4HTFB

Crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
247
Chain Sequence
b'MQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAIKMAERGHQVILCDLSAQMIDRAKQAAEAKGVSDNMQFIHCAAQDVASHLETPVDLILFHAVLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMSPDYPRDPTQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDCYEALLELETRYCRQEPYITLGRYIHVTARKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine-dependent methyltransferase
molecule tags Transferase
source organism Escherichia coli
publication title Crystal structure of S-adenosylmethionine-dependent methyltransferase from Escherichia coli in complex with S-adenosylmethionine.
rcsb
total genus 88
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4htfB00
1BC5A 2PV0A 3R0QA 4OBWA 3SM3A 2AOTA 1EAMA 1N2XA 5G02A 5JUWA 2ZWAA 3HVJA 3GO4A 5HIIA 1NBIA 5U4XA 5K01A 4PWYA 2JH9A 3G2OA 3HCAA 1L1EA 4GOOD 4M7RA 4RVGA 2I6GA 3HP7A 3TQSA 1YZHA 5CCXA 2CL5A 5FCDA 4EMSA 1QAOA 2E5WA 4U7TB 4WVLA 3HEMA 3M6XA 3IHTA 4H0NA 5E8JA 4RVFA 2YQZA 2AN4A 5CIYA 5D1NA 2GPYA 1VL5A 5E1OA 2G70A 1RI4A 7MHTA 5K8VA 3P97A 3EVCA 4QPPA 3G2MA 3HA3A 4RTMA 5F2OA 1XCJA 2CKDA 3G88A 2JH8A 1NW5A 3IV6A 4RSRA 4CKBA 2PLWA 5ERGB 2UYOA 5K0LA 4C07A 3KQWA 5DSTA 3F4KA 4CTKA 2Z6UA 2PX4A 1RJDA 3U81A 4MIKA 3E23A 5EMMA 3LDFA 4PYIA 5EIWA 4CWAA 3TLJA 4DQ0A 4E31A 5LQUA 1M6YA 2XYQA 3LCCA 1Y8CA 4PYNA 4E2YA 1Q0TA 1EQAA 4IV8A 1NW6A 1DCTA 1M0EA 2VP3A 2P7HA 3LHDA 2NXCA 3G5LA 2B2CA 3R24A 2P1DA 2ZULA 3C3PA 4F85A 5BXYA 3PLAE 5LSAA 3HCBA 2NP7A 3ER9A 5EPEA 4A6DA 3NWBA 3FPGA 3GJYA 3OU2A 1X1BA 3GRZA 5K0BA 1JQEA 5GIOE 4RV9A 4RTLA 1KYWA 1VP9A 5IH3A 4KWCA 1EJ6A 3K0BA 1JG4A 3GRYA 3HVHA 4DKJA 1ORHA 4OQDA 2WA2A 5E2AA 1D2HA 2Z6QA 1NW3A 2EG5A 3FPEA 2VZ9A 2N47A 3M70A 3LBYA 4QQKA 3ELYA 3RW9A 4HG2A 3CJQA 4KRGA 3FTEA 2P41A 1NV8A 1JG3A 2R3SA 4ER0A 3I64A 2IP2A 2Y1XA 5CM2Z 4YV0A 5F2NA 2P7IA 1G8SA 5KVAA 3OFKA 3M4XA 4LG1A 5DLYA 1HNNA 2ZIEA 5DT2A 5E8RA 2UZ4A 4RTPA 2XYRA 4C05A 3AXTA 3EMBA 3FRIA 2ZBRA 3SGLA 4Y30A 4HH4A 3B5IA 4QPNA 2PWPA 5CVJA 3CKKA 4HGYA 1YF3A 3GXOA 4FSDA 2HWKA 3JWIA 4K6MA 4HRAA 2WK1A 5GIPE 2BH2A 3ER8A 2B3TA 3AXSA 5LR6A 3MHTA 3UJCA 3DMGA 1OR8A 4P7FA 3HA5A 1RJGA 2JHCA 3ELUA 3KQTA 3B3JA 5E1DA 3X0DA 1R6AA 5FULA 4AZTA 1XDSA 1VLMA 2IPXA 4PCLA 1KXZA 3FZGA 3KU1A 3LGAA 3OE4A 4M36A 2PJDA 2FYTA 5DX0A 5EVJA 4C03A 4FZVA 3UJ8A 2BM9A 2ZFUA 5LQKA 2XVMA 4V0QA 1KPHA 2HTEA 4RVDA 3TKYA 1HMYA 3UA4A 5MHTA 2A14A 5DM4A 4RX1A 2AZTA 5FQNA 3LBFA 1R00A 3O31A 3KPUA 2FRXA 4PYLA 2NXNA 2AOUB 4FT4A 4RTQA 5HOQA 3DULA 3GGDA 5DM1A 3JWGA 4F86A 3PVCA 3EVFA 3HCFA 4R6WA 3H2BA 4RTKA 4WXHA 4DMGA 2PXXA 1VP3A 3FUWA 3HCEA 5EEHA 3TR6A 3VSEA 3A27A 5EEGA 4C4AA 3GRRA 9MHTA 4XCXA 1PRYA 2PXAA 1L3CA 1G60A 2XYVA 3A4TA 4KW7A 2P8JA 5EC8A 3TM4A 4X41A 5K0CA 4RTOA 2JG3A 3R3HA 8MHTA 2NNWB 2AOXA 3S68A 5K0NA 2VDUE 1DUSA 2ONYA 3OZRA 1RJFA 4MQ4A 5HFJA 2QRVB 