4HT4A

Molecular basis of vancomycin resistance transfer in staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
AMYHFQNKFVSKANGQSATAKSAFNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWNKVHDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRGLDKNNEFEPKRKGNDYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicking enzyme
publication title Molecular basis of antibiotic multiresistance transfer in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase/dna
total genus 58
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4ht4A00
4LVLA 2NS6A 4LVIA 4LVMA 4HT4A 4LVJA 4LVKA
chains in the Genus database with same CATH superfamily
4UP9A 1WNLA 1YFTA 3HXYA 3E9IA 3VQYA 4XU2A 4OP0A 4ZTZB 2CJAA 4P3PA 4OLFA 3RKWA 2ZINA 4CS4A 4BWAA 4YCUA 1PYSB 2DJZA 4XU0A 3KFUA 4UP7A 4RDXA 3V7SA 4TQFA 1EVLA 1WU7A 3W3SA 3PCOB 3QO5A 3A7UA 1Z7MA 3TEGA 4KR3A 4YRFA 3TUPA 1H4SA 4WJ3M 4XTXA 2DZCA 4Q15A 4LVJA 2I4NA 4X5OA 1C0AA 4LVMA 4RQEA 1ATIA 3MEYA 3R07A 1USYC 4K88A 3I7FA 3CMQA 4K87A 3OD1A 2ODRC 3DSQA 4LVKA 2NS6A 4TVWA 4P74C 4HVCA 1QE0A 3HY1A 4YRLA 1NJ8A 3EFRA 4YP0A 4H2WA 1EVKA 2DVEA 2FYKA 5KNNA 3HTZA 4AH6A 1B70B 4RMFA 2DTHA 2A8EA 4P71A 3RL6A 4XU1A 4H2XA 3NELA 2E64A 3LSQA 4G85A 1JJCA 1H4VB 3A7RA 2E1HA 1KOGA 1IL2A 2ZT5A 4E51A 3L4GA 5C51B 4UP8A 3A5ZA 5F5WA 3LSSA 4LNSA 3VBBA 4YROA 4LVIA 1ASZA 4HT4A 1Z7NA 2ZR2A 3P8TA 2DU5A 4YCVA 4YRPA 3RUXA 4CH5A 4TVYA 2Q7HA 4XEMA 4CS3A 1X2HA 3A31A 2Q5HA 4YREA 4YRRA 4H2YA 4TTVA 4YCWA 3MF2A 3A7AA 3MQZA 3V8JA 1HXDA 4ZTUB 4PG3A 2DEQA 4RQFA 3HY0A 4YRQA 3VQVA 4BW9A 4P3OA 4HWTA 4XTVA 4TWAA 4YRIA 1HTTA 4O2DA 3EFSA 1WPYA 3HRKA 2E65A 4NCXA 4P72C 1YFSA 2XTIA 2CGHA 2RHQB 2Q7EA 2CJ9A 1VQZA 2AKWB 2C7IA 5K1XA 1NNHA 4PHCA 3HXXA 2ZZGA 4KR2A 4P73C 4H2TA 2ZR3A 3V7CA 2Q5IA 4P75A 1KMMA 2P5IA 3G1ZA 1ASYA 4YYEA 1NJ2A 3ERRA 1B70A 4WJ4A 1X55A 1SERA 1KMNA 3A32A 2ZT6A 3HRIA 2EJGA 1B8AA 3P8VA 3VQXA 4LVLA 1B7YA 3M4PA 3ICAA 2RHSB 2PMEA 4DQ2A 4XTWA 11ASA 4CH6A 3E9HA 1WQ7A 1E22A 2DXTA 2E5AA 2AMCB 2PMFA 3HXVA 3RGLA 3UFGA 4YRKA 3HFZA 4XU3A 3UGQA 3VQWA 2EJ9A 5ELOA 1W66A 