA 3WFDL 4APQA 1AXSB 5E5UB 3RJDA 5JW4N 5T33L 3OGCA 3VI4E 1SYSA 3S97C 4JO2L 3PIQB 2G2RA 3F7YB 5HVFB 5D7JA 1TPXB 4XMPL 5ICYB 3LPWA 2JB6B 3QNZA 3VH8G 5EFIA 4ZOEA 3GMLB 4Q2ZA 4MQ7A 3X11B 4DEPC 8FABB 1OGAD 2IF7A 1I9RH 3B2UC 5ESQB 4H1LA 2O93L 3GSVB 4HJ0C 4KJPD 3W11C 5JOPD 5EBMB 2CDEA 2BC4B 1H5BB 1Q0YL 2NW2A 3SN6N 5ECJE 1NEZG 2BSSA 4HX1B 4GS7C 4M6OL 4KK8D 4PBXA 3MMEB 2NY4C 4UBDC 2J2ZA 2I60L 3WS3A 3TCXA 1OCWH 1J1PH 4LSQH 2X4OA 3LY6A 3MA7B 5C1MB 4RX4D 3DRTB 5T3XE 3MRIA 4HMEA 4OIAA 1H3PL 1DP0A 3HNVH 4KDTA 4RGMB 5HDLA 3WE6A 2D0HA 1IGJA 1DBML 2R1XB 5C86A 4XGZB 3WFHB 1EBAA 9CGTA 4I2XA 3QJHB 3ZMRA 5FGSA 2XQBH 4LGSB 4ZUUB 3BPOB 2AJ3A 1A1OB 5I17B 1S7SA 4F9LA 5DHYB 4OZIB 1F2XK 5CD5C 4Y4KB 1IQDB 3TH3T 4HT1H 5FCUL 4JRYD 2AQ3A 2V9QA 3OXRA 1KEML 4YH6A 4OLYL 1NBVL 1XGRA 5F8QC 5F1NA 4OZGA 1EEZA 1JGDA 1JK8B 2VDPH 3VFPB 4HFUL 2IALB 3ZKMD 3BZFA 4WUUA 1INDH 3WUZA 5DQDH 1MY5A 3D3VD 1MOEA 2GTWB 1IAIH 4X83A 4NFBA 4AIZB 1LO5A 5KSAB 2GEEA 4JHZA 4XC3H 1EUTA 3ZO0A 2OKMA 3NCEB 4HKBB 4R0LB 2E27L 1KIRB 2EDXA 3SDXF 5F3HA 2DQGH 1NGYB 1OSZB 4M7JH 4WWKB 2WANA 4TVSa 5I1CL 4KTDL 1SM3H 2YEZB 3CSBA 4ZSOE 4EUPA 4KRPB 1X5IA 2EECA 4BJLA 4OM0H 5HVHC 5FAAA 1A14H 3GJFK 3K7UA 4RMWA 2CR6A 3G6JE 5GIRA 3UJTH 2FWOB 3U1SL 1PEWA 3FQNA 1FL5A 4U6VL 2CKBH 1E0OB 3PG2A 3FQTB 4ONHB 3V0AC 5MEOA 1J86A 2J88L 4IDJH 4NUJB 3UTTD 3VG0H 3U4EA 3ULVC 2P1YA 4FABH 1IVLA 3T2PA 4J4PD 5JOPE 2D9CA 4X4ME 1Q9WB 5ESAB 2CO6B 4LLUB 2DM4A 2ICWB 5L2JA 3IDMB 1GGIL 1CFNB 3QFJA 1N0XL 4X99A 4KRPD 2WLZA 2E7LC 1BMGA 4ELME 4F9PA 3GHEH 2VOTA 3QUXC 3MRNB 1BF2A 1LMKA 1UJ3B 1ZEAL 4JN1H 1T5XB 3GB7A 4R9HA 2VL5A 43C9A 2F19L 2NTFA 3KPLB 1A7NH 3CFEB 1DBKL 4G80A 1BGXH 4R7DA 1DBBH 3CVHL 5GPRA 2ZSVA 4YUEH 3LQZA 1BVLA 1X4YA 4FNLH 5FGRA 4KZEH 2FO4B 3QUMH 4DFIA 3C5ZC 2ITDA 1C5CL 3EBAA 2J8UB 3SO5A 4QWWD 1HQRB 2AK1H 2ID5A 2BRQA 4J2XA 4MD0B 1GSMA 1JGEA 1IAMA 3N1MC 1QUNA 1MQKH 1WF5A 4B7LA 4F8TA 1EHXA 1EX0A 5CEZD 1E27A 3VXUE 4CU7A 4I0KA 4NQCB 4IMLA 2I24N 4LGRB 3VJ6A 2JB5H 2VAAA 1G7LA 4HUVA 2CDGB 5I19L 2A1WL 1X5JA 4OQ1A 3S35H 2W07A 1TJHL 1TQBC 1CD1B 3LS5H 4Z9KB 5C07E 1AGBB 3IJYB 2R0ZH 3K80A 3HE6A 3Q0HA 1HHKA 1NANH 1YN7A 4WJ5B 3TESA 4JDZB 3F65A 4J8RA 5HGDA 2L7JA 2ADGA 4FN0A 4JFYB 5SWQA 3DWTA 4FQXC 4K3JH 3KXFA 5E94B 2DQEH 3GNML 2XPGB 3FN0L 3VDCA 4EN3B 1L0QA 1WZKA 3MCLL 1EH9A 4LLYB 5LGHL 1SBSL 5D8JH 2J4WH 5JR1L 5E2VH 5J11B 2Y1VA 4L4TD 4D9LH 3FO1A 4LSRH 4UDTB 2ADIA 1MRFL 5FYLE 3QEQA 2FYYB 1D3CA 2Q76A 4NZRL 5CEZH 5HGAA 1L7TL 2Y7QB 4KKLD 4KH2A 3LRSB 3ULVF 1GIGL 1IC5L 3MROB 2E7HA 3ARFB 4ODWA 3UO1H 2OXGA 5E99H 2VAJA 1ZANL 2YD6A 2CKNA 5DS8B 3SGKC 4L8SB 1ROWA 1S8DB 2CUIA 4LCWA 4LLDB 3O2DL 1MWAA 3UAJD 4Q6YA 2CKBL 5DD5H 2NX5D 1H5BC 3TBTA 4PRNA 3QQ3B 3VFVB 3UROR 5B4MC 2BVUA 2VDMH 1JGUL 4ZUVB 1IEAB 1FVDA 1NFDB 1FNHA 2HH0L 1MFCL 1KOAA 1WT5C 4FZ8L 5L2KA 4IRSD 4MA7H 3WIFB 5HDBE 4L1DA 4YHKL 4N8VA 1KJVA 1MIEH 3H3PH 1NGPH 1W0VA 4P46C 1EO8H 3SGEI 2HVJA 3NA9H 1OAZL 1KTDB 5ETUB 