5HEKA 2IGTA 1UWVA 3FYDA 1JTEA 3FTFA 1SUIA 2PX5A 5C9ZA 1XDUA 5E9QA 2LD4A 2PBFA 3A7DA 4GOLD 2CMHA 4PYQA 1JR4A 1X19A 2ORED 3FTCA 2QY6A 5DX1A 5FADA 3NJRA 5DM0A 5DTMA 2YX1A 4CKCA 4EKIA 5B1SA 1ZG3A 2H00A 2FK7A 4FR0A 5EGSA 1L3BA 2ERCA 5GP1A 3LECA 3ANXA 2PY6A 1H1DA 2FPOA 5M5BA 3CJTA 5LQCA 2OO3A 4OA8A 1R74A 3GU3A 3CBGA 1KPGA 2CMGA 1F3LA 3KPYA 1YUBA 3OZSA 5DRYA 1NW7A 3R6TA 1KP9A 3C6MA 5CVEA 2QE6A 3TOSA 3MGGA 1XCLA 3HVKA 1SVUA 4P7KA 5K05A 4CTJA 2NXJA 3G89A 2UYHA 1FBNA 4V0RA 3DOUA 4KDRA 1NKVA 1XJ5A 2GLUA 4JXJA 3P71T 1O9HA 3LKDA 4YMHA 2C7OA 2PX8A 2IFTA 3BGVA 3C0KA 3DTNA 3T7SA 4RYLA 2ZCJA 3GRVA 3L8DA 5H02A 2UYQA 3AWIA 1IM8A 1ZKDA 4LWPA 3NW9A 4A6EA 5EKXA 5LQRA 3EGVA 1BHJA 2XVAA 3MQ2A 3KR9A 3OZTA 3GIWA 3LDGA 4YMGA 3LPMA 5HILA 1VPTA 3KQVA 4M38A 1AV6A 3LX6A 2O07A 3K6RA 3OE5A 2BR5A 4PGGA 2ONZA 3LCUA 4XUEA 1VQ1A 5E9JA 2BZGA 3PFHA 2IBTA 1WXXA 1MJFA 2PXCA 3P2KA 3BXOA 5E2BA 5LQJA 3NMUF 4OBXA 5DXJA 3SSNA 3UJDA 3B7PA 4FGZA 4F84A 1X1CA 2B78A 3O7WA 4C08A 2PT6A 3ORHA 5CD1A 5ICEA 4BLUA 2AVNA 5DTQA 4PINA 1BOOA 1RJEA 5D1HA 1B42A 2ZBPA 4XUCA 1FPQA 1XTPA 2ZZNA 5F2KA 3EVBA 2FCAA 3THRA 2PX2A 2YTZA 3QOXA 3KHKA 5FWDA 1AQJA 5EMLA 5K0FA 3A25A 4E2WA 4R05A 5FHRA 1ZGJA 1WY7A 3OFJA 2OB1A 2PVCA 4GC5A 4BP3A 3FUXA 3D2LA 4GOND 3DUWA 5CVDA 2ZVJA 3Q87B 2GAFA 3R9XB 3EVZA 4EK9A 3FPFA 4OQEA 5CVVA 1UIRA 3BGDA 4DA4A 3KQQA 3P9CA 2HV9A 3UWPA 10MHA 3UFBA 4FS8A 1L9KA 5BP7A 3M6WA 4HGZA 2WA1A 3SVZA 3SR4A 1XVAA 3G8BA 3EPPA 5ICFA 1R8XA 5IKMA 4Y2HA 3QV2A 5T67A 2ZWVA 3KR1A 2AOWA 2VDVE 1TW3A 1EG2A 1I1NA 2QYOA 3KPJA 3P8ZA 3P9NA 4M37A 4DCMA 2I9KA 3E05A 3UA3A 1VE3A 3CGGA 3KQMA 1KIAA 4BY9E 4FSXA 3MCTA 3P9KA 4U7PB 4G56A 1PJZA 3T7RA 5HIJA 4QQNA 4X61A 4BLVA 5KYGA 4IKPA 3FUTA 1IY9A 2R6ZA 2YXLA 3KKZA 5K03A 5CUQA 3DLCA 2ZTHA 4DF3A 3DLIA 1ZHFA 5GM2A 4EKGA 2OB2A 1FJXA 3QOWA 5FHQA 3BWBA 1EJ0A 3GCZA 3MTIA 5DPMA 3SMQA 1RI1A 2OPBA 3FPHA 5EIFA 2ZIFA 1YZ3A 3Q7EA 1SUSA 4GEKA 4R8SA 3DR5A 2DPMA 3KPWA 4AZWA 2IH4A 4ZTBA 3I9FA 3EGIA 1L3IA 4QVGA 2Q41A 2K4MA 5GINE 4EQZA 4PYMA 2EJUA 3EVAA 5P8WA 4AZSA 2IIPA 4E2XA 3NVMB 5BW5A 2ZW9A 4P7GA 3UJ9A 4X63A 2BR3A 3FUUA 1AQIA 3KR0A 4RWZA 3GWZA 3I5UA 4YV2A 1NE2A 2G71A 1F38A 3P2EA 4RTNA 3ME5A 2Z6AA 2YVLA 2JHPA 1JG1A 5DRTA 4YUVA 1JTFA 4ER6A 3B89A 1WXWA 3TM5A 3RODA 4GQBA 4FT2A 3SSOA 2YUIA 1RI2A 3C3YA 3KQPA 1WG8A 3KR2A 5E1MA 3SXJA 2ADMA 1I9GA 5E1BA 4BLWA 3KQOA 1O54A 2FHPA 2ZLBA 5FA5A 2OXTA 2OZVA 5DXAA 3BUSA 2PSSA 3BKXA 1TPYA 5GOZA 4YUXA 5FWAA 3HA7A 5EQJB 2JJQA 3KQYA 3NVKI 2F8LA 3HM2A 3MCZA 1FP2A 2HR1A 2ZZMA 1R8YA 1QANA 3BWCA 3FTDA 3OPNA 4IWNA 4HTFA 2PKWA 4LECA 5T64A 4R6XA 5FUBA 3CCFA 5ICGA 2PT9A 1INLA 2AR0A 3G7UA 4PYKA 1ORIA 5DX8A 4DM3A 2G1PA 3CVOA 3BZBA 5K0EA 4C04A 3HTXA 2GB4A 3DMFA 3T0IA 3LSTA 3ERCA 5EMKA 2I7CA 4QTTB 1G8AA 1KR5A 3BKWA 2C7RA 2UYCA 5EHGA 1RI3A 5EZQA 4GUAA 3REOA 5FTWA 3DXXA 4ER7A 4PYJA 1WS6A 2P3OA 2VDWA 3BWYA 5E9WA 