4HT1T

Human tweak in complex with the fab fragment of a neutralizing antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
131
Chain Sequence
RAIAAHYEVHGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEELGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human TWEAK in Complex with the Fab Fragment of a Neutralizing Antibody Reveals Insights into Receptor Binding.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Tumor necrosis factor ligand superfamily member 12
total genus 24
structure length 131
sequence length 145
ec nomenclature
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ht1T00
2HEWF 4MXWA 4MSVA 1IQAA 3URFA 4J6GA 1A8MA 2RJLA 1I9RA 1OSGA 3QBQA 4EN0A 3TWIA 2R30A 1D0GA 1DU3D 3K51A 3ALQA 5TSWA 1U5XA 4QQOA 4RSUA 4DOUA 4OUSA 1KD7A 4OUMA 4G4FA 5L19A 2ZJCA 1GR3A 2O0OA 4HT1T 2WNUB 3FC0A 3B94A 2ZPXA 5KWRA 1WCKA 1D2QA 2E7AA 5BNQA 4DB5A 3QD6A 1XU1A 1OQDA 1C3HA 2WNVC 2KA3A 1TNRA 2WNUC 1U5YA 5L36A 4F3JA 2TNFA 2R6QA 2JG8C 1TNFA 2WNVB 3IT8A 3ME2A 1PK6B 1JTZX 2WNVA 3LKJA 4KG8A 1D4VB 4OULA 3AB0A 4N90A 2X29A 2Q1MA 2JG8B 5HBAA 2QE3A 1ALYA 2HEYF 2AZ5A 4MXWB 4QPYA 3L9JT 5KC6A 1O91A 1OQEA 4E4SA 4TWTA 2JG9C 2WNUA 1PK6A 1S55A 4G3YC 2JG9A 4QQ2A 4QQHA 2JG9B 1C28A 1RJ8A 1KXGA 4KGQA 4D7YA 3MI8A 4TSVA 1PK6C 2R32A 1RJ7A 3B9IA 4GIQA 2TUNA 5CIRA 4MXVA 3K48A 1XU2A 3TYJA 4QQPA 4NN0A 1JH5A 1U5ZA 2RJKA 2Z5WA 2QDNA 4QQLA 2OIIA 1DG6A 2HEVF 2RE9A 4E4DX 2Q8OA 3WD5A 2JG8A 4KGGA 3V56A 3B93A 5KC5A
chains in the Genus database with same CATH superfamily
1JZ2A 1NCRC 3KD4A 3VBOA 5JLVA 2OW4A 4RR3C 4CDWC 4N53B 1GLHA 3VD7A 2ZKLA 1OFSA 3ZO0B 4M4PA 4MGYE 1I9RA 5JXIA 1XB9A 3VZMA 3NNMA 1OOPA 4LE4A 1POQA 2VXJA 1FMD3 2JDMA 3HQRA 1RINA 2WO2A 1WCUA 4IQPA 4QX0A 4CYDA 3TBDA 5DPNA 3KV6A 1ND2A 5LBCA 3SH5A 1N1VA 3EBRA 4KI5M 1VIWB 1H1AA 2XQRA 3POFA 4ATFA 3THTA 1O8SA 3AKPA 3ES4A 2WNUB 5FPUA 1L7RA 2ZGUA 2VMCA 3ILRA 3UGGA 3SCGA 5LY2A 2ZGRA 3E6DA 4TZDA 1F31A 2OUJA 3LFMA 5FUNA 3RWNA 4AFBA 2VMHA 3SNMA 4PJYA 1XYPA 2CSGA 4LT5A 3E1F1 3S0MA 5FYBA 4E9KA 1LNSA 4NUBA 1LB2A 2P3KA 3PMEA 2A7AA 1ULDA 4A7ZA 5BNPC 2GNBA 1D7PM 2Y0IA 3C7EA 2TNFA 3ZDSA 2G4IA 4COUA 2NQYA 1SLBA 4CUCA 2BBAA 5H9PA 3WDXA 1JOPA 2WJSA 2ZX1A 5EZWA 1W9TA 1RVF2 3HNBM 4BB3A 1H0BA 3AB0A 3HQXA 2CNAA 3I59B 4JGYB 2F4LA 2WS93 2RMU3 3OOXA 5F8PA 5J48A 5LK7B 4FPFA 1S1AA 1WMXA 3BTYA 4RL7A 3VBFB 1XNTA 1BJQA 3J8F3 2GMMA 4C1WA 5IK7A 1PNFA 4FOWA 1VBE3 5C6CA 3N36A 2Y8KA 2VG9A 1PX4A 4ORFA 4XJUA 2CL2A 4IE0A 3AL5A 3ITQA 4M3CB 4E4HA 4DUXA 4UFKA 3H9AA 2CGOA 4GQ7A 4LK6A 1KJLA 1UZYA 2HYKA 2R063 2VW0A 3KVAA 3R0RA 4PIYA 5DZGA 5FMBA 3IIIA 5KXDA 2JG9A 2UY8A 3VN4A 2VTXA 4Y1YA 1QJX1 3N7JA 4CDXB 5IVFA 4AAPA 4MX3A 5LASA 3ZMOA 2HWE3 4EV0A 3POWA 1ZNPA 4Q4Y2 2V5DA 1OA2A 3WNMA 1O4YA 2CTVA 2Z69A 5BPXA 3R4UA 2HWD1 3O1TA 4CEWA 2RVAA 2PHWA 2PAKA 4MXVA 1MS8A 1FNZA 4EN8B 1QJZA 1XYOA 3NNGA 5A7QA 4LPLA 3AYAA 3ACFA 3LA2A 4FCAA 1OKQA 5FREA 2VZSA 1DQ1A 3WOGA 2PN5A 1UKGA 3E97A 1DZQA 1TME1 3Q8FA 5GZFA 3POSA 5DG2A 1PMHX 4MVTA 3VL8A 1LRHA 5CG9A 1L7LA 2DBIA 1JU4A 5DN2A 1OI6A 5K9YA 1ZREA 2ARXA 5D21A 2DBNA 3L2HA 2AC1A 4GWNA 1KS5A 2IXHA 4RR3A 3B93A 3NJVA 3WINE 1OFNA 1REFA 1ZYBA 4EQVA 3GF6A 4MXWA 4Y24A 1DF0A 4COYA 4LLFA 4FQ4A 5FUPA 1A8MA 1XE0A 4D94A 4DINB 3RZLA 1MACA 3ZXFA 3ACLA 4URAA 1Q8QA 1RHI3 3AM2A 3C7FA 1YFUA 3BPSA 5A3NA 4MGQA 3LFIA 5C5UA 4EZ4A 1EUUA 2EIGA 3O1RA 1XBFA 5IT6A 5EIYB 1YQCA 2LW8A 4I0WB 4IETA 4DMIA 5M0TA 2W87A 3SXWA 1SBDA 3I2KA 4UXAA 5T52A 3UYJA 1ZA7A 4MG2A 1RUJ3 1UU6A 1NZIA 2JECA 1VBA2 4WVWA 2Y34A 5C33A 5FLHA 1UU4A 1PO13 4GB31 4K6BA 4XEZA 3SISA 3K2OA 1W6OB 4N9HA 1NYWA 2R1DA 2SLIA 3KS7A 3IMMA 1GWLA 2Y33A 1WD4A 5BNQA 3AP9A 5DAXA 3ES1A 5C8CB 3U78A 1X8MA 4IESA 1V9U2 3IIAA 2VUCA 4Y4RA 2ZMKA 3DL3A 3E5UA 4BJ0A 5DXDA 4BQXA 1NCQB 5L36A 3VBRB 4KL1A 5E16A 3EHKA 5C3SA 1LKNA 2BWCA 3MLLA 1UX7A 3PJQA 1CVNA 1PO12 1PIV3 2OXBA 1WA6X 2UWAA 2VBPA 5EYXA 4DQAA 4CUAA 3MUY1 2FCUA 2VUAA 1QGLA 3AP7A 5JZGB 3VD9A 4YVSC 1VBA1 1DGRA 4J1WA 4KG8A 2HWF3 1O4TA 4YG6A 3I2JA 5JOWA 3WDWA 5EP9A 5GLWA 1LU1A 1XXNA 2AYHA 4LBMA 1UZVA 5JR7B 3TRSB 4XUNA 1UNBA 4XDOA 1IOAA 4LBQB 2VJXA 1PVC3 1R093 1EV11 2WS92 2RMU2 3ZFEA 5A80A 1IQDC 3CQOA 5FOBB 5DUWA 5F7UA 4A41A 1PIV2 2PAMA 4RHV3 3J8F2 2O8QA 1CWPA 1OQEA 2WRAA 3B69A 4IE5A 4CP2A 5A32A 2PA7A 5A7OA 5DDJ3 1JUIA 2MHFA 4K8FA 3NVCA 1I5ZA 1N3PA 1W6MA 1MS1A 4LKEA 1M06G 1CESA 1D4M1 3IDAA 1R1A2 2JXAA 3POEA 4P14A 5FMOL 5C4WA 4KGQA 3CO2A 2D5FA 4N53C 1CZTA 3DXUA 4E4ZA 1PK6C 1WZXA 5D8AC 2D6OX 2CY6A 4FTEA 4FO9A 2WFF2 2BERA 4B1LA 1Z7S3 2VH9A 1CD3G 1QJX3 4WV8A 5HCFA 3H7JA 1VBD2 2YYOA 1NXMA 2D40A 3KCXA 3AMMA 4JHZA 2ET7A 2P3IA 4UBHA 5BY5A 3BI3A 1UIKA 4AOCA 4Z2WA 3DPRB 2DUQA 5GLZA 3ZXKA 2VBDA 4WVMA 3V65A 5J96B 2XJQA 2Z5WA 1ULEA 1YNAA 3GZEA 3PUQA 5ACA2 1XSRA 1FOD1 2VY0A 2OPKA 5JSRA 1SMVA 1Y7BA 1VBE1 2JDHA 5CKQA 2YG0A 2ZEXA 2P3YA 1OUSA 3HR9A 4QXKA 1N1TA 2EXIA 1AXYA 2PHXA 1QJX2 3KZ4C 1MPXA 4C0HA 3PNAA 2BOIA 1XYNA 4D7SA 1UX6A 3OUJA 5K0UA 5KC5A 4XUQA 1WUVA 5FZHA 3VKFC 2WZPP 2WYSA 2EXJA 2YV8A 2VZVA 3JQXA 3URFA 2JIJA 3ZFFA 5JDBA 2XR4A 2OA2A 2J1TA 3LD8A 3CZUA 1AYN3 2EXHA 4RFT0 4IEPA 5CFDA 