4HSQA

Crystal structure of domains d2 and d3 of the major pilin spad from corynebacterium diphtheriae
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
272
structure length
272
Chain Sequence
KTEKTVKDADQNIQDAYTYTIKADAPTWGKDKKLTAFRFEDELDKRLDFQKVTEVKAGDTVLGTSDYTVNDPATDGNKLVVTLTDEGLKKVKSGDKMSLTFEVKRKEVGNTTELKNRADVIFNNPNTDKEVKNKTNEVVTYHGKLKVVKKDGKEAGKVLKGAEFELYQCTSAAVLGKGPLTVDGVKKWTTGDDGTFTIDGLHVTDFEDGKEAAPATKKFCLKETKAPAGYALPDPNVTEIEFTRAKISEKDKFEGDDEVTLVSEIKNIKQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative fimbrial subunit
publication title A slow-forming isopeptide bond in the structure of the major pilin SpaD from Corynebacterium diphtheriae has implications for pilus assembly.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Cell adhesion
total genus 68
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hsqA02
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hsqA01
4YK4B 4R7DB 2A9MH 4RX4D 3QQ4A 5IUSA 4FQLH 1WWCA 5KSAB 1H0DB 2H32A 1PZUB 5F96H 1LDPH 2YD7A 4X6CF 4D8PA 5ENWB 2Z91B 5DQ9A 4O02L 5EH1A 3QXUA 3L1OH 3MO1A 4HCRH 1NGZB 3MLZH 4F33B 1YEIH 4ZAKB 2IGFH 3LZFH 5F1NB 2P49B 4OBSA 1HSBB 3JWDH 1U8NB 3FTGB 3QIBA 1A9EA 1YEDB 4XNXL 3GJFA 2WBJB 5D9SA 1FYTB 1NEZA 1R3LB 2A38A 2J2ZA 4AYFA 3L6FA 2BP3A 1J8KA 1U8QB 4BH8A 4UTAL 3FHQA 4W68A 3CJJA 2OR7A 1NCBL 1SEQH 5CJOH 2OTUB 4OI8A 4FQXD 2EDXA 4NJAL 1MAMH 4R4FH 3HMXH 3GBNL 3BKYH 3TM6A 3NCBB 1HHIA 4MSWA 3RNKA 1VFOA 5ITBL 2ATPA 5GS1C 1UM6H 1BQSA 1BLNB 4PJIF 4WGWB 1F2XK 2VR5A 4J4PD 4MNQB 2ARJQ 2OKMA 4WWKA 4JPKH 3B3IB 4UTBH 3V5DA 5DQDL 2VUOA 2NMSA 2YD2A 1PKOA 3QUMH 4X5LA 3C08L 4ENEC 2WAHA 3CD4A 3RWEA 5C1MB 8FABB 2P5WD 4AQOA 1MI5B 3ULUC 4LCWA 5TH2A 5DQ9B 1MJ7H 3G04A 5CIPH 4WRLA 3MO1B 5C0CA 3U30C 1MRFH 2F58H 3WLWD 4NQEB 4KY1L 5HYSA 1WUNT 2BY3A 1GIGL 1TCRA 2GCYA 2WUCL 4R90H 2OQJA 1P84K 3OR7B 1FO0B 5TPWL 4GMSL 3V6FA 3GJFB 3VFPA 1FZJA 1NEZB 3L3DA 5CJXC 3WMSA 3VGFA 3GSQB 4KUZH 3QPQC 2ESVD 1KCSH 1T6VN 4CL7A 3UDWA 1AI1H 3T8XB 2BOBB 4I9WE 5C0BB 1FG2A 3VXTA 5I17B 1J1OL 2J5LB 2X4QA 2OSLA 5BMFL 2QL1A 1S7SA 1YJDL 5I1DA 4H20H 3PDOA 4PR5A 1WAAE 4Y88A 5DWUH 3LV3B 43CAB 3RVVC 4XVSH 4KI5E 1WBYA 1JNNL 1F6AA 1KCKA 1P7QD 5HD8D 4M02A 5H8DA 4N0FB 3V5DB 3WNOA 1DR9A 4DZBB 4Q6YA 2QHRH 3O3BB 3H7LA 4UI2A 1H9VA 2K9UA 3DGGB 4GAGL 3QFDA 3P4MA 1ND0B 1T0PB 4B7IA 2X4PB 3HZKB 3TT3L 4GG6F 1NCCL 3GMMB 4JFFA 1TLKA 4OLZL 2FZ3B 3DVGA 3BESR 1D7FA 1IGFL 2FDBP 1KJ2H 4LSTH 2VJXA 1XGPA 1RZ7H 2AXFA 2OK0L 1QACA 4ODTL 5EBMA 3QUYD 5BZWB 1GOHA 1IT9H 4ESKA 4P2QB 5JXAH 1XGYH 4C57C 4OV5A 1H3PH 5B21A 1IC7L 3QEUB 1W0VA 5DD0L 4QXUH 1FG2B 4V2BA 5F8RC 1PG7X 5A3IC 5EIIA 3ULVH 1A4KA 3NABH 1JHLL 5ADPH 4YEEA 1DQJB 3H7BA 1HOCA 3QNXA 4PJXF 3I02A 3JBG7 2X9XA 5IV2B 4PJGF 3QEGL 1S5IH 4HXAH 5DRNB 5J06A 4EUPB 4WCYH 1F6AB 3N1QC 5KSAD 1JPST 4F15B 1PVHA 2X09A 3LKOA 4C4KT 2EXWC 2YWYA 1LDPL 1U3HC 2AK4D 5EB9A 4D9QE 3L1OL 3BPLC 4HCRL 3HUJE 1J9CT 4LSRL 3MLZL 1YEIL 2IGFL 3HZYB 1RIUH 3LZFL 3PP4L 4F9LC 5IBLC 4ZAKD 4P5TA 2X4OA 3IDYB 4LAQH 4NN7B 1I7UA 2ID5A 4YIQB 3WKMH 5I74C 1T03H 2HG5B 3IDUA 2WBJD 3VXQB 1FYTD 1ZVYA 4MCYB 1U8MA 1N6UA 3MGAA 4P57B 4XP5L 5DF0A 2ZCLL 1G9EA 2RFXA 3O11A 1FVDA 2ADGA 4N8VG 1MAML 4OV5B 1S9WB 4R4FL 1VACB 3NACL 5FF6B 3IFLH 2Z0BA 4X4ZA 2MMXA 5AUMB 2Y7QB 1P4IH 5CZVH 3U1SL 3VXSB 1UM6L 2PUQT 4RDQG 2W0FA 2J4WL 1K3IA 1CFVL 3QNXB 4O2EA 3I02B 5AZ2H 5C6TH 4MNQD 4LDEB 4P2RA 4JPKL 3UAJC 1H8OA 3EOBB 1U93A 3QFJA 1K4DA 1ZVSB 2QSQA 1MCFA 2XPGA 3RKPA 3QUML 4ONHB 1JZ2A 1IGIL 1CD8A 5DUBB 3BN9D 1KB5A 4QYOA 4LLVA 1MI5D 1MJ7L 1TVHB 5MENA 4URTB 5HHXH 3DNKA 1KN4H 3AREB 2HA1A 1G7IB 4JFDA 4G8GE 2Y9RT 1XT5A 4NQED 2X4OB 3P4OB 3MLWH 4CADB 4L1DA 4Y4HA 1J1XH 1LE9A 1X5FA 3ARTA 4ELMF 1J8HA 1O0VA 4NUGH 4A6YB 3OKLA 5EN2A 4FQJL 2HLFD 1C08A 1KCSL 5BW7A 1OPGH 4J3XA 1T66D 2RFXB 3BWUC 1URLA 3M17A 1OD9A 3NA4A 1FVDB 3UPCA 3KWWA 3QIBC 5C0BD 3RVXC 5F9JB 3DRTB 2P47B 1QLFB 4ODSH 4XPFL 4H20L 3QR2A 3KYNA 1KYOK 4W6WB 2Y5TA 3MXWL 1BVLA 5DWUL 1AO7E 3RVWD 4ZFOA 4JM4L 5F89B 1QPPA 3EJYC 3KYMA 4G6MH 4XVSL 1AGFB 5EU3A 2RIKA 5TQ2H 3BGMA 3D0VB 4N1EA 1A6ZB 4MAYA 1UWXK 1CTNA 1KBGH 2H1PL 4X6CE 5IMMB 1PKQA 4QYOB 3SJVA 2N56A 2HAZA 4GO6B 1XFPA 4LLVB 5IJVB 5MENB 1F13A 1H8SA 4HHAB 1IGTB 1BIIB 3EZ8A 3V4PH 4PJ9A 1KJ2L 2H2SC 5HDQH 4WWKC 2IH1A 4DKEL 3EDDA 3L9RB 1WZ1L 1I1CA 1BQHG 4LKCA 3OF6D 3U4BH 4LQFH 3MOQA 1NAMA 1NGPH 3ARDC 2NX5A 3MNVB 4JFPB 1C08B 2V17H 1AY1L 3H9ZA 1XGYL 3O6KL 4P2QD 2XWJA 3PGFH 5F7DA 3M17B 4JRXE 5F7WC 3V0AC 4QXUL 3IKCA 1NL0L 3BO8A 3FT2B 3ULVL 1GAFH 4GW4B 3ZYZA 1U42A 1RMFL 3LAFA 3MV8B 2YUZA 1VGKA 1ZS8A 4RMSA 5H37H 1VENA 2XZCH 4PJIE 1QSFB 4TUOA 3BEWB 1IAII 3PWUA 1KB5L 4G7VH 4U1JA 3TZVB 1N64L 5GIRB 1ZSDB 3UDWC 5HVWA 3BGMB 4A2LA 3OWEA 3PXJA 2P4AB 2H8PB 1HYSD 1YMMA 4MAYB 5DUPH 1EO5A 1C16A 1JGEA 2DQDH 4KFZC 5GGQH 4B7LA 4ZXBA 12E8H 1F58H 5ADOL 4Y2DC 4LCIL 4AL8H 3UBXB 3LQAL 1R5IA 2F74B 4NNYB 1X5KA 4PJ9B 1T03L 1INDL 3MLVL 3EOYG 2HFGH 4M7LL 1VADB 25C8H 3LOWA 3L3OB 2FYYA 4YXLL 5IBTL 1Z9LA 1JGDB 4D3CH 4XBGA 2DI7A 3KYOB 5FGSA 3IFLL 2IFGA 2IALB 3ARGA 3DXAB 4ZFOL 4MJIA 5D7KD 1E6OH 3VXSD 4GSDH 1H3GA 3U46A 2A6JA 3E6FA 1VGKB 3P77A 5EC2A 