3OU6A 5CCBA 1JG2A 1X1AA 1NT2A 3CC8A 3VYWA 4RTJA 3MB5A 4KVZA 3UJ7A 5JR3A 5DWQA 3BWMA 3LCVB 4P7JA 4PIPA 1QAQA 3TMAA 2QM3A 4IV0A 4HSGA 4LWOA 1NBHA 3VC2A 3TRKA 1TW2A 2OYRA 4POOA 4QDJA 3FRHA 4YUZA 3EGEA 2G72A 3DP7A 2CWWA 2HNKA 4E33A 3NWEA 1G55A 4YV1A 2ZSUA 3E8SA 2EJTA 3B3GA 4GF5A 5C1IA 1YFJA 3G2PA 3B3FA 5LQNA 1SKMA 3FUVA 3PS9A 5LQAA 1AF7A 4AUKA 2P40A 4E32A 2O05A 5HIKA 4E30A 2O57A 3FPJA 2V74B 3SSMA 1SG9A 3OU7A 1MHTA 1D2GA 1P1BA 3MTEA 2AVDA 4OA5A 3BT7A 4BP1A 2IH2A 2HMYB 4RTRA 1ZQ9A 1VIDA 5KQRA 3UZUA 2O0LA 3AJDA 2BR4A 2AOTB 3ELWA 3EEOA 1G38A 3G2QA 2GA9A 2H11A 3IYLW 1VBFA 3GNLA 4PGHA 1QAMA 4RVHA 4MWZA 3TKAA 1Q0SA 2P3LA 1Z3CA 1IXKA 3DH0A 2NXEA 2P35A 3G5TA 5KS2A 4MHTA 2YXEA 5DTRA 4GOMD 2OKCA 3ELDA 1P91A 1ZGAA 5EZSA 1XXLA 1YFLA 4YUYA 3JWHA 1SQGA 4AX8A 1JQ3A 3M33A 4DCGA 1QZZA 2DULA 3HCDA 4L7VA 4PCAA 3V97A 1P39A 5CVUA 3LDUA 4Z2YA 2FK8A 5GWXA 3HNRA 1UFKA 4GC9A 3UJAA 2AN5A 3LL7A 2AS0A 4PIMA 2AOUA 1YB2A 1R18A 1JSXA 2PWYA 3I58A 3MERA 1M6EX 3PTAA 1EIZA 4CKEA 5EKUA 1DL5A 1WZNA 3NDIA 4CXMA 2C7PA 4MTLA 4QVKA 4X60A 4B17A 3E7PA 2IH5A 5BW4A 5EMJA 1SQFA 1RI5A 4ER5A 2JHAA 2AN3A 4X1OA 5K0GA 4HC4A 1QYRA 2BM8A 2Y1WA 1O9GA 2AOVA 2IDJA 3RIEA 4E2ZA 1V39A 2EFJA 3VC1A 5K0JA 5FQOA 1P1CA 2I62A 3DXYA 5ICCA 2PGXA 3SX0A 3AY0A 3LKZA 4C06A 3BGIA 5K09A 3GRUA 2YXDA 1KPIA 3MAGA 4NECA 3UJBA 2IBSA 5HZMA 3IEIA 4PYOA 5EHIA 3THSA 5DM2A 1N7IA 4ISCA 2ZIGA 2EX4A 4QDKA 3HVIA 2ZZKA 5GM1A 4RTSA 1NV9A 3KPVA 3P9IA 3JWJA 2ZBQA 3EMDA 3UJ6A 1KYZA 5EG5A 4P58A 5EOVA 3TFWA 3NTVA 4QTUB 4ER3A 3EVGA 1XDZA 2V7EA 5HIMA 4PNEA 2H1RA 1NW8A 3GDHA 4E70A 4O29A 3T7TA 3PX3A 1BKYA 1JQDA 3ID6C 4KDCA 1T43A 2P3QA 3EEYA 1KHHA 3P2IA 2XBMA 3PT9A 4R8RA 3C6KA 4ATNA 4KIGA 4AZVA 1FP1D 4DZRA 3WSTA 5C0OE 3PB3A 1D2CA 4PONA 5FA8A 1N7JA 2B9EA 1U2ZA 3O4FA 3PFGA 4HTFB 4OX9Y 5T6BA 2GS9A 2OY0A 1X1DA 1G6Q1 2VS1A 3DXZA 3V8VA 4UOEA 3EVEA 2KW5A 3HCCA 2O06A 2C7QA 4XUDA 2QRVA 1JSZA 3A26A 3KQSA 5KQSA 3CJRA 4EVIA 2NP6A 2YR0A 2NYUA 5DSXA 3EVDA 3M6VA 2GH1A 1I4WA 2B25A 3A7EA 4GBED 2G8NA 2OBFA 3TPZA 3I53A 4YUWA 2IDKA 3PX2A 3UBTA 4FP9A 3FYCA 3M6UA 2ESRA 3G8AA 3NDJA 4KIFA 3DMHA 3OCJA
chains in the Genus database with same CATH superfamily
2O6HA 3CLUC 2GCPA 3CURA 3HQ4O 4HB0A 3WLMA 1JEJA 5L7TA 1QLHA 4MLPA 1B2RA 1GGKA 1VE6A 4KPGA 5G0TA 2I80A 1KEPA 3BDIA 1G8PA 4OMFG 3TECE 1FRZA 1AGNA 1TYBE 1UBEA 1USGA 1E3JA 1LKZA 3E3NA 1YZHA 2B35A 2Z5VA 4PXAA 4DWJA 1FMFA 2PZFA 2E5WA 3ED1A 3T5GA 5E8JA 4ZKDA 4HLDA 3CZ5A 2Q2VA 1BVHA 1RWBA 4GBJA 1VL5A 4BEJA 3GMTA 2IUSA 4NFYA 2RHRA 1IPHA 2QN9A 2VJNA 4J0CA 4C6HA 3CSSA 3FPSA 5F2OA 5JSKA 2J0UA 2BJHA 3SYLA 4A0QA 2RGDA 1YZFA 1UKEA 4HBGA 4S24A 1SC9A 1T5DX 5DSTA 1TYEB 3WBKA 4D3YA 2GVDC 3Q9SA 5JEEA 4LS3A 2PQ2A 5TMDA 1GGVA 3MJSA 3UB3A 1NUQA 1NFFA 1XRMA 2VJLA 2CVHA 2Q62A 2Y71A 4ZICA 3ZD7A 1NM5C 3G5LA 1GRQA 2ZUBA 4ITRC 4D41A 4IJVA 2Q3FA 3Q3HA 3OOJA 5FWYB 5H70A 3X3HA 5JU6A 