1S0CA 2BV4A 3DUIA 1AR63 2G19A 3I2GA 5FLIA 4RFRB 2FMYA 4FAHA 1XNCA 3B7MA 5FUIA 5T5PA 4D0QA 3O1VA 4CCJA 2DVFA 2YZ4A 5EV7A 2RG4A 1D0GA 2NM1A 1ZBE3 2PAEA 3ILFA 1LAJA 4QQOA 4RSUA 1H2MA 3GZAA 2ZAAA 3KF3A 3PURA 2WO1A 2YROA 1KITA 4NWWA 3SH4A 4HLTA 1KD7A 4U36A 2OZJA 4LULA 5D8AB 5FY0A 4BH9A 5A3LA 1C57A 2ZMLA 1F9KA 1W99A 2CU5A 3N9NA 1CGPA 2RR13 2XUMA 2ZPXA 5KWRA 4S2HA 5E8AA 3CL1A 3DGTA 5CFDB 2O14A 3RYKA 4FPHA 1TMF1 4RD7A 4Y4YA 4PLMA 4I01A 1RUD1 4ET7A 4KWKA 3TOJA 1C3HA 2K46A 1BK1A 3AP6A 1YI9A 2AR6A 3MGUA 5FFOC 4WZCA 1SPPB 3KB5A 2IUWA 1V9U3 1Y43B 2QQKA 3DF0A 4DEQA 3GNEA 1JI6A 1O5UA 1SLLA 4R9DA 4N7IA 4XAEA 3VKNA 1W6MB 2UWBA 2YC2A 4YW7A 1NA1A 5A7WA 1IPJA 3CEWA 2EA7A 1KFUL 2JDNA 4PT6A 2A3XA 5C9AA 3I2OA 4YVSB 1H4GA 1VRH2 3IM0A 5F6KA 4UFJA 2QE3A 3O12A 3ZFGC 5J3UA 5FZCA 3C8XA 1Y4WA 1LOGA 2DCKA 3I8TA 4QPYA 4Y22B 5K0UC 3ASIA 3HNYM 1E5HA 2ARBA 5KC6A 3E6BA 5C4WC 1R092 2LTNA 1DIWA 2RS31 4C8DA 1PMJX 1R083 1UPIA 4NWVA 1PK6A 1POV3 3BVCA 3OB8A 3ZPOA 5JXGA 2VAUA 1HRI2 1AX0A 4CU9A 1MZ6A 1RUI1 4Y3OA 3I3DA 5FP4A 3H8RA 1LOFC 4XCBA 1PGL1 2JKBA 3MIGA 4TTGA 2FCTA 1O6UA 4P08A 4YNIA 4GKYA 3JD73 3RRDA 2H6BA 3A4UA 1K12A 1CPNA 3G7DA 1F4AA 2ZBJA 3LCPA 1JH5A 1EPWA 4PBPA 1SACA 1JHNA 5FYMA 5FQ0A 2YBSA 2QZ3A 2B42B 4CDWA 4DPNA 5C4WB 5KXCA 2VQUA 1KQRA 5FAXA 2I74A 3W59A 4CDWB 1V6LA 5KHHA 4GB32 4PLOA 1YYNA 3IDEA 3WD5A 3H1MA 3M2MA 1SLIA 1H8TB 3VBUC 4BYYA 3FLPA 4AW7A 3W58A 4CP1A 1VBC2 2ZX2A 1JODA 5BNPA 3O0VA 4YVWB 4MSVA 3GGLA 3RMYA 4WVZA 3SKJE 2C1FA 4RS5C 1PX3A 4D7TA 3BTXA 4HXCA 1CN1A 1LOAA 2F4PA 5LA0A 2W94A 2XG3A 1JZ3A 5FYHA 3A22A 4F83A 3H8OA 4LBQA 3UL2A 1UZZA 2DVAA 3FLRA 1TQ5A 2CAUA 5CNAA 1W6QA 1VRBA 4CUBA 1LENA 3M3QA 3ZSMA 3VBUB 2ZGMA 5ANQA 1CQ9A 1JXNA 2Q8CA 2XJVA 4A45A 1ZZ7A 5CISA 3FC0A 1FV3A 1AR61 3CDZB 4XETA 2FHRA 3OYWA 1S2EA 5JWPA 3IDBB 1DQ4A 3NAPC 1AL22 3UNPA 1ASJ1 1AX1A 1GP4A 1W28A 1XJAA 1XU1A 2O8OA 5HXVA 2OQ7A 1TNRA 1QJY3 1UXXX 2XL9A 2Y38A 1ASJ2 3MIBA 3VZJA 4DIQA 3WF3A 5A1AA 2OKXA 2LUWA 5A7NA 2V4AA 4MH0E 2R6QA 2HWD2 2GAUA 1NAEA 4UW5A 2WNVB 4DXRA 3ZXJA 1FT9A 1TE1B 1VAKA 4XBLA 5B2GB 3LKJA 4YZ2A 1H2LA 4A7YA 4W6XA 1BVP1 1CIWA 2ZAHA 3EXUA 4WM7C 2V73A 5FLJA 2Q1MA 3EQEA 3H3LA 3CJXA 4HZFA 4B8EA 1J58A 4PI0A 2CAVA 5FZDA 1QJEA 3ZFFB 1BBT2 2JDZA 4QU2A 5T55A 1OH3A 1PMIA 2MEV1 3R6SA 1RUC1 4COWA 1LCLA 2W46A 4P9GA 1J1TA 3J7NA 5D8AA 1M4WA 2CGNA 2DCTA 3T0BA 4K7JA 5BXXA 4CTEA 1A8DA 2X53S 5KBFA 1H30A 4R9AA 1VBC1 2BJSA 1FV2A 2HH9A 2A6YA 2CDOA 2CYFA 2WQZC 3DCQA 3OPTA 2GH2A 4YGCA 1BK0A 1UY2A 2JD9A 3ZYFA 4D6SA 1UY3A 2VUJA 1LHVA 5C7GA 4W65A 1I3HA 2Y6HA 3ZIXA 2Y6JA 3CHXA 3HBZA 3ZFEC 1GMMA 5F3IA 4BU2A 2BFUL 2OPWA 4AQ6A 1LTEA 4DEVA 1MVQA 2TBVA 2KR2A 1FPN2 5FMCA 4AQ2A 2BW8A 4Q0VA 3BTZA 2Q8OA 2VZQA 3IMNA 4DXTA 3ZN6B 1FMD2 4NAOA 4NHLA 1W8ZA 4A6SA 3ZDVA 3C7GA 4O9EA 1RMU1 4ZU5A 3S57A 2FD8A 2GN7A 3MW2A 3VDBA 4QWNA 1H8TA 1HRI1 2I45A 2VBBA 2VMIA 1SBFA 4NOTA 4EN7B 5JSPA 1QXJA 2DTYA 2WIIB 4FP3A 2ORZA 1W6PA 1W6NA 5LB6A 4XXAA 5FZ3A 4GKXA 4S2GA 4NMIA 2O1QA 2JDPA 2R071 2CWMA 5FKBA 5FQ0B 4O9GA 4UF0A 5CU1A 2XVKA 2VNVA 4COZA 5SV5A 2R072 5DZEA 4YSFA 5J09A 3VKMA 2CGPA 3NKTA 2QNKA 3TAYA 1KRIA 1DQ6A 4ZZ5A 3VUOA 4AI0A 1UCXA 5FXVA 1GZTA 5A3MA 4AE2A 3OD4A 3E5XA 3A7QA 5LA2A 1BCXA 1QIQA 4LO4B 2PMWB 4LHKA 3AMNA 4Q4X2 5FR3A 3N7KA 3F2ZA 4COVA 4LIVA 5HV0A 1RUF3 5D2AA 1IS4A 5GLVA 4CE8A 1WCSA 1YFYA 3T0AA 3KSCA 5FO8B 4OQ8A 5F5QA 1RUE1 4Z1VA 1BZWA 3V0BB 3OGGA 3BYWA 2YXSA 2WT1A 1V6NA 2WT0A 3SEPA 1AL0G 2ADEA 4RQPA 2Q8DA 3UK9A 5FMOS 5JZGA 2BYVE 4JVAA 4NRMA 3BIEA 1SEFA 1HV1A 3KT1A 1GQPA 2ZGNA 2X5IB 1J3QA 4B4PA 2C5DA 3APBA 4UWDA 3T2QA 4NIHA 3ZMNA 3S30A 1W2AX 2AGSA 5IFTA 4B4QA 1GKBA 3N35A 3W5MA 2RS12 3PTRB 2R0HA 2GC0A 3B01A 4YW4A 2NZ9A 1UMIA 3VBHA 1ZRDA 1IG0A 1AYM2 1YUDA 3O7OA 4LXLA 4Q4Y3 2ZZJA 1GWMA 1ENXA 4N53A 4QU1A 5F2SA 3VD4A 4HG6B 2QQNA 1GQGA 5E89A 4BISA 4K1YA 5FZ7A 1HKDA 5H9RA 3AKSA 1J59A 4LKFA 1QKQA 1LR5A 1T2XA 4AVBA 4K1ZA 3AC0A 1G8WA 3NJYA 4LO5B 2WFF3 4PCRA 4W50A 4CSWA 1GP6A 1SZBA 5FO9B 2WA4A 3M70A 4XFCA 1VBE2 1QH6A 1QQP1 4UFHA 5LWBA 2OS2A 4NRPA 3HN3A 5KHGA 2TUNA 2PELA 5J1XA 3FHQA 4C90A 1ULGA 2D5HA 5FJKA 4IV1B 4JDMA 3TYJA 4AGVA 3E5QA 2VL4A 5F5IA 2AH2A 5BYNA 4XF1A 3NV4A 4AFAA 1HN0A 1GSLA 1SFNA 2XJUA 3Q8BA 2FCVA 2XUEA 4ZZ8A 1HB3A 1R1A1 4Q4X1 3VKOA 2XBO1 4A7KA 4OYUA 2JG8A 3HT2A 4E2QA 4AK3A 1F5JA 1HRV2 2OVUA 2ZS6B 1KDMA 1WW4A 3VDDA 2JJ6A 3ZSEA 3BCWA 3KM5A 2E32A 5AFEA 2DCYA 4B4RA 3OCPA 3B02A 1CZVA 1AR81 3PTYA 4H14A 1DZTA 2KXLA 3ACGA 2W5FA 2GC1A 2GNMA 1RUH1 2VVFA 3DYOA 4F7ZA 4WVMB 4QPWA 5F32A 3T2PA 3E6CC 3FUQA 5GZEA 3V0BA 1N3QA 4OFGA 5EJ1B 3T09A 2ID4A 4CDXA 2WINB 4FOQA 2N7GA 4DNYA 4HBNA 3Q8EA 3BALA 2R073 4E2GA 4K8RB 1QEXA 1FMD1 3NNJA 1O3QA 4PQ9A 1NCQC 1FPN1 1G86A 3BTAA 2QUOA 4OZXA 1OLQA 1WCKA 1JBCA 1CAVB 1T6BX 2D6NA 1KFXL 2KD7A 4UT5A 3GJAA 3ETPA 4Q4X3 2VULA 4E8CA 1SCSA 3RPQA 3OEAA 1KDKA 2WC2A 2YPJA 2GNTA 2QQVA 1YJKA 1AR91 1OD5A 1HQWA 2WKKA 4K21A 1ZZBA 3T0DA 4QKNA 1NE4A 2XJTA 1XC6A 3CBNA 3RZMA 3I97A 3HWJA 2RS51 3AP5A 5T5JA 1QJU2 2XHNA 5AC92 2LRPA 3AVRA 4FOVA 1HW5A 1VPHA 2GMPA 3FFQA 3AZYA 4ES9A 3UKTA 2ZTNA 4ITCA 2ZGKA 4IERA 4FBFA 4IEOA 4RS5B 2DU0A 4P00B 4CCMA 