1G9ML 4PJGA 1FZOA 4P2OC 4M02A 3EFFA 4YIQA 5ABDE 5B39B 3G5YB 3HC0B 1D7FA 4FQXA 3BJLA 1T3FB 2QADC 4XNMB 4YDJB 3GI9L 3QIUA 2H6PB 5CSGA 5IESH 5ALBH 3HR5A 4PFEA 4PJHB 3O6LL 5C0ND 1F6LL 1NDMB 2W65B 2AV7B 2B4CH 5IKCB 3QWRA 2AXGB 4WFFD 2UYLA 5KAQF 4ONFH 1OTUC 1EXUA 3G9VA 2DTSA 1YQVH 2VR4A 1B0GB 1JGVH 2YC1B 2XTJB 5FV2A 3KPRB 1L9MA 4AH2B 3AREA 3H9SE 3S7GA 4Z7NF 3CFDA 1YQVL 3E6FB 4G8EB 1QNZL 5HGBB 3D69B 5CGTA 1XGYL 3ZL4L 2E6JA 3WNLA 4XHJD 5EO9A 2GAZA 5MEPA 1MFBH 4M48L 3WNMA 2BSRA 1H0DA 4ZUSA 3RVVD 5TDNA 3GI9H 3PGFL 1A6ZB 3GSNB 1MFDH 4AEHL 4U6HA 3R06B 1HZHL 4AM0B 5I15L 5JOEA 4M6MH 2P5WD 1MFEH 3RPKA 4G42A 4OI7A 4Z18A 4JFDA 1ONQA 5HTSA 5DJZA 2F53E 4N90E 3I6KA 5DI8B 3BZ4B 1SJHB 2DLFH 1LQSR 4JANB 4QOKE 4JZJB 5EU5A 3MOBL 5CHNA 3B3IA 4EOWH 2QL1A 5IM7A 3REWA 4Z5RA 2E6QA 5EO1B 3UXFA 1TENA 3IS0X 2OR7A 4NNXB 4OLWL 5E8EB 2F8VA 2ZG1A 1UJTA 4OSUH 5D9SB 1NGWA 5AD0A 1MIML 4J3UA 4RDQF 2OTPA 5J13B 5JHDB 3SDCB 5M7QA 5CIPA 4P3CL 5AZEH 5C09D 3WNKA 5IB3B 3UTTA 4XPBH 4UQ3A 4YLQT 1WITA 4WIQA 4YFEA 2P45B 4Z7WF 1HYSC 1UM4H 3LV3B 4XXCC 4LCYB 3EYFB 3BRDA 3DJ9A 1G9MC 4RAVA 3HUJF 5B21A 4DVBB 3B8SA 4CW1B 3W11D 3AU1B 5DC9B 1I7RA 3C2AL 4U1HB 5J8OA 4Y5VB 2PXYA 2LAGB 1WLHA 3TIDA 4E42A 3MRJB 1P9MC 2YUVA 1DQMH 2PO6B 4QRRA 1N6QH 2VDKL 4LEXL 1NC2A 4X9GA 3MBXH 3RX7A 1OM3H 4NRYB 5ISZB 5DJAB 1J05A 2DWEB 4BA8A 1BZ7B 2VQ1B 3TF7C 5ICXA 2NY0B 1ZHKA 3NH7L 3NCFB 4HKXB 1H3VA 1IM9A 1X5GA 1YMME 2EDNA 4CMHC 2R29H 4UTBL 1IAKA 5KOMC 5FOJA 3I9GL 5F7EH 4Z77B 1Q38A 3CC5A 3T08A 3K1DA 3FL7A 2OQJA 5JMRA 4CVXA 4UV7H 3HMWL 2ZOLA 1GOGA 4O02L 3CDFA 2EZ0C 1ZSDB 3IDIA 3TC9A 4O5LL 1Q0XL 4LSPL 4YEFA 3Q2CA 3B83A 2OJEB 3QIUC 1NAML 3QRFM 4X6DE 2NLJB 1NAMB 4O9HL 4KHXH 5T1LD 2QSTA 3RPIA 2EIDA 3QXDA 4GMTL 3GSRB 4Y2DB 5CJ5A 2DYPD 2YPLE 2BRRH 1B88A 3GKWH 4L5FL 5C0CA 1NAMH 2NY6B 2XFXB 1FFPB 2YN5A 3UCRA 4FRWA 5IROA 1UWGH 3H7LA 3TFKC 43CAB 1ZVSA 3L3GB 5EOTA 1WZMA 3TFKD 5FUZL 2OSLA 5DC4B 2HJKA 5DA4A 4GG6B 3SKMA 1IQWH 2OI9C 4M62H 2CQVA 3VD5A 1XF3B 2P49B 5F1KC 5TPWL 3V8CA 2UWEB 5IBLC 4FFZL 4X4YB 3S98A 4Y1AB 4YNYB 4GBXD 1JJUA 1YEJL 5IFHL 3S37X 3B9KA 1OAKH 3R1GL 1CWVA 1E6OH 1ODAA 1NMBH 5HY9B 4NRXB 4KUCF 5AYQA 4HH9B 1XAUA 1FHGA 2B2XH 3C8KA 5I1HH 2DMBA 3DVFA 5IMOA 3T77A 4HJGA 5DJ8A 4YXLH 4GFTB 3KPQB 3MLWH 4NPYA 5MENA 4PRBB 4D0BB 3HCVA 1K3IA 1AP2B 2V2WB 5E6ZA 1EFXA 3FT2A 3LKQA 3NN8B 2ATPB 4WHTB 5BMFL 1I8IB 5T1MB 4MJIB 4YAQB 3AGVA 5FA4B 1C5BL 5D6CA 3D25B 4PD4K 1RK1A 4NZTL 4O58H 3QAZC 4XP9H 3UDWC 1T1ZB 2YWZA 4O00A 4NKOA 4EI6A 1QACA 1UCBL 3VXPB 1UB6B 4YHML 4KJWC 3SDAC 4AL8H 4KJWD 1PFCA 2I9LB 2XG5A 2G60L 2MCPL 2QHRH 2YK1H 6FABH 3ZHLA 2NXYB 2ZUYA 4MA3A 4ZFZA 2EDKA 4K23H 5D1QD 1UC6A 4AJ0A 4Z76B 4PGEA 4Z7VF 1YEKL 1MNUH 1FLRL 4A6YA 3ULVE 2R69H 3V6OE 4NWTL 1Q9KB 3KNBA 5DJCB 4CDGC 1OSPH 4POZD 1X7QB 4PIRF 5FIEA 4WU7B 2HT2C 1VACA 4L4VA 2YPKB 1MCOH 1GJIA 2GSIA 2MWCA 4GRWH 4KRLB 4NWTH 4IOIA 4NQCD 3HKFA 5E2WH 5CBEB 4APQC 1LDPH 3MTRA 3H3KA 1SEBA 1WBXA 4YBLC 