3C7KA 4PAOA 1KEEB 1R0RE 3PUZA 2W22A 1IAVA 4WJLA 2Y1KA 4N7BA 5J47A 3CEHA 3N0WA 4KNWA 2WBLC 5D6OA 2Q7DA 4U2GA 4GGPA 4JYAB 1ZCJA 1U94A 1R0SA 2P2DA 2P11A 2Y1CA 3FMVA 3B6EA 5MHTA 2XRMA 1J1UA 1ZUNB 2YY5A 4Z5XA 2VI5A 4RJTA 1XD2A 3CJQA 3K0HA 2P41A 5JIBA 1JU4A 1CRPA 3TKYA 5E7QA 1QHYA 1RIFA 4NBWA 4CUJA 4BXOA 2Z4RA 3KTOA 4AF8A 1AKNA 4EJ6A 3CZ9A 2W9XA 3AHEA 4NZPA 3QLUC 1AUQA 1JDUA 4DV3B 2IUUA 2XH8A 4OM8A 1ADJA 1HX7A 2FN3A 2ZQ5A 3O82A 4H7IA 4Z3OA 2JLXA 1I32A 5CLGA 4Z1MD 3K5PA 2FJPA 3JVDA 5DN6D 2QX6A 4OQNA 4QTYA 1PR9A 1BW9A 5E7JA 2FW8A 4X95A 4E5KA 1JH8A 3AQIA 4II3A 2BE9A 4MINA 5SZIA 1K27A 1XDSA 3X1JA 5BSMA 2IV7A 3VH3A 5J4KA 5JTTA 1RQLA 5EP3A 2NUAA 4NS1A 4I2NA 2GOYA 3HMKA 4R41A 3LGAA 4WKOA 3OE4A 4XQCA 3RH0A 4KXLA 2CNLA 4IS2A 3ZGNA 4CKZA 1W5EA 2DECA 2VDLB 1CYDA 1RLIA 2Z8ZA 1VHJA 2XRFA 3MT9A 4IUBS 4M2LA 4MVJD 4JXXA 3N86A 2HYIC 4LPKA 1LCIA 1M2OB 1VTKA 3KPUA 5HOQA 2I29A 1EXDA 4EGAA 2C9DA 3BA6A 3NXSA 3D7RA 2WKSA 4XRRA 4F2HA 3EASA 3TJMA 3GA0A 3K0CA 5FT9A 1IUOA 1JJ7A 2E1RA 2GPWA 5EEHA 1DU4A 2O5CA 3ZW8A 2RGYA 3GRRA 4NIMA 3LT4A 5KKCA 3TZQA 1GAQA 2AFHE 2BGKA 3L5OA 3AMVA 3HSYA 4DCPA 2JZNA 4K87A 3QKSA 4Y1FA 1UKCA 1F2VA 3OZRA 2GEBA 3K7EA 3K8YA 5HDQA 4JKIA 1W85A 4G2NA 4U0JA 4OUKX 4DEXA 5IEJA 4G1EB 1J42A 4PSDA 4UNRA 4RDXA 4DCOA 1RACA 3W5UA 1P1KA 3CZAA 4K26A 3ZWKA 1JTEA 3A6ZA 2IU4A 2NO4A 5JAHA 3VMFA 1KZYC 3PWKA 4RY9A 2YMMA 3RFTA 2QDXA 3AHHA 3D8TA 2E5LB 3I30X 1PTKA 3KD2A 1ISRA 4TTTS 4N3BA 5CT9A 5DX1A 1B23P 5TGTA 3WHPA 4MYRA 3ZCVA 1PJLA 2HN9A 4IJ6A 4MW1A 4GOXA 1NJGA 2QX9A 3FI9A 1O6GA 4FR0A 5EGSA 1GA1A 1U8CB 4NOMA 4RZQA 3FN4A 1PFYA 4DQXA 5AW6A 5DYNA 2RHHA 1Q7RA 4G4IA 5AJZA 1E20A 2UVQA 3SDBA 1QFZA 4ZRDA 2JEYA 4IZIA 4D57A 1KJIA 1LLUA 2GM9A 3WAJA 2QL9A 3GDGA 4F8JA 5HUHA 1SVUA 1E0AA 2FVXA 3AGQA 5FRDA 3OOEA 3FOBA 4KDRA 4YRMA 1GV1A 4ARZA 4B33A 3GUUA 3LKDA 1QYXA 2WC1A 4QUHA 5C53B 4NBSA 4NAVA 4QO7A 6NULA 1UJ2A 1Y6RA 2D2IA 2OV6A 2Z8YM 4WWHA 3GMDA 4HGNA 1ECCA 4NEHB 1QKKA 2EJBA 4GLLA 5AQEA 5BPHA 5EE1A 2O8CB 4LWPA 3IT2A 5CJJA 3LPDA 3ZU2A 4RSMA 2V8OA 5JNUA 5C1BA 2R9VA 1UMDA 3MQ2A 3LZDA 3FDZA 4WZZA 3ZWQA 3GIWA 3D6AA 3LPMA 2BBOA 4M38A 1HLGA 1SXGA 2IZ7A 3AVUA 3A9TA 4LRXA 4BMVA 1UJBA 3K6RA 1TM4E 1XDDA 2BR5A 2HBYA 4HAXA 1KIFA 2MWMA 1WCYA 2BP7A 1NMQA 1JQJC 3Q8MA 4JLNA 3MWLA 4U0KA 2C29D 5M34A 2LRHA 4K40A 1E0DA 1XZIA 2H9AA 4MUXA 4BLUA 4J9VA 1Y1PA 3DWIA 1BOOA 1FFSA 2AMFA 3CRMA 3MILA 5AI6A 4ABYA 4DS3A 1CNEA 3K16A 2JZOA 3FCSB 4L28A 3KXLA 4GXNA 4KYIB 3U3OA 1DV1A 4F97A 5BNWA 2ZZNA 2VCYA 3P4XA 2VAMA 2VXCA 1RAHA 4HO1X 4Q24A 4HX2A 3UCFA 4HDAA 4MV5A 1QDEA 1CWUA 1TF2A 3NTLA 1L1RA 1LWOA 1WDMA 3U13A 5CVDA 5AI9A 1PWXA 3IB3A 2EQBA 3VU0A 4MH0R 2WPDA 5BUZA 2A1TR 3ACCA 1W59A 4NYJQ 4XIIA 3F67A 2TRSB 4UQOA 2OYCA 4KBFA 3TBFA 3A1EA 3UFBA 4EX6A 5BP7A 1ZL2A 2ZGVA 4TL6A 1Q7BA 4IUYA 3EISA 5CTJA 1NN1A 4CKWA 1U7ZA 5AH0A 3RRXA 3OEYA 3OG9A 1QP4A 3C3DA 