5TJWK 1FFOB 3U0TA 1WQVT 3HFMH 5C6TL 1SMOA 4IRSA 3PWUB 4J1UA 5ACZB 1TZGH 1HHHB 4GAJL 4MDJA 3GGWA 1I8MA 1MUJB 2X1XR 2EXYC 4NGHH 3DLQR 4MVBC 3BPCA 4Y19E 1YPZA 2F5BH 4HIHA 1EUUA 1J05B 1T6WA 3PNWA 5IB2B 1KN4L 5DD5H 4GG6E 3ARED 4YPJA 1YECL 5BZDB 5I76A 3B9KA 3LS4L 4U6YB 3VG0L 3MLWL 1A2YB 1NAML 1D6VH 3HA0A 3NGBC 2AXHA 1DJSA 3FFCE 5HGAB 4W70A 2D4DA 2VXVH 5EOTB 1U8PA 2YBRA 2X9WA 2H9GB 4CVXA 3T0DA 4PLNC 3SY0B 3HB3C 2ED9A 2YA2A 4JEGB 5D1ZB 5MHSE 3QXDA 4P5TC 1F3RB 3S4SA 4F8TA 5C0FA 3QXTA 2DQUH 1Q9LB 3RHWK 2A74B 3S97C 4P4KB 3PWLA 3Q5TA 5EC2B 4PJXE 1G7JA 3JWOH 1JI1A 1F97A 4HFWB 4HT1L 5F72S 3MRNA 4BFIA 4PJGE 3BI9X 3EHBD 4RWHA 5DK3A 1MFAH 2A0LC 4P2RD 1KIPA 5CJ5A 1S7QA 1K4CA 3H8NA 4KKCC 4OTXH 5GGSA 5E95B 3KJ4B 1CF8H 4YBHA 5KVFH 1HHKA 2AKRA 4DAGH 1IQWH 4JG0H 5F21B 3ROLA 5MEND 2WINB 4C55A 4KZDL 4DW2L 4N8CH 3V4PL 3IYLW 5I76B 3FZUD 3ULVC 3VJ6A 5I1LA 1RUPL 5FYLD 4ALAH 3B9KB 4ODXA 3KPMA 2W07A 4BK4A 2IPKA 3BIKA 1ZHNA 1E4KA 5GRWA 3OJDB 5FUOH 1U8PB 5KSVB 2V17L 2VL5A 4CVXB 5I1CH 3OHXA 1T1XA 4UU9A 3PGFL 1UM5H 4RRPA 1U2CA 3M8OH 3MLXL 5F6IC 3TNMA 5C0FB 4Y4HC 4OF8A 3VFRB 2FIKA 3LQAC 4U1SA 3CC5B 3GK8H 1UGNA 5DRXA 3MV8D 3RWHA 1QSFD 5FGBC 4Z5RA 4YXKH 2JCCB 5MI0C 1G7JB 5BW7C 4G7VL 2J12B 1UXWA 4HEPG 3HPJA 2RCSH 3FB7B 3MFFB 3Q3GB 4RFNC 3TZVD 1BFSA 3CLFL 5HHOB 3Q2CA 2OCFD 4NQUA 2ICEA 4MAYD 4EOWH 4PJFA 4M3JA 1R3HA 3WS6A 5GGQL 2CMRL 2XNAA 5ANMA 1J87A 4FQCL 4NZDA 1F3DH 3V4UL 5I73C 4P2YA 1KF9B 2ICWA 3I6LD 3OR6A 1W8NA 2YPKA 3FQRA 4PJ9D 3VJ6B 2QBWA 3H2WA 4I8DA 2CUHA 1GH7A 3OQ3B 5DYOB 2HFGL 4JVUA 4D94A 3SCMA 2LU3A 4ELME 4H0HB 2FRGP 2BVYA 2HMID 4HIXL 1BFTA 2VZVA 5JUEL 5K9KA 4QHUA 5JW4N 3OHXB 1T1XB 4O5LL 4D3CL 4OIIH 1SM3H 4XNQA 4NZRH 1QBLH 5EBLB 3C5ZB 3DXAD 1E6OL 5DJZA 3TNMB 5IEKB 1QKZL 1A0QL 1JF5A 1OAKH 2FIKB 2HJFB 5BRZA 4ONOA 3TIEA 5DRXB 4LEXL 1OGAE 3RWHB 4WUUB 1RZGB 3IU4H 4WFHE 3HFML 4WJ5A 2ADJA 3CXHJ 5DD1H 4HUNB 2X1PA 2KL6A 5IVXF 3HPJB 3T0AA 2VLKE 4NGHL 3TPKA 1MCWM 2M26A 3ORJA 3AS1A 2CK0H 2F5BL 2ICEB 4PJFB 3QQ9C 2DLTA 3V5HA 3C8HA 3GSNA 2Z8VC 4PBVC 3PABB 4WW2A 4YHIA 2XNAB 4CW1B 1WLHA 4QLRA 1NDMB 4KK9D 2V9QA 3U9PH 4YE4H 2ICWB 5BQ7A 2YN3A 5FCUH 1QFOA 2IBZY 2YPKB 1D6VL 4JM2A 4FQIH 1WVZA 3T0XA 1YQ2A 1CLZH 4X9GA 2Q76B 1J0IA 3CDGA 1HQRA 4XVJH 4OM1H 1A02N 1XZ0B 3QZWB 5TF1L 3CFDA 1UH4A 3MXVH 4ZXBC 4Q9QH 3U36A 5K9KB 2BVOB 4JY4B 1AXIB 3QAZB 5D1ZD 1A7OL 2O5YL 4QRRE 3WJJA 3WEXA 2D0GA 3MUZ1 1QBMH 1LGVA 4DN4H 2R2HB 4KHTH 4YX2H 5DJZB 3T2OA 4PJ5E 5K59F 5KJRH 4ZSOB 5BRZB 4NN6B 1JBJA 3B2VH 3HNSH 3TIEB 3IXAA 3H9HA 5D4QA 4TSBH 4P4KD 2R8SH 3SGKC 1T04A 3JWOL 2B8OT 2P5EB 4WJ5B 5K9JH 1GPOL 1HK6A 2ZUUA 4HUMB 3RWCA 4HH9A 1T1YA 4NBYB 1EA9C 1WZMA 2YK1L 2VKXA 3QJFA 4PJBB 3MV7A 3PF2A 3NCJL 3UTSB 3ARGC 4OTXL 4YO0A 3E3QE 5KVFL 1NPUA 1NGWB 1EHAA 2D03L 3KS0H 4NJ9L 4PLKD 3D1MC 5FV2A 4JG0L 3T3PF 3TYFB 1VA9A 2HTKD 3CFCL 1ZEAH 3ILPB 5C2BH 4YHYC 4RGNC 4IRSC 4ALAL 2ADFH 5ETUA 3IJHA 3SDDA 3B9KD 5I1AA 1RIVH 5FA3A 3OAYH 4Y8DC 2X05A 5IBUG 3KPSA 1ZHKB 5B22A 4ZTPH 4KKLD 2D0FA 1PDKA 3SPVA 3CDGB 3X11B 2AXGB 2VYRE 4MA8H 4DVBA 5JR1H 2I25N 4PGDA 1PD6A 5EZJB 5T1MB 4YXHH 1S7TA 4FRWA 5DSCA 3U36B 5ICXB 3ISWA 4IEFB 1UM5L 5CBEA 3WEXB 1B4RA 1DBBL 4WI4A 5IB4B 1HH9A 1KN2H 4M1CC 4AMKL 4OSUL 3HC3H 2DBJA 4OFDA 3NFPB 4ZPTB 5GHWL 3UPRB 3L5WB 1GZQB 3MACL 3IXAB 3H9HB 5F7EL 4GKSA 4D0BB 5JHDA 3QCVL 1KJVB 1AE6L 1T04B 3ARSA 5EZIH 1TZIB 2W91A 3GSNL 3RWCB 3GKWL 2ICES 2XYCA 5GJTH 4LVOB 5ELIA 4P9ML 5HHOD 1I8KA 1KEMH 1AGEB 2VXTL 3QJFB 4PV8B 3CSPA 4ZS6D 4YO0B 3VXNB 4WO4A 3F12B 2RHEA 4ZNEE 1TITA 4RDQF 1KPUA 2F19H 4M5ZH 1VFUA 3NPSC 2DQJH 4I1NB 4Y89A 4BZ1L 5ETUB 2ZCKH 5GXBB 1Q1JH 4CJ1A 1G6VK 5I1AB 4P4RA 2V6HA 2Z31C 4JO1H 5LAXA 3G6DH 4OCSH 3KPSB 5HDOA 2NNAB 3FKUS 2BNRB 4IS6A 1YDPB 3H0TB 1RJYA 3C8KB 2J8UA 2F8OA 1FPTH 3VE0B 4CKVX 1EHXA 3GSUA 3ARXA 4PJCB 2MOVA 5E6YA 1JTPA 1S7TB 2WW8A 4MWFB 2FH8A 3QO1B 2CKBB 1M4KA 5JNYB 3WNKA 1U6AH 3GIVA 5HYQA 4NZRL 4NM4L 2V7NA 3NCYP 1TCMA 1NCTA 3FQWB 3C5ZD 3FN9A 1DE4B 5IF0A 1HH9B 2VC2H 1OAKL 1KEGL 1UCBH 2IANE 5T3ZL 3VG9B 5IWLA 2GUOB 1OAYH 4KTEH 3RWJA 1E4KC 5IHUH 4WUUD 4M7LT 4XBPA 3OJ2C 5DEZA 2GY7B 2FH6A 5EUOA 1CXFA 2LQRA 2VIRA 5DD1L 3P11L 3CUPB 2HRPL 4OZFG 3DUUA 4UB0H 5E2VL 2X4SA 2BNQB 3V8OA 4V1DA 2BY2A 3SQOH 2FSEB 4XNUL 1DBML 4GAFB 4LLWA 2W9DL 1NGYA 3I9GH 3W9EB 3S3PA 3X3FL 4DFIA 1KPUB 3CFJB 3U9PL 4YE4L 5AG8A 3WL9A 1S7WA 2D3VA 5FCUL 1FBIH 4J3VA 3ROOB 3QEQE 4ISVA 1YNTB 5I0ZA 1JN6A 3I6KA 3RUGA 2BC4A 4WEMB 3GM8A 4HGWB 3JWOC 2P7TA 4B41A 5JZ7C 1JVKA 1W72A 1FL5B 4DGIL 4IS6B 4XVJL 3WS6C 4AY0A 1MCRA 4W81A 4ZFZB 4XPGL 3HE7B 3MXVL 4G80B 1JWUB 4K7FA 5D96C 1NMAH 4FP8H 4C83A 2EYRA 5JLZA 1OWWA 3TBSB 3GIVB 2R29H 1T0MB 2VNCA 5EBWA 1EZVY 4KHTL 4YX2L 5IF0B 3RHWF 1DANU 2X89D 3SCMC 3QDJA 3T2NH 4G9FE 3B2VL 1I9RH 1N4XH 3HNSL 3CK0H 5BRZD 3RBGA 3KHQA 1D5IL 5IFJB 2W9EH 2PNDA 4TSBL 3DO7B 2W0PA 5EFIA 3AXLA 5DFTA 4O58H 5K9JL 1LK2A 1FSKB 2P5ED 5I6XC 4G43A 4MD5B 1PW3A 4FFWC 3HNVH 3PG2A 3DUUB 5D7JB 4O4YH 4N90E 2IPTL 3N85H 4X6EA 4LPXA 4AG4H 5JOPD 3UTSD 2YC1A 4LLWB 4PTUA 3G9AB 3UJJL 3S8WA 1ZEAL 4HZLA 2R0LL 1BD2E 3DX8B 3S96A 1I4FB 2ADFL 4H8WL 4XP6H 4XTRC 4OM0H 2GAZB 1UB6A 4NDMA 1RIVL 4K3DL 