4HIJA 2YK1L 3C60B 3H0TB 1ITBB 1NEZB 5J12B 1FL3A 5EA0H 3ROLA 3ILPB 3QCVL 2XV6B 2RJMA 4GKOA 4MJ6A 1A9EB 1H3TA 4ZUWA 3OKNB 3QFJE 4NZDA 3QB7C 5ALBL 1KJ2B 4FHBD 1N5AB 2FIKB 5DQ9B 3EJYD 3M17B 3AUVA 3W81A 5ACMA 5I1LA 4TRPH 2P5ED 1T2JA 4HIIB 4O2EB 4GW1B 2BVOA 4OIBA 3QNYB 4NO3A 4OKDA 4M3KB 5BZDA 5F9OL 4BH8A 4LCUB 1CXKA 3UDWA 4HWBH 4PRHA 2PCPA 2Y07L 3OJMB 3EYOB 1AHWA 3CDGB 5T1DL 3V9FA 5KJRH 4ELMA 3GMPB 5DJ2A 3WFEH 5ISZD 1I8MA 1UYWL 1XGQB 4EI5B 2PYFA 1KGCE 4MHHG 3HE7B 2RHEA 5FDYA 1N5YH 3HZYB 3V79C 5FK9B 3BGFB 4MA7L 1YEJH 2FEDC 2OR9L 3U79A 4Q9BA 2XWBB 3P4MA 5ILTL 4YE4H 1AD0A 3F6IA 3BWAA 1CIDA 4LHUB 3CK0L 3K0WA 1WIUA 2CRZA 4RAUA 4R97C 4X6EB 3FQUB 1FZJB 5I6XC 4U1LA 2IPTH 5J1SC 1F8TL 4OGYH 2P43B 5CZKA 5IIEA 3LRHA 3WHE0 2F74A 2QQNH 1EVTC 1GOFA 1XCTB 5HGGS 3UAJC 4KKBC 2JCCE 3DXAD 4WW1B 2V7NB 3CVHA 3LAFA 5F70A 4EZMA 4JPIB 3NFNB 1I3GL 1N26A 1N64L 3HI1A 3MRGB 4DGVH 4RSVA 2DQFA 1E4XH 2OZ4L 4WRLA 4PUBH 1MY7A 4TOYL 1JZ8A 4OF5A 4IOFC 4FFWC 4X6BA 5DMIL 4GRLD 4X8JB 5D1ZD 3MOAL 4ZDHB 3EO0B 3OJ2C 4JRXB 4Z8FL 1KCRL 2R4RH 3V52H 3W2DL 1S7XB 5K33A 5CBAA 5I75C 4TPRH 1ZHNB 2F6AA 3HFML 4HGWA 2YPLA 4LIQH 4L9LA 1I3VA 3HPLA 4U1IA 4UT7L 3VCLB 1D5ZA 2AJUH 1JBJA 2OZ4A 3FB7A 4D0CA 4G6JH 1U93B 3SGDH 1PAMA 3V5DA 2ARWA 2ZCLH 2EO9A 5J0BA 3L6FA 3WL9B 1FGNH 3UJJL 2DMKA 1QHOA 1QA9B 1IGTA 2PYED 2J6EH 3ABZA 3FB5B 2J5LB 3GK8L 3U0TB 4U1MB 4AEFA 4LIQE 1TVHA 4P9HC 2JJUA 1U58A 1WEJL 3MJ9A 3IDYB 4YC2B 1X9QA 4R7NB 3EZ8A 1YPZA 2FJGB 4JKKA 2Z31D 3REVB 3WN5C 2EYSA 3IRPX 1GGTA 3WHXB 3VFSA 4Y5YB 5TF0A 3WYRA 5DEGB 1KXVC 4FTVB 4JJHA 3MLPA 3IU4L 2DQDH 3SPVA 5C0BA 1ZKAA 4XPTL 2WAHA 4HFWA 4C56A 3BEVB 5LAXB 1EAPA 1F00I 4PV9B 4F8QA 3NABL 4MAYA 5HI3D 5E9DB 5JDSA 4UDUA 1AY1L 4JFHE 3GSNL 3B43A 2X44D 5F96L 4MS8D 3UZQA 4BQ6A 3FFDA 3P30L 3KLDA 1FO0H 4PJHE 1A7RH 1LNUB 3NVQA 4PG2A 1OB1B 3BD4A 3HZVA 4NO0A 2FD6H 1CLCA 3MRDA 5F7YC 1KYOK 2Y5EA 3VWJB 3KWWA 4HUNB 1CR9H 4TYUA 3EAKA 5FKPA 2VXVH 5KOVC 3WMSA 5HHPB 4N68A 4HPOH 4R4FL 3DVGA 5HYSB 3DGGA 4FQLH 5DLMH 2XZAL 1Y6MR 4PPTA 1A7RL 4R90H 1RIVL 4M1DH 2WWKT 25C8H 1QRNB 1U8MA 1RQ5A 2YD8A 1AO7D 3W0WD 3QDJE 4KAQH 1XH3B 3NACH 4YBQD 2V5YA 4UQ2A 4V1DD 1MNUL 3CCHB 1C5DA 3ZE1F 1IEBB 1OAQL 5JW5A 5KN5B 1PYWA 5A2JH 2P8PA 4G3YL 4P3DB 4F7PA 4CN6A 1R5IB 1RZKC 2VISB 3H2WA 4WGWB 3RAJL 1EO5A 5IG7A 2EH8L 4TULH 1R3JA 2NTSP 2FBOJ 4KI1A 5C08E 4BFIA 1QOKA 2ADFH 2AEIT 3UTQB 3OHXB 1D5IH 4EI5D 3RUGB 3DHJA 1SY6L 2H3NA 3L3JB 4MXQC 5E00B 5BCAA 2CK0H 3GI8L 1KCSH 4NQEB 4KGLA 4JFOA 2QKIA 2YRLA 4L4JA 2DB8A 4K71B 2VQUA 4GRLA 4QHUA 4PGCB 1A3QA 3GJEA 3DXAA 4JZNB 2AABH 3VFWB 4JO3H 4KPHH 2RQ8A 3ZKSD 4YHPA 4XP1L 4Z78A 1T03H 4K7PL 2N7AA 1B6UA 2JLLA 3HNTH 3FQWA 3QEQD 3BSZH 1NGXB 1CFVL 2FH8A 2YBRB 3MR9B 1YEHH 4HWUA 2CUMA 5I1AA 4DFHA 3TPUA 2YD7A 4PS4L 1INEH 4YHYC 2PN5A 2ZSWA 1KIQB 1QRKA 4P9HL 5DD6A 1S7UA 3VRJB 3OB0K 4G8FA 4OZFG 3O3AB 5K59F 2X4QA 4GT7A 1KJ3H 5IVZA 3BIKA 3GBNH 3V0WL 3JXAA 1KCRH 2Q87A 3PGCB 5E08H 5GS0L 1I7UB 