4HA8A 4HWPA 4DPGA 2HNIA 1H4TA 1SRYA 1H4QA 1G5HA 1SETA 1QF6A 1YGBA 4G84A 2J3LA 1EIYA 3TEHB 4HWRA 1ADYA 2ZNJA 4H2XB 1X01A 2G4CA 4XTUA 2ODRD 4YRNA 4H2SA 1GGMA 1EFWA 2QHVA 1EOVA 2DQ0A 2I4LA 3PZCA 4WI1A 2DKGA 3RIRA 1PYSA 1USYA 2DTIA 4K86A 4TVAB 2RHQA 4YRSA 2QHTA 2DU7A 4P71C 1X2GA 3PCOA 4P74A 5E3IA 2ZXFA 3A74A 2IY5B 3QTCA 2J3MA 3LC0A 5K1PA 2ZTGA 4EX5A 12ASA 2ALYB 3M4QA 1SESA 4L87A 4XTYA 4CH4A 2XGTA 1E1OA 2C8MA 1YFRA 2E3CA 4KQEA 4J15A 3REXA 1WLEA 4HWOA 3IKMB 2CIMA 4H2VA 4HWSA 1NJ6A 4TQDA 1NYQA 4ZIBA 1ADJA 1HC7A 4YPFA 2EAYA 3NEMA 1X54A 2ZCEA 1BBUA 1LYLA 5ELNA 3L2ZA 3HXZA 1L0WA 3REUA 4UPAA 2EL9A 1BIAA 1G51A 2ZT7A 2ARTA 2RHSA 2P0LA 3RKXA 2DQ3A 3V8LA 1N9WA 1NYRA 4YRGA 1NJ5A 3HXUA 2I4MA 2AMCA 1YB3A 2QHSA 2DXUA 2DTOA 2ZT8A 1J5WA 4WF2A 1EQRA 2ZIOA 2ZZEA 3IKLA 4P3NA 4YRJA 4Q6GA 2EJFA 3BFMA 1X56A 3HFVA 3RACA 4H02A 1E1TA 1WQWA 3RKYA 4EO4A 2E41A 5C53B 3P8YA 2ZNIA 2ZGWA 3TEHA 1BIBA 2Q7GA 1E24A 4CS2A 1WYDA 2EWNA 1BBWA 4YRTA 2E10A 2I4OA 1NJ1A 4P72A 3IALA 3L1AA 2DDZA 2ZZFA 1B7YB 2QHUA 3A5YA 3V7RA 3V8KA 4CH3A 3NENA 3NETA 1B76A 3UH0A 5HGQA 2DZ9A 3IG2A 4P75C 1JJCB 1RIQA 4XEOA 3RF1A 4H2UA 4TVAA 5C52B 4P73A 3QNEA 1FYFA 3L4GB 4YDQA 4YRMA 3HFZB 4YRCA 3WQZA 2CJBA 2IY5A 2ALYA 3QO8A 2ZIMA 2AKWA 3HXWA 3QO7A 3FJPA 3MF1A 1EIYB 1G5IA 2ARSA 3UGTA 3BJUA 4XTZA 2ARUA
chains in the Genus database with same CATH topology
4UP9A 1WNLA 1YFTA 3HXYA 3E9IA 3VQYA 4XU2A 4OP0A 4ZTZB 2CJAA 4P3PA 4OLFA 3RKWA 2ZINA 4CS4A 4BWAA 4YCUA 1PYSB 2DJZA 4XU0A 3KFUA 4UP7A 4RDXA 3V7SA 4TQFA 1EVLA 1WU7A 3W3SA 3PCOB 3QO5A 3A7UA 1Z7MA 3TEGA 4KR3A 4YRFA 3TUPA 1H4SA 4WJ3M 4XTXA 2DZCA 4Q15A 4LVJA 2I4NA 4X5OA 1C0AA 4LVMA 4RQEA 1ATIA 3MEYA 3R07A 1USYC 4K88A 3I7FA 3CMQA 4K87A 3OD1A 2ODRC 3DSQA 4LVKA 2NS6A 4TVWA 4P74C 4HVCA 1QE0A 3HY1A 4YRLA 1NJ8A 3EFRA 4YP0A 4H2WA 1EVKA 2DVEA 2FYKA 5KNNA 3HTZA 4AH6A 1B70B 4RMFA 2DTHA 2A8EA 4P71A 3RL6A 4XU1A 4H2XA 3NELA 2E64A 3LSQA 4G85A 1JJCA 1H4VB 3A7RA 2E1HA 1KOGA 1IL2A 2ZT5A 4E51A 3L4GA 5C51B 4UP8A 3A5ZA 5F5WA 3LSSA 4LNSA 3VBBA 4YROA 4LVIA 1ASZA 4HT4A 1Z7NA 2ZR2A 3P8TA 2DU5A 4YCVA 4YRPA 