3ZE9A 2I54A 3P9NA 3KPJA 3S2IA 4BMNA 3OP1A 3NHSA 1XMJA 4IY1A 1O87A 5DBFA 4AJ9A 4BJ3A 3OIWA 3EDQA 3T1HB 3AF4A 4D0NA 4AP5A 1BXRA 4KQJA 4K7JA 1V8OA 3D9QX 2GXSA 2WINI 3NAGA 4IEIA 2H1CA 2X1MA 2Q1TA 4YDHB 3DBIA 1GRRA 3VR1A 4B3GA 3SAJA 5DJ5A 5JW6A 3AHIA 5T5QA 1TAGA 2EX0A 3FHJA 5EA2A 3MK31 1W46A 3MMZA 1EFPA 5ALHA 4O4JF 2X58A 4LIPD 2JAQA 2XWBF 4OL0A 1F2UB 1J0EA 3EB9A 4R0NA 1FP7A 1UPBA 5HDBB 1SKBA 1YZ3A 1E2GA 2XR1A 2GHTA 3CX3A 1UDAA 4ZJPA 8GPBA 4A0SA 3T9CA 3H1TA 2YOFA 2D7DA 2HLDD 2ZDGA 3UHPA 4S05A 3DLPX 2WUFA 3EGIA 4KLNA 1G4HA 3OH8A 3O3MB 3EDYA 1XLUA 2W6OA 4FKBA 4LHVA 4B71A 4GNKA 4B44A 4G65A 3NVMB 3BXPA 1JA1A 3L8FA 4ZT4A 2QI9C 1L4HA 4BFSA 1NBMD 3DDOA 2XMGA 4UPEA 2IV2X 3FGNA 1E9VA 2CFTA 3O8OA 1E0KA 3BIFA 4BIMA 4IGFA 1U4SA 4JLVA 4RBNA 1SCBA 1G2IA 1ZEJA 2IYLD 2YUIA 3ABZA 1NYTA 3B6KA 2WG0A 1WNTA 1AKWA 1MIOA 4TMWA 5EY5B 4BLWA 5FA5A 3Q6MA 4GMKA 3JWPA 4OB7A 2GEKA 3RHSA 1TYZA 4DIBA 1Q2XA 1JYEA 2DQYA 4P4LA 1I01A 3MCZA 3WMRA 4C4RA 1A9RA 2ODPA 4TXNA 3GFRA 1RCUA 1SG0A 1SUPA 4FLMA 4JY7A 3ZDZB 5IC4A 2JFNA 1E3DA 5JFOA 1E92A 1Q0RA 3ZV3A 2EJVA 3LHIA 1QO7A 1EM6A 5SYMA 4C3OB 4PYKA 1JHXA 1C0IA 1QPBA 3CVOA 4MLZA 4P98A 4WNYA 4BDTA 4XD7A 4FGLA 2VH5R 2GB4A 4MK4A 4EAQA 2AEFA 1IJBA 3FMIA 3NQ41 3IP9A 3ZQJA 1XQ9A 2IW1A 2I7CA 1QQBA 2Q4TA 4D43A 2FSIA 2OL4A 2RGCA 1N1MA 2R0QC 1NNUA 1RRMA 1O95D 3E70C 2LIPA 4ER7A 4LMBA 3H1EA 4HNSA 2E9SA 4TTVA 2BHRA 4F92B 1C41A 2UUPA 4PX5A 1W4RA 3EFEA 1H0SA 3TIFA 1EUCA 3MQFA 4B34A 4KUGA 2XTZA 1E4EB 5T57A 5JCOC 1QIEA 4KVZA 4C0KA 3PXEA 3RS7A 4GKVA 2Q3EA 5FI3A 1ECFA 1Z5VA 2AXEA 2BJWA 1JEYA 3OJCA 4LWOA 1UMDB 5C8YB 4DLKA 2F1IA 3TRKA 5AW3A 1SXPA 4QQRA 4NRDA 4CV1A 1RE1A 2OFOA 3FNEA 2D00A 1FSPA 5L3SA 2PL5A 4TXLA 1EINA 3M9XA 3E1GA 3LL4A 4KR3A 1QE0A 2IEAA 2P2CA 2GEUA 4G09A 5CT6A 4JBIA 2BFBA 4RULA 4I9GA 3VNQA 4YFVA 4FOTA 1R3DA 1FLVA 3WBJA 3RYCA 1R2QA 2BUCA 2R4UA 1ATZA 1ELOA 1R10A 2Z1NA 3F49S 3Q2IA 4UBLA 4IHJF 1WV1A 5LKRA 2FN9A 1K6MA 2BW0A 3IQEA 3OZEA 4ETWA 3K9BA 3MTEA 1SU4A 5ADVA 2H4FA 5ALEA 2ERXA 5BYAA 1RYMA 1JAYA 1DZ3A 3IP3A 3K0CC 5FFMA 3R9KA 4BP1A 4HQRA 4EL0A 1WHSB 5SZJA 4A8JB 2IOQA 4R51A 2PFKA 2GSDA 3TCNA 2XWSA 2QE7A 3QEJA 2TYSB 2GA9A 4BFWA 4IDCA 4H4CA 2PRZA 3OPQA 4L57A 2Z6VA 3TW4A 3DH0A 4X6UA 1T8YA 4XGKA 1AKVA 1YS4A 1EH5A 1KU6A 2D8AA 4DBLE 4Y2RA 1TFRA 1G59A 5AJUA 2OKCA 2A57A 3SOPA 3JPWA 1LDYA 3PFWO 3EHDA 1UDBA 2CEAA 4AX8A 1XRSB 4KG7A 1NPYA 3M1YA 2YY6A 4P22A 2ONJA 4BO6A 4E07A 3EPRA 4IJMA 4DOMA 2P9JA 3LDUA 3WICA 5BPFA 1SXJE 5I4IA 3U5ZB 1WDKA 3A6KA 4R01A 4GC9A 2EFEB 5CJ2A 4ZYXA 4F1KA 1RBYA 1V6CA 4BGVA 1EIZA 3UG6A 3FSEA 5BOSA 1FDTA 2CHUA 3NDIA 1Z62A 4HI0E 4WKGA 4XWAA 4A82A 4D9FA 2ZG6A 3A1FA 5KTMA 3CRVA 1T4MA 3N2LA 1ZRSA 3EFBA 4G25A 4P4UA 2C98A 5DZSA 1ILEA 4ILEA 2PL3A 1Z4LA 5E3IA 4AW9A 3ETGA 4ZZIA 3WB0A 2C83A 3KOXA 3PQ3A 3KKLA 5KWSA 1P1RA 5IHPA 4FYKA 2PMBA 3SX0A 4MRAA 5F7OA 1WPGA 2WOOA 4ZALA 1IPFA 