4RFEB 2NQCA 1OGTA 3O2WL 4FQQB 1PKQE 1FNGB 2Z31A 4BH7A 1OVZA 1MCKA 4LBEA 3I02A 3RVUD 5IMMB 5I8CA 2YKLH 3KYMB 3QPXL 1VA9A 1OY3B 3QO1A 1LP9E 3A67L 1EPFA 3BKJL 4PY7B 1A4JA 4PGBB 4PLJC 2R2HB 3LN4B 4ETYA 3TZVA 3EFDH 4AIXA 2NY5C 3Q1SL 2JCCB 3LKOA 3MLXL 5D7IB 1NUDA 3P4OA 2DRUA 5DO2C 3S6CA 4XP4L 4DUXA 3TN0A 2Q8BL 4HC1L 4OZHF 5HJ3A 3BJ91 2FGZA 4ZO8A 1IAOB 5JMOC 1K5NB 4PB9L 1UB5B 3I6GA 1NCCH 4R3SA 3ZYIA 4POYA 1BZ9A 4KMLB 3DVNA 4JPWL 3WSQL 3DO3A 3TVMA 1WZ1H 4DKAA 4ZFOA 1VKXB 1NMCC 4HUXB 3IAPA 4JN2A 2BHZA 4LLQA 2DJUA 5EBWB 1CYGA 4YXHH 3MUGB 1G7QB 3BH8A 1NC4B 5D7LB 2KKQA 3W9DA 2MCG1 1F11B 3VWKC 2XT1B 5C0NC 4NQDB 4PJBF 4NQCE 2A83A 4LNRB 4F15C 3MJGX 4QRPB 3KPSA 1A3RH 3O4OB 4NKMA 1WWWX 2XZQL 3DX9A 2YZ1A 1TETL 5IVXA 3GRWH 1UM4L 4XVUC 3LMJL 4R4BA 4CNIB 1YY9C 2AJVL 4AIOA 3SDDD 3P77B 5E8NA 1U8QB 1IC1A 2P5WA 4MNGA 3IXTB 4ZO6A 1AR1D 3JV6A 3U48A 3RKPA 3U36A 4MYWB 4Z0BL 1A6VL 2P5EE 1M4KA 1A2YB 5SWSD 5CJOH 2IPTL 1F58H 3DARA 2BVQA 5DYOA 1TIUA 4J3SA 4RWYH 3EDEA 5C7XH 4AT6A 1HYRC 3QUYA 3QCUH 4KUZH 1P2CA 2DQJL 2A9ML 1U95A 1IKNA 2OYPA 1J12A 2ESVB 5D1XC 5H2BA 4LSSL 4XAKD 3FT4B 1VEMA 2I27N 3V5KA 3WEXB 4P4KD 3Q6GH 5BOPA 4XPFL 2WW8A 4QXTB 2XZAH 3IFPB 3V4PH 3V6ZB 3MFGB 5HI4C 3KDMB 5JA8B 2C3HA 3GIVB 1I75A 4XBPB 1D9KC 2P24B 2VSCA 2QSQA 5JW3H 1DEEB 3F5WA 3VXUD 1FVEB 4O51B 1F6AB 2EC9T 2ITCB 5D5MF 4DGYH 4OJFH 1QSFB 2ZG3A 3MNZB 3BH9A 5LGKA 1C12A 4RA3A 3MBEA 1BQHB 4LRNH 4JAMA 3RZCC 3TJEL 5IT2H 1WIOA 1S7WA 3C08H 3PP4H 1DQDH 4K9EL 4NRZB 3QXWA 3KYNB 5JIHA 5I66A 1PQZA 5CJBA 3GGWA 3W9EB 2ZUXA 3H3BC 4R96A 1MF2H 3OPZH 3WUWG 4U6YB 4L29A 2BSTB 4NC1C 1T4KA 4YHLH 1KENH 4KI5F 1OAQH 4WFGD 1IZKA 3O45A 3L9RB 1YNKH 1E4WH 2VSDA 4EDXA 3CXDH 3QNXA 4RNRA 4ZXBA 1BOGA 4EJ1C 2FB4L 4MNHB 4WNQA 2QR0B 3DBXB 2KQNA 2EZ0D 1A9BA 1LVEA 3D3VB 2FX7L 2PYEA 4NUGH 3MRLA 4XWOC 3VXQA 2VLKD 1TZIA 3VWKA 4DN4H 4HPOL 5D1QC 1LK3H 3Q48A 5I1DA 5FFLA 5D2NB 4ODUA 3PDDA 1WFUA 2VDML 2X9ZA 3T0XA 3I6LE 4QRPE 5FDWB 5J3HC 3H42L 3QZWB 3KPOA 3MRPB 3QIBA 4XCCL 4K8RD 3HZMA 1SBBA 2LTQB 3MCKB 5T3ZD 4PJ7E 1T1XB 4QF1B 4O58L 1S9WA 3L7EA 3P30H 5FF6B 3ULSB 4I77L 3MLRL 4OZFA 5FECB 1WC7A 3AFLA 4IMKA 1CDBA 2ICWI 1J0YA 4PLNC 1HN1A 4WV1B 1K4CA 2F54B 2HMID 4NC2B 1BQHG 5C0EA 1MHHB 4XHJC 4G9FA 4HDIB 5F89B 1HHIB 4OGXH 2EYRA 2EEAA 4E0RA 4ZS6D 4KK9C 3SJVB 5IEHA 1BBDH 2H8PB 2C4XA 2EC8A 1LP9A 3V7AE 2VITB 2FR4B 5T5FH 1CLOL 2BOBB 4HKJA 5T1KD 3RWIA 2E9BA 1LO3H 3HPJA 1WCBB 3RTQA 3RIFF 4NKDB 1H3WM 1VEPA 5IFJA 1XCQB 1UXWA 4IJ3B 1Z3GH 1YY8A 5CILH 1K2DB 3MRCA 3SJVE 3MV8E 1WK0A 1OOAA 4QRQA 1IGYA 4PTUA 4X7EC 5D7LE 3QQ4B 5F6IC 4S11A 4Z7OF 2EDRA 1CG9B 3RX8A 2UZXB 2A9NL 4HXAH 1RZ7L 5GGVL 5AZ2H 4X80H 3MODL 4H8WL 4N8PA 3QIBD 2R23B 1GZPA 1LO3L 1OF2B 4P3CH 1T83C 5AZEL 3CXHJ 4R8WH 1K6QH 4WFHE 3RVWD 1N5YL 1RUML 1CXEA 1QD0A 4F37K 2B1AL 5EIIA 4P5TB 3VXTB 1ZLVK 3BZEA 3FRUA 5DGRA 1FSKB 1QFWM 5KSBA 5FB8B 2VB5A 5JHLH 3NZ8B 1CLYL 3B8YA 4UV4L 5T1KB 1ZEAH 3BOVA 2V7HA 2WBJB 3GDBA 5FGCE 