3RUXA 4CH5A 4TVYA 2Q7HA 4XEMA 4CS3A 1X2HA 3A31A 2Q5HA 4YREA 4YRRA 4H2YA 4TTVA 4YCWA 3MF2A 3A7AA 3MQZA 3V8JA 1HXDA 4ZTUB 4PG3A 2DEQA 4RQFA 3HY0A 4YRQA 3VQVA 4BW9A 4P3OA 4HWTA 4XTVA 4TWAA 4YRIA 1HTTA 4O2DA 3EFSA 1WPYA 3HRKA 2E65A 4NCXA 4P72C 1YFSA 2XTIA 2CGHA 2RHQB 2Q7EA 2CJ9A 1VQZA 2AKWB 2C7IA 5K1XA 1NNHA 4PHCA 3HXXA 2ZZGA 4KR2A 4P73C 4H2TA 2ZR3A 3V7CA 2Q5IA 4P75A 1KMMA 2P5IA 3G1ZA 1ASYA 4YYEA 1NJ2A 3ERRA 1B70A 4WJ4A 1X55A 1SERA 1KMNA 3A32A 2ZT6A 3HRIA 2EJGA 1B8AA 3P8VA 3VQXA 4LVLA 1B7YA 3M4PA 3ICAA 2RHSB 2PMEA 4DQ2A 4XTWA 11ASA 4CH6A 3E9HA 1WQ7A 1E22A 2DXTA 2E5AA 2AMCB 2PMFA 3HXVA 3RGLA 3UFGA 4YRKA 3HFZA 4XU3A 3UGQA 3VQWA 2EJ9A 5ELOA 1W66A 4HA8A 4HWPA 4DPGA 2HNIA 1H4TA 1SRYA 1H4QA 1G5HA 1SETA 1QF6A 1YGBA 4G84A 2J3LA 1EIYA 3TEHB 4HWRA 1ADYA 2ZNJA 4H2XB 1X01A 2G4CA 4XTUA 2ODRD 4YRNA 4H2SA 1GGMA 1EFWA 2QHVA 1EOVA 2DQ0A 2I4LA 3PZCA 4WI1A 2DKGA 3RIRA 1PYSA 1USYA 2DTIA 4K86A 4TVAB 2RHQA 4YRSA 2QHTA 2DU7A 4P71C 1X2GA 3PCOA 4P74A 5E3IA 2ZXFA 3A74A 2IY5B 3QTCA 2J3MA 3LC0A 5K1PA 2ZTGA 4EX5A 12ASA 2ALYB 3M4QA 1SESA 4L87A 4XTYA 4CH4A 2XGTA 1E1OA 2C8MA 1YFRA 2E3CA 4KQEA 4J15A 3REXA 1WLEA 4HWOA 3IKMB 2CIMA 4H2VA 4HWSA 1NJ6A 4TQDA 1NYQA 4ZIBA 1ADJA 1HC7A 4YPFA 2EAYA 3NEMA 1X54A 2ZCEA 1BBUA 1LYLA 5ELNA 3L2ZA 3HXZA 1L0WA 3REUA 4UPAA 2EL9A 1BIAA 1G51A 2ZT7A 2ARTA 2RHSA 2P0LA 3RKXA 2DQ3A 3V8LA 1N9WA 1NYRA 4YRGA 1NJ5A 3HXUA 2I4MA 2AMCA 1YB3A 2QHSA 2DXUA 2DTOA 2ZT8A 1J5WA 4WF2A 1EQRA 2ZIOA 2ZZEA 3IKLA 4P3NA 4YRJA 4Q6GA 2EJFA 3BFMA 1X56A 3HFVA 3RACA 4H02A 1E1TA 1WQWA 3RKYA 4EO4A 2E41A 5C53B 3P8YA 2ZNIA 2ZGWA 3TEHA 1BIBA 2Q7GA 1E24A 4CS2A 1WYDA 2EWNA 1BBWA 4YRTA 2E10A 2I4OA 1NJ1A 4P72A 3IALA 3L1AA 2DDZA 2ZZFA 1B7YB 2QHUA 3A5YA 3V7RA 3V8KA 4CH3A 3NENA 3NETA 1B76A 3UH0A 5HGQA 2DZ9A 3IG2A 4P75C 1JJCB 1RIQA 4XEOA 3RF1A 4H2UA 4TVAA 5C52B 4P73A 3QNEA 1FYFA 3L4GB 4YDQA 4YRMA 3HFZB 4YRCA 3WQZA 2CJBA 2IY5A 2ALYA 3QO8A 2ZIMA 2AKWA 3HXWA 3QO7A 3FJPA 3MF1A 1EIYB 1G5IA 2ARSA 3UGTA 3BJUA 4XTZA 2ARUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVL A;  2NS6 A;  4LVI A;  4LVM A;  4HT4 A;  4LVJ A;  4LVK A; 
