4HT4A

Molecular basis of vancomycin resistance transfer in staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
AMYHFQNKFVSKANGQSATAKSAFNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWNKVHDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRGLDKNNEFEPKRKGNDYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of antibiotic multiresistance transfer in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase/dna
molecule keywords Nicking enzyme
total genus 58
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4ht4A00
2NS6A 4LVLA 4LVJA 4LVIA 4HT4A 4LVMA 4LVKA
chains in the Genus database with same CATH superfamily
3HFZB 4KR3A 4PHCA 4XTYA 4UPAA 3HXUA 3HRKA 4G84A 2EJFA 3HY0A 1J5WA 1G5HA 4KQEA 1NNHA 2E10A 3RKWA 3L2ZA 4L87A 1B7YB 3RUXA 1SESA 3UFGA 2AMCB 3MF1A 3VQYA 5HGQA 4P74A 1WLEA 1B70B 4TVWA 2ZT7A 4YRTA 4H2UA 4XTXA 2AMCA 1PYSB 4K88A 1IL2A 3OD1A 4H2VA 4CH4A 1FYFA 4YREA 5E3IA 1YB3A 1NJ8A 2E41A 1SERA 3M4PA 1YFTA 4EO4A 2XGTA 4XTVA 3FJPA 2NS6A 1NYRA 2ALYB 2ZINA 4YCVA 3TEHB 1SETA 4YP0A 1H4VB 2I4LA 1QE0A 4CS4A 2FYKA 3TEGA 2ARSA 3MEYA 3WQZA 3NEMA 2ODRD 3IALA 3I7FA 3P8YA 12ASA 4WJ3M 3TEHA 4RQEA 4KR2A 3UGTA 4LNSA 4TVAB 4XTWA 1EFWA 4XU2A 4ZTZB 2RHQA 3A32A 3EFSA 1Z7MA 3RGLA 1B8AA 1HXDA 4P3OA 2ZR3A 4XEMA 3A31A 4YRNA 3NELA 3UGQA 3QO7A 4Q6GA 1NYQA 4K87A 4CH6A 3V7CA 2P0LA 4PG3A 3BJUA 4TQFA 1GGMA 2CJAA 4TVYA 3REXA 4HVCA 3A74A 3HXVA 4YRSA 1JJCA 1LYLA 4TQDA 4XEOA 4P75A 3RL6A 3QTCA 3HXXA 4WI1A 2HNIA 1X2GA 2ZNJA 4YRIA 4CS2A 2Q5IA 2ZCEA 4UP7A 1BIBA 1Z7NA 3P8VA 4UP9A 2XTIA 1BBUA 3L4GA 3BFMA 3RKYA 3A5YA 1SRYA 3EFRA 2ALYA 4H2TA 1X55A 2DVEA 4HWRA 4EX5A 3PCOB 1JJCB 4YDQA 3QNEA 2P5IA 2AKWA 3PCOA 2DXTA 2QHTA 2ZGWA 2ZIMA 1KMNA 4YRFA 1H4QA 2RHQB 4P71C 1PYSA 3HTZA 4H2XA 4P74C 1ASZA 1USYA 3ICAA 3IKLA 1BIAA 4H2SA 3IKMB 3M4QA 1B70A 2ZTGA 3TUPA 3ERRA 4LVMA 1E1TA 1N9WA 4XU3A 3HFVA 4P72C 5F5WA 1X54A 4YPFA 4HWPA 1ATIA 1QF6A 3HFZA 2ZIOA 3CMQA 1EOVA 4UP8A 1KOGA 1E22A 5ELNA 2Q5HA 2DQ3A 5C53B 2PMFA 3MQZA 1YFSA 3LSSA 3UH0A 2G4CA 3RF1A 4O2DA 4OLFA 3E9IA 3L1AA 5K1PA 2DKGA 5C51B 