3V4UH 3OAUH 3V4VL 1YEHL 2YXFA 2DLEA 4P2RA 3TBYA 1VEOA 2J8UE 2CLRA 1MFDL 4AEHH 1YEEH 3CFJA 4ZYKB 5DEZA 1BAFH 1FIGL 5JOFA 1QQDB 4G9DA 3C2AH 2E5EA 3VG0L 1XIWA 2ERJC 1RZGA 1FO0A 5DRNA 3CSYB 3HG1D 1YMMB 3U1SH 3LKSA 4XRCA 3V5HA 2NR6C 4KJYA 2NR6D 3B5GA 2DWDB 2DKUA 3T0EE 1CBVH 4L8CA 1OQOA 4BELD 3PV6B 2EDBA 5AEAA 1CU4H 5HD8C 3STZB 3LPFA 2J8OA 2H2PD 2HFGL 3NFPB 2OM5A 2GSGB 3QR2A 3RIAF 5EBGA 3RVXD 1YYMH 2DQIH 1QLRB 3NCJH 1IGCH 3ARUA 4P2QB 3RZWA 2R69L 2NZ9C 1UYWH 2V2TA 4N9GA 5LQBL 4F7MA 2Z4QA 1AGEB 2IH1B 1AO7E 3W0WE 4P3WA 1CDHA 3C5JA 3LEYL 1MI5D 1PBYA 1NCBH 2X9XA 5GRVK 3NACL 4H8WC 4QHLA 3TT1H 3PGDB 4LLWB 2GJ6A 1QTYT 2HLFD 4JDVA 1A6TA 1JUFB 1UFUA 4ZPTB 5EU7C 4MX7B 1FFRA 1G7JB 3G6DL 4HWZB 3RUGE 4OAWB 4RZCA 3P4NA 3VXSA 4CL7A 1MAJA 3MRHA 1M6OB 2X42A 3BP5B 2BXZA 5T5NG 1G7MA 5HYQA 1ZGLP 2VXVL 1QVOA 2OJZL 2WOYA 3L1OH 4G9FD 3U4BH 4H0HB 1C08B 4WVRA 3HE6C 4Y4FB 3VE0A 2QTEA 2CPCA 5KVEL 1I1CA 4R26H 3MRKA 2H9GA 1Q9OA 1U2CA 5CLWA 5D5MA 4JFHD 2ORBH 3SKUD 4BQ9A 5E03A 3KVQA 1P7QD 4ERSL 1HH6B 4JDTL 4LCIH 1OWRM 3BUYB 4OFIA 5HHVH 3QJFB 2BNRE 3E6HB 1FCCA 3UC0L 5FGBA 5I71C 1J1PL 1A5FH 3D0LA 5DHVH 3IDXL 1HIML 4I5BA 2Y36L 4PJ9B 4NHUB 1R0AL 2VLRD 5JO5A 4U31A 3DMMC 1JF1A 3IXAA 1T1WA 1WAAF 5C6TH 1GZQA 4HK0A 4MXWH 1BX2B 1N2RA 2JB6A 1KIUA 4EDWH 2FL5A 2RIKA 4JG0L 1JI1A 3GMLA 4Q2ZB 5DDHA 5DHXB 3RBGA 3X11A 3MC0A 5HHQB 4PJBE 2W1NA 1JWMA 1JGLH 2LVCA 5EN2B 4J1UA 4OF3A 4QTIL 5BQ7B 2IPKA 1ZWIB 2O5ZL 2X40A 4Y2OA 1RULH 3U7AA 3JTTB 1Z0NA 4CUCA 4GKZA 5D70L 1PJ9A 5F9DC 4M3JA 1H5BA 2F5BL 3S35L 3OTTA 1P4LA 5F1OB 3DUSA 1IARB 3VXSD 1T04B 2IAMA 4XCNA 5BRZB 3UZEA 3ZE2E 4GQ9L 5E5MA 3ZKXC 5EBLB 3UEZA 4XMLL 5I1HL 1H3UA 3IT8D 1T7ZA 2HVKB 3ALPA 1ZLUH 4GLRH 5IBUB 1IM3B 3FB8B 1QSEE 5MERA 1YC7A 3MXWH 3Q6FA 3QEHA 1QLEL 4NM4H 5FHBH 3MLZH 4Q9QL 4JM2A 4Y4KD 3WFCL 1KIPB 2X4NA 1A6AA 1T0NB 4IHOA 1G1YA 2IQAB 3IRZA 4OD1L 5E2VL 4TPRL 1PZ5B 4M93C 1NCCL 5HYFA 2N4IA 3MJ9L 4G8GE 3G5ZB 1S7QA 4L8DA 3LOWA 3RFZC 2BOCA 2PTTA 1CD9B 3TIEA 4G6AD 2IADA 4RGMC 1JE6A 3RY6C 1U8OB 4DZBB 5IFAH 1JK8A 1UWXK 5FYKD 4F3FB 4MNGE 3BPOC 1GGIH 4RFNB 5B38B 1IBGH 2A6KB 1LO4L 1QPPA 2Z92A 1G6RB 2CXGA 1IKFH 3QIWC 1CK0H 4AIZA 3OJDB 1EUUA 1WQVT 4O02H 4XCCH 3AS3A 1G1CA 1KPRB 4GW4B 2YSSA 3H42H 3TYGH 4OCYH 2Z1PA 2BX5A 1G0XA 2P4AB 4HGMA 4TSCL 4FQCL 4C56D 4UT9L 1KGCD 5MHSD 5ILTH 2BJMH 3OXSB 4YHOL 5ISZE 4U0RB 2DBLL 3IDNA 3QG7L 2V5TA 2I5YL 1TVBB 1MCJA 4FNLL 2CK2A 4LPTA 4NDMA 4P2RE 5C08B 1DQML 4BFBD 1OAUL 4Y4HA 1U8JA 4N5UA 1EGJL 1ZLSH 5SV4A 1YEDA 1OLZA 3X12B 2GJ6D 3UBXG 3PXJA 1I3RA 1K9TA 5B8CB 4Y2DD 4DCQB 3CX5K 3A6OA 5TDPB 3M1BB 3RWJB 1IE5A 1GGYA 4KMQA 2HFFB 5D2LA 2B4CL 1S7VA 2C5DC 3CPLB 5ELIA 3D1MC 4GH7B 5L9DH 3MRNA 3TYFB 4TULL 1S7TA 1RUAL 1ZVHA 1DBAL 3LSOB 1LDPL 4YDIH 3L3IB 5E2WL 5JNYA 5GRUL 4XTRC 3ULUC 2NYYC 3V4PL 4L9LC 5EZLA 4KK9D 1E4JA 1I9EA 1IGCL 1EO8L 2NYYD 3NCJL 4PJFF 3ZDYF 4MAYD 4PBVC 4NQEE 4I18A 2X1WL 3QDMD 3OAZH 3UX9B 2EE9A 1OAYL 2YUWA 1FC2D 4RMUA 4WWKC 