1V6KA 1BXHA 3ZN6A 2RR11 4XIKA 2Q1ZB 2P3JA 1LEDA 4I0AA 3DKQA 2A6XA 3D82A 4LR4A 1QJFA 5I0UA 3AJYA 2DUPA 1Q8SA 4Q5OA 1ALYA 5FMDA 3POJA 3TB0A 1DDLA 3NO8A 1QJU3 2VVDA 4NHKA 3M7AA 4W8JA 3VDDB 2J1EA 5C5TA 1UYYA 1K45A 2C24A 3PHMA 1YLLA 1RUG2 3P6BA 4I02A 3AZXA 4YGDA 1N1YA 1OVPA 1VBD3 1JZ5A 3FUOA 2JG9C 4FPJA 4D3WA 1G9AA 3RG0A 1UYPA 1N1SA 2XVGA 5LA9A 4EE2A 4NHMA 2WNOA 1AVBA 4HKWA 5LBFA 3ON7A 3GCXA 2VMGA 4BQ1A 2BPA2 3FMGA 4GWJA 4FVVA 1Z78A 3USUB 2GNDA 1OURA 1YQ5A 2E63A 1YQ6A 3ZOIA 1RXGA 3DEMA 1DGWX 3VB9A 3MZHA 5HV4A 5JXJA 5JI9A 4IDZA 3M3IA 4OHVA 5GALA 4YZ5A 2WBKA 5ERLA 3LDBA 2WLPA 3AFKA 3UETA 4MHRA 3USSA 3MV11 5SV8A 4BE3A 1YI7A 1JW6A 2YC4A 4LQRA 4AEJA 1B35B 5IUQA 3PLQA 5BNNC 1ENSA 1GV9A 1TMF2 2VD7A 3JUUA 3OGJA 4AEDC 2YBPA 4E4DX 1Z7S2 2A75A 4YW1A 3K77A 4G9SB 2W1WA 2HBUA 4GAZA 4V1PA 4M0HA 1WMFA 3A21A 1GOFA 4LBJA 4XJAA 3ZXEA 1OPMA 4FAGA 4IGOA 1AXZA 4IEYA 1PM7A 1DGRN 4QKBA 1X82A 3X29B 1K3IA 2HLEA 2ZEYA 1IZ3A 2HWC1 2XDVA 1LGBA 1YIPA 1GICA 4H55A 3AMPA 1AJOA 4GMP3 5FYVA 5CZKA 4BA6A 3PMSA 4Y1VA 4EJRA 4XYXA 3UESA 2D43A 3QH7A 5F3GA 1CX4A 5A70A 4DOUA 5H9QA 1S0EA 4OZOA 4OUMA 3RZKA 4IV3B 2PQQA 2YGLA 2ZJCA 4XTMA 1GR3A 1PVC1 2GU9A 3C7OA 3AFGA 3RS6A 5KHJA 3HPNA 1DLCA 1HLCA 3M3OA 4GULA 4CDXC 4CEYC 3ATGA 3LOBA 4FTBA 1JOJA 3D6EA 2X10A 1FOD2 4KU8A 2VW1A 2UU8A 3PVEA 3WNLA 4QDQA 1DCSA 2XB6C 4MOAA 1B35C 3T4VA 1HV0A 3PUSA 3POIA 2RJ2A 2VNGA 1VBB2 3MW4A 4Q2FA 4XJ9A 1EAH2 1TEIA 1Y9QA 5FBZA 3N4MA 3S5QA 3BU7A 4QHZA 2XPJA 1PGL2 4IEQA 1W9YA 1HXS3 3PIGA 2JDYA 2ZHKA 2WFF1 3I3EA 4AHXA 5CEHA 4KH9A 4QX8A 3IT8A 5FZOB 3ME2A 3TEWA 2J1SA 2DURA 1IPKA 2D7FA 1LECA 2J42A 4XBNA 2YGMA 5J98B 4GXLA 4OCTA 1RC6A 2RDSA 4OULA 3SCFA 3I2IA 3ZFGA 4AEDA 2WT2A 3BPZA 3JB8A 1WCDJ 4LBKA 4QAWA 3BB6A 4UW4A 1NY71 2SBAA 2X29A 4FSJA 4META 2RM23 5GZCA 1XNAA 2VMEA 2ZKNA 2HYXA 3M3CA 2H0BA 2C9KA 1WD3A 5FBJA 1RUOA 2A73B 5DQ0A 4YM3A 1ST8A 3A23A 4OI1A 4FPOB 2JDAA 1F8VA 3WQ7A 5A32B 4Z92B 4XBQA 5FY9A 1O4ZA 3WNXA 5T5OA 5J36A 4BDVB 2IC1A 2A71A 3BGAA 1AJKA 3GALA 3WEZA 4CP9A 2RM22 1W03A 3L2YA 2ADDA 3SCHA 4XC9A 1RJ8A 4A42A 2BEOA 3MI8A 3WX5A 4Q4W2 2J1AA 2UURA 2BBVA 2QTWB 2YHJA 1PZ9A 1G9FA 1JN2P 1W90A 1L7QA 5F3CA 4QKDA 2XONA 4NHXA 5T54A 2AENA 3D0SA 4DZGA 2XGXA 3K3NA 1CX1A 4CDQA 1WKYA 1MEC3 1UQXA 1V9U1 1ND2C 4NJ4A 1U5ZA 4N7UA 5FYZA 2B46X 5FIXA 4Z2AA 4IEZA 3GCWA 2GDFA 2XHKA 5CFDC 3RZHA 1PHMA 3WXPA 1ENQA 4MZUA 4FPYA 5DUVA 3T30A 4CXYA 4MHUA 3I2DA 5FZEA 4WM8A 4XHXA 4C91A 2PLV2 2QKDA 3SH3A 1NCRB 1IKQA 2E6VA 3HEIA 1S4CA 2VUDA 2XKOA 3ACHA 4RR3B 2GALA 2QJVA 4JQTA 5DUUA 2JENA 3ZFFC 1UZ0A 2ZXQA 2PHTA 3WNPA 1NA1B 1MEC2 4JAAA 5GJ6A 5A7WB 2HWE1 3W9AA 4YZ4A 2P1BA 4QXBA 4UBGA 4B1MA 1JZ6A 1QH7A 1MQTB 5FPZA 1VAVA 5FOJB 1BHGA 4FPCA 5FRAA 4BIFA 1GP5A 5L73A 4JGYC 5C3QA 2VZ3A 3TEYA 2EVXA 3U4XA 1UO9A 3LA7A 2RDRA 4IE6A 4M3CE 1AYN2 5J7MA 1DU3D 2DVDA 4L11A 5FP9A 3VGIA 5A33B 2JICA 4P9XA 3TN93 3W5NA 1V6OA 2J1UA 3KF5A 3BODA 2ERFA 3INAA 3UJQA 4R8HA 1QJY2 2DCJA 4XF4A 1JU3A 1WW7A 2JB8A 2O0OA 4HT1T 4OHXA 5ANNA 5LCWL 4LKSA 4DFSA 1GZWB 1N3OA 3B94A 3MUZ1 4H7LA 1JS9A 1QDCA 4XMAA 4L0PA 4U2AA 4HANA 4LA3A 1W9SA 4K9SA 2QQWA 4P5YA 2VTFA 2HJIA 4K20A 4CCDA 1G7YA 1LOEA 3JBG3 4K3UA 2HBTA 4EYUA 5I8YA 1G9DA 4V2WA 4Y26A 3ZR6A 1FOD3 4AG4A 2XVLA 3VDAA 3GZUC 4XTPA 1MVEA 4YGEA 1IG3A 1VP6A 4X8PA 2G9GA 3I3MA 4PBOA 4YYOA 1Q43A 3WDTA 3ZLIA 2VNRA 4Q27A 1PVXA 5DG1A 2BOJA 2WABA 5GM0A 3SLIA 1V6MA 1JTZX 2JDUA 5APAA 5FYIA 2JX9A 1AF9A 3OUIA 1ZBA2 2LM3A 4FFGA 3OYWB 1LOCA 2YY1A 2EICA 3AVSA 5L7OB 1RUC3 1NG0A 2WN2A 3HQUA 4XQ4A 1UY0A 2B9VA 1IS3A 5FYSA 4ARYA 1DGWA 3L9JT 3NW4A 4IV3C 5DZFA 2LALA 3DPRA 5KXEA 1Q8VA 3LSDA 4IL7A 4QX3A 4XUPA 4OI0A 2W0XA 4IEWA 5FY4A 1PO22 3WDYA 2DDUA 1ZRIA 4IUGA 3NRUA 5LRSA 5EXOA 3RNSA 2FDGA 3P3PA 2WAOA 3B9IA 3MPBA 4RGAA 3RFRA 5F5CA 2Y60A 3DYMA 4O7XA 4N43A 2FZ1A 1GYKA 4H7MA 3VBSA 3ZX7A 3PU8A 4XXPA 5I93A 3EMRA 3S6PA 1W8TA 2W47A 3T1LA 1XU2A 5CFCA 1MZEA 2VCMA 4NRQA 2ZA9A 2X09A 1HB1A 1MS4A 2VQ0A 1OOPC 2IXJA 3T1MA 3VZOA 2QDNA 4Y5SA 1H1MA 5T3NA 1RIRA 4Z82A 2OIIA 2WO3A 1W2OA 4QPGA 4A3XA 4LHLA 1X7NA 4LORA 1UMZA 1L3JA 1E5IA 4ARXA 3O5SA 2PQSA 1YHFA 3KGZA 1CR7A 2PYTA 3SHRA 2Q4SA 5JXHA 1NQJA 4XHBA 4N9IA 3IZOA 1C5IA 3O1OA 1X9TA 1WLWA 5JUVA 2RM21 4QD2A 4OI4A 4J25A 4QGNA 2D6LX 2ET1A 3V0AA 4RHV1 4JX0A 3CU7A 5FK8A 1JYTA 4XFGA 4UYBA 1HJGA 3WW1A 3T2TA 4BK4A 1R091 2K0GA 2QQLA 2UYBA 3DKWA 4URTA 3O1PA 1QOTA 3ZXDA 5JPNB 3H1WA 4DRVA 2BWAA 3ZN5A 2VVEA 2W1SA 2A6VA 1WMDA 3I7DA 5TSWA 5F2WA 2C6SA 5ABJC 4CEWC 5I0SA 1VRH1 3M8LA 1SLAA 1VBA3 2W3JA 1D0HA 3VLBB 5LATA 1QOOA 4G4FA 2FBEA 4L99A 4XILA 5FV3A 3ZKUA 1DLLA 3VZLA 4RA0A 3WT3A 3QOPA 1C8M3 1S0GA 1CIYA 4LMFA 1R1ZA 1AR93 3B5LB 4AEKA 4A4AA 3HN1A 4IV1A 1GZ9A 5I0TA 1U12A 1JYWA 4W6WA 1KEXA 1RVF3 1ULCA 1VBB1 3EJKA 3Q8CA 3GYDA 1VB2A 2X5IC 5C70A 4NPLA 3K4AA 1HN1A 1LEMA 4ZXEA 2W2IA 2OZ6A 2YMZA 5EPAA 4QGLA 2ES3A 2XJPA 1SHWB 1C8M2 1BVVA 1NXD1 4Y1ZA 5E6HA 3GXUA 4XVHA 3VBUA 5IVVA 5JCTA 2JG8C 1ZZCA 2VC9A 5LRRA 4GMP1 4Z07A 4A44A 4AHZA 2WNVA 5CYYA 5T50A 3V0AB 3ZYIB 1RXFA 3WUDA 2XLFA 1PVC2 1QDOA 1R081 4R4ZA 4XUTA 1X36A 3UJOA 4OMDA 1DHKB 4AAXA 4XF0A 1OVSA 1SCRA 4CDUB 5BV6A 1ZRFA 