4HT4A

Molecular basis of vancomycin resistance transfer in staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
AMYHFQNKFVSKANGQSATAKSAFNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWNKVHDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRGLDKNNEFEPKRKGNDYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicking enzyme
publication title Molecular basis of antibiotic multiresistance transfer in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase/dna
total genus 58
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4ht4A00
4HT4A 4LVMA 4LVIA 4LVKA 2NS6A 4LVJA 4LVLA
chains in the Genus database with same CATH superfamily
4RQEA 3P8YA 3BFMA 4YDQA 1NJ8A 4TQDA 4YRFA 2ZNJA 3RKXA 5C51B 1J5WA 4XTYA 1YB3A 2AMCA 1YFRA 2J3MA 1X54A 3HRKA 4XTUA 2HNIA 3A74A 1YFSA 4EX5A 5KNNA 2FYKA 4BW9A 3E9IA 2ARUA 2ZIOA 4H2XA 3QNEA 3E9HA 2I4MA 3HY0A 2J3LA 3HFVA 4H2YA 3MQZA 1X01A 3A5YA 4CH4A 4HWRA 1ADJA 2DXUA 2DKGA 2DTHA 2ODRD 3TEHB 4G85A 1WQ7A 4YRQA 1KMNA 3VQWA 2I4OA 4UP8A 4YROA 2E65A 4HA8A 4CH5A 4ZTZB 1BIAA 3HY1A 3UH0A 4LVIA 2RHSB 2EJFA 3RIRA 2PMEA 2ODRC 4DPGA 4H2SA 3P8VA 1C0AA 3NELA 3VQXA 1FYFA 1H4VB 2EJGA 4WI1A 4WJ4A 2E64A 4K87A 3V7RA 1EIYA 1N9WA 2RHQA 4XTVA 3RACA 4XEMA 1X2HA 4HWSA 1HXDA 4HWOA 1WYDA 1G5HA 2ARSA 4L87A 3VBBA 2DDZA 4CH6A 1GGMA 3REUA 4CS3A 4YRMA 3V8JA 4BWAA 1EOVA 1W66A 3P8TA 4OP0A 2NS6A 1WQWA 1X56A 4J15A 2AKWB 4Q6GA 4P71C 2CJAA 1YFTA 3IALA 4YP0A 3CMQA 3V8LA 3HTZA 1NJ1A 4WJ3M 2I4NA 4XEOA 3TEHA 4YRIA 3MF2A 2ALYB 2C7IA 1H4TA 1E1TA 1SESA 4G84A 1WNLA 4KQEA 2IY5B 4LNSA 3QTCA 4P3PA 2RHSA 4TTVA 1HC7A 1ASYA 1RIQA 3REXA 2ZT8A 2CJBA 4P71A 5E3IA 4YRRA 4UPAA 5ELNA 4YRCA 2Q5HA 1KOGA 1KMMA 4X5OA 4XU2A 4P72A 3A32A 4H2VA 1H4QA 2ZXFA 3HFZB 1EVKA 4UP9A 3IKMB 4Q15A 3A5ZA 3NEMA 3EFRA 1ADYA 3HXWA 4LVLA 4LVMA 2DQ3A 2ZCEA 1SETA 3V7CA 4H2WA 2ZZFA 1NJ2A 4XTXA 4YRTA 2ZZGA 3A7RA 3HXXA 3RKYA 2AKWA 1B8AA 3V7SA 2ZZEA 1HTTA 3MF1A 3L4GA 4ZIBA 3PCOB 2QHSA 2Q7EA 3L1AA 4YYEA 1Z7MA 2Q7GA 1USYC 4TVWA 2IY5A 4H02A 3TUPA 2DZCA 4WF2A 3DSQA 3HXVA 4CS2A 1E22A 1WLEA 1X2GA 3ERRA 1G51A 