#chains in the Genus database with same CATH topology
 4UP9 A;  1WNL A;  1YFT A;  3HXY A;  3E9I A;  3VQY A;  4XU2 A;  4OP0 A;  4ZTZ B;  2CJA A;  4P3P A;  4OLF A;  3RKW A;  2ZIN A;  4CS4 A;  4BWA A;  4YCU A;  1PYS B;  2DJZ A;  4XU0 A;  3KFU A;  4UP7 A;  4RDX A;  3V7S A;  4TQF A;  1EVL A;  1WU7 A;  3W3S A;  3PCO B;  3QO5 A;  3A7U A;  1Z7M A;  3TEG A;  4KR3 A;  4YRF A;  3TUP A;  1H4S A;  4WJ3 M;  4XTX A;  2DZC A;  4Q15 A;  4LVJ A;  2I4N A;  4X5O A;  1C0A A;  4LVM A;  4RQE A;  1ATI A;  3MEY A;  3R07 A;  1USY C;  4K88 A;  3I7F A;  3CMQ A;  4K87 A;  3OD1 A;  2ODR C;  3DSQ A;  4LVK A;  2NS6 A;  4TVW A;  4P74 C;  4HVC A;  1QE0 A;  3HY1 A;  4YRL A;  1NJ8 A;  3EFR A;  4YP0 A;  4H2W A;  1EVK A;  2DVE A;  2FYK A;  5KNN A;  3HTZ A;  4AH6 A;  1B70 B;  4RMF A;  2DTH A;  2A8E A;  4P71 A;  3RL6 A;  4XU1 A;  4H2X A;  3NEL A;  2E64 A;  3LSQ A;  4G85 A;  1JJC A;  1H4V B;  3A7R A;  2E1H A;  1KOG A;  1IL2 A;  2ZT5 A;  4E51 A;  3L4G A;  5C51 B;  4UP8 A;  3A5Z A;  5F5W A;  3LSS A;  4LNS A;  3VBB A;  4YRO A;  4LVI A;  1ASZ A;  4HT4 A;  1Z7N A;  2ZR2 A;  3P8T A;  2DU5 A;  4YCV A;  4YRP A;  3RUX A;  4CH5 A;  4TVY A;  2Q7H A;  4XEM A;  4CS3 A;  1X2H A;  3A31 A;  2Q5H A;  4YRE A;  4YRR A;  4H2Y A;  4TTV A;  4YCW A;  3MF2 A;  3A7A A;  3MQZ A;  3V8J A;  1HXD A;  4ZTU B;  4PG3 A;  2DEQ A;  4RQF A;  3HY0 A;  4YRQ A;  3VQV A;  4BW9 A;  4P3O A;  4HWT A;  4XTV A;  4TWA A;  4YRI A;  1HTT A;  4O2D A;  3EFS A;  1WPY A;  3HRK A;  2E65 A;  4NCX A;  4P72 C;  1YFS A;  2XTI A;  2CGH A;  2RHQ B;  2Q7E A;  2CJ9 A;  1VQZ A;  2AKW B;  2C7I A;  5K1X A;  1NNH A;  4PHC A;  3HXX A;  2ZZG A;  4KR2 A;  4P73 C;  4H2T A;  2ZR3 A;  3V7C A;  2Q5I A;  4P75 A;  1KMM A;  2P5I A;  3G1Z A;  1ASY A;  4YYE A;  1NJ2 A;  3ERR A;  1B70 A;  4WJ4 A;  1X55 A;  1SER A;  1KMN A;  3A32 A;  2ZT6 A;  3HRI A;  2EJG A;  1B8A A;  3P8V A;  3VQX A;  4LVL A;  1B7Y A;  3M4P A;  3ICA A;  2RHS B;  2PME A;  4DQ2 A;  4XTW A;  11AS A;  4CH6 A;  3E9H A;  1WQ7 A;  1E22 A;  2DXT A;  2E5A A;  2AMC B;  2PMF A;  