1RL3A 1YJLA 2ZHMA 5F5AA 1H2KA 1EPZA 3LPFA 4YFWA 1PGW2 2HEYF 1OXCA 3AYDA 3OSDA 2VE1A 3THCA 3N3HA 3AYEA 4HL0A 2QQOA 4NR1A 4AFCA 1SBEA 5A3TA 4MYEA 4GZ9A 1JZ7A 3CF6E 1C1FA 1R1A3 1NQDA 1COV2 1OUXA 2EAAA 2EIBA 3ELNA 3K3OA 5FZ4A 3MFCA 5LBBA 2X05A 2BDRA 3WNOA 4YW5A 3WHTA 2FDHA 1ZBA1 1JOBA 2VPVA 5FP7A 1WWYA 4P5HA 1C8M1 2Z42A 4GIQA 2QQIA 2RDQA 4Q1RA 5FYCA 5FZFA 3ZSKA 5JIUA 5FWEA 2QQJA 4ZONA 1XSQA 1HIXA 4FQZA 4M4RA 3MDPA 3N9LA 3WW4A 1HRV3 2R49A 2OUHA 3CJIA 4XFBA 2WWSA 2IXLA 4M3CA 4CXWA 2Y6KA 1A3KA 3OTFA 4X6QB 5IVBA 5CFCB 2RJKA 3FE5A 1F5FA 2PXJA 4ISRA 3LEMA 4I3GA 1YWKA 5FYUA 4FXKB 4MGSA 5H9SA 5F1RA 3Q9OA 3FJSA 3JD71 3MHZA 3WF2A 1AL21 3THDA 1QF3A 5A6XA 1J83A 4TN7A 3LWCA 4R9CA 2ZGTA 4YG0A 2WO7A 4KMQA 3VHRA 5FZMA 2IVIB 5EFUA 2NMNA 4MADA 3KV9A 1W8UA 2JD4A 3AJZA 5I8TA 2HEWF 2UY9A 1AR73 3R05A 4GH4B 4QPGC 3WF4A 4DXSA 3LOIA 4AEDB 2RJLA 4XAAA 5FYTA 3ZVXA 5FPLA 4ZPIA 4JHTA 3KMHA 2E26A 3I2FA 2XJSA 1UIJA 1EV12 1UF2C 1SFYA 4XUOA 4W4ZA 4P02B 2PFWA 2RS53 3CJIC 3ENRA 1UW8A 5C3PA 3PVOA 4XQDA 2YFZA 1YEWA 1ND3C 2E31A 2RR12 5DAVA 1HQLA 1VMJA 4L9BA 4PLNA 3OBAA 4BQWA 3U4SA 1S0JA 3AXDA 1S0DA 1ND3A 2VU9A 2G9ZA 3D0JA 4YFZA 2FDFA 3AKTA 5CG8A 1WLCA 4W6YA 1WW5A 2ZHLA 3VD3A 2WFPA 3ZKYA 4C1XA 1PZ7A 3I59A 1E5SA 2PHLA 3ECQA 2OX0A 5CA6A 2RS52 4LA2A 5AC91 1NLSA 5I91A 3OGRA 3S7IA 4ONUA 2VCCA 4BMBA 1OQDA 4Y20A 3H1YA 1MS0A 2D6KA 3IBMA 5FPAA 3HT1A 2GZWA 4NAMA 3WG4A 3ZPYA 3K75B 3H8XA 3ZSLA 1H9PA 1ACCA 1RUI3 2BUKA 1GNHA 3WP4A 4QKFA 3GHMA 1ULFA 1DP0A 1GNYA 2Z2SB 5HXMA 1D4M3 3H8UA 1DQ5A 2ARCA 4GMP0 3O1UA 5DAWA 2V09A 3MFAA 1H8VA 1PK6B 1VAMA 3WLUA 2WAAA 3LAGA 2GMEA 2NYYA 4K40A 2VOVA 4Y1XA 5L7OA 4D6RA 2NP0A 5JVVA 5FDBA 5EJZB 3GBFA 1PM4A 4LE3A 4E2SA 1RGSA 2TEPA 4PIZA 2YC0A 3IN9A 5A1FA 5FY1A 1UOGA 3LZZA 5AC93 1YQ2A 1O3TA 1TZOA 2WSUA 1BYHA 5HCBA 2BQPA 4LUMA 2XXZA 1RUH2 4LHNA 4DUVA 3C2UA 2VZTA 1CAUA 4OMCA 1Q8PA 1K42A 2HWF2 1B35A 1W9WA 1FX5A 5FYYA 5CAZA 3GBGA 4NIGA 1VE0A 1HRV1 1CZSA 1ZVFA 4AHWA 2W39A 2YBKA 4P9WA 3J7HA 1ZA4A 1QWRA 2G1MA 4FTSA 3FHAA 3OY8B 3JD72 5CKMA 1VJ2A 2BGOA 2R32A 4MO3M 3RZZA 5HCAA 2W1QA 3USUA 1C1LA 1RUD3 4P9YA 4IEXA 1GOGA 4XW3A 1WCQA 2W91A 3GM8A 3FZ3A 2D3SA 2Q5TA 3KQRA 5C9AC 3MF6A 1F15A 5EYYA 2WZR1 4X8NA 4QQPA 3CLPA 1F2NA 3AYCA 3U75A 3ZSJA 1MR5A 1OH4A 1S2KA 1FXZA 2R7EB 4QMAA 3SQOA 4CDQB 1JYIA 1OLMA 1XQNA 3P1IA 2HEVF 2C26A 3M1HA 3EB7A 4H2AA 4XOGA 3KCYA 2FMDA 1YFXA 4YM1A 3VZNA 2C4XA 1QMJA 2Q30A 2ILMA 4GH4C 1C4RA 1SG3A 2WR9A 1OKOA 4Q26A 1GZWA 3FFZA 3V56A 4LO6B 4AQSA 2VZRA 1T6GC 1X33A 4Y33A 2EALA 2ZCWA 3NKGA 2WLQA 2IXCA 4INDA 4PDWA 4HKLA 1IPSA 1J1LA 3P3NA 2B9UA 1LESA 2DVBA 1N47A 1Z0HA 1AXKA 2AUYA 3KQ4B 4QM8A 3VBFA 3ORJA 1O5LA 2VZOA 3RZJA 3W20A 3K46A 1MEC1 4XJ8A 3K51A 4EWDA 3RJRA 3I3BA 1RHI2 1U5XA 4BQ3A 4CU6A 1UL9A 1VR3A 2DFBA 1LODA 4AL9A 1WBFA 5K4LA 4ZU4A 3U1XA 4NE9A 3J26N 1RVF1 1VBB3 2PLV1 1E5RA 2VNOA 4FPGA 1RUE3 4FFFA 5C71A 4HK8A 5A7PA 3CIHA 2V4VA 3LIHA 4PF5A 3ZFGB 2ENRA 1ZX5A 1XNBA 5C8CA 4PDWB 5FY8A 5GZDA 1BEV2 1W6NB 1W6PB 3LSEA 1RITA 1ONAA 4MGKE 1C8NA 5FCCA 1RUNA 5F6LB 3VKLA 4BOWA 4AWDA 4PI2A 4A3ZA 3KHBA 5FXXA 1LHUA 1SDWA 1U5YA 2WNUC 1HJFA 2AEYA 3NWKA 3S7EA 4CZSA 1VMHA 4PIXA 1H9WA 3NV3A 4KWJA 1HQNA 3POGA 4QX5A 2WQ4A 4FPEA 3BU0A 3FWEA 4WVVA 2ZACA 1H6XA 1RUI2 4FOYA 3GDBA 2J22A 2RDNA 1CAVA 1LJ7A 4HSJA 1ENRA 3WDVA 4HFSA 3WQBA 3IB3A 2WZR3 5JOYA 1OOPB 1GOHA 1O7FA 1HRI3 2QCSB 1WLDA 2D6PA 3LPGA 3POYA 1O3SA 4OHZA 2ORXA 1QXPA 1QNWA 1HXS2 5IFPA 4MXWB 3T2OA 3JB4C 4KG0A 3MIDA 2ZEZA 1WW6A 2DUOA 4JC1A 4P9JA 5JMCA 1O91A 4FI9A 1RB8G 5GLUA 4UFLA 2WS91 3T4HB 4XFFA 4RHV2 5CB7A 1APNA 1S0IA 3CMGA 5FKCA 3ZYRA 1RMU2 4CU8A 5DMYA 2WA3A 5FZ6A 1VRH3 3I54A 4GA9A 3AXEA 3WW2A 2AREA 3WVJA 2BFUS 4GWMA 4XE9A 5DDJ2 2VGDA 1ZM1A 2ATFA 1WLTA 4BLJA 1RJ7A 1NLQA 4LOSA 1YO8A 3OG2A 3TEZA 1H8TC 1US3A 2A6ZA 3QH6A 1JUHA 1DYPA 4Y22A 5FZ8A 3U07A 4V2VA 4CEWB 5LA1A 2BU9A 2CV6A 2RV9A 4QGMA 2VECA 1W6OA 1RUD2 1Y9MA 4OHWA 4XMIA 4ZU7A 3OF1A 4WM7B 3NNFA 3WSOA 5HCHA 1ZZ9A 1S0FA 2CDPA 5JPMB 3U37A 5JIAA 4ZXKA 3WV6A 4Y1UA 5LZ6A 3RSJA 1LOBA 5FY5A 4XZUG 1POV1 4B7KA 4AGGA 2DU1A 2B7YA 1GQHA 2R043 3H7YA 4EWEA 1GANA 3P5BA 4KNCA 1AR83 5JOXA 3AL6A 2P2KA 1RHI1 3TN92 1EUTA 2BNMA 3LEKA 4OQ9A 3WQ0A 4JKMA 5F9TA 4F8AA 5DUXA 4S2FA 2VOWA 4LUKA 5HPOA 1W0OA 1YCIA 2MEV2 1JZ8A 1OPOA 2QQPA 5IVJA 2H6CA 2IWGB 5CKNA 4AYUA 1OT5A 1NUKA 1XNDA 2LROA 2PLV3 2YU2A 3C3VA 4QPIA 4AVSA 4EN0A 4TLFA 2R30A 5FK7A 4IV1C 3ZXLA 3IPVA 3K4DA 5EJ3A 3THPA 4ZS2A 2WYFA 5IYYA 4XACA 2XOMA 5AFBA 3HD8B 2B5HA 1PZ8A 3LE0A 1G9CA 3MBWA 4Q4V2 2ZHNA 3QACA 3VV1A 4LITA 3WNKA 3B9CA 4QPIC 3PU3A 5A3WA 4JCKA 5LEJA 3AKRA 3MLJA 5A3UA 1W3XA 5ABJA 1D2QA 4AFMA 3PUIA 2D3RA 5LW9A 2A3WA 3WCSA 3GHNA 3I4IA 4WM7A 3WP5A 4Y20B 4BZ4A 4D8MA 1H6YA 1TME2 1ULOA 3NSTA 2VZ1A 3RMXA 4AI8A 4CU7A 3SEEA 1CJPA 5FP8A 4QM9A 1VBD1 3OGSA 2Y6GA 3UKNA 1BEV3 3ZM8A 1SFPA 3VBOC 4DXZA 3NL1A 3LA3A 4HMZA 2XMLA 1OHFA 5FO7B 5BUVA 3AZZA 1NOVA 1RYYA 1AL23 2WL1A 4Q4Y1 3ZYHA 2GP3A 2E51A 3PUHA 3WG3A 1VB4A 1H1IA 3OBTA 2GC3A 3TNPB 1IS5A 1K5MB 3BOWA 3LEGA 1AYN1 4AI1A 3N9OA 2JG8B 3AZVA 3ZFEB 4BWOA 4E27A 5HBAA 1R64A 2P37A 4OVEA 5K8SA 2EXKA 5L9BA 4RQPC 3VBOB 