1PYSB 4P3OA 1BIBA 5K1PA 4NCXA 4CH3A 2DEQA 4PG3A 2QHTA 4XTZA 3ICAA 1B70B 2DZ9A 3HFZA 4H2TA 4K86A 4ZTUB 2EAYA 3LSQA 1NJ5A 2ZNIA 4YRSA 2XGTA 4KR3A 2A8EA 4YREA 4XU0A 1H4SA 4P3NA 4P74C 4P75C 1NJ6A 4HT4A 1X55A 2XTIA 1BBUA 2ZTGA 2DU5A 1EQRA 2DVEA 3WQZA 3V8KA 4YPFA 3M4QA 1G5IA 4YCUA 3W3SA 3TEGA 2EWNA 2DTOA 2E1HA 3I7FA 1LYLA 3QO8A 2Q5IA 4P74A 11ASA 4TVAB 4P75A 1Z7NA 2DU7A 1NYQA 4XU1A 4TWAA 2DTIA 1WPYA 2DJZA 4KR2A 2ZINA 3RF1A 2E3CA 4DQ2A 4RDXA 1NNHA 3VQVA 2P0LA 3A7UA 4AH6A 3OD1A 1PYSA 1E1OA 4XU3A 4YRLA 4P73C 4RQFA 4PHCA 2ZT6A 3QO7A 3UFGA 1B76A 5K1XA 3LC0A 3UGTA 1B7YB 3VQYA 1B70A 3NETA 4TQFA 5F5WA 2ARTA 3HXUA 3HXZA 3BJUA 3A7AA 3QO5A 4LVJA 1IL2A 1E24A 12ASA 1L0WA 4YRJA 1NYRA 3G1ZA 3IKLA 4UP7A 1VQZA 4P73A 4YRKA 2G4CA 4LVKA 2ALYA 3FJPA 4YRPA 3RUXA 4EO4A 5HGQA 4E51A 3RKWA 4K88A 1JJCB 1EFWA 1QF6A 4YRGA 1SRYA 2PMFA 2E41A 4HVCA 4YCWA 4TVAA 1ASZA 2CIMA 1SERA 2AMCB 3KFUA 1WU7A 4O2DA 4TVYA 1USYA 3MEYA 1YGBA 2QHVA 2ZGWA 3M4PA 3PZCA 2ZR2A 4H2UA 2CJ9A 4H2XB 3UGQA 2ZT7A 3LSSA 2ZT5A 4YRNA 2DQ0A 1B7YA 3RL6A 4XTWA 4HWTA 2I4LA 2CGHA 5ELOA 2ZR3A 2E10A 3NENA 3IG2A 3HXYA 3RGLA 4HWPA 3A31A 2P5IA 1QE0A 2DXTA 2E5AA 3L4GB 3EFSA 2EJ9A 3PCOA 4RMFA 3L2ZA 3R07A 2EL9A 1BBWA 1ATIA 3HRIA 2ZIMA 4P72C 5C53B 1EVLA 5C52B 2Q7HA 1EIYB 4OLFA 1JJCA 2RHQB 4YCVA 2QHUA 2C8MA 4CS4A
chains in the Genus database with same CATH topology
4RQEA 3P8YA 3BFMA 4YDQA 1NJ8A 4TQDA 4YRFA 2ZNJA 3RKXA 5C51B 1J5WA 4XTYA 1YB3A 2AMCA 1YFRA 2J3MA 1X54A 3HRKA 4XTUA 2HNIA 3A74A 1YFSA 4EX5A 5KNNA 2FYKA 4BW9A 3E9IA 2ARUA 2ZIOA 4H2XA 3QNEA 3E9HA 2I4MA 3HY0A 2J3LA 3HFVA 4H2YA 3MQZA 1X01A 3A5YA 4CH4A 4HWRA 1ADJA 2DXUA 2DKGA 2DTHA 2ODRD 3TEHB 4G85A 1WQ7A 4YRQA 1KMNA 3VQWA 2I4OA 4UP8A 4YROA 2E65A 4HA8A 4CH5A 4ZTZB 1BIAA 3HY1A 3UH0A 4LVIA 2RHSB 2EJFA 3RIRA 2PMEA 2ODRC 4DPGA 4H2SA 3P8VA 1C0AA 3NELA 3VQXA 1FYFA 1H4VB 2EJGA 4WI1A 4WJ4A 2E64A 4K87A 3V7RA 1EIYA 1N9WA 2RHQA 4XTVA 3RACA 4XEMA 1X2HA 4HWSA 1HXDA 4HWOA 1WYDA 1G5HA 2ARSA 4L87A 3VBBA 2DDZA 4CH6A 1GGMA 3REUA 4CS3A 4YRMA 3V8JA 4BWAA 1EOVA 1W66A 3P8TA 4OP0A 2NS6A 1WQWA 1X56A 4J15A 