3SDAB 4LLDB 4NNPH 5T5NG 3D39A 5A1AA 4ZTPL 5EOCJ 2VDOL 1KJMA 3QXVA 2F68X 4MA8L 1Q8MA 4DOHE 1NANI 4BJLA 5E08H 2QR0B 4WW2C 5GGVH 3DX9B 6FABL 4LLMA 4OZHF 2EYRB 4P9HH 3BP4A 4M6MH 5JLZB 1ZOXA 3LS5L 4MZ2A 4JDTH 1LEGA 1OTTD 4JM2C 1YYLL 4TULH 4ZOEA 3DUSA 4ZG1A 5A2KH 1DANT 2PETA 3BH9B 1ZK9A 3Q5YA 4HJ0C 3KPNB 4QT5A 1AIFB 3FO0L 2E8ZA 3AXLB 1RJLB 1LO4L 4ELKA 4UILH 3WYRA 2Q1EA 2UVFA 4PJAA 1G0YR 3F58L 5IVXE 1CG9B 4OLXL 4LKXA 2X7LB 3P0VH 2W1NA 4QRUB 5AYUH 1P2CB 1KXQE 1XAUA 1AQDB 4P48A 1X44A 4RISH 3DO3A 1AP2B 1R3KA 4U7MA 1JI2A 3F6LA 1ERNA 1W72L 5B39G 4ETYA 1Q1JL 3G6JF 3RVTD 4JO1L 3ARUA 2Y6SD 2BCKA 4OCSL 1RFDH 4FS0A 2QQQA 4XPAH 3U0WH 3KPSD 2BNRD 2JE8A 4R96A 3S9DB 4HKZB 5IFHH 4PRNA 3LRSA 4NO0A 3VXPB 2XA8L 3W0WA 1ETZA 1GSMA 3D9AH 5DEFA 2NLJA 1QFWM 4MXQD 2R0KH 2DQEH 3VXRE 1WFOA 4OD3H 4KKAC 3RWDB 3SDDC 1INEH 1PBYA 3QI9B 2FX7H 3PWJB 5CP3H 4Q9RH 5K59E 2ARJA 3QUXA 3VGGA 5IHUL 4QT5B 1FL3A 4ODWA 4HS8H 4FOMA 5LG1A 2BNQD 2MQCA 4O51A 4LKXB 3L7FB 2Q86A 1LE5A 1YEKH 3IS1X 1WWBX 2JB5L 4LLYB 5AEAA 1FAIL 3T3PE 4JANB 3SE4A 4WI8A 4M93B 2A2QT 1O5DT 4UBDD 1QA9A 2CDFA 2CO7B 1MCQA 3Q1SH 1D5XB 3TYGH 1FG9C 4X6FA 3ZMRA 1I3GH 3VFMA 3MLTA 3F62A 1FDLH 1U8JB 1VFBA 3CDYA 3FOMB 4J7RA 3ZL4L 3QIWC 3N50A 1U92A 5FYKL 2IQAB 4WO4C 3LKPA 4LFHD 1RK1B 1EEQA 2PYEA 3GBLA 3LRSB 3HE7D 4JQIH 4MGXA 1ORSB 2F53E 1MCOH 3I84A 4O2CB 3FMGH 2R29L 1CFQA 1Y18A 5F6HI 1T3FA 1X5YA 3UX9B 3WIIH 4OGAD 4YHOH 4OCYH 1I9RL 1ZVHA 4JFHE 2FATL 2NXZC 4UT6L 4H8WC 1XR9B 4XWGH 3FQTA 3QG6B 1KLUA 3HUJB 1I8IA 3WIHH 2MHAB 4ODWB 2ITDB 1ZT4A 3HNVL 4WI7A 3KLHD 3RVUC 4O4YL 1TJIH 4JG1L 5D7JD 2D0HA 3T0VA 1NKOA 3BRFA 4YBLB 4QHKI 3Q6FB 1QTYT 5IWLC 2X4RB 2B39A 4TTDC 4X83A 4LSQH 4PY8I 1M6OB 2FGWH 3LN5A 3DIFA 2VISB 1N7ML 3GSVA 4OM0L 2W59A 1F8TH 1MWAB 4BZYA 4NNPL 5F7FA 1WBZB 3SDAD 3MLTB 3UC0H 2WLZA 1CDCA 5DHVA 1IQDB 1VFBB 1LEKA 2FLBT 4ZO8A 5E08L 4Z8FH 3VFSB 4TRPH 4MQSB 3IAPA 1TTGA 1UA6H 2BOCB 1CZ8H 4M62H 4M6ML 3UBXI 2BSED 2CXKA 4JDTL 1Y18B 3VH8G 5B8CA 5HXMA 1Z2KA 1Q9WA 2FR4A 3B5GA 1UB5A 4X6CA 4KV5F 1FNGA 4PV9B 5IMLA 2ZUTA 1N2RB 2HKFH 3FQXB 3BH8B 1UWEL 5DFVC 4RIRB 2KZ1B 1I8IB 3PV6B 1OSZB 1KOAA 1P1ZA 4OLYL 1MCKA 2VXSH 3GRWA 4G8GB 4J3SA 4NO2A 3GB7A 1EPFA 1ZA6A 4M6OH 4NZUH 5I9QB 1RUMH 2XZZA 5HI3C 2OZ4A 1I9EA 1Q9OB 3HLAA 1X7QA 1R5WB 4GQPH 5GGTH 3S35L 2CDGA 3PWVA 1J5OH 1G7MA 1K8IA 5E8OB 5IB1A 4PJDF 1BFVH 1A64A 1VFMA 1RULH 2DICA 3OGCA 2Q7YA 1KCVH 3LN5B 4JY6B 4NKQB 4P5KA 2R2CA 3HN3A 3RY5A 2WWMD 3DBXA 2ZUSA 1A6TA 3U0WL 5EPMA 2DQTH 1DQTA 4I9WD 1HXMB 1A6WL 5CINL 1KUMA 5DJ2B 5JW4M 5DZNA 5IFHL 1LEKB 3QNYA 3TA3B 3MV01 4YHPB 5D93B 3BE1H 1MVUB 4FQ1L 3S3JA 1AO7B 2DQEL 1DVFC 1YMHA 4PGJA 1B4JL 4OD3L 4KI5D 3AM8A 3GMOA 5B8CB 4QHNB 5EU6E 3QI9D 2HLAA 4Q9RL 5J1TC 3RDTA 4X6CB 4PG9B 3NAAH 1JWMA 2OP4L 5D2LA 1JF6A 4HS8L 7FABH 3TT1L 5FO9A 2E7MA 4NO2B 3AAZA 4XMPL 4OAWA 5DJXB 3HZMB 2EDQA 1F45A 5CJQH 2CDGB 4ZPVA 5C0JB 2JLLA 3DX6A 4Y2DB 5LKNA 1BM3L 1EK3A 2E9JA 5SX5K 5IB1B 4ONGH 5J9PA 2ED8A 3QDGA 5ID0B 1OARL 2VSCA 4Q9CA 3OGCB 2Q7YB 5EU5A 3MA7A 4ZDHB 3BRDA 1FORL 3DBXB 4PJ8C 1FDLL 4JRXB 3DETC 3CXHK 1MCPL 4NWTL 4E41A 1E6JH 4JGJA 1DUYB 1NFIB 4P3CL 4PJIB 4ZOBA 4S1RH 3FMGL 4E42A 5JHLH 3FQNB 4OZHE 4D9LH 3DSNA 3WIIL 2V5RA 1OLZA 3ZT7A 3C60C 4OCYL 2EYTA 5F9WB 2HLAB 3GRWL 5L7XL 3UEZA 1JWMB 4D9QD 3K74B 3L5JA 1IJ9A 1G6RA 3UAJD 1NLDL 1DFBH 4HKBB 4HIEB 3MCG1 3RFZC 1NAKL 1G1CA 3P9MA 5F9OH 1Z5LB 2WIMA 4I18C 1UQSB 4K8RL 2VDML 2D7NA 3WJLA 4Y4KA 3K8LA 1G9NH 3SO3B 2ZSVB 4P9HC 5J1AB 3C2AL 3DX6B 5D7LE 3B5TA 3QUXC 4PFEA 2FGWL 2GJJA 3GHBH 3G6JE 2EDRA 3ARZA 2ZPKH 4U1GC 1I3RB 1QHOA 3D85B 5IW6B 4H25B 3BP6A 2ZG2A 5GGVY 2NY1B 3O2DH 3OZ9H 4Z8FL 1Y6MR 3K2UH 5E2TH 4TRPL 4F7CB 3B9AA 3SE4C 3EYUH 4WTWA 3SHSA 4ZO7A 1UA6L 4E5XA 1KTLB 4N5EC 4NRYA 4HG4J 4OI9A 1D9KA 4M8QB 3NH7H 3ZKXB 4L5FL 2ZUQB 4BFBD 5MEQB 3I75A 4WV1A 1PYWA 5DRZB 3FJTA 2PW1B 4YC2B 2IFFH 4Y19B 4ZO9A 4Y5YA 2HKFL 5LBSH 4Y16A 3EUUA 2CLZB 1CBVL 3O0RH 1L0QA 4CMHC 4GG6B 2AJYH 4ZODA 1G6RB 2VXSL 3G08B 3IFNL 4MNGE 4U6HB 4G8GD 4UNTA 3N9GL 3UJIH 4P3DA 4DVRL 3VD9A 5GGTL 3U7YL 5DJ6B 5CHNA 2X5PA 4QOKE 3BD3A 5KAQG 2XKSA 2I9TB 1BFVL 1YNKH 3O6FB 3OTTA 3FFCB 3RL1A 1WC7A 2EO9A 4L3EA 4QHLA 5IVNA 2V9RA 2PW2A 3O8XB 4DUWA 4PRHE 1DBAH 3INUH 4PLOB 2CD0A 3QISA 3TJEH 2WK2A 2XKNA 1M7DA 1HH6A 2DQTL 2XQBH 2VKWA 4ODUB 2B2XH 5EZOH 5SWZE 3GEWB 3WHE1 2CR3A 5SV4A 3TA3D 4HULB 4WI5A 1KPRA 1RK0B 1DUZB 1AO7D 4PJXB 4L8BB 5IOPA 4E5XB 1G7PA 5SWQB 5F6IB 3MRDA 4O00A 1NMCB 4PJGB 4XZUA 1SJEB 1D9KB 2ICWI 4KJWC 2FWOB 3MRJA 3N1FC 4OFYD 3VXOB 4ZYKA 2X40A 1LD9A 1AHWB 3I75B 1PYWB 1HDMB 4H1LA 1PZ5B 5MI0B 5IKCA 4Y5YB 5TE4L 5FYKU 4Y16B 2X4UB 4F7PA 3LKRA 3FRPA 3IF1A 3UTTE 1LEIB 4P23B 2NY3C 1T7ZA 4IDJL 4D9RE 5E8EB 1TQCB 4UNVA 4MB3A 5CJQL 3U0PA 1Z0MA 1Z9MA 3DOSA 5T3XE 5BV7B 3O4OB 2AP2A 1R3IH 5AYQA 5C71A 4K3JL 3KHOA 5J4MA 5C7XL 2R69H 2PW2B 4AEFA 1RSFA 3TC9A 2DL2A 1F6FB 5L8KB 1FIGL 5J13B 2ITCA 1CGWA 4JRXD 2ATKA 2E7BA 2AJUH 5CFHA 3OAUH 1A1OB 1E6JL 1CGYA 3IJYA 3RNQA 1ZLUK 1F4HA 4LOUC 2MSPA 1G0DA 4KPHL 1MH5B 2DM7A 4S1RL 4LNRB 4K8RC 1HI6A 3WNPA 4D9LL 4U1MB 1KT2A 2R1YB 1V8HA 2Q3ZA 3M45A 2VLKA 1I85A 2EEAA 1ZLVK 1UKTA 4JHWH 2IWGA 5T5NF 2AEQL 