3HXV A;  3RGL A;  3UFG A;  4YRK A;  3HFZ A;  4XU3 A;  3UGQ A;  3VQW A;  2EJ9 A;  5ELO A;  1W66 A;  4HA8 A;  4HWP A;  4DPG A;  2HNI A;  1H4T A;  1SRY A;  1H4Q A;  1G5H A;  1SET A;  1QF6 A;  1YGB A;  4G84 A;  2J3L A;  1EIY A;  3TEH B;  4HWR A;  1ADY A;  2ZNJ A;  4H2X B;  1X01 A;  2G4C A;  4XTU A;  2ODR D;  4YRN A;  4H2S A;  1GGM A;  1EFW A;  2QHV A;  1EOV A;  2DQ0 A;  2I4L A;  3PZC A;  4WI1 A;  2DKG A;  3RIR A;  1PYS A;  1USY A;  2DTI A;  4K86 A;  4TVA B;  2RHQ A;  4YRS A;  2QHT A;  2DU7 A;  4P71 C;  1X2G A;  3PCO A;  4P74 A;  5E3I A;  2ZXF A;  3A74 A;  2IY5 B;  3QTC A;  2J3M A;  3LC0 A;  5K1P A;  2ZTG A;  4EX5 A;  12AS A;  2ALY B;  3M4Q A;  1SES A;  4L87 A;  4XTY A;  4CH4 A;  2XGT A;  1E1O A;  2C8M A;  1YFR A;  2E3C A;  4KQE A;  4J15 A;  3REX A;  1WLE A;  4HWO A;  3IKM B;  2CIM A;  4H2V A;  4HWS A;  1NJ6 A;  4TQD A;  1NYQ A;  4ZIB A;  1ADJ A;  1HC7 A;  4YPF A;  2EAY A;  3NEM A;  1X54 A;  2ZCE A;  1BBU A;  1LYL A;  5ELN A;  3L2Z A;  3HXZ A;  1L0W A;  3REU A;  4UPA A;  2EL9 A;  1BIA A;  1G51 A;  2ZT7 A;  2ART A;  2RHS A;  2P0L A;  3RKX A;  2DQ3 A;  3V8L A;  1N9W A;  1NYR A;  4YRG A;  1NJ5 A;  3HXU A;  2I4M A;  2AMC A;  1YB3 A;  2QHS A;  2DXU A;  2DTO A;  2ZT8 A;  1J5W A;  4WF2 A;  1EQR A;  2ZIO A;  2ZZE A;  3IKL A;  4P3N A;  4YRJ A;  4Q6G A;  2EJF A;  3BFM A;  1X56 A;  3HFV A;  3RAC A;  4H02 A;  1E1T A;  1WQW A;  3RKY A;  4EO4 A;  2E41 A;  5C53 B;  3P8Y A;  2ZNI A;  2ZGW A;  3TEH A;  1BIB A;  2Q7G A;  1E24 A;  4CS2 A;  1WYD A;  2EWN A;  1BBW A;  4YRT A;  2E10 A;  2I4O A;  1NJ1 A;  4P72 A;  3IAL A;  3L1A A;  2DDZ A;  2ZZF A;  1B7Y B;  2QHU A;  3A5Y A;  3V7R A;  3V8K A;  4CH3 A;  3NEN A;  3NET A;  1B76 A;  3UH0 A;  5HGQ A;  2DZ9 A;  3IG2 A;  4P75 C;  1JJC B;  1RIQ A;  4XEO A;  3RF1 A;  4H2U A;  4TVA A;  5C52 B;  4P73 A;  3QNE A;  1FYF A;  3L4G B;  4YDQ A;  4YRM A;  3HFZ B;  4YRC A;  3WQZ A;  2CJB A;  2IY5 A;  2ALY A;  3QO8 A;  2ZIM A;  2AKW A;  3HXW A;  3QO7 A;  3FJP A;  3MF1 A;  1EIY B;  1G5I A;  2ARS A;  3UGT A;  3BJU A;  4XTZ A;  2ARU A; 