2AKWB 4Q6GA 4P71C 2CJAA 1YFTA 3IALA 4YP0A 3CMQA 3V8LA 3HTZA 1NJ1A 4WJ3M 2I4NA 4XEOA 3TEHA 4YRIA 3MF2A 2ALYB 2C7IA 1H4TA 1E1TA 1SESA 4G84A 1WNLA 4KQEA 2IY5B 4LNSA 3QTCA 4P3PA 2RHSA 4TTVA 1HC7A 1ASYA 1RIQA 3REXA 2ZT8A 2CJBA 4P71A 5E3IA 4YRRA 4UPAA 5ELNA 4YRCA 2Q5HA 1KOGA 1KMMA 4X5OA 4XU2A 4P72A 3A32A 4H2VA 1H4QA 2ZXFA 3HFZB 1EVKA 4UP9A 3IKMB 4Q15A 3A5ZA 3NEMA 3EFRA 1ADYA 3HXWA 4LVLA 4LVMA 2DQ3A 2ZCEA 1SETA 3V7CA 4H2WA 2ZZFA 1NJ2A 4XTXA 4YRTA 2ZZGA 3A7RA 3HXXA 3RKYA 2AKWA 1B8AA 3V7SA 2ZZEA 1HTTA 3MF1A 3L4GA 4ZIBA 3PCOB 2QHSA 2Q7EA 3L1AA 4YYEA 1Z7MA 2Q7GA 1USYC 4TVWA 2IY5A 4H02A 3TUPA 2DZCA 4WF2A 3DSQA 3HXVA 4CS2A 1E22A 1WLEA 1X2GA 3ERRA 1G51A 1PYSB 4P3OA 1BIBA 5K1PA 4NCXA 4CH3A 2DEQA 4PG3A 2QHTA 4XTZA 3ICAA 1B70B 2DZ9A 3HFZA 4H2TA 4K86A 4ZTUB 2EAYA 3LSQA 1NJ5A 2ZNIA 4YRSA 2XGTA 4KR3A 2A8EA 4YREA 4XU0A 1H4SA 4P3NA 4P74C 4P75C 1NJ6A 4HT4A 1X55A 2XTIA 1BBUA 2ZTGA 2DU5A 1EQRA 2DVEA 3WQZA 3V8KA 4YPFA 3M4QA 1G5IA 4YCUA 3W3SA 3TEGA 2EWNA 2DTOA 2E1HA 3I7FA 1LYLA 3QO8A 2Q5IA 4P74A 11ASA 4TVAB 4P75A 1Z7NA 2DU7A 1NYQA 4XU1A 4TWAA 2DTIA 1WPYA 2DJZA 4KR2A 2ZINA 3RF1A 2E3CA 4DQ2A 4RDXA 1NNHA 3VQVA 2P0LA 3A7UA 4AH6A 3OD1A 1PYSA 1E1OA 4XU3A 4YRLA 4P73C 4RQFA 4PHCA 2ZT6A 3QO7A 3UFGA 1B76A 5K1XA 3LC0A 3UGTA 1B7YB 3VQYA 1B70A 3NETA 4TQFA 5F5WA 2ARTA 3HXUA 3HXZA 3BJUA 3A7AA 3QO5A 4LVJA 1IL2A 1E24A 12ASA 1L0WA 4YRJA 1NYRA 3G1ZA 3IKLA 4UP7A 1VQZA 4P73A 4YRKA 2G4CA 4LVKA 2ALYA 3FJPA 4YRPA 3RUXA 4EO4A 5HGQA 4E51A 3RKWA 4K88A 1JJCB 1EFWA 1QF6A 4YRGA 1SRYA 2PMFA 2E41A 4HVCA 4YCWA 4TVAA 1ASZA 2CIMA 1SERA 2AMCB 3KFUA 1WU7A 4O2DA 4TVYA 1USYA 3MEYA 1YGBA 2QHVA 2ZGWA 3M4PA 3PZCA 2ZR2A 4H2UA 2CJ9A 4H2XB 3UGQA 2ZT7A 3LSSA 2ZT5A 4YRNA 2DQ0A 1B7YA 3RL6A 4XTWA 4HWTA 2I4LA 2CGHA 5ELOA 2ZR3A 2E10A 3NENA 3IG2A 3HXYA 3RGLA 4HWPA 3A31A 2P5IA 1QE0A 2DXTA 2E5AA 3L4GB 3EFSA 2EJ9A 3PCOA 4RMFA 3L2ZA 3R07A 2EL9A 1BBWA 1ATIA 3HRIA 2ZIMA 4P72C 5C53B 1EVLA 5C52B 2Q7HA 1EIYB 4OLFA 1JJCA 2RHQB 4YCVA 2QHUA 2C8MA 4CS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HT4 A;  4LVM A;  4LVI A;  4LVK A;  2NS6 A;  4LVJ A;  4LVL A; 