4KV5E 1DQDH 2GEEA 4PUBL 5J89A 4IIQB 3VI4F 1DFBL 5I30H 4C56E 2D31B 4LP5A 3R06A 5CEXB 3O4LA 4U2ZA 5BV7L 3OXSA 3HC4H 1Q72H 3AM8C 4M43H 1SQ2N 1UKSA 1S3KH 3UYRH 5F44A 2QSTA 4S0TD 2GJZB 2VLJE 4ELMB 1BF2A 1OAUH 4TVSa 3RDTC 2VLLA 4XCCH 1S9VB 3TBVB 4PJDE 1IBGH 3FHAA 3O9WA 4JO2H 4XAKE 5DR5H 3W11D 5GZND 4R26L 1A6AA 1C12B 4KMTH 4WDIB 1DLHA 3K1KC 3RQ3A 4M1DL 1RQ5A 5J57B 3QHTC 3D85D 1B3JA 5C3TA 2CJUH 3OKYA 4N9GA 4X5XB 5I75B 4G6JH 3O2DL 3OZ9L 4NUJA 1AGDB 4Q6IC 4X4YA 2NY1D 3K2UL 3RNQB 4GRLA 1DEEA 4U1LB 5CZKA 1T22B 2ENSA 1OGAB 5GZOC 3TFKD 2EYSA 5GS0D 2JTDA 5AWNH 2AJ3A 5DMYA 5GRJH 4L3AA 1RHHA 3PIQA 2EKJA 5JPNB 1RUKL 1I3VA 2PTUA 2VLKB 2YA0A 3MROB 2XTJD 5DZOA 3WNNA 1BWWA 2PXYA 2M8XA 5CSZB 4WY7L 3RGVA 4KUCF 1ZHLA 4HUVA 1CFTA 3VGAB 1JTTA 1LMKA 1MHHA 5DUML 3S5LG 1M7IA 3DV6A 3W9DA 5ISZA 3UJIL 5HYJA 3C6LB 3MCLL 4P46A 2ZUXA 1EEZA 4L4TA 1VEOA 5HGHA 1JNLH 3OB0H 3WD5H 4UQ2A 5I8CB 2ZOKB 5INCB 2VLLB 3O6FD 5D72L 3BGFB 3FFCD 3ZSTA 1FL6A 4OFVA 1DQML 2NR6D 2XA3A 4CNIB 3O8XD 2NY4C 3L3KA 1A6AB 2GIYA 3TJEL 1OSPH 5CP7A 1DLHB 2XY2A 4XNMB 1MFBH 5MHSD 4QRRB 2IBZX 1E4XH 3RIFK 1I1FB 3VWKC 4ODBD 2WP3T 5AG9A 1XF4A 2B2XL 4Y1AA 5ESAB 4N9GB 4KC3B 1CDUA 3WJLC 4Y4KC 4GKOA 4PJ5B 2VITA 3QRGL 3MOBH 4YQXH 4X7CC 3S36L 4APQC 4GKZB 5CLWA 5L0QB 2X9ZA 3QZWG 1D9KD 1DSFL 3ARYA 1FVEB 1B0RA 2H6PA 3HNTH 2CUIA 2AV7B 5I8OL 3QEHA 1FFNA 1IFHH 4HGKC 1BX2B 3FCTA 4HUVB 4Y16D 3CDFA 3REWA 4P23D 1EXUB 4RA0C 3CCHA 1QR1B 3DV6B 5M7QA 1HHGA 4OUUB 1SBSH 5CD3A 5GPRA 5IQ9A 4JJ5A 1K6QH 2DD8L 5SV3A 1XF2A 1EEZB 2I27N 4IHOA 3IAQA 5HGHB 4I13B 4WV1C 3CU1A 3NCMA 4NCC2 4UQ2B 5FYJH 9CGTA 1R3IL 5IM7B 1QOKA 3TO2A 3K8MA 3FQUB 1NDGB 1UKQA 3Q48A 3STLA 3DTXA 2NY7H 3REVA 1T7XA 3WKNA 3D48R 3QH3A 1GHFL 1XEDA 4WI2A 1VFAB 2AJUL 2XACC 5INDA 1NUNB 1IC4L 3VD4A 2VITB 1U8HB 3OJVC 2GSGA 1HNGA 3VFNA 1D6EA 3BQUA 3RPIA 1FNAA 2D4FA 1FYHB 4TVPH 3ZHLA 5BS0E 2HT3C 1JPTL 5DJCB 2BFVH 1CICA 3E8UH 5KANI 3V7AG 3PWNA 1ACYH 1BVKA 2WQRA 4WIQA 3B5HA 3T77B 1ACZA 1DQDL 1IL1B 3P0YH 1N59B 3NZ8B 4I3SH 4MLIA 1A21A 3HAEH 3QPXH 4PB0L 3REWB 2EDJA 4GKNA 3E2HC 3GI9H 1J11A 3CCHB 3OL2A 3T0WA 3HC4L 4YGAB 3GMNA 3QEQA 3BKMH 5I1EH 4M43L 5CD3B 1YUHB 4PP1C 4XT1C 5CWSA 3SEPA 5IT2L 3ZTNH 3GSXA 3U79A 4OZGA 3BW9B 4JB9H 1O7SA 4DKDC 2FJHB 1KCLA 5CGYD 5AD0B 5I8KH 4O2FA 3CSGA 5DR5L 3CXDH 3TO2B 4F80A 3A6CH 3BXNB 3STLB 3KXFE 1WIUA 4KMTL 4U3CA 4IOIB 2DWDA 3GNMH 3MRFA 3REVB 3ZKNC 1YEGH 2PTTA 1AGBB 5F1SA 2CJUL 2RQ8A 2HVJA 3THML 1NLBL 3VXUA 4F7EB 2AEPL 2IANB 1JHKH 5E7BA 4U7KA 2WSKA 4JRYA 4F58H 1OGAD 2GKIA 4WFHD 1V7ML 4TOYH 4IOFC 4U6XA 3JZ7A 5AWNL 3BQUB 5KSBF 4PPTA 4YBQD 3D18B 4CN6A 3DVNA 5MEPA 2VLKD 5I1HL 4XP1H 1KSRA 4S1SH 2YPLE 4M7KH 3PWNB 1P4LB 1Z6JT 1BVKB 3N1MC 2Y4SA 3VA6A 5D6CA 4KQ3H 4DUXA 5E8PA 1IAOA 5F7LB 1GGBL 2B0SH 2X4TB 5L6YH 1AD9A 1OCWH 1U58A 2VDQH 3MJGX 4ZS7L 3IS0X 3C6LD 1RZFL 3QEQB 4XCFH 3NCEB 1I85C 1JNLL 4KRMB 4DZ8B 5FO7A 1JNHA 2A73B 2CGRL 3LKQA 1VEMA 1BHGA 1ZMYA 2MQ0A 3WN5B 5BVPH 4ERSH 2IMMA 2HJLA 1OSPL 2R23A 2DWDB 4UOJA 3MRFB 1WISA 1JZ3A 5GGRY 4MD0B 1NCWH 4QRRD 4HK3N 2PTTB 5C8JB 1EBPA 3VFUA 2HVJB 5DRWA 4R3SA 4G9FB 3VFOA 1D5ZB 4PJ5D 3MOBL 4QXTA 1KTKE 3B43A 3KVQA 4G6AD 4YQXL 3X14A 2JB6B 3O9WC 1KFAH 1QLRB 1YYMH 1MIML 1LVEA 1IGCL 4L4VE 1JPFA 4RFEA 5EWIL 4AEIH 2DBLL 5FUCC 5ID1A 2F54A 3BHBB 3DVNB 1EZVX 4QXGL 4UUJB 3R1GL 1I1AA 3UMTA 3AMLA 4S0SD 1FLRH 3ARBB 4JFOB 1QNZL 2XN9A 3EO0A 4GRLC 3K0WA 2FHBA 1W2KT 2BERA 1X5AA 4LVHC 3VI4E 1BD2B 1JF1B 4MYWB 1AD9B 1U58B 1GYAA 1N6VA 1K6QL 1LWRA 2YS4A 3DJ9A 1JE6A 1A9BA 1A6VH 1CTOA 5IW1A 1DLFH 1P53A 1I9IH 4L8SC 5KTEL 3LKQB 2PXYC 1TJHL 2W60A 4UV7H 3P0GB 3RGVC 4K94H 4DOHB 3FONA 3OMZA 3SKOA 4G7YH 2CIKA 1A7QL 2NY7L 1KLGA 1VGEH 4BFEA 5HGBB 4KVNH 3VCLB 3WFDH 3VXRA 3W39A 1S7VB 1T5XB 2FL5B 5E8DL 1MJ8H 4P46C 1G1YA 2AGJH 3HI6L 4JHBA 3WFHA 1S7UB 3I85A 2VE6B 1ONQA 5L2KE 4QXTB 1JV5A 3V6OA 3I3BA 4AT6A 5I66A 4XCNB 4TVPL 4RFEB 2EZ0C 3OKNA 5E9DA 3E8UL 5IVXB 5JORA 2BMKA 2ZJSL 4NZTH 1RJZA 3AB0B 3SGJA 3SN6N 3ZE1F 4FFVD 4UDTB 3P0YL 2BVEA 1E4JA 3UTZB 1VB9A 3O45B 2DTMH 4DKAA 2A6KB 3RKDD 2Q87A 5I1EL 2EIBA 2A6DB 1V3LA 1KNOA 43C9B 1A4JA 4JB9L 1I9JL 4XWOC 5I8KL 4WEBH 4CRPA 3CXDL 5F3BA 1IEBB 3A6CL 4MQTB 5MERB 4KK8C 3H9SE 2CIKB 3TJHD 3BJLA 2F53A 5IP4A 1YEGL 3VXRB 4EN3C 3D0LB 2DLFH 2Q6WA 3IXTB 2VN7A 1H3WM 1BWMA 3WFHB 2EIDA 5SWSA 1E27B 1ONQB 2IAND 5C0EB 1NEUA 4HUWB 5KAQF 4TOYL 3BDBA 3FO9B 1EAPA 1FFPA 4AT6B 3BQUD 2E9BA 1OQOA 1YN6A 2IAMB 4Z7WF 4X7TA 5D2NE 3EYFA 3MJ9H 5HDBF 5IESH 1IM9A 4HGMA 5JORB 1XGTA 4XCEB 3AC0A 3GMPA 4N8VA 1CD1B 2EDBA 2E7LA 1IVLA 4KQ4H 4HLZG 5A2JH 5EIVA 4K3GA 5FYJE 4KXZI 2B0SL 5IB5A 3GM0A 5BO1L 5I1IH 2VDQL 1WGOA 3LRGA 2NCMA 3QQNA 4DTGH 1HXYA 1WK0A 3B9EA 3VD3A 2O93L 5DMIH 4H88L 3QEQD 1LO5A 2IBBA 2OTPA 1CICC 3NZHH 3LB6C 1U8IB 2Z8SA 4P2OB 2VL4A 3CH1A 1A4JB 5D1XB 3ZDZF 5BVPL 4DQOL 4ZUUA 1QZ1A 4ERSL 1NBVL 3RIAK 3FFDA 1TQBB 2V7HB 4BUHA 2R9HD 5J6HB 3HE6B 4I3GA 4FQQA 3LMJL 2F53B 1K3ZA 1J88A 4PP2A 1QHPA 1N0XL 1ES0A 1BBDH 4BFGA 4G9FD 1HQ4B 3SGEH 1S9XB 5DS8A 1UXSA 1A7BA 3CFEB 4Z7VF 5B4MD 5HHPA 2VZTA 3L95B 4WVRA 1JRHI 3SE8H 1DTUA 5CZXD 1YEEH 2VAAB 1FJ1A 4Q58C 4N90D 1EMTH 1A3LH 1KV3A 2FX9H 2W65A 4MS8D 4FTVA 