4YRGA 3HXZA 3QO8A 4P72A 3L4GB 4CH5A 4WJ4A 2DTOA 5K1XA 11ASA 4NCXA 5ELOA 1G51A 2E3CA 4HWTA 1EIYA 4BW9A 2ZT6A 1VQZA 2I4NA 4YRMA 1X56A 3HXYA 4XU0A 3R07A 1NJ6A 3G1ZA 1KMMA 4Q15A 1EVKA 4YRLA 1H4TA 2Q7GA 1HTTA 2IY5A 2DZCA 4YRJA 4HT4A 2DZ9A 4YRQA 4G85A 1EIYB 3A7RA 4YRPA 1NJ5A 2E5AA 1EQRA 1HC7A 4HWOA 3V8LA 4YROA 1WQWA 2DU7A 4J15A 4P73C 3IG2A 3P8TA 4LVIA 1B7YA 2A8EA 1ASYA 4ZIBA 3LC0A 1ADJA 1NJ1A 2DEQA 2QHVA 2PMEA 3VQXA 1E1OA 2ZR2A 4TVAA 4K86A 4LVLA 1NJ2A 2E64A 2EJ9A 2DQ0A 4XTZA 4LVJA 3KFUA 1W66A 2CJBA 2EAYA 3VBBA 3HY1A 2RHSB 1L0WA 2RHSA 1G5IA 2Q7EA 2CGHA 5KNNA 3RKXA 2ZXFA 4RMFA 2DJZA 4RQFA 3REUA 1YFRA 2ARTA 3RACA 2EL9A 4HWSA 1YGBA 4YRKA 3V8KA 1WQ7A 4H2YA 2AKWB 4P75C 3HRIA 1B76A 3LSQA 2E1HA 1X01A 4P3NA 4DPGA 4P71A 1WNLA 1X2HA 1USYC 2I4OA 3RIRA 4AH6A 2QHSA 1ADYA 4BWAA 4H02A 1EVLA 1BBWA 4XTUA 4HA8A 3W3SA 4LVKA 2C7IA 4XU1A 2J3LA 4CH3A 2DTHA 4E51A 4DQ2A 2CIMA 2DTIA 3HXWA 2DDZA 3A5ZA 3A7UA 1WYDA 2E65A 4ZTUB 4YCUA 4YYEA 1H4SA 4H2XB 1RIQA 3A7AA 4TTVA 3PZCA 2ZNIA 2CJ9A 2EJGA 3V7RA 4RDXA 2ZZGA 2ZZFA 4P3PA 3VQWA 3VQVA 2Q7HA 2DU5A 3V8JA 4CS3A 3NENA 2C8MA 3MF2A 5C52B 2ODRC 2EWNA 1C0AA 4YRRA 4TWAA 4X5OA 4WF2A 2J3MA 4YRCA 2ZT5A 4P73A 4H2WA 4YCWA 4OP0A 3E9HA 3QO5A 3NETA 3V7SA 3DSQA 2QHUA 1E24A 1WU7A 2I4MA 2ZZEA 2ZT8A 2ARUA 1WPYA 2IY5B 2DXUA
chains in the Genus database with same CATH topology
3HFZB 4KR3A 4PHCA 4XTYA 4UPAA 3HXUA 3HRKA 4G84A 2EJFA 3HY0A 1J5WA 1G5HA 4KQEA 1NNHA 2E10A 3RKWA 3L2ZA 4L87A 1B7YB 3RUXA 1SESA 3UFGA 2AMCB 3MF1A 3VQYA 5HGQA 4P74A 1WLEA 1B70B 4TVWA 2ZT7A 4YRTA 4H2UA 4XTXA 2AMCA 1PYSB 4K88A 1IL2A 3OD1A 4H2VA 4CH4A 1FYFA 4YREA 5E3IA 1YB3A 1NJ8A 2E41A 1SERA 3M4PA 1YFTA 4EO4A 2XGTA 4XTVA 3FJPA 2NS6A 1NYRA 2ALYB 2ZINA 4YCVA 3TEHB 1SETA 4YP0A 1H4VB 2I4LA 1QE0A 4CS4A 2FYKA 3TEGA 2ARSA 3MEYA 3WQZA 3NEMA 2ODRD 3IALA 3I7FA 3P8YA 12ASA 4WJ3M 3TEHA 4RQEA 4KR2A 3UGTA 4LNSA 4TVAB 4XTWA 1EFWA 4XU2A 4ZTZB 2RHQA 3A32A 3EFSA 1Z7MA 3RGLA 1B8AA 1HXDA 4P3OA 2ZR3A 4XEMA 3A31A 4YRNA 3NELA 3UGQA 3QO7A 4Q6GA 1NYQA 4K87A 4CH6A 3V7CA 2P0LA 4PG3A 3BJUA 4TQFA 1GGMA 2CJAA 4TVYA 3REXA 4HVCA 3A74A 3HXVA 4YRSA 1JJCA 1LYLA 4TQDA 4XEOA 4P75A 3RL6A 3QTCA 3HXXA 4WI1A 2HNIA 1X2GA 2ZNJA 4YRIA 4CS2A 2Q5IA 2ZCEA 4UP7A 1BIBA 1Z7NA 3P8VA 4UP9A 2XTIA 1BBUA 3L4GA 3BFMA 3RKYA 3A5YA 1SRYA 3EFRA 2ALYA 4H2TA 1X55A 2DVEA 4HWRA 4EX5A 3PCOB 1JJCB 4YDQA 3QNEA 2P5IA 2AKWA 3PCOA 2DXTA 2QHTA 2ZGWA 2ZIMA 1KMNA 4YRFA 1H4QA 2RHQB 4P71C 1PYSA 3HTZA 4H2XA 4P74C 1ASZA 1USYA 3ICAA 3IKLA 1BIAA 4H2SA 3IKMB 3M4QA 1B70A 2ZTGA 3TUPA 3ERRA 4LVMA 1E1TA 1N9WA 4XU3A 3HFVA 4P72C 5F5WA 1X54A 4YPFA 4HWPA 1ATIA 1QF6A 3HFZA 2ZIOA 3CMQA 1EOVA 4UP8A 1KOGA 1E22A 5ELNA 2Q5HA 2DQ3A 5C53B 2PMFA 3MQZA 1YFSA 3LSSA 3UH0A 2G4CA 3RF1A 4O2DA 4OLFA 3E9IA 3L1AA 5K1PA 2DKGA 5C51B 4YRGA 3HXZA 3QO8A 4P72A 3L4GB 4CH5A 4WJ4A 2DTOA 5K1XA 11ASA 4NCXA 5ELOA 1G51A 2E3CA 4HWTA 1EIYA 4BW9A 2ZT6A 1VQZA 2I4NA 4YRMA 1X56A 3HXYA 4XU0A 3R07A 1NJ6A 3G1ZA 1KMMA 4Q15A 1EVKA 4YRLA 1H4TA 2Q7GA 1HTTA 2IY5A 2DZCA 4YRJA 4HT4A 2DZ9A 4YRQA 4G85A 1EIYB 3A7RA 4YRPA 1NJ5A 2E5AA 1EQRA 1HC7A 4HWOA 3V8LA 4YROA 1WQWA 2DU7A 4J15A 4P73C 3IG2A 3P8TA 4LVIA 1B7YA 2A8EA 1ASYA 4ZIBA 3LC0A 1ADJA 1NJ1A 2DEQA 2QHVA 2PMEA 3VQXA 1E1OA 2ZR2A 4TVAA 4K86A 4LVLA 1NJ2A 2E64A 2EJ9A 2DQ0A 4XTZA 4LVJA 3KFUA 1W66A 2CJBA 2EAYA 3VBBA 3HY1A 2RHSB 1L0WA 2RHSA 1G5IA 2Q7EA 2CGHA 5KNNA 3RKXA 2ZXFA 4RMFA 2DJZA 4RQFA 3REUA 1YFRA 2ARTA 3RACA 2EL9A 4HWSA 1YGBA 4YRKA 3V8KA 1WQ7A 4H2YA 2AKWB 4P75C 3HRIA 1B76A 3LSQA 2E1HA 1X01A 4P3NA 4DPGA 4P71A 1WNLA 1X2HA 1USYC 2I4OA 3RIRA 4AH6A 2QHSA 1ADYA 4BWAA 4H02A 1EVLA 1BBWA 4XTUA 4HA8A 3W3SA 4LVKA 2C7IA 4XU1A 2J3LA 4CH3A 2DTHA 4E51A 4DQ2A 2CIMA 2DTIA 3HXWA 2DDZA 3A5ZA 3A7UA 1WYDA 2E65A 4ZTUB 4YCUA 4YYEA 1H4SA 4H2XB 1RIQA 3A7AA 4TTVA 3PZCA 2ZNIA 2CJ9A 2EJGA 3V7RA 4RDXA 2ZZGA 2ZZFA 4P3PA 3VQWA 3VQVA 2Q7HA 2DU5A 3V8JA 4CS3A 3NENA 2C8MA 3MF2A 5C52B 2ODRC 2EWNA 1C0AA 4YRRA 4TWAA 4X5OA 4WF2A 2J3MA 4YRCA 2ZT5A 4P73A 4H2WA 4YCWA 4OP0A 3E9HA 3QO5A 3NETA 3V7SA 3DSQA 2QHUA 1E24A 1WU7A 2I4MA 2ZZEA 2ZT8A 2ARUA 1WPYA 2IY5B 2DXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS6 A;  4LVL A;  4LVJ A;  4LVI A;  4HT4 A;  4LVM A;  4LVK A; 