#chains in the Genus database with same CATH topology
 4RQE A;  3P8Y A;  3BFM A;  4YDQ A;  1NJ8 A;  4TQD A;  4YRF A;  2ZNJ A;  3RKX A;  5C51 B;  1J5W A;  4XTY A;  1YB3 A;  2AMC A;  1YFR A;  2J3M A;  1X54 A;  3HRK A;  4XTU A;  2HNI A;  3A74 A;  1YFS A;  4EX5 A;  5KNN A;  2FYK A;  4BW9 A;  3E9I A;  2ARU A;  2ZIO A;  4H2X A;  3QNE A;  3E9H A;  2I4M A;  3HY0 A;  2J3L A;  3HFV A;  4H2Y A;  3MQZ A;  1X01 A;  3A5Y A;  4CH4 A;  4HWR A;  1ADJ A;  2DXU A;  2DKG A;  2DTH A;  2ODR D;  3TEH B;  4G85 A;  1WQ7 A;  4YRQ A;  1KMN A;  3VQW A;  2I4O A;  4UP8 A;  4YRO A;  2E65 A;  4HA8 A;  4CH5 A;  4ZTZ B;  1BIA A;  3HY1 A;  3UH0 A;  4LVI A;  2RHS B;  2EJF A;  3RIR A;  2PME A;  2ODR C;  4DPG A;  4H2S A;  3P8V A;  1C0A A;  3NEL A;  3VQX A;  1FYF A;  1H4V B;  2EJG A;  4WI1 A;  4WJ4 A;  2E64 A;  4K87 A;  3V7R A;  1EIY A;  1N9W A;  2RHQ A;  4XTV A;  3RAC A;  4XEM A;  1X2H A;  4HWS A;  1HXD A;  4HWO A;  1WYD A;  1G5H A;  2ARS A;  4L87 A;  3VBB A;  2DDZ A;  4CH6 A;  1GGM A;  3REU A;  4CS3 A;  4YRM A;  3V8J A;  4BWA A;  1EOV A;  1W66 A;  3P8T A;  4OP0 A;  2NS6 A;  1WQW A;  1X56 A;  4J15 A;  2AKW B;  4Q6G A;  4P71 C;  2CJA A;  1YFT A;  3IAL A;  4YP0 A;  3CMQ A;  3V8L A;  3HTZ A;  1NJ1 A;  4WJ3 M;  2I4N A;  4XEO A;  3TEH A;  4YRI A;  3MF2 A;  2ALY B;  2C7I A;  1H4T A;  1E1T A;  1SES A;  4G84 A;  1WNL A;  4KQE A;  2IY5 B;  4LNS A;  3QTC A;  4P3P A;  2RHS A;  4TTV A;  1HC7 A;  1ASY A;  1RIQ A;  3REX A;  2ZT8 A;  2CJB A;  4P71 A;  5E3I A;  4YRR A;  4UPA A;  5ELN A;  4YRC A;  2Q5H A;  1KOG A;  1KMM A;  4X5O A;  4XU2 A;  4P72 A;  3A32 A;  4H2V A;  1H4Q A;  2ZXF A;  3HFZ B;  1EVK A;  4UP9 A;  3IKM B;  4Q15 A;  3A5Z A;  3NEM A;  3EFR A;  1ADY A;  3HXW A;  4LVL A;  4LVM A;  2DQ3 A;  2ZCE A;  1SET A;  3V7C A;  4H2W A;  2ZZF A;  1NJ2 A;  4XTX A;  4YRT A;  2ZZG A;  3A7R A;  3HXX A;  3RKY A;  2AKW A;  1B8A A;  3V7S A;  2ZZE A;  1HTT A;  3MF1 A;  3L4G A;  4ZIB A;  3PCO B;  2QHS A;  2Q7E A;  3L1A A;  4YYE A;  1Z7M A;  2Q7G A;  1USY C;  4TVW A;  2IY5 A;  4H02 A;  