#chains in the Genus database with same CATH homology
 4UP9 A;  1WNL A;  1YFT A;  3HXY A;  3E9I A;  3VQY A;  4XU2 A;  4OP0 A;  4ZTZ B;  2CJA A;  4P3P A;  4OLF A;  3RKW A;  2ZIN A;  4CS4 A;  4BWA A;  4YCU A;  1PYS B;  2DJZ A;  4XU0 A;  3KFU A;  4UP7 A;  4RDX A;  3V7S A;  4TQF A;  1EVL A;  1WU7 A;  3W3S A;  3PCO B;  3QO5 A;  3A7U A;  1Z7M A;  3TEG A;  4KR3 A;  4YRF A;  3TUP A;  1H4S A;  4WJ3 M;  4XTX A;  2DZC A;  4Q15 A;  4LVJ A;  2I4N A;  4X5O A;  1C0A A;  4LVM A;  4RQE A;  1ATI A;  3MEY A;  3R07 A;  1USY C;  4K88 A;  3I7F A;  3CMQ A;  4K87 A;  3OD1 A;  2ODR C;  3DSQ A;  4LVK A;  2NS6 A;  4TVW A;  4P74 C;  4HVC A;  1QE0 A;  3HY1 A;  4YRL A;  1NJ8 A;  3EFR A;  4YP0 A;  4H2W A;  1EVK A;  2DVE A;  2FYK A;  5KNN A;  3HTZ A;  4AH6 A;  1B70 B;  4RMF A;  2DTH A;  2A8E A;  4P71 A;  3RL6 A;  4XU1 A;  4H2X A;  3NEL A;  2E64 A;  3LSQ A;  4G85 A;  1JJC A;  1H4V B;  3A7R A;  2E1H A;  1KOG A;  1IL2 A;  2ZT5 A;  4E51 A;  3L4G A;  5C51 B;  4UP8 A;  3A5Z A;  5F5W A;  3LSS A;  4LNS A;  3VBB A;  4YRO A;  4LVI A;  1ASZ A;  4HT4 A;  1Z7N A;  2ZR2 A;  3P8T A;  2DU5 A;  4YCV A;  4YRP A;  3RUX A;  4CH5 A;  4TVY A;  2Q7H A;  4XEM A;  4CS3 A;  1X2H A;  3A31 A;  2Q5H A;  4YRE A;  4YRR A;  4H2Y A;  4TTV A;  4YCW A;  3MF2 A;  3A7A A;  3MQZ A;  3V8J A;  1HXD A;  4ZTU B;  4PG3 A;  2DEQ A;  4RQF A;  3HY0 A;  4YRQ A;  3VQV A;  4BW9 A;  4P3O A;  4HWT A;  4XTV A;  4TWA A;  4YRI A;  1HTT A;  4O2D A;  3EFS A;  1WPY A;  3HRK A;  2E65 A;  4NCX A;  4P72 C;  1YFS A;  2XTI A;  2CGH A;  2RHQ B;  2Q7E A;  2CJ9 A;  1VQZ A;  2AKW B;  2C7I A;  5K1X A;  1NNH A;  4PHC A;  3HXX A;  2ZZG A;  4KR2 A;  4P73 C;  4H2T A;  2ZR3 A;  3V7C A;  2Q5I A;  4P75 A;  1KMM A;  2P5I A;  3G1Z A;  1ASY A;  4YYE A;  1NJ2 A;  3ERR A;  1B70 A;  4WJ4 A;  1X55 A;  1SER A;  1KMN A;  3A32 A;  2ZT6 A;  3HRI A;  2EJG A;  1B8A A;  3P8V A;  3VQX A;  4LVL A;  1B7Y A;  3M4P A;  3ICA A;  2RHS B;  2PME A;  4DQ2 A;  4XTW A;  11AS A;  4CH6 A;  3E9H A;  1WQ7 A;  1E22 A;  2DXT A;  2E5A A;  2AMC B;  2PMF A;  3HXV A;  3RGL A;  3UFG A;  4YRK A;  3HFZ A;  4XU3 A;  3UGQ A;  3VQW A;  2EJ9 A;  5ELO A;  1W66 A;  4HA8 A;  4HWP A;  4DPG A;  2HNI A;  1H4T A;  1SRY A;  1H4Q A;  1G5H A;  1SET A;  1QF6 A;  1YGB A;  4G84 A;  2J3L A;  1EIY A;  3TEH B;  4HWR A;  1ADY A;  2ZNJ A;  4H2X B;  1X01 A;  2G4C A;  4XTU A;  2ODR D;  4YRN A;  4H2S A;  1GGM A;  1EFW A;  2QHV A;  1EOV A;  2DQ0 A;  2I4L A;  3PZC A;  4WI1 A;  2DKG A;  3RIR A;  1PYS A;  1USY A;  2DTI A;  4K86 A;  4TVA B;  2RHQ A;  4YRS A;  2QHT A;  2DU7 A;  4P71 C;  1X2G A;  3PCO A;  4P74 A;  5E3I A;  2ZXF A;  3A74 A;  2IY5 B;  3QTC A;  2J3M A;  3LC0 A;  5K1P A;  2ZTG A;  4EX5 A;  12AS A;  2ALY B;  3M4Q A;  1SES A;  4L87 A;  4XTY A;  4CH4 A;  2XGT A;  1E1O A;  2C8M A;  1YFR A;  2E3C A;  4KQE A;  4J15 A;  3REX A;  1WLE A;  4HWO A;  3IKM B;  2CIM A;  4H2V A;  4HWS A;  1NJ6 A;  4TQD A;  1NYQ A;  4ZIB A;  1ADJ A;  1HC7 A;  4YPF A;  2EAY A;  3NEM A;  1X54 A;  2ZCE A;  1BBU A;  1LYL A;  5ELN A;  3L2Z A;  3HXZ A;  1L0W A;  3REU A;  4UPA A;  2EL9 A;  1BIA A;  1G51 A;  2ZT7 A;  2ART A;  2RHS A;  2P0L A;  3RKX A;  2DQ3 A;  3V8L A;  1N9W A;  1NYR A;  4YRG A;  1NJ5 A;  3HXU A;  2I4M A;  2AMC A;  1YB3 A;  2QHS A;  2DXU A;  2DTO A;  2ZT8 A;  1J5W A;  4WF2 A;  1EQR A;  2ZIO A;  2ZZE A;  3IKL A;  4P3N A;  4YRJ A;  4Q6G A;  2EJF A;  3BFM A;  1X56 A;  3HFV A;  3RAC A;  4H02 A;  1E1T A;  1WQW A;  3RKY A;  4EO4 A;  2E41 A;  5C53 B;  3P8Y A;  2ZNI A;  2ZGW A;  3TEH A;  1BIB A;  2Q7G A;  1E24 A;  4CS2 A;  1WYD A;  2EWN A;  1BBW A;  4YRT A;  2E10 A;  2I4O A;  1NJ1 A;  4P72 A;  3IAL A;  3L1A A;  2DDZ A;  2ZZF A;  1B7Y B;  2QHU A;  3A5Y A;  3V7R A;  3V8K A;  4CH3 A;  3NEN A;  3NET A;  1B76 A;  3UH0 A;  5HGQ A;  2DZ9 A;  3IG2 A;  4P75 C;  1JJC B;  1RIQ A;  4XEO A;  3RF1 A;  4H2U A;  4TVA A;  5C52 B;  4P73 A;  3QNE A;  1FYF A;  3L4G B;  4YDQ A;  4YRM A;  3HFZ B;  4YRC A;  3WQZ A;  2CJB A;  2IY5 A;  2ALY A;  3QO8 A;  2ZIM A;  2AKW A;  3HXW A;  3QO7 A;  3FJP A;  3MF1 A;  1EIY B;  1G5I A;  2ARS A;  3UGT A;  3BJU A;  4XTZ A;  2ARU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...