#chains in the Genus database with same CATH topology
 3HFZ B;  4KR3 A;  4PHC A;  4XTY A;  4UPA A;  3HXU A;  3HRK A;  4G84 A;  2EJF A;  3HY0 A;  1J5W A;  1G5H A;  4KQE A;  1NNH A;  2E10 A;  3RKW A;  3L2Z A;  4L87 A;  1B7Y B;  3RUX A;  1SES A;  3UFG A;  2AMC B;  3MF1 A;  3VQY A;  5HGQ A;  4P74 A;  1WLE A;  1B70 B;  4TVW A;  2ZT7 A;  4YRT A;  4H2U A;  4XTX A;  2AMC A;  1PYS B;  4K88 A;  1IL2 A;  3OD1 A;  4H2V A;  4CH4 A;  1FYF A;  4YRE A;  5E3I A;  1YB3 A;  1NJ8 A;  2E41 A;  1SER A;  3M4P A;  1YFT A;  4EO4 A;  2XGT A;  4XTV A;  3FJP A;  2NS6 A;  1NYR A;  2ALY B;  2ZIN A;  4YCV A;  3TEH B;  1SET A;  4YP0 A;  1H4V B;  2I4L A;  1QE0 A;  4CS4 A;  2FYK A;  3TEG A;  2ARS A;  3MEY A;  3WQZ A;  3NEM A;  2ODR D;  3IAL A;  3I7F A;  3P8Y A;  12AS A;  4WJ3 M;  3TEH A;  4RQE A;  4KR2 A;  3UGT A;  4LNS A;  4TVA B;  4XTW A;  1EFW A;  4XU2 A;  4ZTZ B;  2RHQ A;  3A32 A;  3EFS A;  1Z7M A;  3RGL A;  1B8A A;  1HXD A;  4P3O A;  2ZR3 A;  4XEM A;  3A31 A;  4YRN A;  3NEL A;  3UGQ A;  3QO7 A;  4Q6G A;  1NYQ A;  4K87 A;  4CH6 A;  3V7C A;  2P0L A;  4PG3 A;  3BJU A;  4TQF A;  1GGM A;  2CJA A;  4TVY A;  3REX A;  4HVC A;  3A74 A;  3HXV A;  4YRS A;  1JJC A;  1LYL A;  4TQD A;  4XEO A;  4P75 A;  3RL6 A;  3QTC A;  3HXX A;  4WI1 A;  2HNI A;  1X2G A;  2ZNJ A;  4YRI A;  4CS2 A;  2Q5I A;  2ZCE A;  4UP7 A;  1BIB A;  1Z7N A;  3P8V A;  4UP9 A;  2XTI A;  1BBU A;  3L4G A;  3BFM A;  3RKY A;  3A5Y A;  1SRY A;  3EFR A;  2ALY A;  4H2T A;  1X55 A;  2DVE A;  4HWR A;  4EX5 A;  3PCO B;  1JJC B;  4YDQ A;  3QNE A;  2P5I A;  2AKW A;  3PCO A;  2DXT A;  2QHT A;  2ZGW A;  2ZIM A;  1KMN A;  4YRF A;  1H4Q A;  2RHQ B;  4P71 C;  1PYS A;  3HTZ A;  4H2X A;  4P74 C;  1ASZ A;  1USY A;  3ICA A;  3IKL A;  1BIA A;  4H2S A;  3IKM B;  3M4Q A;  1B70 A;  2ZTG A;  3TUP A;  3ERR A;  4LVM A;  1E1T A;  1N9W A;  4XU3 A;  3HFV A;  4P72 C;  5F5W A;  1X54 A;  4YPF A;  4HWP A;  1ATI A;  1QF6 A;  3HFZ A;  2ZIO A;  3CMQ A;  1EOV A;  4UP8 A;  1KOG A;  1E22 A;  5ELN A;  2Q5H A;  2DQ3 A;  5C53 B;  2PMF A;  3MQZ A;  1YFS A;  3LSS A;  3UH0 A;  2G4C A;  3RF1 A;  4O2D A;  4OLF A;  3E9I A;  3L1A A;  5K1P A;  2DKG A;  5C51 B;  4YRG A;  3HXZ A;  3QO8 A;  4P72 A;  3L4G B;  4CH5 A;  4WJ4 A;  2DTO A;  5K1X A;  11AS A;  4NCX A;  5ELO A;  1G51 A;  2E3C A;  4HWT A;  1EIY A;  4BW9 A;  2ZT6 A;  1VQZ A;  2I4N A;  4YRM A;  1X56 A;  3HXY A;  4XU0 A;  3R07 A;  1NJ6 A;  3G1Z A;  1KMM A;  4Q15 A;  1EVK A;  4YRL A;  1H4T A;  2Q7G A;  1HTT A;  2IY5 A;  2DZC A;  4YRJ A;  4HT4 A;  2DZ9 A;  4YRQ A;  4G85 A;  1EIY B;  3A7R A;  4YRP A;  1NJ5 A;  2E5A A;  1EQR A;  1HC7 A;  4HWO A;  3V8L A;  4YRO A;  1WQW A;  2DU7 A;  4J15 A;  4P73 C;  3IG2 A;  3P8T A;  4LVI A;  1B7Y A;  2A8E A;  1ASY A;  4ZIB A;  3LC0 A;  1ADJ A;  1NJ1 A;  2DEQ A;  2QHV A;  2PME A;  3VQX A;  1E1O A;  2ZR2 A;  4TVA A;  4K86 A;  4LVL A;  1NJ2 A;  2E64 A;  2EJ9 A;  2DQ0 A;  4XTZ A;  4LVJ A;  3KFU A;  1W66 A;  2CJB A;  2EAY A;  3VBB A;  3HY1 A;  2RHS B;  1L0W A;  2RHS A;  1G5I A;  2Q7E A;  2CGH A;  5KNN A;  3RKX A;  2ZXF A;  4RMF A;  2DJZ A;  4RQF A;  3REU A;  1YFR A;  2ART A;  3RAC A;  2EL9 A;  4HWS A;  1YGB A;  4YRK A;  3V8K A;  1WQ7 A;  4H2Y A;  2AKW B;  4P75 C;  3HRI A;  1B76 A;  3LSQ A;  2E1H A;  1X01 A;  4P3N A;  4DPG A;  4P71 A;  1WNL A;  1X2H A;  1USY C;  2I4O A;  3RIR A;  4AH6 A;  2QHS A;  1ADY A;  4BWA A;  4H02 A;  1EVL A;  1BBW A;  4XTU A;  4HA8 A;  3W3S A;  4LVK A;  2C7I A;  4XU1 A;  2J3L A;  4CH3 A;  2DTH A;  4E51 A;  4DQ2 A;  2CIM A;  2DTI A;  3HXW A;  2DDZ A;  3A5Z A;  3A7U A;  1WYD A;  2E65 A;  4ZTU B;  4YCU A;  4YYE A;  1H4S A;  4H2X B;  1RIQ A;  3A7A A;  4TTV A;  3PZC A;  2ZNI A;  2CJ9 A;  2EJG A;  3V7R A;  4RDX A;  2ZZG A;  2ZZF A;  4P3P A;  3VQW A;  3VQV A;  2Q7H A;  2DU5 A;  3V8J A;  4CS3 A;  3NEN A;  2C8M A;  3MF2 A;  5C52 B;  2ODR C;  2EWN A;  1C0A A;  4YRR A;  4TWA A;  4X5O A;  4WF2 A;  2J3M A;  4YRC A;  2ZT5 A;  4P73 A;  4H2W A;  4YCW A;  4OP0 A;  3E9H A;  3QO5 A;  3NET A;  3V7S A;  3DSQ A;  2QHU A;  1E24 A;  1WU7 A;  2I4M A;  2ZZE A;  2ZT8 A;  2ARU A;  1WPY A;  2IY5 B;  2DXU A; 