3TUP A;  2DZC A;  4WF2 A;  3DSQ A;  3HXV A;  4CS2 A;  1E22 A;  1WLE A;  1X2G A;  3ERR A;  1G51 A;  1PYS B;  4P3O A;  1BIB A;  5K1P A;  4NCX A;  4CH3 A;  2DEQ A;  4PG3 A;  2QHT A;  4XTZ A;  3ICA A;  1B70 B;  2DZ9 A;  3HFZ A;  4H2T A;  4K86 A;  4ZTU B;  2EAY A;  3LSQ A;  1NJ5 A;  2ZNI A;  4YRS A;  2XGT A;  4KR3 A;  2A8E A;  4YRE A;  4XU0 A;  1H4S A;  4P3N A;  4P74 C;  4P75 C;  1NJ6 A;  4HT4 A;  1X55 A;  2XTI A;  1BBU A;  2ZTG A;  2DU5 A;  1EQR A;  2DVE A;  3WQZ A;  3V8K A;  4YPF A;  3M4Q A;  1G5I A;  4YCU A;  3W3S A;  3TEG A;  2EWN A;  2DTO A;  2E1H A;  3I7F A;  1LYL A;  3QO8 A;  2Q5I A;  4P74 A;  11AS A;  4TVA B;  4P75 A;  1Z7N A;  2DU7 A;  1NYQ A;  4XU1 A;  4TWA A;  2DTI A;  1WPY A;  2DJZ A;  4KR2 A;  2ZIN A;  3RF1 A;  2E3C A;  4DQ2 A;  4RDX A;  1NNH A;  3VQV A;  2P0L A;  3A7U A;  4AH6 A;  3OD1 A;  1PYS A;  1E1O A;  4XU3 A;  4YRL A;  4P73 C;  4RQF A;  4PHC A;  2ZT6 A;  3QO7 A;  3UFG A;  1B76 A;  5K1X A;  3LC0 A;  3UGT A;  1B7Y B;  3VQY A;  1B70 A;  3NET A;  4TQF A;  5F5W A;  2ART A;  3HXU A;  3HXZ A;  3BJU A;  3A7A A;  3QO5 A;  4LVJ A;  1IL2 A;  1E24 A;  12AS A;  1L0W A;  4YRJ A;  1NYR A;  3G1Z A;  3IKL A;  4UP7 A;  1VQZ A;  4P73 A;  4YRK A;  2G4C A;  4LVK A;  2ALY A;  3FJP A;  4YRP A;  3RUX A;  4EO4 A;  5HGQ A;  4E51 A;  3RKW A;  4K88 A;  1JJC B;  1EFW A;  1QF6 A;  4YRG A;  1SRY A;  2PMF A;  2E41 A;  4HVC A;  4YCW A;  4TVA A;  1ASZ A;  2CIM A;  1SER A;  2AMC B;  3KFU A;  1WU7 A;  4O2D A;  4TVY A;  1USY A;  3MEY A;  1YGB A;  2QHV A;  2ZGW A;  3M4P A;  3PZC A;  2ZR2 A;  4H2U A;  2CJ9 A;  4H2X B;  3UGQ A;  2ZT7 A;  3LSS A;  2ZT5 A;  4YRN A;  2DQ0 A;  1B7Y A;  3RL6 A;  4XTW A;  4HWT A;  2I4L A;  2CGH A;  5ELO A;  2ZR3 A;  2E10 A;  3NEN A;  3IG2 A;  3HXY A;  3RGL A;  4HWP A;  3A31 A;  2P5I A;  1QE0 A;  2DXT A;  2E5A A;  3L4G B;  3EFS A;  2EJ9 A;  3PCO A;  4RMF A;  3L2Z A;  3R07 A;  2EL9 A;  1BBW A;  1ATI A;  3HRI A;  2ZIM A;  4P72 C;  5C53 B;  1EVL A;  5C52 B;  2Q7H A;  1EIY B;  4OLF A;  1JJC A;  2RHQ B;  4YCV A;  2QHU A;  2C8M A;  4CS4 A; 