1B0ZA 2C9YA 1KP2A 4WECA 3MAGA 1F0YA 4KNVA 5AIAA 1U0SY 4KYTA 3N6RA 5JE8A 3NP9A 4PYOA 2VL7A 4OJMX 1U8TA 2V7UA 3VU8A 1GZ4A 1TQ6A 2RKOA 1CUUA 1FTQA 5HS6A 2A5GA 3EJ6A 3JVVA 3JQDA 3VO2A 1MO5A 1IBSA 2I2DA 3NRCA 2ZU6A 4NJMA 4QDUA 4QRHA 3ZX5A 4HMQA 4WIAA 4HZUB 4IINA 4JKOA 1O9BA 4JDPA 2AXQA 3B51X 1Z7YA 1BWSA 1MV8A 3UHAA 3AUKA 3W5IA 4KX5A 2XVYA 3QVKA 4ZXFA 3R7SA 1A27A 2HJVA 1GA4A 4B3IA 1YS2X 1L7DA 3GDHA 2BZ0A 3PX3A 1BKYA 1TF5A 2I3BA 4R1OA 1S3IA 4PNPA 4OXRA 4PSVA 1QORA 2HCBA 2WF6A 4FC7A 4RQBA 4ATNA 1N77A 2XBMA 3U7EB 3E22B 5IBPA 5JSQA 4PQRA 4F6CA 3PB3A 1JPUA 3UOGA 3ES9A 2DFLA 4UEWA 5CIWA 4PQEA 2PTHA 4LFBB 1GGJA 1UBMS 3QVVA 5JJKA 3TQQA 5CLJA 1IN6A 3EDMA 4CTNA 4JLMA 3GHYA 1Z0IA 3P20A 4AJ4A 4ZEMA 3H5NA 4OFBA 4URVR 3ZE8A 3E9DA 3JQ8B 5FAXA 4KE7A 3WI7A 5I45A 1X7YA 4PGAA 1PWZA 1Q11A 2JDIA 4XJTA 5AJTA 1YCDA 4YLEA 2VK2A 2FR0A 3JQBC 4P3OA 3LYHA 2R1VA 3T7JA 5L4NA 2IDKA 3N59A 3RIGA 4HAUA 2O0MA 5ALOA 5JYBA 2HCFA 4N0QA 4MR9A 1DBIA 3DWEX 4GP7A 3URMA 2Z5GA 2NSHA 4OJTA 1JI3A 1GZ5A 2PV0A 4ZANA 2YC4C 3EIWA 2JHFA 1BA2A 2NGRA 3R0QA 4NBVA 3U3RA 2XE4A 3WIBA 2G88A 3DE7X 3ICQB 1TX4B 5HGJA 1OXBB 2J7KA 4UHFA 3ZXSA 2ZETA 3W0LB 4F1JA 3LLMA 4TV9B 2WU8A 2B4KA 5DCYA 2O2HA 3Q3JB 5CX1B 5LLDA 5AKGA 3PUYA 3D4NA 1KYXA 3OOSA 3DZFA 5FTNA 1L5NA 2WV7A 3I01M 4QOSA 4A9AA 3IHTA 1JHUA 4MXDA 4RVFA 4Z9YA 4RVCA 4PLGA 4NL4H 4TRMA 2H0AA 2REBA 1KC3A 4OL9A 4MMZB 3S3TA 1SBNE 3R3XA 7REQA 4ZQFA 4LJAA 5IG2A 1QWSA 1E9FA 1QVRA 4G1UC 4J0FA 1S8NA 2B0CA 2HNBA 2ZKLA 2QM7A 4WEQA 1TT7A 4I0WB 4O2AA 2LCFA 1EK6A 5LQUA 1K6JA 1MAWA 1Y8CA 3CRZA 3PK0A 2X0DA 3LW7A 2FZCA 5H1YA 3T0FA 2B37A 3OBIA 1GTRA 3ZCRA 1N36B 3RSZA 1J90A 3I37X 1R9MA 2O1EA 2WSBA 5AHXA 4PEVA 3VPCA 4FBLA 4PF1A 1YR8A 4LVNA 1PZGA 3AZPA 2ZULA 5BXYA 2X3YA 1HEYA 3ZI7A 3FWZA 1J00A 2AYXA 4K9QA 2QL6A 1KKLA 1X1BA 1W75A 1C1DB 2QL7A 5DHFA 3UFXB 2I91A 2UZAA 1UZMA 3X1WA 1GKYA 1EFVA 4KWEA 1MR3F 3VNBA 2R00A 4C0WA 4EF5A 1XJCA 4EY7A 1NWHA 1X6VA 2A1IA 2ANBA 5CB0A 2DCMA 2EERA 1I8TA 2BEJA 5EJEA 2Z6QA 1LS6A 1LC3A 1OLSB 1XUOA 1Q17A 3LY8A 2VK8A 3HFRA 5DK4A 4BO5A 1EU1A 2OZLB 2ZSDA 2HJRA 2Y67A 4KRGA 5AI8A 1X7WA 2Q3MA 1T9KA 3I8SA 5BNTA 2I4LA 3ENVA 4YRNA 4YV0A 5JY6A 4EW6A 1TVCA 3FY4A 3M34A 2C9CA 4AS2A 3OFKA 2ORVA 3SIPA 3TW8A 3TGPA 4NCAA 1HQDA 5B1HA 4K5QA 4S04A 4RTPA 4RJKA 1UOOA 1YH3A 1M75A 1C0EA 3GXOA 4K46A 1VE1A 2FFHA 2PM8A 3N75A 1P2FA 3CISA 4IIUA 2B3TA 1XFAA 3AXSA 1RM3A 3FPCA 4KAAA 1VCMA 2PYZA 1GNLA 3E48A 2X4LA 3H5TA 1X7GA 1JYSA 4S2EA 4RL6A 3WWDA 4B81A 2G36A 2PPVA 1L5OA 5DMHA 1E2LA 4TKUA 1XU7A 1VLMA 1N2JA 2EHDA 4YRKA 3I5YA 4I5DA 4QBKA 4ZYVA 1WMDA 2OO7A 5D3ZA 2BI7A 1GXSB 4GKBA 3ZCXA 4FINA 5IKOA 3KD3A 3IAEA 1KJ8A 3T3NA 1GQFA 1FRNA 2GI4A 2LR0A 3EGOA 3HR8A 3QELA 3D6HA 5DGTA 1IL0A 2R7AA 2RIRA 2NPFA 1VYTA 2WHPA 3VHXA 4CEJB 2FZWA 4Q6WA 1QHXA 4LI3X 4IDFA 3JQEA 1VFPA 1YZQA 3HYTA 4ONEA 4OHXA 3U7IA 1SGWA 4TZ6A 3FMPB 1U11A 1SUBA 