#chains in the Genus database with same CATH homology
 3HFZ B;  4KR3 A;  4PHC A;  4XTY A;  4UPA A;  3HXU A;  3HRK A;  4G84 A;  2EJF A;  3HY0 A;  1J5W A;  1G5H A;  4KQE A;  1NNH A;  2E10 A;  3RKW A;  3L2Z A;  4L87 A;  1B7Y B;  3RUX A;  1SES A;  3UFG A;  2AMC B;  3MF1 A;  3VQY A;  5HGQ A;  4P74 A;  1WLE A;  1B70 B;  4TVW A;  2ZT7 A;  4YRT A;  4H2U A;  4XTX A;  2AMC A;  1PYS B;  4K88 A;  1IL2 A;  3OD1 A;  4H2V A;  4CH4 A;  1FYF A;  4YRE A;  5E3I A;  1YB3 A;  1NJ8 A;  2E41 A;  1SER A;  3M4P A;  1YFT A;  4EO4 A;  2XGT A;  4XTV A;  3FJP A;  2NS6 A;  1NYR A;  2ALY B;  2ZIN A;  4YCV A;  3TEH B;  1SET A;  4YP0 A;  1H4V B;  2I4L A;  1QE0 A;  4CS4 A;  2FYK A;  3TEG A;  2ARS A;  3MEY A;  3WQZ A;  3NEM A;  2ODR D;  3IAL A;  3I7F A;  3P8Y A;  12AS A;  4WJ3 M;  3TEH A;  4RQE A;  4KR2 A;  3UGT A;  4LNS A;  4TVA B;  4XTW A;  1EFW A;  4XU2 A;  4ZTZ B;  2RHQ A;  3A32 A;  3EFS A;  1Z7M A;  3RGL A;  1B8A A;  1HXD A;  4P3O A;  2ZR3 A;  4XEM A;  3A31 A;  4YRN A;  3NEL A;  3UGQ A;  3QO7 A;  4Q6G A;  1NYQ A;  4K87 A;  4CH6 A;  3V7C A;  2P0L A;  4PG3 A;  3BJU A;  4TQF A;  1GGM A;  2CJA A;  4TVY A;  3REX A;  4HVC A;  3A74 A;  3HXV A;  4YRS A;  1JJC A;  1LYL A;  4TQD A;  4XEO A;  4P75 A;  3RL6 A;  3QTC A;  3HXX A;  4WI1 A;  2HNI A;  1X2G A;  2ZNJ A;  4YRI A;  4CS2 A;  2Q5I A;  2ZCE A;  4UP7 A;  1BIB A;  1Z7N A;  3P8V A;  4UP9 A;  2XTI A;  1BBU A;  3L4G A;  3BFM A;  3RKY A;  3A5Y A;  1SRY A;  3EFR A;  2ALY A;  4H2T A;  1X55 A;  2DVE A;  4HWR A;  4EX5 A;  3PCO B;  1JJC B;  4YDQ A;  3QNE A;  2P5I A;  2AKW A;  3PCO A;  2DXT A;  2QHT A;  2ZGW A;  2ZIM A;  1KMN A;  4YRF A;  1H4Q A;  2RHQ B;  4P71 C;  1PYS A;  3HTZ A;  4H2X A;  4P74 C;  1ASZ A;  1USY A;  3ICA A;  3IKL A;  1BIA A;  4H2S A;  3IKM B;  3M4Q A;  1B70 A;  2ZTG A;  3TUP A;  3ERR A;  4LVM A;  1E1T A;  1N9W A;  4XU3 A;  3HFV A;  4P72 C;  5F5W A;  1X54 A;  4YPF A;  4HWP A;  1ATI A;  1QF6 A;  3HFZ A;  2ZIO A;  3CMQ A;  1EOV A;  4UP8 A;  1KOG A;  1E22 A;  5ELN A;  2Q5H A;  2DQ3 A;  5C53 B;  2PMF A;  3MQZ A;  1YFS A;  3LSS A;  3UH0 A;  2G4C