#chains in the Genus database with same CATH homology
 4RQE A;  3P8Y A;  3BFM A;  4YDQ A;  1NJ8 A;  4TQD A;  4YRF A;  2ZNJ A;  3RKX A;  5C51 B;  1J5W A;  4XTY A;  1YB3 A;  2AMC A;  1YFR A;  2J3M A;  1X54 A;  3HRK A;  4XTU A;  2HNI A;  3A74 A;  1YFS A;  4EX5 A;  5KNN A;  2FYK A;  4BW9 A;  3E9I A;  2ARU A;  2ZIO A;  4H2X A;  3QNE A;  3E9H A;  2I4M A;  3HY0 A;  2J3L A;  3HFV A;  4H2Y A;  3MQZ A;  1X01 A;  3A5Y A;  4CH4 A;  4HWR A;  1ADJ A;  2DXU A;  2DKG A;  2DTH A;  2ODR D;  3TEH B;  4G85 A;  1WQ7 A;  4YRQ A;  1KMN A;  3VQW A;  2I4O A;  4UP8 A;  4YRO A;  2E65 A;  4HA8 A;  4CH5 A;  4ZTZ B;  1BIA A;  3HY1 A;  3UH0 A;  4LVI A;  2RHS B;  2EJF A;  3RIR A;  2PME A;  2ODR C;  4DPG A;  4H2S A;  3P8V A;  1C0A A;  3NEL A;  3VQX A;  1FYF A;  1H4V B;  2EJG A;  4WI1 A;  4WJ4 A;  2E64 A;  4K87 A;  3V7R A;  1EIY A;  1N9W A;  2RHQ A;  4XTV A;  3RAC A;  4XEM A;  1X2H A;  4HWS A;  1HXD A;  4HWO A;  1WYD A;  1G5H A;  2ARS A;  4L87 A;  3VBB A;  2DDZ A;  4CH6 A;  1GGM A;  3REU A;  4CS3 A;  4YRM A;  3V8J A;  4BWA A;  1EOV A;  1W66 A;  3P8T A;  4OP0 A;  2NS6 A;  1WQW A;  1X56 A;  4J15 A;  2AKW B;  4Q6G A;  4P71 C;  2CJA A;  1YFT A;  3IAL A;  4YP0 A;  3CMQ A;  3V8L A;  3HTZ A;  1NJ1 A;  4WJ3 M;  2I4N A;  4XEO A;  3TEH A;  4YRI A;  3MF2 A;  2ALY B;  2C7I A;  1H4T A;  1E1T A;  1SES A;  4G84 A;  1WNL A;  4KQE A;  2IY5 B;  4LNS A;  3QTC A;  4P3P A;  2RHS A;  4TTV A;  1HC7 A;  1ASY A;  1RIQ A;  3REX A;  2ZT8 A;  2CJB A;  4P71 A;  5E3I A;  4YRR A;  4UPA A;  5ELN A;  4YRC A;  2Q5H A;  1KOG A;  1KMM A;  4X5O A;  4XU2 A;  4P72 A;  3A32 A;  4H2V A;  1H4Q A;  2ZXF A;  3HFZ B;  1EVK A;  4UP9 A;  3IKM B;  4Q15 A;  3A5Z A;  3NEM A;  3EFR A;  1ADY A;  3HXW A;  4LVL A;  4LVM A;  2DQ3 A;  2ZCE A;  1SET A;  3V7C A;  4H2W A;  2ZZF A;  1NJ2 A;  4XTX A;  4YRT A;  2ZZG A;  3A7R A;  3HXX A;  3RKY A;  2AKW A;  1B8A A;  3V7S A;  2ZZE A;  1HTT A;  3MF1 A;  3L4G A;  4ZIB A;  3PCO B;  2QHS A;  2Q7E A;  3L1A A;  4YYE A;  1Z7M A;  2Q7G A;  1USY C;  4TVW A;  2IY5 A;  4H02 A;  3TUP A;  2DZC A;  4WF2 A;  3DSQ A;  3HXV