5EDXA 4R4FH 3SDDB 3TBSA 5E7FA 4FFYH 3H9SD 4MDJA 3TNNB 2IANA 4C83B 3G04A 5EU6A 4PJCA 1FZKB 1E27B 2ZCHH 1RI8A 5EULV 5HGHA 1MWAH 3VJ6B 1EEYB 3MACH 1KNOB 1HSBB 1NC2D 2G75A 2MKWA 1IGML 5SWZB 1YC8A 2EDTA 5GGRA 4CGTA 4MJ5B 5FO8A 1DN0A 1HHKB 1XGTA 3L5XH 4NQVA 3VGAB 1M7IA 1S78D 1ETZA 5IK3B 15C8L 2IBZX 1AY1H 4U2ZA 5H37G 4NZUL 1MLCB 1U8LA 2QQLL 3FONA 4HIEB 4U6XB 3R0NA 2RR3A 3E8UH 3QUMA 1UM5L 1OGAE 1A02N 5T33H 2AV1A 5EUOF 4MMZC 3ARBC 1PX3A 3ILQD 4PRPA 4RQQB 2X1QA 4P23B 3WFDH 2DQEL 4EEEA 3FO1B 4P5TC 4PJ5E 3SE3C 3QUYC 4ZQKA 3BVNA 4ORGB 3MREB 1QFUL 3D87B 1DBMH 5E1AB 1BFVL 1BJ1H 2VZ3A 2ZP0T 2VE6B 5TFSH 2Y7QA 1CDGA 1NUGA 2DQDL 4YBQC 1T5WA 3MRMB 3MROA 4M93B 1AXTL 3WFCH 1FFQA 2B1HL 3ZDXF 3RL2B 3PJSA 4Y4HC 4HJJL 2HFTA 4LFHG 4CADB 1FRGH 4X6DA 3MXWL 1BREA 4NYLA 1QSEB 2X4SA 4LCWB 1RK0B 3KPPA 3O3BA 1NBZA 1RIHH 1D9KA 4PJBB 2P42B 1NCTA 2E9IA 2XKSA 2ZUQC 2DYPA 4HC1H 2Q8BH 4JY6B 3BDXA 2C1OA 3KPNA 2DIJA 3VGFA 4NKIH 4RX4A 2CLVB 5CMAA 5CEZE 2BNUB 1HCFX 4TNVF 5ID0B 1CFQB 3NMEA 2CSPA 1NCAL 1MCCA 4M43H 3EYUL 1KLUA 4S1SL 2GY7B 5IMKB 4D0DB 4Z0XB 2AJUL 3CFBB 4QTIH 1KJVB 1D6VH 2OL3B 1E4XI 4Z7NE 1X44A 1A7BA 4NIKB 1WBZB 2OL3L 4D9LL 4LIQL 2V2XA 5C0AB 1SVCP 3PL6A 5ETUA 2CRYA 4MNQB 1FZOB 3FAXA 3P9MA 1DBBL 4YPGA 3VI3F 2JCCF 3EFFB 3VI4F 2AXJA 3OKEB 3AM8A 3QA3B 4FQXB 4J3OC 3S5LG 3RGVD 4LKXB 5DSCA 5IB4B 3UTSD 3LN5A 1XMWA 1E4XL 5FUCC 3BX7C 1U8HB 4NZUH 1ZOXA 5GGSA 4JO4H 4WFEE 3RNQB 5FHBL 4M4RA 1UZ8A 3EYUH 4TTDD 4KKCD 4ZS6C 2HRPH 1IRAY 4AQOA 3MGOA 4IDLA 5AUMB 2BP3A 3ULUE 5CS7A 3QG6B 3ZT6A 1T7WA 1FE8H 4K94L 2YA0A 5K9OA 5TGBB 4K2UL 5D70H 5ID1A 2J1KA 4UINL 1A6ZA 3GSNA 1D6EB 1RVFH 1O5DT 2FX7H 3MRQA 3X3FH 2VLJA 2HA1A 3EZJB 4KTDH 1I9IH 4XCYA 2ADFL 5DJZB 1CL7L 4JM4L 2Y6SD 4DVRL 4YWGH 5ADPH 5DI8A 1SJHA 3MV9E 1ZMYA 5HI5C 1XF5A 3DMMA 4M8QA 4ZOAA 4I48A 4NN5C 2Q6WB 1S9YB 1RJZB 5IP4A 3TO4A 3ARPA 4OUUB 1WSST 3O4OC 4HIHA 1UM5H 3NIFE 3CH1B 1RUAH 2BY0A 4OB5H 2GITB 4NSKB 2VXUH 3PP4L 3C08L 4W6XB 5JHDA 1HH9B 15C8H 1INDL 4HUKB 1HHHA 4Y19A 4OM1H 4MA8H 5C0RH 3LZFL 4UQ3B 4PTTA 4ACPA 4IGBB 2DLIA 4PR5B 3LV3A 3EYFA 4G8IB 3O6FD 5E4IA 1KPUA 1PG7H 1UQSA 3FO9B 4TUOA 3RWFA 3MLUH 1I7RB 2XY1A 3PWJA 1E28A 5HYJB 3O3EB 1VCAA 4NKQB 3TIDB 3UPAA 4I4WB 1KV3A 4CMMA 4DW2H 4FA8A 3K3QA 2MNUA 3H7BB 2FD6L 4QRSB 2HFEA 5C9JA 1KEGH 4FQHA 4CDHA 3DYPA 1PD6A 5J1AB 4P5KA 5CIPH 4JG1H 4CU6A 4UU9A 1MPAH 2NW3B 4Z7UB 5I76B 1DUZA 4YDVA 1ZVYA 4LDOB 1MCWW 1MI5E 1UACL 2X4TB 5LG1A 5GRUH 4C57C 1W8OA 3SCMD 5ACLA 3VXME 4K3EH 3AM8C 5FGCB 2P8LB 4L8BA 5DEFA 2NY3D 3RBSA 2BDNH 2NXZB 2NY3C 4E5XA 6FABL 1Q0YH 4PV8B 4E41B 2H32A 4X6CE 3QDJB 3X14A 1UZ6E 4NCC2 3SGKA 2Z35A 1WCQA 2HKFL 1KSRA 1KT2A 4LU5L 1U3ZA 5ENWB 4I3GA 5D1ZA 4LCWD 2VJXA 1IBGL 5AZ2L 3NTCH 3ARFC 3EOTH 4PG2C 2F58H 4FQIH 4PRPE 1BD2D 4DKFH 1UT9A 3QDME 3NCCB 4GSDH 2F5AL 3DECA 4MCZA 7CGTA 1NH6A 2DICA 4KKBD 1JHLL 3IGAB 4OFKA 2WNGA 2ZUTA 3SDXA 1AD9B 3UYOD 1DVFC 3ZYOA 3DETC 4M5ZH 4ZO9A 4MXVE 1IGIL 4P99A 5IGXL 1V05A 