1DTWA 3CG4A 1KE2A 3QNMA 1H65A 5A9RA 3KDPA 2XYPA 4M0MA 1SU7A 3ZBPA 5JSZB 1IQUA 4TQAA 3GJQA 1ZJZA 2GPNA 5B1YA 3UJPA 1L3CA 4A1FA 3DBLA 2ID4A 3L4BA 5JI3E 4UVEA 2H5JA 4HNGA 1V16B 4MPDA 4BL5A 3DE0X 1DEKA 3ULKA 4F9EA 3QKTA 4MQ4A 1RJFA 3BQ9A 5ALZA 1HO3A 2R8EA 1H3FA 1K6IA 2PZKA 3LXRA 4G84A 1EHCA 1VBNA 2PSFA 4L2IB 4TTQA 3V2HA 4BZZA 4DC0A 1HK7A 1KWKA 2G5GX 2JFWA 3VU9B 2PSDA 2W7TA 5FBZA 4KR7A 3RBAA 2PBFA 4OQLA 4Q3AA 5LP6B 1IFXA 1SC1A 2C0CA 3CX6A 3L2OB 4IYJA 1E7RA 1S3FA 1Q16A 4HD8A 4IOLA 3CW9A 1B73A 1PHPA 2IK8A 2QN6A 2TECE 1TVEA 4L3VA 3GH3A 3W3AD 5LQDA 3S40A 2O8CA 3YASA 2C07A 1DBWA 5IVDA 3A31A 4G6ZA 4G23A 1D6MA 3DBLB 2E6KA 2M6SA 2QUHA 3O91A 4L8GA 4CMBA 1MJGA 4QTZA 5IAEA 3OZSA 4TMVA 1R0ZA 1JZSA 1YR9A 5CVEA 2WMNB 1OLXB 4IMJB 4B84A 4DIMA 2V0CA 4ZZ0A 2L2QA 4JHXA 4QOFA 5GONF 2PCJA 2OBXA 2HY7A 4TQUS 2XHEA 4L5IA 5IBRA 1BWQA 3HVRA 3FXAA 5FTMA 3USZA 3WGMA 3LQ4A 3DFKA 1HE1C 1SNYA 1QCCA 4M1KA 4XGIA 4D2IA 4CEJA 2WIKA 4Y9SA 5H02A 2EW2A 3ORFA 2H1SA 3KQNA 4IOMA 1GQ2A 3UWKA 2VP6A 4LX8A 1U4OA 4I1YA 4L8WB 3RREA 1GXSA 4MAFA 3TAXA 3F90A 4IQFA 3JYHA 4YALA 4BUZA 3O0DA 1LI5A 2VUHB 3PWSA 4CL2A 1XNQB 4O2BF 4FEEA 1U7OA 2ONZA 4BP9A 1QR2A 5BVGA 1X0VA 5BYJA 4EW3A 3A70A 5ALFA 3W7BA 4F45A 2C7BA 3UWMA 2FB9A 2MIIA 4L08A 3UC9A 1WOYA 3UKOA 2E4AA 3CX8A 2JEZA 4Y1GA 1LLFA 3VR6D 1WUIS 1E5XA 2B1IA 3E9MA 5ENDA 3CNNA 1JEDA 3WQBA 3AETA 2OCIA 3OMWA 1RXWA 1Q83A 2OFPA 5AOAA 3WFJA 2HHAA 2B9VA 1YV9A 3TCKA 2J9FA 2FFAA 1AQNA 1UXHA 3EEQA 4JN6B 1N9GA 4IVRA 1QZTA 3ZD9A 3GD7A 5K20A 1NQAO 2F3PA 2LKCA 2O2SA 2OB1A 4GC5A 5EJFA 3AI2A 4PC1A 3TSOA 3ZV7A 4JCCA 3U17A 4PCUA 4EECA 3C5VA 3CEJA 1A9XA 2HPHA 4EPVA 2B94A 5L3QB 1ZN2A 1X15A 1SO8A 4G4SO 1A4XA 2QB5A 4CW7A 5ITZB 6REQB 2OCAA 4D3SA 1CJBA 4FS8A 4OXQA 5EYPA 4TT8A 5FOWA 3HO6A 1KAHA 3NC4A 1E96A 2AA3A 4Z9BA 3EPPA 5FBWB 2QLFA 1I7SB 5LJLA 3CA8A 4AJNA 1YZNA 2ASEA 4S0XA 4NE9A 2AB0A 5CHYA 1CD5A 1NU8A 1OVGA 4BY9E 3FPBA 3DZCA 4MB2A 3P9KA 4IS3A 1J0AA 2X0EA 4D25A 3T7RA 1MO3A 1M74A 1Z7EA 4EYOA 1Y4DE 5KSOA 4QYIB 2AFIE 3T34A 4F38A 1JR2A 1P0FA 3RK0A 2CHVA 4B82A 2I4IA 2O3UA 2ZTHA 3ZI4A 2EP5A 4MQFA 1N6OA 3A0RB 1EJ0A 2XMPA 4LRUA 4LVCA 3ZE7A 4BNWA 3NFRA 4AKEA 3PDHA 1AZLA 1IRXA 1J7JA 2YVAA 1UC4B 4L7QA 4QPZA 5EJMA 3PEWA 4BBPA 2EZTA 2GBFA 4BO2A 3T99A 2W8BB 1L7QA 4DT1B 1QG4A 1Z4IA 4X63A 4G0WA 2P9YA 5CA1F 1CHDA 5JANA 1QIHA 4D99A 4R0VA 1YVEI 2DUUA 2QXYA 1EFHA 3GPIA 3THOA 5C5DA 5IMSA 1VYUA 2CJPA 5JH7A 2ZRQA 4RHCA 5D86A 1I5EA 1YI1A 1DIAA 1YVUA 2N46A 1ZRHA 3LH5A 4IZHA 4EGJA 2OAP1 4K28A 1KI8A 2ZDHA 2C8JA 4HFMA 4ZRNA 2YNMD 4B0PA 1VLLA 1PLLA 2PHZA 3OQMA 4LJ8A 2DY1A 1JG1A 3FRJA 1J1IA 3IURA 4CVNA 5KNCA 3H18A 1X1QA 1WA5A 2GDZA 2PS0A 2YZNA 4GQBA 4WLOA 1RAGA 5AM5A 3ZW7A 1BMFA 4XEUA 4H1WA 3LOUA 1N57A 1XJWA 4XAQA 4Z1MA 1EESA 4JLBA 3N2GA 5DULA 4HN9A 5AHOA 3R9XA 1A8HA 1KSHA 1VRWA 2DFKB 1TQ4A 2L0XA 3KDSE 4AUNA 4E09A 4YP6A 2BUAA 1F7UA 1Y5LA 