A;  4CS2 A;  1E22 A;  1WLE A;  1X2G A;  3ERR A;  1G51 A;  1PYS B;  4P3O A;  1BIB A;  5K1P A;  4NCX A;  4CH3 A;  2DEQ A;  4PG3 A;  2QHT A;  4XTZ A;  3ICA A;  1B70 B;  2DZ9 A;  3HFZ A;  4H2T A;  4K86 A;  4ZTU B;  2EAY A;  3LSQ A;  1NJ5 A;  2ZNI A;  4YRS A;  2XGT A;  4KR3 A;  2A8E A;  4YRE A;  4XU0 A;  1H4S A;  4P3N A;  4P74 C;  4P75 C;  1NJ6 A;  4HT4 A;  1X55 A;  2XTI A;  1BBU A;  2ZTG A;  2DU5 A;  1EQR A;  2DVE A;  3WQZ A;  3V8K A;  4YPF A;  3M4Q A;  1G5I A;  4YCU A;  3W3S A;  3TEG A;  2EWN A;  2DTO A;  2E1H A;  3I7F A;  1LYL A;  3QO8 A;  2Q5I A;  4P74 A;  11AS A;  4TVA B;  4P75 A;  1Z7N A;  2DU7 A;  1NYQ A;  4XU1 A;  4TWA A;  2DTI A;  1WPY A;  2DJZ A;  4KR2 A;  2ZIN A;  3RF1 A;  2E3C A;  4DQ2 A;  4RDX A;  1NNH A;  3VQV A;  2P0L A;  3A7U A;  4AH6 A;  3OD1 A;  1PYS A;  1E1O A;  4XU3 A;  4YRL A;  4P73 C;  4RQF A;  4PHC A;  2ZT6 A;  3QO7 A;  3UFG A;  1B76 A;  5K1X A;  3LC0 A;  3UGT A;  1B7Y B;  3VQY A;  1B70 A;  3NET A;  4TQF A;  5F5W A;  2ART A;  3HXU A;  3HXZ A;  3BJU A;  3A7A A;  3QO5 A;  4LVJ A;  1IL2 A;  1E24 A;  12AS A;  1L0W A;  4YRJ A;  1NYR A;  3G1Z A;  3IKL A;  4UP7 A;  1VQZ A;  4P73 A;  4YRK A;  2G4C A;  4LVK A;  2ALY A;  3FJP A;  4YRP A;  3RUX A;  4EO4 A;  5HGQ A;  4E51 A;  3RKW A;  4K88 A;  1JJC B;  1EFW A;  1QF6 A;  4YRG A;  1SRY A;  2PMF A;  2E41 A;  4HVC A;  4YCW A;  4TVA A;  1ASZ A;  2CIM A;  1SER A;  2AMC B;  3KFU A;  1WU7 A;  4O2D A;  4TVY A;  1USY A;  3MEY A;  1YGB A;  2QHV A;  2ZGW A;  3M4P A;  3PZC A;  2ZR2 A;  4H2U A;  2CJ9 A;  4H2X B;  3UGQ A;  2ZT7 A;  3LSS A;  2ZT5 A;  4YRN A;  2DQ0 A;  1B7Y A;  3RL6 A;  4XTW A;  4HWT A;  2I4L A;  2CGH A;  5ELO A;  2ZR3 A;  2E10 A;  3NEN A;  3IG2 A;  3HXY A;  3RGL A;  4HWP A;  3A31 A;  2P5I A;  1QE0 A;  2DXT A;  2E5A A;  3L4G B;  3EFS A;  2EJ9 A;  3PCO A;  4RMF A;  3L2Z A;  3R07 A;  2EL9 A;  1BBW A;  1ATI A;  3HRI A;  2ZIM A;  4P72 C;  5C53 B;  1EVL A;  5C52 B;  2Q7H A;  1EIY B;  4OLF A;  1JJC A;  2RHQ B;  4YCV A;  2QHU A;  2C8M A;  4CS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...