5GLTA 3TEXA 2BP6A 1LOFA 4AVAA 2RMU1 1UD1A 3VHPA 4M3CF 1COV3 2P17A 3TNQA 4ASKA 3I2HA 4HONA 1Q3EA 4IGPA 3MLKA 2D98A 1ZBA3 2BVBA 2GN3A 3RYPA 1VMFA 1FATA 1W8FA 3LDRA 4ASMB 5DAQA 2HWE2 1W3VA 3LB9A 2OT7A 3OJBA 4LKDA 1DZRA 3JU9A 4HOOA 3TN91 4AR2A 2E7QA 1C28A 3BUCA 1DBNA 3WY6A 3FN9A 4YG3A 4RS5A 4XJWA 5FZKA 4TSVA 3D4KA 4SBVA 4NVPA 1FPN3 1CONA 4LIUA 2B39A 4L8QA 3K4ZA 1RUF1 2DYCA 3RI8A 4L92A 2I07B 4MUVA 4PQQA 5IVYA 4NPRA 3ZYJB 4Q4W3 3VBRC 2RHPA 4PF1A 1JZ4A 1BKZA 1XE8A 2ZOEB 2YDEA 4I09A 2FQPA 4IEVA 2WWUA 2W68A 2R041 1FI2A 4NN0A 1H4HA 4JQRA 1QNYA 4BK5A 5KXBA 2DFCA 4MGZE 2RS33 2J7MA 3MICA 4DS0A 1UYXA 3NAPB 5DDJ1 2VZUA 2RE9A 3T3YA 3S5AA 4I30A 1MQTC 1FYUA 1AR72 4YVWC 1AUYA 4BMEA 4XCAA 4GWIA 3JXSA 2GP5A 2I2SA 1RTVA 2JE8A 2P34A 4UW6A 3FHIB 1EV13 3CJIB 2HKXA 3NQHA 3KLSA 2XBO3 2VOXA 4J6GA 3UT0A 2FZ2A 3NJZA 3OUHA 1JMUB 5CADA 2VCAA 4FFHA 3ROUA 5IWFA 1Y9GA 2RS32 1HXS1 4CP0A 1A34A 1VALA 1W0NA 3NMBA 2X8KA 2B8MA 1OSGA 2G9FA 1GUIA 2BZDA 3OGVA 4FPLA 3WCRA 4CPBD 5T5LA 4CEYB 1U0AA 1K5JA 1US2A 1W2TA 2AACA 4CEYA 1MS5A 3H3ZA 3J4UH 3NV2A 3AMQA 4AVCA 4O65A 2A1XA 4HVOA 2BTVC 2XBO2 4R9BA 2Q0AA 5F39A 2JB4A 4B3NA 1PGSA 4A6OA 3DECA 4LBNA 4Q4V3 2E7AA 2H0VA 2X5IA 3PVNA 3LIGA 1LHOA 5BNOC 5B4NA 2QDRA 1EP0A 4DB5A 4MLOA 4YZ1A 3KHCA 2XQXA 5J37A 2D93A 1UN1A 4IE7A 2KA3A 2KM2A 1XOYA 3KVBA 4KWLA 1I6XA 5FZLA 5LY1A 4YLZA 3NV1A 2V5YA 4HN0A 3ZR5A 4NPMA 1NE6A 3WP6A 3WF0A 2BGPA 1RUF2 3RGBA 1KJRA 4CUGA 2ZABA 1XNKA 4BCUA 4RGGA 4XURA 2CWSA 2Y6LA 4FXGB 3H50A 2A5ZA 3PUAA 1AX2A 4I3PA 2XWBB 4R4XA 5CVRA 5IAXA 1FAYA 2FDIA 1OD3A 3O14A 3C7HA 3PL0A 1PO21 4P9IA 4Y5Z0 4TXWA 1UMHA 4BQYA 5I0RA 2YPDA 4GJYA 4O61A 1RUG3 4M0NA 4N43B 5LBEA 4HVRA 1AYM1 1NA1C 1ZZ8A 4UW3A 1W6QB 1RUC2 5A1LA 1GWKA 4LK7A 1JYNA 2D44A 3J7MA 4GH4A 4YRDA 4Q0SA 1A6CA 4CRQA 2HWC2 2JE7A 2QFEA 4RQPB 3SC7X 3KT4A 3UV9A 2A3YA 2A70A 2WNUA 4SLIA 1URXA 2Z79A 4MGIE 1UZWA 3VD5A 5AVAA 1S55A 5D1IA 3I49A 3GBWA 4A2UA 4LOTA 4IW3A 4QQ2A 1NKGA 4QQHA 2JG9B 4TYSA 3AMHA 4JDNA 1ND2B 3ZYGA 3MW3A 5JSOA 1KS4A 4HKOA 4NIAA 1ZRRA 3HOBA 1K5MA 1S2BA 2VQTA 2E9QA 2HWC3 2P5BA 5FXZA 3WUCA 2R062 1BMV2 3AK0A 4XIOA 3VBSB 5ACA3 2ZGLA 4Q0UA 5IAVA 4I2OA 4XF3A 4ZY9A 2P6CA 1I1EA 1CAXA 1TVGA 2FDJA 2MPFA 2CHHA 2XKPA 2JDKA 1OLME 3FBYA 2XLGA 2P6HA 4QX7A 4CCOA 5BNOB 4XFHA 4IXLA 4YZ3A 1I5PA 3NJXA 2EIDA 4QB1A 3D8CA 5E1RA 5JR2A 1LU2A 2WSVA 4KGGA 4C0BA 5AVPA 1G9BA 1UWWA 4YARA 2UWCA 2F17A 4QX1A 5FY7A 3AX4A 1UKRA 1IQAA 3WG2A 1KGYA 2P4EA 2BNOA 3JBG1 1V00A 4XFIA 5LK5A 2BRTA 1W39A 2Y6FA 3J8F1 4JZRA 4PHZA 4KWUA 5FPVA 1MQTA 1RUG1 4FFIA 5FP3A 1W05A 4CCNA 4YPJA 1OA3A 3IPVB 2HWB2 2XL7A 4UF0B 4BLIA 1SPPA 3N9PA 3ALQA 3WNNA 4M00A 3RJ2X 4FP2A 1LULA 4WM8B 1F4HA 2ARAA 2C9AA 4GD4A 3PJYA 4NROA 4IGQA 4LBOA 5LEKA 5K0UB 1MZFA 2ZX0A 3WZ1A 5G04L 4XZPA 1W8NA 2YUEA 5IK4A 3IWZA 5L9VA 4TLGA 4NIIA 1YFWA 1FNYA 1QJU1 4QX2A 4KU7A 3KV4A 1EAH3 3MIFA 4QT6A 3FX3A 2OQ6A 3QD6A 1GFF2 1RUJ1 1AR92 4AVTA 2WN3A 3AP4A 1YRZA 4LTAA 5JI7A 4CDUA 5A6QA 1ZRCA 1LHWA 1OF4A 5FZBA 3AKQA 2AEZA 2IXKA 3JCIA 1CAUB 2QBXA 4QPIB 1JYVA 3VBHC 1RUJ2 1NCRA 2VM9A 3DN7A 4RN5A 3RDIA 3VDDC 4D69A 4YW6A 3WDUA 3MIEA 2NMOA 4AXOA 3PIJA 3A0KA 4JRLA 4ASLA 4Z8BA 2QVSB 4KBZA 4Y5TA 1D4VB 2PTMA 4XDQA 1W8HA 3U14A 3OD0A 3JQWA 5BNNA 2HWB1 1OC1A 1UXZA 2EAKA 5FTTC 4BQ5A 5ISLA 4AF9A 4LO8A 3H42B 1AZDA 2R1BA 4XPVA 1WA4A 2R16A 1DGLA 5EHDA 2RS13 4BXFA 5IK5A 4N43C 4DRRA 1OF3A 3Q8AA 3WG1A 4AFDA 5CBLA 4Q0PA 4CDUC 3ACIA 5IVEA 4AEMA 5E88A 1AYM3 1K5MC 2ZX4A 3HJRA 3RZGA 2LS6A 1J3PA 4G3YC 4X6RB 1YIFA 4CVUA 1NY72 4HVQA 1F35A 4Q8KA 4RGKA 1MS3A 5A33A 3ZYPA 1KXGA 2YFUA 1YXWA 4CDQC 2V72A 4B29A 3B00A 4CA9A 4BIOA 1TMF3 3OBZA 2Z4FA 1RUH3 4LBQD 1W06A 1OA4A 2DWRA 3MPPG 4AZZA 1GZCA 3VHNA 2ZZQA 3A0NA 4AGRA 1Q8OA 4S2DA 1NX9A 3QCWA 3DYPA 2B45X 2D6MA 4UAPA 1W8OA 3J9SA 3SMHA 1EAH1 4Q8LA 5G05L 3WP3A 4N8MA 4XABA 2K2SA 2VMFA 3VBFC 2WWJA 1QXRA 5C8WA 1CAXB 2D97A 4AVVA 1NZCA 3AZWA 3PVBB 3LEIA 1W2UA 2B4KA 1AR62 3GZTB 4QPGB 1QHDA 3HAGA 1EYBA 2DTWA 2PHFA 3N7MA 4OUEA 1EY2A 2YU1A 4EROA 3HNMA 4ZHNA 4XF9A 3KGLA 4ES8A 3RQ0A 4Q4V1 5FJHA 1B09A 2JWPA 3WR0A 2DF7A 1QOSA 2VQAA 4YVWA 3VHOA 4AI2A 3WW3A 5ABJB 3F95A 3M4FA 2IXIA 2IVJA 1MS9A 3EO6A 4BQ2A 3OBRA 3LQCA 3SKVA 1QY4A 4LEJA 4YW2A 2E53A 3FL7A 3OPZA 5BNNB 3OPWA 4AI3A 2NLRA 3HIFA 5FXWA 2XWJB 3IAQA 5I8SA 1IKPA 3BOPA 4R52A 4QDRA 4BQ4A 1W2NA 2RS11 3TWIA 3T08A 1PGW1 1XPWA 4RYDA 1C5HA 3R4SA 1P8JA 1H2NA 2EIEA 1WMEA 2BGCA 4DUWA 3WQ1A 2YB7A 4JKKA 2W08A 4OUSA 5C3OA 1SLTA 2GH8A 3LF7A 1UOBA 2XH6A 2HWB3 4ZS3A 1AHSA 2Y0OA 2R0FA 3BIWE 2F6BA 4E8DA 1X8EA 1UU5A 3DXTA 3KT7A 2DVGA 1V6IA 1Z7S1 5F37A 5IATA 1GU3A 3KCCA 4Q0QA 1Q56A 2VW2A 2PHUA 1CAWB 1BLZA 1ZBE2 5A7SA 5ACA1 1OQ1A 3RYRA 2OYZA 2WNVC 4QB2A 5F3EA 3WHUA 1REEA 2WZR2 3B3QE 1NT0A 4D6QA 2J1RA 2VO5A 4UFMA 1RUE2 4F3JA 3H3UA 2FDKA 4JGZB 1XE7A 4GJZA 4LBLA 3W21A 4QDSA 2E33A 3D5OA 3MV01 4YM2A 4DY5A 5FZIA 5L7OC 4HSLA 3JZVA 1OMIA 1W0PA 2ZGPA 3HMYA 3O0XA 1IS6A 3OEBA 4IE4A 4J1XA 3DV8A 1D4M2 4N90A 4QHOA 4YW3A 3VDCA 4BPZA 4EWAA 2VOKA 1RMU3 4HN1A 3PDQA 3VBSC 1BBT3 5JZGC 2W92A 4WBBA 1U5IA 4JDOA 2XJRA 4L97A 3ILNA 4HPKB 2JIGA 2HWF1 1J84A 2C0ZA 4QHBA 5C3RA 4IEUA 