1GRWA 4HH9A 1CXIA 1HOCA 3KGRA 1PSKL 4P2OA 1J8HA 3DO7B 2G5BA 4XPGH 3W39A 4AENB 4K07A 4CVZB 3ES6B 3MRBB 2PR4H 1TJGL 4TTGA 4JFXA 2CLZB 3QXAB 3D39A 4X7CC 2EKSB 5CD5D 1TJIL 4XH2A 3BW9B 3SKOA 3GMMA 2ZZUT 3MLVH 3IDJA 1YMHA 1XF2A 4I77H 3QFJD 5D96C 4I9WE 3GJFH 3HC4L 4EI6B 3LEVL 4BKLB 1MLBA 2SEBB 4QXGH 4GG8A 1B0WA 3CIQA 5E1HB 4HS6B 5CINL 4X7TA 3SDAB 2G9HB 5TDOB 4K8RC 4TN9A 4NNPH 4FZEH 1ZLUK 3T1FB 5BJTB 1I7ZA 1YNLH 2GT9B 3DHMA 2WINA 4C56E 2GW5A 4A6YB 3BEWA 5B3NA 3FRPG 3JV4B 3ROOA 4HG4J 1M05A 1LK3L 3CMOH 1FPTL 2MQ3A 2YN3A 5DK0B 4L4VB 1FORL 2FGWL 4IIQB 4NQSB 1P53A 4UTAH 3MV8A 1S7RA 1OM3L 3BMWA 1JPFA 4HKZA 4NO5B 4TVPL 1R5VB 3OKDB 1MJ7L 4RIRB 1VFAA 4HV8A 5FGBC 3LIZH 4APQB 3LQMA 1WBXB 4K7PH 1KULA 3H9ZA 5ITFA 1DLFL 4O2CA 1LEKA 5KS9E 3UTZA 2Q86A 3Q5TA 2WBKA 3C60C 1GAFH 1S3KL 2NY0D 2V5MA 3M45A 3QNZB 1V3KA 4MJ6B 3EGSA 1U41A 3L1OL 3S5LB 2CJUH 4MQ7B 5I8KH 3HG1A 3M17A 1X4ZA 4PJEB 1QBML 1JPGA 3RHWK 1ZTXH 3GSVA 2X05A 5CKGA 5F72S 5T3ZE 5EBMA 1A1NA 1D5IL 3ARBA 3SDAD 1ERNA 2WUCH 4BH8B 3QCVH 3QAZB 2CRMA 3TZVD 1FDLL 4PRID 1G0YR 1G9NH 4HX1A 4AZ8A 4EOWL 2HLAB 2HN7A 2IG2H 4N0UB 3SGDI 3A0OA 1I8MB 3MMEA 1Q1JL 4DGIL 3FQXA 3X13B 5A2FA 5IR1A 4EI5A 2DLFL 4OM0L 4H88L 2D31A 4L4VD 2NXYC 5EOCH 4YHIA 1U42A 3ORJA 3SEPA 5BV7H 4XBEH 1MCOL 3RVTC 1IGJB 4YBHA 3L3KB 5GSVA 1AD0B 3OZ9H 4DN3H 4M1DL 4OI8A 3B5TA 4PJXA 4LKCB 2UVEA 4MMXC 4I2XB 1NUFA 4LHUA 5C0DA 1DQJB 4ZUUA 5BOZG 2A73A 1QFHA 2OTUB 1FZJA 4LVOC 3O41B 4XC3L 1GH7A 2H45A 1NFDF 4N8VG 1NANI 4FQ1H 3WKMH 1QSED 2JJTC 3PABA 2G60H 3RY6A 3V0VA 1YUHA 3L3HB 3IF1A 4YBLB 5DMKA 5EC1A 2VZ1A 4RGOL 3C6SB 1G7PA 4NN6B 2IALA 2ZNWA 3OR6B 1UZ6F 3HI1B 1Z2KA 4KDWA 1R3KA 4K3HA 1ND0A 5B3JE 1FH5H 3EO9L 3G5VB 4LOUC 5F96H 1RJYB 1ZT4B 2EIZB 4OB5L 2CJUL 1TETH 5I1IL 5DC0A 4X6BB 4WFGE 4X8JA 3EDJA 3PHQA 3BPCB 3EO0A 4JPKH 3OJVC 1NPUA 4U49A 5SWSA 5DVOA 1F2QA 4YFDB 4OD3H 5IWLC 4ZFFB 2Z9TA 4FQXD 1H8SA 4KROC 4MD4B 2DJ4A 4ZMAT 1JZ5A 1DSFH 3QRGL 3VCLA 1MCPH 5DD0H 2NY3B 2HG5B 3RWEA 5I0DA 5D1XA 3F12A 4IBLT 4D2NA 1IZJA 5F9JB 4U6TA 3GO1L 2V17L 3JTSA 5JLZB 3FCTB 3MODH 4H8WH 4PJDE 5JPNA 4MJIE 3QH3B 1CFTB 3OAYK 5GIRB 1AGFA 1KACB 4XTRD 3ULUD 3PNWB 4U1MA 1U8NB 1TVHB 5FUZH 1A21A 4F7TA 2H26A 5DJDB 1QSVA 1KELH 3BQUA 1R3LB 3TJHD 5E6ID 1DLHB 3GUTA 1NQBA 3EFDL 5ESAA 2VUYA 3WN5B 1GCFA 4LLUA 2XZCL 5CZXD 1YEEL 1QR1A 5DEGA 5E4EB 5B4MD 3MV7E 2W9DH 3SPVB 3GRWL 4L3CA 5C6PB 3V4UL 5IQ7H 2WQSA 1MRFH 3TO4C 2GKIA 5D71H 4U1JA 5J6GA 2GUOB 3D2UD 2F68X 2VN7A 4I9WD 5D8JL 1KTKE 2A6JA 4M6AA 1EAPB 3CFEA 3HMWH 1B0RA 4X6CF 3TA3B 3MLTA 4WFHD 2IWGA 1RSFA 3GIZL 5EOQL 4BSVA 4MWFB 2A6DA 4X4ZA 5JDSB 1RHHB 1CZ8H 1T2XA 3MRFB 1A3LH 1BVLB 5EPMA 4OCNC 5D71L 3GMNB 2OK0H 1TZGL 2BZDA 4H25B 4R8WL 3MJ7B 1Q9LB 3MV7A 4MQSB 2PTVA 4MD0A 4NO0B 4HSQA 3QEQE 3AREC 3KWWB 2I25N 3B2VL 4GQ9H 4JGJA 5EC2B 5IJKA 1YECL 3RA7H 4NOFA 4IJ3C 1R24A 2R1YA 2A74A 5CSZA 4MD5A 1RIHL 3BN3B 2AEWA 3P0GB 5E5RB 4HUWA 1MJJA 1A6WH 1F02I 3KYAA 4WJ5A 3BP7B 5BZWA 