3ARBD 1BZ7B 5DMKA 3OKMA 2KUTA 3OKEA 1PY9A 2XZAL 1QFUH 3KYKL 3C6SA 3DECA 2XIDA 1IEHA 4N0CC 1BD2D 2NZIA 4JO4H 3KJ6L 4G6FB 4XC3L 1HXYB 2HTLD 1LO5B 3WO4C 2QQKH 1DLFL 3WFZA 1DQQA 3VDAA 3U2SB 4ZQKA 1PQZA 5T1KA 1IM3A 3HI1A 2NY0C 5JXEA 2BRRH 2OI9B 1JGVH 4UV7L 3ARWA 5E00A 4OV6F 3OGOE 2XI9A 1OT1A 1Z3GH 3L5HA 4FQQB 4KVNL 4EVNA 3RI5F 4JGUA 4WENB 1CLOH 3J8F7 5GSVB 2AGJL 2AV1A 3WUWB 1ES0B 2MJWA 5EO9B 3Q5OA 3U6RB 4PTTB 3VA2C 2YD8A 5IFAL 1Y0LB 3RY4A 4YDVB 5DD6A 3BEVB 3MLYH 3KPTA 2JJUA 3VWJA 2IMNA 3EDFA 1BQHA 1A5FL 3BP5A 3QDHA 5HHPB 3UJTL 5KSBE 3KPQB 3ARFA 4LCCB 3STZB 1WSST 2MCPH 1FJ1B 1MRDH 5DK0B 3HRZB 2E27L 3WIFA 1Q0XH 2VDLL 1C5DA 3ILQD 2R1XB 4F7TB 3OX8B 1GGCL 2W65B 1B0GA 3CGTA 2DTML 2A77H 2F8VA 3RJQB 5IEHA 1HWGB 2BSTA 4QWWD 3BUTA 3DX7A 4LRNL 3ZDXF 1S5HA 3QWRA 4Z78B 4TUJB 5I8EB 2FHCA 4NRZA 4XBEL 5E5RB 4FQHB 1CDJA 2A9NH 2BRQA 4JKLA 1MEXH 1I1AC 1PQZB 2AJXH 4AIOA 4JDZA 3HI1B 4OD2A 2PF6A 5IGXH 2QKIB 3D69A 4MQ7B 4IGBB 5E00B 4JDVA 4JFEA 1MCIA 3MJ7B 4DCQA 1IGJB 1BZ9A 2EH7H 3VXRD 3QCTH 4YHNB 1IRAY 5EU6B 3ZKMC 1WIOA 5GS2H 1QQDB 5B38A 3SGDI 3TO4A 4BZ2L 3WFBL 3FO1B 4K9EL 1KCRL 1BQHB 1T2QH 5C6WH 4LASL 3AMKA 3TN0A 4K71B 2IAMD 1MQKH 5GISL 5HYSG 3FB5B 4X99A 5E9DD 5DVLA 2Z93A 4RAHA 5IESL 4X7SL 5T1DL 1CD9B 4OZ4B 4JZJC 5D7LA 1T2JA 1A7NL 4I5BA 5DJDA 3X12A 4YNYA 3V6OC 5I1IL 4WTXA 1MAJA 2BSTB 1P5UA 5FB8A 5TDOA 5HPMA 1MCJA 5AZEL 1XGRB 2DQCL 3G5YB 4U1HA 3SGJC 1J86A 4P2OD 2DI9A 5D1XD 2LE9A 4GUPA 4JDZB 4BSJA 3U4EA 1IE5A 2IQ9L 3HE6D 4JDVB 5E6IA 2F53D 4PJHF 2EO1A 1HZHH 2R4RL 4KKNA 4CMMB 4OZHB 2OL3B 4ZO6A 4BSVB 1Q9KA 3TPUA 4TUKL 4HIJA 3SDCA 3T0EC 4JFHD 2Z4QB 2NZ9C 3OBAA 1IAKA 2KZWA 3PUCA 1FVCA 5K9OB 2ZG3A 1ZTXH 1IAIH 5FOBA 3TN0B 5FA4A 3MNWA 1YEEL 5CKAA 1OTSD 5L2JB 3G9VA 5H35B 3OKOA 4X99B 1A3LL 3O6LL 4KK5C 3LEXB 4NKDA 3ZE1E 1AQKH 3V2AR 5BOPA 1ZLWK 3MUJA 5TDNB 1FNFA 1QO3A 5D7LB 1FE8H 4I5BB 4NCC1 2HKHH 4JO4L 5I1GL 4PRHA 1WFTA 3EFDH 5JDJA 4G6FD 3GBML 4MAUH 4RBPK 2AEWA 5TDOB 3G6JB 3PJSB 3V10A 4XGZA 4LBEA 3O3DB 4JHAL 2Y36H 2Y72A 4PGBB 4D0CA 4PD4K 5SWZA 5C0RL 1PLGL 2E7LC 2UYLA 4OGXH 4GUPB 3EJZD 1EDQA 5H2BA 4JCMA 1MQ8A 4KROC 1DL7L 4ORZC 2UZIL 5E6IB 1DQLL 1TVDA 4L29B 4KK6D 2ZKHL 1J0KA 3QP3A 2G2RA 1YEJL 5I16B 4HIJB 2VXQH 4JJHA 3MRQA 1IAKB 4OFKA 1FVCB 3UTTA 3KAAA 4QKXB 5HHNB 1UZ8A 4NSKA 2P8PB 5FOBB 4MNGB 5HDLA 4MA3A 2RGSA 4Z7WE 1XCQA 1V7NL 1N3NB 3QO0B 5HDBE 1BEYH 2L7UA 3MRBB 4K2UH 4NC2B 1F3DJ 1G7HA 3FRUB 1Q0XL 4QOKB 4NKOA 1JZ4A 2X2YA 1ZE3C 4FMKA 2A77L 4MQXD 5H94A 4MNHA 4EXKA 4Y5XA 2FJFB 3G5VA 4PRHB 4MXVF 1AKJB 2OM5A 3E0GA 4M8VA 3RU8H 3WDHA 2C3XA 2I5YL 4K9EC 3ARPA 1MEXL 2AJXL 4HMEA 4D0CB 1UC6A 5SWZB 3ZDZE 4EI6A 1HILB 3K7UA 4XNYH 2OLDA 5HGDA 5H2BB 4OF3A 1K5NA 4IGBD 3G5XA 3NFSH 4WTZA 4JREC 1A1NA 4YFDB 2UZXB 4YWGL 5EU6D 3L3IB 1X5IA 4M7ZB 5JXEC 4HUXA 4NQSA 3HR6A 1T2QL 2X4NB 4BKLA 3PP3H 3R4DA 3UTTB 5T33H 4HQQH 4Z7VE 1KENH 1A47A 3JTSA 1MHPH 3LEVL 2C1OA 2Q20A 3VRJA 2NXYB 2VDRH 5F9DC 1MNUH 1KLFA 3SKNB 5FK9A 1MF2H 4GQ9H 5J56B 1XGQA 3G6AB 2VLJA 2ZCHH 4BQBA 5CBAA 1TVBB 2J88L 4UT7L 1WWAX 3QNZA 3VWJC 2DYPA 4LGRB 4X8XA 2ADIA 4QRTA 2FECI 2BNUB 5I18L 1INQA 1T83A 5D71H 1RU9L 3RAJH 3ARFC 4YDJB 1ITCA 4RMVA 4UOW1 3QHFH 1LQSR 1HKLH 4QTIL 3RIAF 5FGRA 1JUFB 2X9YA 1NGQH 4JFXA 2LTQC 4KKBD 3IFPA 4HF5H 4QCIB 4Y5VB 3S37L 3FT4A 2P24A 3CVHA 2W0KA 2VZUA 4G42B 4MDIB 4U1IB 2YEZA 1H5BC 1SY6H 1A1NB 1KCUH 2Q3AA 2QV2A 4WU7B 3DVFA 3VXMA 2MPAH 3O3AA 2WUBH 4NQSB 2YXFA 3ULUF 4BKLB 1A7PH 1IAIL 2JIXA 5DMGD 5T3XL 4C56B 3TN0D 3JTSB 1AGCA 4U4BA 3FT3A 3GJEA 3HI5L 2C1OB 3TCLA 3VRJB 4M4PA 4MA7H 4PRAA 4JPIA 5FK9B 1XF3B 3SBWA 1ZKAA 2E9IA 1XGQB 1LO3H 1FE8L 2VLJB 3BVNB 1QSEE 5E8NA 5D7LD 4NHCH 3O3EA 4GLRH 3TO4C 4PJDB 3ULUH 2UWEA 3QNZB 5CEZH 2DYPB 3NCCB 3EFDL 4S1DD 4L8CA 2ADIB 3ZDXE 2R0WH 3KDMA 1OF2A 1NBQA 3QA3A 3I50H 3EO9L 4LARH 4J2XA 4L3CB 2BVPA 3HHRB 1HSAB 4N0UA 1JYWA 1BGXH 1BQLH 2QSCH 1AJ7H 4TPRH 5E4IA 4RX4A 4U1NA 3V7MA 4OCLC 4JFXB 4LCUB 3LPWA 3IFPB 1TNMA 3EYOB 2P24B 3CVHB 3VWKB 5BOZG 1JZ5A 3LN4B 5E6ID 3RWFB 1N26A 1X5HA 4FZ8L 4UDUA 2PYFB 2AJZA 2VDKL 1CL7H 3LHPL 2ICCA 4LIQL 5HHVL 2GY5A 1I1RA 2FO4B 4XI5C 1MLBA 4DFHA 5J7CC 1T5WA 3SKUD 5D7IA 5GJSH 3HZVA 1SJHA 4WHTA 4YDIL 3T4AA 3ZO0A 1TMCB 5DJ0B 4KAQH 4PJEA 3TVMA 5ITFA 3CZFB 1BEYL 1T0NB 4I0PA 4PB9L 5FUZL 1NFKA 3F5WB 3EYQC 4HPYH 5KVEH 2FEEI 3O6MH 4JPIB 4PRAB 1WTLA 4NWUL 5JMOC 4QOKD 5DDHA 1S7XA 3SDCC 2D7OA 4Y4FC 5HY9B 3O3EB 4XP9H 1Y6KR 3ZKSD 1V3MA 4PRHD 1GRWA 2DI8A 2HH0H 2AXJA 1AKJD 1OF2B 4IMLA 3MV9E 5ECJE 4Z7UF 4N8PA 5SWZD 4J4PA 1N5AA 4XNYL 1EEUA 3SDXF 5E1AA 5IIEB 3NFSL 4UAOC 1YY9C 2YPVL 4PJ7F 4R2GB 3TBWA 4PJHE 5BS0A 4L9DA 2P5WA 5FOJA 4O9HL 5DO2D 4OD1H 4O02H 4M9OA 1KG0A 1OP5K 4JKKA 5DGQA 1AXTL 1CGVA 2BVQA 4KGJA 3EOAA 1MHEB 4IM8A 1TPXB 3UTTD 4CGTA 1SJHB 5C0DB 4NQVA 4PRDA 4KI1A 4EXPX 3TVMB 4XNXH 2VDRL 2Z35A 4D9RD 1MNUL 2NXYD 2QJDA 1DEDA 1MF2L 3CSYB 3QSKB 4GQ9L 4WFGE 2ESVA 1YN7A 4UTAH 1NFDA 2ZCHL 5T3XD 1NCBH 2H2PD 1QFPA 4XXDA 4NJAH 3SDYH 3EOTL 3MUHL 5D71L 3GBNH 4XHJC 2CRIA 3LRHA 2H45A 3PDGA 1E4WL 1B2WL 1UVQA 3QHFL 5C9KA 3F7RA 5ITBH 4OZFA 5JW5A 3MJ8B 1MRCL 5HI4C 3VFVB 2GK2A 1NGQL 4NM8H 2NY6C 2D7TL 1K8DB 2RB8A 3PHQB 4B0MM 2ERJC 