A;  3RF1 A;  4O2D A;  4OLF A;  3E9I A;  3L1A A;  5K1P A;  2DKG A;  5C51 B;  4YRG A;  3HXZ A;  3QO8 A;  4P72 A;  3L4G B;  4CH5 A;  4WJ4 A;  2DTO A;  5K1X A;  11AS A;  4NCX A;  5ELO A;  1G51 A;  2E3C A;  4HWT A;  1EIY A;  4BW9 A;  2ZT6 A;  1VQZ A;  2I4N A;  4YRM A;  1X56 A;  3HXY A;  4XU0 A;  3R07 A;  1NJ6 A;  3G1Z A;  1KMM A;  4Q15 A;  1EVK A;  4YRL A;  1H4T A;  2Q7G A;  1HTT A;  2IY5 A;  2DZC A;  4YRJ A;  4HT4 A;  2DZ9 A;  4YRQ A;  4G85 A;  1EIY B;  3A7R A;  4YRP A;  1NJ5 A;  2E5A A;  1EQR A;  1HC7 A;  4HWO A;  3V8L A;  4YRO A;  1WQW A;  2DU7 A;  4J15 A;  4P73 C;  3IG2 A;  3P8T A;  4LVI A;  1B7Y A;  2A8E A;  1ASY A;  4ZIB A;  3LC0 A;  1ADJ A;  1NJ1 A;  2DEQ A;  2QHV A;  2PME A;  3VQX A;  1E1O A;  2ZR2 A;  4TVA A;  4K86 A;  4LVL A;  1NJ2 A;  2E64 A;  2EJ9 A;  2DQ0 A;  4XTZ A;  4LVJ A;  3KFU A;  1W66 A;  2CJB A;  2EAY A;  3VBB A;  3HY1 A;  2RHS B;  1L0W A;  2RHS A;  1G5I A;  2Q7E A;  2CGH A;  5KNN A;  3RKX A;  2ZXF A;  4RMF A;  2DJZ A;  4RQF A;  3REU A;  1YFR A;  2ART A;  3RAC A;  2EL9 A;  4HWS A;  1YGB A;  4YRK A;  3V8K A;  1WQ7 A;  4H2Y A;  2AKW B;  4P75 C;  3HRI A;  1B76 A;  3LSQ A;  2E1H A;  1X01 A;  4P3N A;  4DPG A;  4P71 A;  1WNL A;  1X2H A;  1USY C;  2I4O A;  3RIR A;  4AH6 A;  2QHS A;  1ADY A;  4BWA A;  4H02 A;  1EVL A;  1BBW A;  4XTU A;  4HA8 A;  3W3S A;  4LVK A;  2C7I A;  4XU1 A;  2J3L A;  4CH3 A;  2DTH A;  4E51 A;  4DQ2 A;  2CIM A;  2DTI A;  3HXW A;  2DDZ A;  3A5Z A;  3A7U A;  1WYD A;  2E65 A;  4ZTU B;  4YCU A;  4YYE A;  1H4S A;  4H2X B;  1RIQ A;  3A7A A;  4TTV A;  3PZC A;  2ZNI A;  2CJ9 A;  2EJG A;  3V7R A;  4RDX A;  2ZZG A;  2ZZF A;  4P3P A;  3VQW A;  3VQV A;  2Q7H A;  2DU5 A;  3V8J A;  4CS3 A;  3NEN A;  2C8M A;  3MF2 A;  5C52 B;  2ODR C;  2EWN A;  1C0A A;  4YRR A;  4TWA A;  4X5O A;  4WF2 A;  2J3M A;  4YRC A;  2ZT5 A;  4P73 A;  4H2W A;  4YCW A;  4OP0 A;  3E9H A;  3QO5 A;  3NET A;  3V7S A;  3DSQ A;  2QHU A;  1E24 A;  1WU7 A;  2I4M A;  2ZZE A;  2ZT8 A;  2ARU A;  1WPY A;  2IY5 B;  2DXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...