4XFAA 4AQTA 5FZGA 1LHNA 3IKWA 4OI2A 2NPIA 1UY4A 3GJBA 4NHYA 5I0DA 1PO23 1O3RA 2PHRA 1HX6A 1JYXA 1Y3TA 3KWVA 4TWTA 4XQWA 4JRAA 5C8CC 2Y64A 1DYKA 4EZHA 3U10A 5BNOA 4CPBA 1REDA 3NAPA 2DV9A 2VCBA 2MNGA 5CFCC 2L9LA 4D7YA 5FPXA 5C9AB 1AR71 1HDKA 4QXHA 5GKAC 4WZFA 2W95A 3VBHB 1PO11 4GB33 2R042 5CIRA 1W04A 3D3AA 1HB2A 1SDDB 4H3WA 2VZPA 5FZAA 1IHMA 3K48A 2WNEA 5FWJA 1BEV1 4FPKA 1ZBE1 3ZN4A 4MGTA 3LDKA 1G6NA 2ZGQA 1DFQA 2J1VA 5JMOA 3MIHA 2MEV3 4AHYA 2W9XA 4PDWC 1XRUA 4EN9B 1DG6A 4GALA 4KQ7A 4CP9B 3ZIWA 2JKXA 2Q1FA 5DAPA 4ZKTB 2VMDA 3DPRC 2E7TA 4UFIA 4CCCA 3R4DB 4JGZA 4JKLA 3SITA 3UKVA 5BNPB 3ST7A 3QLQA 3HVDA 4LJHA 3POBA 3M3EA 1ND3B 5KR7A 2DCZA 3V64A 3KV5A 2VOTA 4HETA 2NN8A 1VLNA 1BBT1 3IDCB 4XDPA 4UI9L 2VTXJ 3RWKX 1CAWA 1V70A 3RVHA 3QBQA 2WQ8A 3MEPA 1CPMA 2BNNA 2GSYA 3VBRA 4CCLA 1AR82 3ETQA 4FT8A 4P9LA 1TME3 2VR4A 1VBC3 3JBG2 3HBKA 4HK9A 5A3PA 3N9MA 4DO0A 1JHJA 4JTNA 5JOZA 1V6JA 5L19A 5EQUA 1Q5OA 1ASJ3 1IGOA 2ZMNA 2Q8EA 1CJDA 1D2SA 3LGRA 4JGYA 1UAIA 2HWD3 1DQ0A 1X50A 5IJRA 3O1SA 1OLRA 1ODMA 1ODNA 3CZJA 3O0WA 5L9RA 2ETEA 3RI9A 4CXXA 1J3RA 1POV0 4M01A 5HI0A 5IW0A 4BXSV 2EF6A 2D3PA 5A6YA 2QQUA 3EYPA 1NCQA 4KBBA 4LLOA 4JGZC 3ZYBA 5IVCA 1A78A 2WZEA 2WZ8A 4YM0A 5EWSA 1X9PA 4BHPA 2R061 1BMV1 2GC2A 1NLRA 1HB4A 1YC61 4YGBA 4L2NA 5FZOA 4UOJA 2UYAA 1TNFA 4IV3A 3N7LA 1QQP2 1ULPA 2W52A 3G6JB 4QB6A 2WUHA 3H0OA 2JE9A 4NO4A 2ZGOA 4YVSA 1O8PA 3MYXA 3OY8A 1QJY1 2W1UA 3CKHA 1ZZ6A 3FLTA 5B4XA 1COV1 3VL9A 1UYZA 5FZ9A 4DY3A 4Q29A 3N9QA 2ZEWA 1WBLA 5A6ZA 1PIV1 2AZ5A 4BM8A 4XJZA 3ZXAC 4I0BA 1QQP3 4ISQA 1UOFA 3J7LA 4LO7A 4WM8C 4JV4A 4LNVA 4E4SA 3UGHA 1UPSA 2WDBA 4NIDA 1LGCA 3MO4A 3O1MA 5IHRA 4QXCA 1DYOA 2ZGSA 3U0ZA 1YQ8A 1R082 2XLAA 5FZ0A 3CNAA 5GZGA 1W9FA 1UY1A 1S0BA 3BN6A 4B7EA 1SLCA 2IFRA 5IK8A 2IZWA 2A6WA 2QZ2A 1GBGA 1W8WA 5FZ1A 2ZX3A 1WGPA 3FBMA 4Q1PA 4YWAA 4AI9A 2QQMA 5JAXA 4CCEA 4HPKA 1QU0A 4JTOA 1O59A 1V0AA 3NNLA 4LHSA 4ATEA 1GNZA 3VZKA 4EN6B 2K9ZA 3WF1A 4OLLA 5K7PA 1SQ4A 3BKZA 4MV2A 1DQ2A 3ZXGA 1E57A 1MZ5A 3U11A 4QQLA 2VXRA 5DABA 2JEMA 4Q4W1 5KHKA 2IFWA 4OHYA 2PHDA 3ABZA 5FPBA 1STMA 1BQPA 3I3QA 4CCKA 1PNGA 1LGNA 1OBNA 3IAPA 5A3OA 1TG7A 5KHIA 3UGFA 3MF9A 2BVVA 1UOJA 2Y26A 1JYCA
chains in the Genus database with same CATH topology
1NCRC 3KD4A 3VBOA 5JLVA 2OW4A 4RR3C 4CDWC 4N53B 1GLHA 2ZKLA 1OFSA 3ZO0B 4MGYE 1I9RA 3VZMA 1OOPA 4LE4A 1FMD3 4CYDA 1RINA 4IQPA 3TBDA 1ND2A 3SH5A 1N1VA 3EBRA 1VIWB 1H1AA 4ATFA 3THTA 3AKPA 3ES4A 2WNUB 2ZGUA 3ILRA 3SCGA 2ZGRA 3E6DA 4TZDA 1F31A 2OUJA 3RWNA 4AFBA 2VMHA 3SNMA 4PJYA 1XYPA 4LT5A 3S0MA 4E9KA 1LB2A 2P3KA 3PMEA 2A7AA 1ULDA 4A7ZA 5BNPC 2GNBA 2Y0IA 3ZDSA 2TNFA 2G4IA 4COUA 2NQYA 1SLBA 5H9PA 3WDXA 2WJSA 2ZX1A 5EZWA 1RVF2 1H0BA 3AB0A 3HQXA 2CNAA 3I59B 4JGYB 5J48A 2WS93 2RMU3 5LK7B 4FPFA 1S1AA 4RL7A 3VBFB 1BJQA 3J8F3 2GMMA 4C1WA 5IK7A 1PNFA 4FOWA 1VBE3 5C6CA 3N36A 2VG9A 4ORFA 4XJUA 2CL2A 4M3CB 3H9AA 2CGOA 4GQ7A 1KJLA 1UZYA 2HYKA 2R063 2VW0A 3R0RA 4PIYA 5DZGA 5KXDA 2JG9A 2UY8A 3VN4A 4Y1YA 1QJX1 3N7JA 4CDXB 4MX3A 3ZMOA 2HWE3 4EV0A 3POWA 1ZNPA 4Q4Y2 1OA2A 1O4YA 2CTVA 2Z69A 5BPXA 3R4UA 2HWD1 4CEWA 2PHWA 2PAKA 4MXVA 1MS8A 1FNZA 4EN8B 1QJZA 1XYOA 3AYAA 4FCAA 3LA2A 1OKQA 5FREA 3WOGA 1DQ1A 2PN5A 1UKGA 3E97A 1DZQA 1TME1 5GZFA 3POSA 5DG2A 4MVTA 3VL8A 1LRHA 5CG9A 1OI6A 5K9YA 1ZREA 2ARXA 3L2HA 4GWNA 1KS5A 2IXHA 4RR3A 3B93A 3WINE 1OFNA 1REFA 1ZYBA 3GF6A 4MXWA 4Y24A 1DF0A 4COYA 4LLFA 4FQ4A 1A8MA 4D94A 4DINB 1MACA 3ZXFA 3ACLA 1Q8QA 1RHI3 3AM2A 1YFUA 2EIGA 5IT6A 4I0WB 4IETA 4DMIA 3SXWA 1SBDA 4UXAA 5T52A 1RUJ3 1UU6A 2JECA 1VBA2 4WVWA 5C33A 5FLHA 1UU4A 1PO13 4GB31 4K6BA 4XEZA 3SISA 4N9HA 1W6OB 1NYWA 2R1DA 2SLIA 3KS7A 5BNQA 1WD4A 3AP9A 3ES1A 5C8CB 1X8MA 4IESA 1V9U2 3IIAA 2ZMKA 3DL3A 3E5UA 5DXDA 1NCQB 5L36A 3VBRB 4KL1A 5E16A 3EHKA 1LKNA 2BWCA 3MLLA 3PJQA 1CVNA 1PO12 1PIV3 5EYXA 2UWAA 4DQAA 5JZGB 2VUAA 3AP7A 1QGLA 4YVSC 1VBA1 1DGRA 4J1WA 4KG8A 2HWF3 1O4TA 4YG6A 5JOWA 3WDWA 5GLWA 1LU1A 1XXNA 2AYHA 4LBMA 5JR7B 3TRSB 1IOAA 4LBQB 1PVC3 1R093 1EV11 2WS92 2RMU2 3ZFEA 5FOBB 5DUWA 1PIV2 2PAMA 4RHV3 3J8F2 2O8QA 1OQEA 3B69A 4CP2A 5A32A 2PA7A 5DDJ3 1JUIA 2MHFA 4K8FA 3NVCA 1I5ZA 1N3PA 1W6MA 1MS1A 1M06G 1CESA 1D4M1 4P14A 1R1A2 2JXAA 5FMOL 5C4WA 4KGQA 3CO2A 2D5FA 4N53C 4E4ZA 1PK6C 5D8AC 2CY6A 2D6OX 4FTEA 4FO9A 2WFF2 1Z7S3 2VH9A 1CD3G 1QJX3 4WV8A 5HCFA 3H7JA 1VBD2 2YYOA 1NXMA 2D40A 3KCXA 3AMMA 2ET7A 2P3IA 4UBHA 5BY5A 1UIKA 4Z2WA 3DPRB 2DUQA 5GLZA 3ZXKA 4WVMA 3V65A 5J96B 2XJQA 2Z5WA 1ULEA 1YNAA 5ACA2 1FOD1 2VY0A 2OPKA 5JSRA 1SMVA 1Y7BA 1VBE1 3HR9A 4QXKA 1N1TA 2EXIA 1AXYA 2PHXA 1QJX2 3KZ4C 4C0HA 3PNAA 1XYNA 1UX6A 5K0UA 5KC5A 1WUVA 3VKFC 2WZPP 2EXJA 2YV8A 3URFA 3JQXA 3ZFFA 5JDBA 2OA2A 1AYN3 2EXHA 4RFT0 4IEPA 5CFDA 1S0CA 3DUIA 1AR63 5FLIA 4FAHA 2FMYA 1XNCA 3B7MA 5T5PA 2DVFA 2YZ4A 5EV7A 1D0GA 2NM1A 1ZBE3 2PAEA 3ILFA 4QQOA 4RSUA 1H2MA 3GZAA 2ZAAA 4NWWA 3SH4A 2YROA 1KITA 4HLTA 1KD7A 4U36A 2OZJA 4LULA 5D8AB 4BH9A 5A3LA 1C57A 2ZMLA 1F9KA 1CGPA 2RR13 2XUMA 2ZPXA 5KWRA 4S2HA 5E8AA 3CL1A 3DGTA 5CFDB 3RYKA 4FPHA 1TMF1 4RD7A 4Y4YA 4PLMA 4I01A 1RUD1 4KWKA 3TOJA 1C3HA 1BK1A 3AP6A 1YI9A 2AR6A 3MGUA 5FFOC 4WZCA 3KB5A 1V9U3 1Y43B 3DF0A 3GNEA 1O5UA 1SLLA 4R9DA 4N7IA 3VKNA 1W6MB 2UWBA 1NA1A 1IPJA 3CEWA 2EA7A 1KFUL 2A3XA 5C9AA 4YVSB 1H4GA 1VRH2 3IM0A 5F6KA 2QE3A 3O12A 3ZFGC 5J3UA 1LOGA 2DCKA 3I8TA 4QPYA 4Y22B 5K0UC 3ASIA 2ARBA 5KC6A 3E6BA 5C4WC 1R092 2LTNA 1DIWA 2RS31 1R083 1UPIA 4NWVA 1PK6A 1POV3 1HRI2 1AX0A 1MZ6A 1RUI1 1LOFC 1PGL1 2JKBA 3MIGA 4YNIA 4GKYA 3JD73 3RRDA 2H6BA 3A4UA 1CPNA 3G7DA 2ZBJA 3LCPA 1JH5A 1EPWA 4PBPA 1SACA 1JHNA 5FQ0A 2QZ3A 2B42B 4CDWA 4DPNA 5C4WB 5KXCA 1KQRA 5FAXA 2I74A 3W59A 4CDWB 1V6LA 5KHHA 4GB32 4PLOA 1YYNA 3IDEA 3WD5A 3H1MA 3M2MA 1SLIA 1H8TB 3VBUC 4BYYA 3FLPA 4AW7A 3W58A 4CP1A 1VBC2 2ZX2A 5BNPA 3O0VA 4YVWB 4MSVA 3RMYA 4WVZA 2C1FA 4RS5C 4D7TA 1CN1A 1LOAA 2F4PA 2XG3A 4F83A 4LBQA 3UL2A 1UZZA 2DVAA 3FLRA 1TQ5A 2CAUA 5CNAA 1W6QA 1LENA 3M3QA 3ZSMA 3VBUB 2ZGMA 1CQ9A 1JXNA 2XJVA 1ZZ7A 3FC0A 1FV3A 1AR61 4XETA 2FHRA 3OYWA 5JWPA 3IDBB 1DQ4A 3NAPC 1AL22 1ASJ1 1AX1A 1XU1A 2O8OA 5HXVA 1TNRA 1QJY3 2XL9A 3VZJA 2Y38A 1ASJ2 3MIBA 2LUWA 4MH0E 2R6QA 2HWD2 2GAUA 4UW5A 2WNVB 3ZXJA 1FT9A 1TE1B 1VAKA 4XBLA 5B2GB 3LKJA 4YZ2A 1H2LA 4A7YA 4W6XA 1BVP1 1CIWA 2ZAHA 3EXUA 4WM7C 2V73A 5FLJA 2Q1MA 3EQEA 3CJXA 4HZFA 4B8EA 1J58A 2CAVA 3ZFFB 1BBT2 2JDZA 4QU2A 5T55A 1PMIA 3R6SA 2MEV1 1RUC1 4COWA 1LCLA 4P9GA 1J1TA 5D8AA 1M4WA 2CGNA 2DCTA 4K7JA 5BXXA 4CTEA 1A8DA 2X53S 5KBFA 1H30A 4R9AA 1VBC1 1FV2A 2A6YA 2CYFA 2WQZC 2GH2A 4YGCA 2VUJA 1LHVA 4W65A 1I3HA 3ZIXA 3HBZA 3ZFEC 2BFUL 4AQ6A 1LTEA 1MVQA 2TBVA 1FPN2 4AQ2A 2BW8A 4Q0VA 2Q8OA 3IMNA 3ZN6B 1FMD2 4NHLA 4O9EA 1RMU1 4ZU5A 2GN7A 3MW2A 1H8TA 1HRI1 2I45A 2VMIA 1SBFA 4NOTA 4EN7B 5JSPA 1QXJA 2DTYA 2WIIB 4FP3A 1W6PA 1W6NA 4XXAA 4GKXA 4S2GA 2O1QA 2R071 2CWMA 5FQ0B 4O9GA 5CU1A 2XVKA 4COZA 4YSFA 5SV5A 2R072 5DZEA 5J09A 2CGPA 3VKMA 1KRIA 3NKTA 2QNKA 3TAYA 1DQ6A 3VUOA 4AI0A 1UCXA 5A3MA 4AE2A 3OD4A 3E5XA 1BCXA 4LO4B 4LHKA 3AMNA 4Q4X2 3N7KA 4COVA 1RUF3 1IS4A 5GLVA 1WCSA 1YFYA 3KSCA 5FO8B 5F5QA 1RUE1 4Z1VA 1BZWA 3V0BB 3OGGA 2YXSA 2WT1A 1V6NA 2WT0A 1AL0G 4RQPA 3UK9A 5FMOS 5JZGA 2BYVE 4JVAA 1SEFA 1HV1A 3KT1A 2ZGNA 2X5IB 1J3QA 4B4PA 2C5DA 3APBA 3ZMNA 3S30A 2AGSA 4B4QA 1GKBA 3N35A 2RS12 2R0HA 2GC0A 3B01A 4YW4A 2NZ9A 3VBHA 1ZRDA 1AYM2 1YUDA 3O7OA 4Q4Y3 2ZZJA 4N53A 1ENXA 1GQGA 5E89A 4K1YA 1HKDA 5H9RA 3AKSA 1J59A 1QKQA 1LR5A 4AVBA 4K1ZA 1G8WA 4LO5B 4PCRA 2WFF3 5FO9B 2WA4A 3M70A 4XFCA 1VBE2 1QH6A 1QQP1 5KHGA 2TUNA 2PELA 4C90A 1ULGA 2D5HA 4IV1B 4JDMA 3TYJA 4AGVA 3E5QA 2AH2A 5BYNA 4XF1A 3NV4A 4AFAA 1SFNA 1GSLA 2XJUA 1R1A1 4Q4X1 3VKOA 2XBO1 4A7KA 2JG8A 3HT2A 4E2QA 4AK3A 1F5JA 1HRV2 2OVUA 2ZS6B 1KDMA 1WW4A 3VDDA 2JJ6A 3ZSEA 3BCWA 3KM5A 5AFEA 2DCYA 4B4RA 3OCPA 3B02A 3PTYA 1AR81 4H14A 1DZTA 2KXLA 2GC1A 2GNMA 1RUH1 2VVFA 4F7ZA 4WVMB 3E6CC 3FUQA 5GZEA 3V0BA 1N3QA 4OFGA 4CDXA 2WINB 4FOQA 2N7GA 4DNYA 4HBNA 3BALA 2R073 4E2GA 1FMD1 1O3QA 4PQ9A 1NCQC 1FPN1 1G86A 3BTAA 2QUOA 4OZXA 1OLQA 1WCKA 1JBCA 1CAVB 2D6NA 1KFXL 4Q4X3 2VULA 1SCSA 3RPQA 1KDKA 2WC2A 2YPJA 2GNTA 1YJKA 1AR91 1OD5A 1HQWA 2WKKA 4K21A 1ZZBA 1NE4A 2XJTA 3HWJA 2RS51 3AP5A 5T5JA 1QJU2 5AC92 4FOVA 1HW5A 2GMPA 3FFQA 3AZYA 4ES9A 3UKTA 2ZTNA 4ITCA 2ZGKA 4IERA 4FBFA 4IEOA 4RS5B 2DU0A 1V6KA 1BXHA 3ZN6A 2RR11 4XIKA 2Q1ZB 2P3JA 1LEDA 4I0AA 4LR4A 2A6XA 3D82A 5I0UA 3AJYA 2DUPA 1Q8SA 3TB0A 1ALYA 1DDLA 3NO8A 1QJU3 2VVDA 4NHKA 3M7AA 3VDDB 3PHMA 1YLLA 1RUG2 4I02A 3AZXA 4YGDA 1N1YA 1VBD3 3FUOA 2JG9C 4FPJA 4D3WA 1G9AA 3RG0A 2XVGA 1N1SA 4NHMA 1AVBA 4HKWA 2VMGA 4BQ1A 2BPA2 3FMGA 4FVVA 1Z78A 3USUB 2GNDA 2E63A 1DGWX 3MZHA 5JI9A 3M3IA 4OHVA 5GALA 4YZ5A 2WLPA 3AFKA 3USSA 5SV8A 4BE3A 1YI7A 1JW6A 4AEJA 1B35B 5IUQA 3PLQA 5BNNC 1ENSA 1GV9A 1TMF2 3JUUA 3OGJA 4AEDC 4E4DX 1Z7S2 2A75A 4YW1A 4G9SB 4V1PA 3ZXEA 4M0HA 1WMFA 4XJAA 4LBJA 1OPMA 4FAGA 1AXZA 4IEYA 1PM7A 1DGRN 1X82A 3X29B 1IZ3A 2HWC1 1LGBA 1YIPA 1GICA 4H55A 3AMPA 1AJOA 4GMP3 4BA6A 3PMSA 4Y1VA 4EJRA 4XYXA 2D43A 3QH7A 1CX4A 4DOUA 5H9QA 1S0EA 4OUMA 4IV3B 2PQQA 2YGLA 2ZJCA 4XTMA 1GR3A 1PVC1 2GU9A 3AFGA 3RS6A 5KHJA 1HLCA 3M3OA 4GULA 4CDXC 4CEYC 3ATGA 3LOBA 4FTBA 1JOJA 3D6EA 1FOD2 4KU8A 2VW1A 2UU8A 3PVEA 2XB6C 1B35C 1HV0A 2VNGA 1VBB2 3MW4A 4Q2FA 4XJ9A 1EAH2 1TEIA 1Y9QA 5FBZA 3N4MA 3BU7A 2XPJA 1PGL2 4IEQA 1HXS3 4AHXA 2ZHKA 2WFF1 4KH9A 3IT8A 3ME2A 2DURA 1IPKA 2D7FA 1LECA 4XBNA 2YGMA 5J98B 4GXLA 3ZFGA 1RC6A 4OULA 3SCFA 4AEDA 2WT2A 3BPZA 3JB8A 1WCDJ 4LBKA 3BB6A 4UW4A 1NY71 2SBAA 2X29A 4FSJA 4META 2RM23 5GZCA 2ZKNA 3M3CA 2H0BA 1RUOA 1WD3A 2A73B 4YM3A 4OI1A 4FPOB 1F8VA 3WQ7A 5A32B 4Z92B 4XBQA 3WNXA 1O4ZA 5T5OA 5J36A 2IC1A 2A71A 1AJKA 3GALA 2RM22 3L2YA 3SCHA 1RJ8A 2BEOA 3MI8A 3WX5A 4Q4W2 2UURA 2BBVA 2YHJA 1PZ9A 1G9FA 1JN2P 5T54A 2AENA 3D0SA 4DZGA 2XGXA 4CDQA 1MEC3 1V9U1 1ND2C 1U5ZA 4N7UA 5CFDC 2B46X 4IEZA 2GDFA 2XHKA 1PHMA 3WXPA 1ENQA 4MZUA 4FPYA 5DUVA 3I2DA 4WM8A 4XHXA 4C91A 2PLV2 2QKDA 3SH3A 1NCRB 1IKQA 2E6VA 2XKOA 4RR3B 2GALA 2QJVA 5DUUA 2JENA 3ZFFC 2PHTA 1NA1B 1MEC2 4JAAA 5GJ6A 3W9AA 2HWE1 4YZ4A 4UBGA 1QH7A 1MQTB 5FPZA 1VAVA 5FOJB 4FPCA 5FRAA 4BIFA 5L73A 4JGYC 2EVXA 3U4XA 3LA7A 4M3CE 1AYN2 5J7MA 1DU3D 2DVDA 4L11A 3VGIA 5A33B 2JICA 4P9XA 3TN93 1V6OA 3BODA 2ERFA 3INAA 3UJQA 