4Y5XC 4XNZB 5DQDH 2F6AA 3TBWB 5BS0B 1FN4A 3P2TA 3B4NA 3PV7A 3IGAA 1KCUL 3QCUL 2FNBA 4X7DC 1A3QA 1YEHL 4P3WA 4MJ5B 4PBXA 4F7MB 2WUBL 5F88A 2Y07L 2PCPB 2VOTA 3JTTA 5JDSA 2Z1PA 4KY1H 5DJ8A 5FM8A 2VR4A 2WUCH 1D5BB 2HRLA 4I2XE 4NQVB 4GRMB 4C56D 4ZFGH 2XWBA 4X6BB 1ZT1A 5EC1B 4GMSH 2CXGA 1EAJA 4QXWA 3N1PC 4JY5L 4YAQA 2Z35B 3QUYA 3MUGB 1CE6A 1RPQA 3BKCL 4HDIA 1BECA 4XRCB 4UMGA 2NTFA 1YN7B 2NW3A 4Z77B 2GK0A 4J3OC 4KVCL 2VLJD 1B88A 1D5MA 1JMZA 4XAKD 3M1BA 2DYPD 2GQHA 1IC1A 2R0WL 1X5XA 4KJYA 4NQDE 3GMQB 1J1OH 4LLAA 4MXVE 1GJIA 4RRPG 4Q74A 3I50L 2R1WB 2XWTA 1YJDH 5JW5B 4OZFB 3NIFF 4HIIA 1G7QA 2GHWB 2H32H 3DRQA 1NGXB 1BQLL 1JIBA 1AJ7L 2QSCL 4R7DA 3O2VL 5KSAA 5LQBL 1QRKA 4X80H 4PRBB 4L4VA 4YHKL 2G60L 4PYHA 1T83C 5ENWA 5DZ9A 2Z91A 4YFEA 3IGAB 2FO1A 4W6YB 5KW9H 3BZFB 1NGZA 4BQ8A 2YPLB 4OLUH 3TT3H 2I60L 4F33A 4ZAKA 2DRUA 5JW4R 1TZHB 4OLZH 3GJFH 1AD0B 5F88B 1HSBA 5JDSB 3QWOA 1U8NA 2ILLA 1IGFH 4LMQE 5DJ8B 3L3GA 2AK1H 1YEDA 2AJSL 2OK0H 2WBJA 4KRPC 2NW2B 2XWBB 1FYTA 1R3LA 2WIIB 4YAQB 3KPRE 3QYCA 5KVEL 1U8QA 4HK3J 3RTQB 4MLSA 1MFDL 1OD7A 3MRRB 1P7KB 2NW3B 4M6NH 1D5MB 4WU5B 4ETQA 4N9OB 3VFGL 4NKIL 1IC7H 5DD0H 2HH0L 3KPLA 1NCAL 4MZ3A 4I48B 1E0OB 3HMWH 1BLNA 1NSNL 3PHSA 4U2YA 3RZWA 1C7TA 2AI0L 4JZNA 1ADQA 4MNQA 4R97C 3DYPA 3QEGH 3B3IA 4MB5A 1J1PH 5JW4Q 1CE1L 3IDGB 4I4WA 3WV0A 4L4VB 2VQTA 4R2GD 3QHZH 4QHMB 8FABA 2P43B 4OD1L 1MI5A 5B39A 3C09C 3X13B 1JGLL 1I75A 4LSRH 5CEYA 2CRYA 3EJJX 3MODL 4XVUC 1P9MA 3PP4H 4NQEA 4G8FA 4NHUB 4K07A 1XF1A 3QWOB 3ULUE 3MREA 1OP9A 3OR7A 2WWKO 5CEZE 4ZTOH 1FO0A 3L3GB 4N0YH 3VGEA 4MJ6B 3OPUA 1UACH 3TVMD 4YDKL 5FKAA 4I0PD 5C09E 1LNUA 3DROA 1ZT7A 3GSQA 2NYYD 4HWBA 2OMNA 4XP5H 2ZCLH 3L5XL 3NBNA 3T8XA 2BOBA 5DVMA 5E99L 4LP4A 3SDYL 4ETQB 5C0BA 3NACH 5I17A 2LVCA 4P49A 3KPLB 3U1SH 1JPGB 4EUPH 5CUSL 3NA9H 2J4WH 4YGVB 3LV3A 43CAA 2BVTA 1CFVH 1GZPA 2AAVA 3JV4A 3VMOA 1H3UA 4NM8L 1MELA 4JZNB 1KJ3L 4OJFH 5ESQA 4FQXC 5L2KB 1NANH 4CU8A 4N0FA 4KDWA 2BK8A 4I4WB 4DZBA 3O3BA 4HJJH 5BS0D 1IGIH 5D2NA 3ARVA 3DGGA 1ND0A 2CO6B 4ZUVB 4CVUA 5B39B 2X4PA 3HZKA 3ESUF 4U0RC 4IJ3C 3GMMA 5LJYH 4XPHH 5CEYB 4HAFA 4CU7A 2FZ3A 4J4PC 3VRIB 4G8FB 1YEFL 1LK3H 3MREB 5E2WL 1FZOB 3MRLA 5DC0A 4ZFGL 1CT8B 3MNZB 3T65A 3OF6A 5DD3H 5FKAB 1ZV5A 4E0RA 1LNUB 1V3KA 5BZWA 1JNJA 4FQJH 5CLTA 5HHQB 3DROB 3A6BH 1ZT7B 2VSDA 3GSOB 3QJHB 1TETL 1MPAH 4P2QA 3WLWC 2OYPA 3IDNA 3H42H 3QEUA 4H26A 3H9SB 3IB4A 4HKXB 4JPWL 4QTHB 4L9LB 5ERWA 3MGOB 4XPFH 2RAMA 4JN2B 1DQJA 5T5FH 3QXWA 2APXA 3MXWH 4Z7UE 1GZPB 5IV2A 3JV4B 4JM4H 5DRNA 3SDXE 4EUPA 4X4MA 5ESQB 4X80L 5E5MB 3MOAL 2BHUA 2LABA 3BPOC 1HCFX 2PO6B 4PJ7E 1PG7L 4GS7B 4DN3L 5D2NB 2H1PH 5HYIA 5FFLA 4GOSA 5KW9L 2EDTA 4OLUL 4OQTA 2YPLD 2R0ZH 1FO0L 3HZYA 2VLRE 3B8SA 3CPLA 1CS6A 4A6YH 3GIZL 4YIQA 3RP1A 5HD8C 4M7JH 2HG5A 1IKNC 2AK1L 1UYWL 4ODHL 4LSDA 4HWBL 4JR9L 3MRLB 4DKEH 3UO1L 1WZ1H 5JA9A 3B2UD 3VXQA 3T65B 3ULVF 1B6DA 2Q8AH 4E0RB 4MCYA 1IZJA 3RTQD 3VH8A 1W8OA 4P57A 1S78D 4M6NL 1AY1H 5J11B 3TBTB 3O6KH 2AK4E 1ZA3B 5C0ND 1S9WA 3IDNB 1VACA 5FF6A 2D2OA 4H26B 4E9LA 4NFBA 4OB5L 4U49A 5AUMA 2Y7QA 5C08E 1NL0H 1Q38A 3VXSA 5IR1B 2Z92B 3HMWL 5ERWB 4YDLC 3QUYC 4HPOH 1RMFH 3W82A 1P6FA 2EE2A 2VLME 4RGMB 1KB5H 3EOBA 1J1PL 1N64H 3VD7A 1ZVSA 3VDBA 4ONHA 5DJAB 4Z95L 2C26A 3OXRB 4L4VD 3QHZL 1GOGA 1RV6X 35C8L 3EBAA 4NC0B 5DUBA 1LO0H 5J8OA 4MJ4A 1TVHA 2OTWB 1EHLL 5L9DL 3R0NA 3AREA 1G7IA 3IU3A 5ADOH 1F4YL 4LCIH 2X42A 3LQAH 3CPLB 3MBEB 4YK4C 3KPPB 3BAEH 3P4OA 5JIIA 5KSAC 1JL8A 2FIRT 4CADA 1BJ8A 4ZTOL 3CFBB 1INDH 3MLVH 4N0YL 1U8KB 1UACL 2QQNL 2XY1A 1OP5H 5KVGL 4A6YA 2WZPD 4UQ3B 4M7LH 4IMKA 5E4EB 4NQCE 4FG6D 4JZOB 1UH3A 2NY2B 3S3SA 3VH8B 3I3EA 3QIUB 4YXLH 1NUDA 4ZAKC 5IBTH 5T1LB 2F9BT 1CYGA 2J7LA 5F9JA 3DRTA 1QLFA 3VU2A 1Y6NR 5F1IB 2WBJC 3NA9L 1TENA 2EH8L 4QRQA 3NIFE 5F89A 5E1HB 4OJFL 1AGFA 1FFRA 3L7EB 2LAAA 1R3JA 5L2KD 3D0VA 1U41A 1A6ZA 4GAJH 4OQTL 3DSFL 4MJ2A 4HJJL 4R7NA 5KSBB 3LH2L 3U7WH 5IMMA 2BJMH 4XX1G 1OM3H 5IJVA 3CZJA 1L6ZA 3SKMA 4HHAA 1QD0A 1A6UL 1IGTA 4UOW0 4XPHL 3MCKB 3WUWG 1BIIA 1YECH 3IU3B 3N06B 1LK3L 5EO0B 4KUCD 1YJDC 3FN0L 3LS4H 4LSPL 3VG0H 3NCFB 4J3UA 5TE6L 1NAMH 4HC1A 4GW5B 1NCNA 3L9RA 4HH8A 4PBWD 3BN9C 1AR1D 5DD3L 4NO3B 3W5NA 3A6BL 2I07B 5DC4B 3MNVA 4JFPA 1MPAL 4HZAA 3IDXH 1P9MC 3MGTB 2V5YA 3H42L 4S10A 3K4ZA 4FABL 2X70A 4LCWE 3H9SD 1C5BL 5TE7H 3FT2A 3SKJL 4EBQH 5C0CE 4GW4A 3MV8A 5T5FL 2DL9A 3JXAA 2HLFC 1QVOB 2NTSP 1QSFA 2A6IA 3BEWA 4QRQB 4HT1H 1T66C 3TZVA 5GIRA 2EEDA 4RAVB 1ZSDA 1R3JB 4OCXH 2H8PA 2Z9TA 2J5LC 2PO6D 1BMGA 4R7NB 4LPVA 1BJ1H 3WSQH 3OAYK 1VERA 3LQZA 5D1QA 2R0ZL 3RVWC 4LVNB 3SKMB 2VZ1A 3UBXA 3WDJA 4KZDH 1QUNA 2F74A 4DW2H 4NNYA 4A6YL 5FYJD 4M7JL 1HINL 3DMMB 1RUPH 1V05A 3QUZB 1D3CA 1VADA 2Q8AL 5C9JB 3MMEB 3L3OA 3FL7A 4BSWB 1WCBB 2BXYA 4POZD 2APBA 1JGDA 5HVHB 3KYOA 1YPZF 2CRMA 4RCAA 5E5UB 2IALA 3DXAA 2X70B 2AABL 5I2IA 5KS9F 3MLXH 4TNWF 4S2SB 1CK0L 4HPOL 4JFFE 5IHBA 3B8YA 5FCSH 1FFOA 2A6IB 4EI5B 1F4WH 3FB6B 5ACZA 1HHHA 1A7RL 3V4VH 1MUJA 3DURB 2DB8A 3CLFH 4LLQB 1HYRC 1LO0L 3NPZB 5FYLL 1HN1A 1J05A 1SVCP 5IB2A 3OAZH 1ZGLB 1G0XA 1ZXQA 3LQZB 2IH3B 5D1QB 5CGTA 2CMRH 1NC4B 5BZDA 3AFLA 3PL6A 