4LU5H 1DQQB 3ARTA 1AXTH 1I1YB 1EGJA 5A16B 2B39A 3IU3B 1MAMH 1C5DB 2QQQA 1VGEH 4JFEA 2LQRA 3MV11 4YDLB 3H9SB 5L2KE 4WDIB 1OT2A 1QZ1A 1R5WA 3NIGE 3TNMA 3DYMA 5JPMA 1R3IH 2D03L 3GJFB 1IILE 1MH5A 1I7TB 5TF1L 1ES0B 3MFFB 3RGHA 2GK0A 4DK3A 4I1NB 4WTXA 5HGAB 3FAWA 1F45A 32C2A 1JNHA 5JXED 3BD3A 2NY6C 4IRZL 2XNAA 4NFDA 3WO4B 5J13C 4OLVL 4G5ZL 4G43A 4JM2F 5SX4I 2DIAA 3MPCA 1MFBL 4QHUB 5IF0B 2ARJB 5L8KB 3BQUC 2QLVB 4PJIF 1F4YH 4KXZI 1DE4B 1CIUA 5KSVB 4M6NL 3PWLB 2AXFB 1IEAA 3T2OA 3ZT7A 1AO7A 3W0WA 4KKAC 1BJ8A 1DVFA 4OZIF 1S5IH 2QSCH 3QEGL 3S36X 5F93C 1SYVA 4D3CL 5BVJB 1KCUL 4QO1A 1CXFA 2ATKA 4PGZA 5IESL 4BYHA 4BUGA 1ZA3B 4N8VB 5C08D 5IEKB 4NWUH 2XA3A 5HHOA 1HNGA 3VRIA 1UA6H 4HGKC 3AY4A 4G8FB 4XNYL 3G5XB 1YNKL 3NIGF 5K9JH 3VFUB 5F3BB 1L6ZA 4ZFGH 2O26U 4FFVC 1IAIM 4F7CA 1EHAA 4OBSA 3ZT5A 3WXWL 2IG2L 3E2HC 3TEUA 3MO1A 1D5BB 3BYTA 3EOAA 5JUEL 5IMMA 1QYGL 2H6PA 4HEME 5KZCB 4OKVB 4XP5L 4P5MA 4QTHA 3F7PC 3LN4A 4JY4A 4YGAB 3WNOA 5L7XL 1G7IA 3LKOB 4RFNC 4LNVA 5GISH 3VGEA 3C6LB 3R0MA 2ICEB 3BDBA 2VLRB 3U46B 4K94H 3U7WL 5DWUL 1K4DB 4UILL 2WIIA 4HIXH 3O8XD 5BXFB 1CFBA 1EGJH 1BZ9B 2CH8A 4IS6A 4N0FB 1BFOA 1VPOH 4PJIA 1H0DB 3MV8D 12E8H 5BW7C 3RWGA 3O6FC 3T8XA 4ELKA 3P11H 4AM0A 5EBWA 5JZ7C 3UPRA 1TCRB 1U8KA 5J6HA 5JZ7D 5HHMB 1CICD 1I4FA 2BNQB 3RWHB 5JTWA 5HVHB 1F4AA 5I8EA 2A9MH 1OCWL 1YY9D 4LSRL 4HS8H 1QKZH 3UBXA 4C4KT 2FECI 1KXQE 1T0MB 1M1SA 1DANU 3NA4A 4JQIL 4OFDA 1MJUL 2C3VB 5CHNB 2LFGA 1R3IL 3BRGC 4NKMB 5IM7B 4RWYL 3FN0H 5C8JA 1ADQH 3TYGL 3STLB 5I1EH 3ECBB 2QQKL 4NNXA 2GFBA 5I30H 1MAML 1FFNB 3G6JA 2BCKA 2D7QA 4CNIA 3RVUC 4OZ4B 4UNVA 3SDCA 5CIPB 1JWUB 4C54A 3PWNA 4CJ0A 1YDPB 4F15B 4WW2B 5C3LD 3L95A 1U36A 3IETA 4G6KL 1DZBA 1HHGA 3VG9C 5DJYA 4JFED 4ALAL 3SQOH 5E4EC 4GS7B 4CW1A 4GUPA 1KC5H 3K1KC 3ARGA 3W5MA 4PJ7B 3JUZA 4FXGA 1XFPA 1Z3GL 2IFFL 2YD2A 3QDMB 3WKNA 1KJ3L 4JREB 3QP3A 4F7EB 3LH2L 4FXKA 3EO1B 3U0PA 2NX5A 3LDBC 3MYJA 4V1DA 3UMTA 4HS3A 1NLBL 4K7FA 1IAKB 3GM0A 5TFSL 5FYJH 1JYNA 1U8PB 1MCPL 5MI0B 3CFCL 4G7VL 1CZ8L 1N6QL 2IBZY 1ZS8A 3SGEH 2OQJB 3MRRA 3V6BR 1CICA 4LVNC 4OD3L 2JJTA 1CN4A 5DUBB 1TZHA 5BS0B 3HS0A 4P59L 4JO3L 2X9YA 5DF0A 3D85B 4BFEA 1TQBB 5LWYL 1FZMA 4MDIA 3C2SA 1ED3A 3V6FA 4QOKB 3NTCL 3QXDB 3A67H 4ZAKB 4PP2A 4FQJL 4QOKD 2RCSH 4QRTA 1FH5L 5D1ZC 1JHKL 4TQEH 4TUKH 3FZUD 5EU7E 2YKLL 3FB6B 2FEEI 1DBJH 1MEXL 3P73A 1PQZB 2VIRB 3AB0B 3GGWB 4F57H 4OLWH 4R96B 2J88H 4UNTA 4X4XB 5AAMA 3ARSA 3GBMH 4JJ5B 3S37L 2OSLB 2NY1C 1T4KB 2W9LA 2VDLH 4ZXBC 1DL7L 3IB4A 1FSKC 3DNKA 3L9RA 1YJDC 1TTUA 2R9HC 1XF3A 5B22A 3QNXB 2W38A 5KSAC 1LE9B 2UWEA 4MNHA 2XXMB 4WNQB 4B0MM 2H2PC 2UVFA 3MXVH 1U91A 3EKCA 4MA1C 1F3JB 1JYVA 4NRXA 1IM9D 5I1CH 3OZ9L 1RZJL 3T2QA 4NWUL 5TQ2L 1KCVL 3CX5J 4FQLL 3BXNA 2BVTA 1MHCB 5DHVA 4Y1AD 3QPQC 5KJRL 4NQXA 1KG0B 5FKAA 5E6IA 3QZWA 4MVBD 3MJ8A 1N6VA 3NN8A 3ARFD 2UZIL 4JGMA 5BO1H 1JGVL 5DURB 3QXVA 3BGMA 2Z91B 5ESVA 3L7EB 4Y5YC 1RK1B 2R0WH 3INUL 4OGAD 1GPOL 5IT2L