4R8HA 1QJY2 2DCJA 4XF4A 1WW7A 2O0OA 4HT1T 4OHXA 4DFSA 1GZWB 1N3OA 3B94A 4H7LA 1QDCA 4XMAA 4U2AA 4HANA 4LA3A 4K9SA 2HJIA 4K20A 1G7YA 1LOEA 3JBG3 4K3UA 5I8YA 1G9DA 4Y26A 1FOD3 4AG4A 2XVLA 3GZUC 4XTPA 1MVEA 4YGEA 1VP6A 4X8PA 2G9GA 4PBOA 4YYOA 1Q43A 3WDTA 2VNRA 4Q27A 1PVXA 5DG1A 5GM0A 3SLIA 1V6MA 1JTZX 2JX9A 1AF9A 1ZBA2 2LM3A 3OYWB 1LOCA 2YY1A 5L7OB 1RUC3 1NG0A 4XQ4A 1IS3A 1DGWA 3L9JT 3NW4A 4IV3C 5DZFA 2LALA 3DPRA 5KXEA 1Q8VA 3LSDA 4IL7A 4OI0A 2W0XA 4IEWA 1PO22 3WDYA 5LRSA 5EXOA 3RNSA 3P3PA 3B9IA 3MPBA 4RGAA 4N43A 2FZ1A 1GYKA 4H7MA 3VBSA 3ZX7A 4XXPA 5I93A 3S6PA 3T1LA 1XU2A 5CFCA 1MZEA 2ZA9A 3T1MA 1MS4A 2VQ0A 1OOPC 2IXJA 3VZOA 2QDNA 1H1MA 5T3NA 1RIRA 4Z82A 2OIIA 4QPGA 4A3XA 4LHLA 1X7NA 1UMZA 1L3JA 3O5SA 3KGZA 1YHFA 3SHRA 1CR7A 2PYTA 2Q4SA 1NQJA 4XHBA 4N9IA 1C5IA 1WLWA 2RM21 4QD2A 4OI4A 4QGNA 2D6LX 2ET1A 3V0AA 4RHV1 3CU7A 4XFGA 3WW1A 3T2TA 1R091 2K0GA 2UYBA 3DKWA 4URTA 1QOTA 3ZXDA 5JPNB 3H1WA 4DRVA 2BWAA 3ZN5A 2VVEA 2A6VA 1WMDA 3I7DA 5TSWA 5ABJC 4CEWC 5I0SA 1VRH1 3M8LA 1SLAA 1VBA3 1D0HA 3VLBB 1QOOA 4G4FA 2FBEA 4L99A 4XILA 1DLLA 3VZLA 4RA0A 3WT3A 3QOPA 1C8M3 1S0GA 1R1ZA 1AR93 3B5LB 4AEKA 3HN1A 4IV1A 1GZ9A 5I0TA 1U12A 4W6WA 1RVF3 1ULCA 1VBB1 3EJKA 3GYDA 1VB2A 2X5IC 1LEMA 2YMZA 2OZ6A 4QGLA 2ES3A 2XJPA 1C8M2 1BVVA 1NXD1 4Y1ZA 3VBUA 5JCTA 2JG8C 1ZZCA 5LRRA 4GMP1 4Z07A 4AHZA 2WNVA 5T50A 3V0AB 3ZYIB 3WUDA 2XLFA 1PVC2 1QDOA 1R081 4R4ZA 1X36A 3UJOA 1DHKB 4XF0A 1SCRA 4CDUB 5BV6A 1ZRFA 1RL3A 1YJLA 2ZHMA 1H2KA 1EPZA 4YFWA 1PGW2 2HEYF 3AYDA 3N3HA 3AYEA 4HL0A 4NR1A 4AFCA 1SBEA 4MYEA 3CF6E 1C1FA 1R1A3 1NQDA 1COV2 2EAAA 3ELNA 3MFCA 4YW5A 3WHTA 1ZBA1 2VPVA 4P5HA 1C8M1 2Z42A 4GIQA 4Q1RA 3ZSKA 5JIUA 1HIXA 4FQZA 3MDPA 3WW4A 1HRV3 2R49A 2OUHA 3CJIA 4XFBA 2WWSA 2IXLA 4M3CA 1A3KA 3OTFA 4X6QB 5CFCB 2RJKA 3FE5A 1F5FA 4I3GA 4ISRA 1YWKA 4FXKB 5H9SA 5F1RA 3Q9OA 3FJSA 3JD71 1AL21 1QF3A 3LWCA 4R9CA 2ZGTA 4YG0A 3VHRA 5EFUA 2NMNA 3AJZA 2JD4A 5I8TA 2HEWF 2UY9A 1AR73 3R05A 4GH4B 4QPGC 3LOIA 4AEDB 2RJLA 3ZVXA 3KMHA 2XJSA 1UIJA 1EV12 1UF2C 1SFYA 2PFWA 2RS53 3CJIC 3ENRA 1UW8A 3PVOA 4XQDA 1ND3C 2RR12 1HQLA 4L9BA 4PLNA 1S0JA 3AXDA 1S0DA 1ND3A 2VU9A 4YFZA 3D0JA 3AKTA 5CG8A 1WLCA 4W6YA 1WW5A 2ZHLA 4C1XA 2WFPA 1PZ7A 3I59A 3ECQA 2PHLA 5CA6A 2RS52 4LA2A 5AC91 1NLSA 5I91A 3S7IA 4ONUA 4BMBA 1OQDA 4Y20A 3H1YA 1MS0A 2D6KA 3IBMA 3HT1A 2GZWA 3WG4A 3ZPYA 3ZSLA 1H9PA 1RUI3 2BUKA 1GNHA 3WP4A 3GHMA 1ULFA 2Z2SB 1D4M3 3H8UA 1DQ5A 4GMP0 2V09A 3MFAA 1H8VA 1PK6B 1VAMA 3WLUA 3LAGA 2GMEA 2NYYA 4K40A 2VOVA 4Y1XA 5L7OA 2NP0A 5JVVA 5FDBA 3GBFA 4LE3A 4E2SA 1RGSA 2TEPA 4PIZA 2YC0A 3IN9A 3LZZA 5AC93 1O3TA 2WSUA 1BYHA 5HCBA 2BQPA 4LUMA 1RUH2 4LHNA 3C2UA 1CAUA 1Q8PA 2HWF2 1B35A 1FX5A 5CAZA 3GBGA 1HRV1 4AHWA 1ZVFA 2W39A 4P9WA 1ZA4A 1QWRA 4FTSA 3OY8B 3JD72 5HCAA 1VJ2A 2R32A 3RZZA 3USUA 1C1LA 1RUD3 4P9YA 4IEXA 4XW3A 3FZ3A 2D3SA 2Q5TA 3KQRA 5C9AC 3MF6A 5EYYA 2WZR1 4X8NA 4QQPA 3CLPA 1F2NA 3AYCA 3ZSJA 4CDQB 1MR5A 1S2KA 1FXZA 4QMAA 1JYIA 1XQNA 2HEVF 3M1HA 4XOGA 3KCYA 2FMDA 1YFXA 4YM1A 3VZNA 1QMJA 2Q30A 2ILMA 4GH4C 1C4RA 4Q26A 3V56A 1GZWA 3FFZA 4LO6B 4AQSA 1T6GC 1X33A 2EALA 2ZCWA 3NKGA 2WLQA 2IXCA 4INDA 4PDWA 4HKLA 1J1LA 3P3NA 2B9UA 1LESA 1N47A 1Z0HA 2DVBA 1AXKA 2AUYA 4QM8A 3VBFA 1O5LA 4XJ8A 1MEC1 4EWDA 3K51A 3RJRA 1RHI2 1U5XA 1UL9A 1VR3A 2DFBA 1LODA 1WBFA 4ZU4A 3J26N 1RVF1 1VBB3 2PLV1 2VNOA 4FPGA 1RUE3 4HK8A 4PF5A 3ZFGB 2ENRA 1ZX5A 1XNBA 5C8CA 4PDWB 5GZDA 1BEV2 1W6NB 1W6PB 3LSEA 1RITA 1ONAA 4MGKE 1C8NA 5FCCA 1RUNA 5F6LB 3VKLA 4BOWA 4AWDA 1LHUA 1SDWA 1U5YA 2WNUC 3S7EA 3NWKA 4CZSA 4PIXA 1H9WA 3NV3A 4KWJA 1HQNA 4QX5A 2WQ4A 4FPEA 3FWEA 4WVVA 2ZACA 1RUI2 4FOYA 1CAVA 1LJ7A 4HSJA 1ENRA 3WDVA 4HFSA 2WZR3 5JOYA 1OOPB 1O7FA 1HRI3 2QCSB 1WLDA 2D6PA 3POYA 1O3SA 4OHZA 1QXPA 1QNWA 1HXS2 4MXWB 3JB4C 4KG0A 3MIDA 5JMCA 1WW6A 2DUOA 4JC1A 4P9JA 1RB8G 1O91A 5GLUA 2WS91 4XFFA 4RHV2 5CB7A 1APNA 1S0IA 3ZYRA 1RMU2 2WA3A 1VRH3 3I54A 4GA9A 3AXEA 3WW2A 2AREA 3WVJA 2BFUS 4GWMA 4XE9A 5DDJ2 2VGDA 1ZM1A 2ATFA 1WLTA 4BLJA 1RJ7A 1YO8A 1H8TC 2A6ZA 3QH6A 1JUHA 1DYPA 4Y22A 3U07A 4CEWB 2CV6A 4QGMA 2VECA 1W6OA 1RUD2 4OHWA 4XMIA 4ZU7A 3OF1A 4WM7B 1ZZ9A 1S0FA 5JPMB 5JIAA 4ZXKA 3WV6A 4Y1UA 3RSJA 1LOBA 1POV1 4B7KA 4AGGA 2DU1A 2B7YA 1GQHA 2R043 3H7YA 4EWEA 1GANA 4KNCA 1AR83 5JOXA 2P2KA 1RHI1 3TN92 2BNMA 3WQ0A 5F9TA 4F8AA 5DUXA 4S2FA 2VOWA 4LUKA 1W0OA 1YCIA 2MEV2 1OPOA 2QQPA 2H6CA 2IWGB 4AYUA 4AVSA 1XNDA 2PLV3 3C3VA 4QPIA 4EN0A 4TLFA 2R30A 3ZXLA 4IV1C 3IPVA 5EJ3A 3THPA 5AFBA 3HD8B 2B5HA 1PZ8A 1G9CA 4Q4V2 2ZHNA 3QACA 3VV1A 3B9CA 4QPIC 4JCKA 5LEJA 3AKRA 3MLJA 5ABJA 1D2QA 4AFMA 2D3RA 2A3WA 3WCSA 3GHNA 3I4IA 4WM7A 3WP5A 4Y20B 4BZ4A 1TME2 3NSTA 4AI8A 3RMXA 1CJPA 4QM9A 1VBD1 3UKNA 1BEV3 4DXZA 3VBOC 3NL1A 3LA3A 4HMZA 1OHFA 5FO7B 5BUVA 3AZZA 1NOVA 1AL23 2WL1A 4Q4Y1 2E51A 3WG3A 1VB4A 1H1IA 3OBTA 2GC3A 3TNPB 1IS5A 1K5MB 3BOWA 1AYN1 4AI1A 2JG8B 3AZVA 3ZFEB 4BWOA 4E27A 5HBAA 4OVEA 2P37A 5K8SA 2EXKA 4RQPC 3VBOB 5GLTA 4AVAA 1LOFA 2RMU1 1UD1A 3VHPA 4M3CF 1COV3 2P17A 3TNQA 1Q3EA 3MLKA 2D98A 1ZBA3 2BVBA 2GN3A 3RYPA 1FATA 4ASMB 2HWE2 3LB9A 3OJBA 1DZRA 3JU9A 3TN91 2E7QA 1C28A 1DBNA 3WY6A