4FQCH 3V4UH 3B9DA 5TGBA 4LNVA 2E9WA 3BAEL 3MBED 3DV4B 4MX7B 4U6YA 5LXGH 4YJZL 1A2YA 4F15C 1HYSC 3CNKA 1BVZA 3KNBA 1ZWIA 4R4ND 4X0KB 4XB8A 2VXUL 5HGAA 4ZFFB 3V6ZB 4GBXA 5EOTA 4GT7A 2H9GA 1WFNA 2Y5EA 1OY3B 4HIXH 1EFQA 3MQIA 2NY2D 3QIUD 3SY0A 1MCBA 5JUEH 5D1ZA 5TFSL 1RY7B 1CFNB 1U3YA 3Q6GL 4O5LH 1RUAH 5T1LD 3IDYC 4NN7C 1UJ3B 3MSPA 4V2CB 2D9CA 1G7LB 4KRLB 3FOLB 5I2IB 1QKZH 1A0QH 2X10A 1Q9LA 2A74A 3KGRA 4P4KA 3T1FB 4FA8A 4LEXH 1TDQA 1YQVL 1N0LA 4HFWA 2J3SA 1PEZA 4LEOB 4J12A 4CBPA 4GMTL 1ODAA 2K1MA 4LVEA 3U7WL 2BJML 4Z7WB 1OM3L 2C3VB 4K3EL 4LF3A 2EICA 2WINA 3KG5A 3PL6B 4QGTA 5TGBB 1CFBA 1R0AL 5IJKA 2ZG1A 3ARRA 3PGDB 4G3YL 3KNBB 4F8QA 1ZWIB 4DEPB 3GO1H 5AAWA 3ULVE 4P2RE 3OJDA 1J12A 2YRPA 4GBXB 5DXWA 5HI5D 5KSVA 3IDXL 3AREC 5BXFB 4WFFE 5TF1H 1BAFH 3QFJE 3MTRA 4MCZA 5DHXB 1PX4A 1VCAA 4JVPA 4PS4H 1A7OH 1JFQH 2O5YH 5CILL 2J8HA 2MKLC 5TE7L 3VFRA 4EBQL 3PDDA 1W0YT 5FO8B 3CC5A 3RBSA 3VMNA 1MLCA 4JFDE 4IMKC 5CMAB 1H8NA 2JCCA 2H3NA 2DN7A 3IT8D 2QADB 2VH5L 1GPOH 3RRQA 2HN7B 3FB7A 3MFFA 3Q3GA 1J8HE 4OCXL 3MRPB 5HHOA 3MX0A 2DLHA 1A14L 4DGYL 2VABB 2YK1H 4Z7VB 1WEJL 3NCJH 5IMKB 5CGMA 4L8DB 3V6BR 3WSQL 2GJ6E 5EOCL 3MBXL 1F02I 4LF3B 2D03H 4NJ9H 4EDXA 2P44B 2CLRA 3CFCH 1QSEA 3EHBC 2FEDD 1RUQL 4UIKL 1J0JA 3DMMD 5D7SL 1Q0YH 5DYOA 1UM4L 4YHML 3QUZD 4IRJB 4NOBA 5KOMC 1OL0A 1XF5B 4MCZB 1N6QL 3FZUC 4HFUL 2OS7A 7CGTA 5EBLA 1EGJA 1PKQE 3C5ZA 1RI8A 2RBLA 5DVKA 4KJPD 3SJVE 1DBBH 3MLUL 1HIML 1PX3A 5IEKA 4WW2F 4AMKH 3WXVL 2HJFA 4OSUH 1ZGLM 3OKKB 5FM5M 1OTUD 1MLCB 2YXMA 5GHWH 4WUUA 1RZGA 4LDOB 3MACH 1L9MA 4LHQB 1F4WL 5F7EH 4JM2F 5DJYB 4EI5D 3QCVH 2H3NB 1AE6H 4QGYA 4R0LA 4Z76B 4LHUB 3V4VL 3GSNH 5DMJB 1CQYA 2DJSA 3GKWH 4M48L 4M61A 1H3TA 4KJQD 3VMPA 4P9MH 3V0WL 4F57H 2VXTH 4LHJB 3RZCB 1QSZA 2NX5E 4TQEL 3RL2B 1KELH 3PABA 4JN1H 4CW1A 5D1QD 4EDXB 2XZQL 1NDMA 1U8LB 1NC4D 2CLRB 3DHMA 4NP4L 1J18A 1QSEB 3O3UN 3D25B 3L3HB 5EBGA 1KPVA 3TZVC 5LXGL 4BZ1H 5EZLB 4XVTH 2BHZA 1FAKT 3K4DA 5A43C 5EORH 1GXEA 4MAYC 1IKFL 2M1KA 1KXTB 2Q76A 4G9DB 3MV9A 4KTDL 1XZ0A 3QZWA 1L7TL 1CLYL 4HK0A 2V5SA 1MY7A 2BVOA 4JY4A 15C8H 5ICYB 1H3VA 1RUAL 1YMME 2AQ1A 4PJ9C 1LDSA 2B5IB 3I2CH 4NM4H 2R2HA 2X89A 1ROWA 4QY8A 3S5LB 4ZSOA 1BOGB 1KEGH 5DEGB 5T3ZH 1C5CH 4X9HA 2HMIC 1UFUA 3RY6A 1JYXA 3W5MA 3AS2A 2P5EA 2DF3A 4R0LB 3P11H 2HRPH 5E2VH 3OKDB 4M61B 4PJBA 1XH3B 3UTSA 3RWGA 1A1MB 4JFYB 1NCDL 1NGWA 4XNUH 2QQLL 3P30H 1DBMH 2W9DH 3TYFA 4TSAL 1KTDB 3ILPA 3X3FH 2YA1A 3PL6D 4M4RA 3T4YB 4QEGA 1FCGA 4MJIE 3CFIC 1W0WB 1KPVB 3OG6B 4AK1A 4P5MB 2UUDH 4Q0XL 1ZHKA 5BJTA 4HKJA 5JIKA 2CKBH 1MAKA 2HT4D 4RGNE 5FKPA 3GO1L 5F8QC 4RMQA 4DGIH 3X11A 2AXGA 3JSSA 3MV9B 1SYVB 5EZJA 5T1MA 4GBXD 4UNUA 4XPGH 1BAFL 2F5AL 4KK9C 4ZUWB 4HK0B 5ICXA 3C5SA 3MV11 4PS4L 4WFEE 1JFQL 1FZMB 4LPTA 4K23L 1YPZE 5IB4A 1U95A 3B6SB 5KS9E 4QY8B 4PJHB 3NFPA 3O2WH 4ZPTA 3UPRA 3L5WA 1GZQA 2BY1A 3NFNA 2CH8A 1D5IH 5I15L 4D0BA 1KJVA 5E2UH 2PTVA 4NQTA 1A8JH 5E94B 2QADD 3P9LB 2VQ1A 1TZIA 5D1ZC 3AUVA 1EIBA 1MJJB 2J8UF 4QNPF 1AGEA 4PV8A 1XIWB 2IPTH 3VFTB 3RWGB 5I19H 3IETB 4NO5B 2HJKB 3VXNA 3ZHDA 5I71B 1GGUA 3F12A 1IAMA 4RMTA 3BYYA 5KSUB 4P4KC 2DMKA 3UJJH 2R0LH 3PWPE 5C6PB 2GTZA 2YD3A 4H8WH 1Q0YL 5J12B 4GW1B 2DQIL 1FP5A 2R2BB 4K3DH 4ZOCA 4NQDA 2NNAA 4HKJB 5BJTB 4IRJD 1KIUA 2BNRA 2P45B 1YDPA 2AVGA 2VDOH 4WHCA 3H0TA 5EUOF 3C8KA 4YHZL 3KJ4C 4AM0B 4PLKC 5FKPB 3VE0A 4PJCA 4N0RA 2HTKC 3K8KA 4MWFA 3QO1A 2CKBA 2DIJA 3SO5A 4AIZB 2DJ4A 5JNYA 3C5SB 2EKSA 4NCDA 5IB3B 6FABH 3B9KC 3LS5H 3FQWA 3ELAT 4NNXB 1DE4A 5IJKC 1U95B 1RIHL 2BSRB 3VD5A 1YYLH 5ESVA 5HVFB 5TDPA 4KKLC 2EDWA 2GUOA 2IADB 4NN5B 1FHGA 2EE3A 2YUVA 3C8DA 3NFNB 5ILTL 3FO0H 3BGAA 3RUGF 4MA1B 3CUPA 3BPNB 1LO4H 1MHCB 2HT2D 3E6HB 2VQ1B 2XFXB 4LHUD 2BNQA 3F58H 4L4JA 3IDIA 3DYOA 4F57L 2IG2L 4OLXH 2FSEA 3KPOB 4I2XB 3RZCD 1KELL 2Y25A 3BDXA 5A40E 2DQGL 4JN1L 1MCSA 4NC1C 3W9EA 3MYJB 4Y2OA 3CFJA 4OCWL 3VGDA 3WLBB 1I7RB 1CU4L 3ROOA 1W72H 1QSED 1YNTA 2GTZB 4OI7A 1U91B 2BVUA 4XVTL 5DQJB 5EORL 3QDME 4HGWA 2VRAA 4XAWL 2R2EB 4NQDB 4ZS6C 5F9AC 4AH2B 1FL5A 1R5VA 4TNVF 4W6XB 4ZFZA 5J3HD 3HE7A 4G80A 1JWUA 5A2LH 5EULV 1FZKB 1F90H 4U6VH 4WHYG 5GSRB 2XA8H 15C8L 3PQYE 3TBSA 3BSZH 1CCZA 2EKSB 3MUY1 1T0MA 3I2CL 5FM5O 3JVGA 1EO8L 5ANME 3SE9L 5ESVB 5J6GA 1C5CL 5TDPB 2BX5A 5IFJA 3DO7A 1JPSL 5GGSY 1DBKL 3PGCB 1JYVA 1E4XI 4N1HB 3EO1B 4GG8B 4MD5A 2D7QA 4LLUA 3EW3B 5D7JA 2YD4A 3C5ZC 3IDIB 2EDYA 2GITB 4MB4A 2ZSWB 3P30L 4XHQA 2JB5H 3KPRB 4FQ2L 1FAIH 3GMLA 3DX8A 4U0QB 4BUGA 1I4FA 3V0VA 2HFEB 2O5ZH 4HWNA 1C7SA 3BZDA 1MCLA 2GAZA 3SDAA 3F6IA 4LLDA 1IAIM 4QRSA 4OUOA 4PLJD 4RNRB 5CJXA 3ALPA 2V2TA 2CKBL 3ZL4H 2K3TA 4XMLL 1R5VB 5FYKH 2G5BB 5LVEA 4PJAF 3MV9D 2QR0A 5K93A 2Q8BL 1CXKA 1KIQA 3SOBH 3DX9A 4D0DA 4YLQT 5CD5D 3ZHKA 3KR3H 5GS1B 2DWEB 3O2WL 5J6GB 3H3BC 3BH9A 5F7YC 4RAUA 2FATH 3KPNA 4UT6H 1AIFA 5E2UL 1RJLA 5ALCH 1I7TB 4LLUB 3QAZC 4X8JB 4KHXL 2GT9B 1CG9A 5LGJB 3ESVF 1BIHA 4JG1H 1I7ZB 2X7LA 4QRUA 1XIWD 5I19L 1P2CA 4R6UA 1OAXL 1AQDA 4NN6C 5DZAA 3MRMB 3U30B 5C09B 1AP2A 4GAYB 3F7VB 3GMLB 3V0VB 2OX5A 3G5ZB 1N7MH 1AXSA 3GDBA 4HSQA 2DM4A 3IAGC 1DP0A 2P8LB 4QRSB 1M1SA 2AERT 4H0IA 2V2TB 1UEYA 1S9YB 4U31A 4HKZA 5T3ZE 5C86A 4NFCA 5JPMB 3VXPA 1WAAA 4Z7UA 1KIQB 4PGCA 3MV7E 4LSUL 3P4LA 4D0DB 3TF7C 3RWDA 5BCAA 3QI9A 3BMVA 3PWJA 5C3LD 1SYSA 1E28B 4BH7A 4RAUB 3DWTA 4OCRH 1JTOA 1UWEH 2VLRA 1EUTA 4OLYH 4JKPL 3WJJC 3BP7B 3JWNC 1OTTC 4LK4A 3L7FA 2FBJH 2J6EH 3S35H 4LGPB 4LLYA 1CD0A 2HVKA 1DBJL 1MWAH 4JANA 5LWYL 1T20A 4MMZC 4BQ6A 1D5XA 3ZYIA 3TCXA 4Z0XA 1BFOB 1AXSB 4LVOC 3EYVA 5F7HA 2IF7A 2X41A 1U8JA 3FOMA 4KWUA 4NQDD 5JHDE 1A6WH 3WCYA 2IQAA 5CINH 1OB1B 1RK1A 4HBCH 4AEHL 3ZKQD 1L7IL 1F90L 4U6VL 1C1EL 1ORSA 4LSSH 4NYLA 4EKXA 4Z7UB 4FQ1H 5DA4A 4HWUA 4O2CA 1QLEL 3BSZL 4PGCB 4R8WH 3SDXB 1IARB 3RVTC 1B4JH 2Y6SC 3V5KB 1EVUA 2FCBA 4PJ7B 3UP1A 1SYSB 1SVZA 1XR9A 4BH7B 3MYZA 5DVNA 3ECBB 3QG6A 2OP4H 3HUJA 5DTFB 2MHAA 1EEYA 2ITDA 4EJ1C 4JPVL 4LPYA 2VLRB 4KDVA 4OGYL 2AJVL 4MXQC 1FH5L 1U3HB 3SE3A 3TT1H 2LV4A 3D6GA 2J8UE 2EECA 4XMPH 4QNPE 3QG7H 2YOCA 3BPLB 3Q6FA 4UIMB 3VG9C 3FO2A 1FNEA 4Y7MA 1FV1B 2VWEC 2X4RA 5I1JL 1BM3H 4NQCA 4XH2A 2HVKB 3F65A 3QQ3A 5F3HB 2J6EA 3KPRD 3V52H 1KACB 1GC1H 3X3GL 1M6OA 1ZLSL 5I74B 1F11B 5DHVH 4DK6A 1T20B 2VISA 1OARH 2O5ZL 4AJ0A 2GYSA 1KC5L 2DJUA 3GI8L 1M71A 4KXZH 1MWAA 2AK4B 2XRAH 4Z0XB 1ORQB 1WBZA 3EYVB 1FORH 4G8IA 3BWAA 5F7NC 2R4SL 1IQDA 2EE9A 1T4KB 5C08B 4JRWA 1MCPH 4NWTH 5EUOE 3VFSA 1ZAGA 4JLRB 5HYFA 4P3CH 3BFOA 4V1DE 3SOBL 4WGVB 4NYLB 5SX4I 3U9UB 2BOCA 4UBDC 1J0ZA 1MFCH 2XV6B 3KR3L 4KRNA 3IDMA 1S8DB 3CIQA 3CMOL 5DI8B 1G9MH 4X5WB 3MRIA 4PV9A 3GRWH 1N2RA 3FQXA 3BH8A 4RIRA 5L7XH 3HE7C 3EGSB 2OZ4H 1OSZA 3PV6A 5ALCL 3RUGE 1EEYB 2ZUYA 1NLDH 4G8GA 1IC5H 4YHLL 1JK8A 1NAKH 4ENED 1U8OB 2R15A 2WLYA 1Q9OA 4OGAC 3ULUD 1R5WA 3JVGC 4K8RH 2VDMH 3C5JA 5CSGA 5CEZD 1BZQK 3C9NB 3HC0B 1JRHH 5E8OA 1F00I 3FO2B 1FNEB 1I3UA 3C2AH 3CDCA 3HAEG 5C09D 4NQCB 4XH2B 3QQ3B 1T7YA 4DKFL 3QQ4B 1FSKC 4JY6A 2H32B 3RJDA 5JW3H 3KLHC 2E6JA 3QDJE 1M71B 5D7JC 4D8PB 2P8MA 1WV7T 4MXWL 4KZEH 5D2LF 5C07E 4G8IB 2MCG1 1HXMA 3BWAB 4XP4L 3ARDA 5DJ2A 2Q7NA 3QPQD 3ZTJH 1T7WA 2Z8RA 4OLVL 3TA3A 4YHPA 4XX1E 1MVUA 1AO7A 4HCRA 2FX8L 3QIBB 2YD1A 1A9EB 5EO1A 4OFYA 3IDMB 4L5FH 3SDAC 1R6VA 4QHNA 3V79C 5D9SB 1RAMA 1WF5A 3L6FB 4JO3L 4BH8B 4PG9A 2H26A 3MRIB 5FECA 4MHHG 4CUCA 4OCRL 3OB0K 3RVVD 2H41A 1TTUA 2ORBH 4RFOL 1CBVH 4YFLF 3D39E 3IFNH 4MMXC 1JK8B 2NY5H 4DJMA 5DJXA 3HZMA 3UROR 3N9GH 1HHIB 2FBJL 2J6EL 4MSWB 3RNKB 4F37K 4DVRH 2ATPB 3HMXA 1U36A 3U7YH 3C5JB 5C0JA 4Y2DA 4D2NA 1MWAL 5FYKE 4W4NA 5ID0A 3CFKA 4WWKB 5GRUH 4HUKB 3GHEL 4OGZA 4ZDHA 2FD6H 3RWEB 4JRXA 2X44D 2P8MB 4LCWB 5TH2B 4I0KA 5GS0H 3ARDB 3G04B 1N5YH 3QUMA 5C0CB 4HBCL 4IRZL 2UY6A 1DUYA 1OP3H 1NFIA 4PJAE 4C4KO 4PJIA 4LSSL 5HYSB 2B1HL 4JVWA 5CIPA 1XR8A 2GCYB 1TCRB 4R8WL 2OQJB 3FQNA 3LDBC 2HFFA 3MLRH 3RA7L 2WWMC 5EO1B 4OKDA 5A3ID 3V6FB 1RZIA 3VFPB 2EDHA 1GGIL 3HTLX 1FZJB 5FV1L 4X7FC 1G6RH 3L3DB 4KDTA 2H26B 1GGYA 5FECB 5TE4H 1MFEL 4RA3A 1MJUL 2FJGA 4HKBA 4HIEA 2VLRD 2EXWD 3SGDH 3VXTB 2X4QB 1U3HD 4J8RA 2UZYB 1Z5LA 2OSLB 4KI5C 4IDJH 1UQSA 1QRNE 3QG7L 1S7SB 5IVZA 3SGEI 2V2XA 3UPAA 1OAZL 3QI9C 5I1DB 3PDOB 4PR5B 2ZSVA 3W0WE 3ARQA 5J1AA 5IBLD 3V52L 2A9ML 1GC1L 2VB5A 1PEWA 3BD5A 4FQLL 1WBYB 4K3JH 5C7XH 3CFKB 4M1GH 5DHYA 5F96L 2V5MA 2XRAL 1I3RA 3D85A 1FIGH 3QFDB 5IW6A 3P4MB 4H25A 5C08D 5LGKA 3QUMB 2VMFA 3ALWA 3I3DA 4F7CA 2YKLH 4JFFB 3DVGB 4KPHH 3JWDL 4RSVA 4M93C 1KTLA 1MCHA 2VLMD 5CIPB 4CU6A 1XR8B 1CDBA 1MFCL 1XGPB 2HFFB 4M8QA 2AXFB 3ZSSA 5MEQA 1G9ML 1KJ2A 4B50A 1RZIB 5EBMB 5DRZA 3K81A 2PW1A 4Y19A 1SEQL 4OFIA 2AEQH 5CJOL 1ULVA 2BZDA 4KU1A 4PUBH 2CLZA 2OZ4L 2FJGB 3OG4B 1J0HA 4U1KA 4GG6A 3G08A 1M05A 3HMXL 1IC5L 4U6HA 1W0VB 3BKYL 2APVA 4Q97A 5BV7H 4J8RB 4F3FA 5EIIB 2DQFA 1A4KB 5DJ6A 5IVZB 2PYEE 2V2XB 1JRHL 3H7BB 1HOCB 4WI6A 2I9TA 3BT2H 3O6FA 3FFCA 4UINH 4NQCD 4UTBL 4K7PH 3O8XA 4POYA 1CDHA 3BIAX 4R26H 5DHYB 3LKOB 5JW3L 1T2XA 4OF0A 3SE3C 3NGBB 4M1DH 4KZEL 4YBLC 4ODUA 2XG4A 1GL4B 1ED3A 1MRFL 2F58L 4BK5A 4P5TB 1RK0A 1DUZA 4R90L 5A2IH 1I7UB 4PJXA 4L8BA 5SWQA 1BF8A 5GQBA 3QIBD 4H1LH 4PJGA 1SJEA 3RVXD 2FWOA 1RUKH 3VXOA 1AHWA 1KJ2B 1HDMA 1EV2E 2XICA 2APWA 4KUZL 5FGBA 1PZ5A 3H6JA 1U8MB 3IKKA 2GJ6A 3EJYD 1OWRM 2X4UA 4I0CC 4WY7H 4MD4A 1AI1L 5DA0B 2ORBL 1LEIA 3O11B 4P23A 5DUMH 2ADGB 1LP9F 1FCCA 4U1KB 1M05B 2NY5L 3DYMA 5E8EA 4X4XA 4F3FB 3MCLH 1QEWA 3TH3T 2DQFB 2W0FB 3UTOA 4ACPA 2Y1VA 2VUYA 3QT2A 4LGSB 3VI3F 4BQ9A 4O2EB 5D72H 4P2RB 4OLWH 5GRUL 2H2SD 4WWKD 1DQMH 1U93B 5D8JH 3QFJB 1K4DB 3GFUA 4HWEH 4WHYH 2XPGB 2QHRL 2FD6L 3LIZH 1KB5B 5I9QC 2DMCA 5GS0L 4LCWD 2X6MA 1N5YL 3ARDD 1A1OA 5C0CD 1ED3B 4JFDB 3QRGH 1MH5A 2CRZA 1YC8A 5EDXA 4LNRA 3H3KA 4LSTL 4JKMA 1RZ7L 3S36H 2BY0A 3MLRL 4U1MA 4HW6A 1PFCA 4Y4HB 2R1YA 5ALBH 4X9BA 1LE9B 1J8HB 1DSFH 3OKLB 5EN2B 1GC1C 1G6RL 1IT9L 5I8OH 1X6NA 2HWZH 1BOYA 5JXAL 2GJ6B 4IIQA 3TA3C 4PYGA 1H3PL 4MD4B 5D93C 4RFNB 2D31A 5CEXA 1CXHA 3KWWB 4BQCA 4X4XB 3NABL 3P4NA 5B8CC 2DD8H 5ADPL 1QEWB 3KYNB 3JWDC 5DZLA 2Y5TB 1KGCE 2GJZA 1PAMA 4ELMA 1BVLB 1HHJA 5I73B 4Y2DD 1S9VA 4ZFOB 2W38A 3TBVA 1S5IL 4HXAL 3KYMB 4WCYL 5EU3B 1G9MC 4M1GL 1C12A 4WDIA 5CS7A 5I1KH 4FMFA 1PKQB 3SJVB 1GHFH 4X5XA 5D2LE 2WZAA 3ME0A 1AGDA 1RIUL 1NQBA 1IC4H 2YSSA 5DT1H 2YKLL 4U1LA 2YMXH 1H15A 1NUFA 1T22A 4JFFD 1OGAA