3E3OA 3FCAA 3EWAA 2I4OA 3DPSA 4IWNA 5EUCA 2P5SA 2YHSA 4KZKA 4GS5A 2OOKA 3B9QA 3EFHA 5ELMA 1X38A 3FYHA 2ZQYA 1VRCA 4RIFA 2CL6X 2JJ2D 3NHAA 1PGPA 1X1RA 3LRXA 4RXUA 1HUQA 1Z2DA 1X0XA 2Q5OA 1VB5A 4MQBA 1G5IA 1IBRA 2JLCA 4BMCA 4PR0A 1Z2CA 5L7YA 3BKWA 5THQA 4ZYLA 3L05A 5I9MA 3NEPX 4EY3A 2J1LA 1C5KA 4RPLA 5I8WA 2CB0A 3UK1A 2E4ZA 2Z08A 2XIJA 2QN3A 2YV5A 1C30B 2R8OA 4FYMA 1II8B 4MIEA 4LF9B 4WVFA 1XZKA 3JQGB 4NEGA 3PDCA 1DIBA 3VR2A 3LCVB 3RUDA 1Q14A 2XEXA 5K8UA 4GX1A 3AVYA 5LIRA 4JP1A 4X24A 3T94A 4IOJA 1MQSA 1U80A 2WAYA 1A7AA 1OXXK 1E1YA 3IELA 3RRNA 3H83A 2Y68A 1XO1A 3T3OA 3Q3VA 2CWWA 3NV9A 2HZ7A 1ABBA 2A9FA 2ZSUA 4LHZA 2IY9A 3CE9A 1EBUA 4ICIA 1YZUA 3TIIA 3U0BA 5HQTA 4E32A 1Y3FE 4GH5A 3SSMA 3CE6A 2WJIA 3V6MA 3COWA 4PZEA 3S2FA 3T3DA 3UW3A 3QUBA 4PLHA 3THXA 4DLAA 2BMVA 4D6PA 5DIFA 2GMWA 4US1R 3TTYA 4BV8A 2CDAA 1UL1X 3ABOB 4KX3A 1TCAA 4ID9A 2FHSA 1NP7A 2FZ5A 3C3JA 5DHSA 2YIVX 5BY2A 3LBIA 4UE3S 1T25A 4FE4A 3WSVA 2ECPA 2RDMA 3Q7IA 2BGGA 3ELWA 1KQGA 1P0CA 3GBVA 4Q21A 5G3ZA 3VR5H 3DS8A 1YDMA 2B8NA 4PGHA 5A71A 1XMIA 2W2KA 4M8KA 1IXKA 4CL8A 4MMXB 5AKYA 3VISA 1VSTA 5I7UA 4MHTA 2WD8A 1WULS 4P9NA 3HA2A 4GOMD 4Q15A 4C2TA 4NNPA 5H9VA 2X0NA 1H85A 1A5AB 2GASA 1UXOA 1XWWA 2J5KA 1EWVA 3F73A 4AO8A 1IPEA 2PGIA 1JQ3A 4UEKA 2VSOA 2Q2OA 3GI1A 4KJZA 1E6KA 4V38A 4DG5A 5F4BA 2NO0A 3BRCA 4H7HA 3HJGA 3LG2A 5FBVB 3EE6A 2AOUA 1SUCA 1XKXA 1CUFA 1W4LA 3ROQA 4AJ1A 3AEUB 4MI1A 3ZHQA 4JMPA 4BKQA 1UBRS 1ZI8A 3DCNA 1VPLA 1WE2A 4QUGA 3FOZA 3SZUA 3DL4A 1TJNA 5FTJA 2NG1A 5HBRA 1V8PA 3FTPA 4HC4A 4DEVA 4QULA 4X8MA 5K0GA 5J4LA 1OMOA 2WLTA 3A1VA 2AG6A 4RSGA 5EZYF 4D1YA 2QTTA 2QOEA 3NBAA 3BCSA 1Y4AE 2H07A 2REQB 3G0CA 1GEGA 2QUIA 4FXPA 1OAAA 2YXDA 4MQFB 3N6XA 4V0OA 3TL2A 2D7JA 4N0PA 2UZ1A 1DTSA 1A9OA 2CDCA 1YR3A 3SS9X 3EZLA 4F71A 4W7SA 3AR4A 3B7WA 3ZWBA 4Z7QB 1EFAA 4ED9A 1OOEA 4RGYA 1NV9A 1FDVA 3AGPA 2C0QA 4ARZB 3R6WA 1JA0A 2AK3A 1LK7A 1H5NA 3T3GA 4EJ0A 2WJVA 4FDVA 1KTVA 1CIJA 1PQ4A 2HREA 3BBPA 4DMMA 1KEKA 3B85A 1NURA 1BGWA 1XDZA 2AXNA 4JJEA 4U7FA 4ABTA 4LDJA 1FSGA 2BUBA 2I4TA 1EA5A 3A6EA 1QTIA 3B2EA 5EYPB 1Y7HA 5F35A 3PE3A 3QHAA 2M6RA 4L02A 2UV8A 5EP4A 4DMKA 1NVXQ 1YFKA 4CKCB 2AZMA 3QOFA 4KCGA 1MO6A 1H6AA 1TZCA 5TXGA 2CXNA 5L3QA 3FTQA 5I7EA 1D6JA 4G86A 2WE8A 3WRWA 1PX0A 4AMZA 4J0KA 5FBLB 3UC5A 3CXRA 4FR2A 1ZU5A 4NCHA 2CLDX 2H9IA 2VHVA 2ZBGA 3ASYA 3C6QA 1ESZA 1KNXA 2IYVA 1PNTA 2OY0A 2IHJA 1QPGA 2KW5A 4DCUA 1RHKA 4XUDA 2DETA 2NP6A 1DC3A 2O7VA 2CUKA 1PJCA 4B3CA 2P1RA 4DDKA 2QPLA 5LC1A 3MLBA 1L5MA 2LNDA 2ZIVB 3QKSB 3CW2A 1KSJA 1Q44A 1X9HA 4YUWA 2M6KA 5L6MB 4RV4A 3QGMA 3EPJA 1NGSA 5DBIA 2K6GA 4DHWA 2OSBA 1CF9A 2CMKA 4NV3A 4CIDA 4CM3A 2IKQA 1RLOA 1WUTA 3Q2OA 1ULZA 2CLLB 2IUYA 3PR2B 4N6OA 3LZCA 3NYRA 5LOVA 4KO4S 3EQ7A 3W5AA 1JJFA 4P0PB 2IYOA 4QNRA 5DH9A 4NARA 6Q21A 1EAMA 5K0TA 3GVCA 4C01A 1TZBA 1V8DA 2IS4A 1NBIA 2AEMA 2PKEA 4EYSA 5CBKA 5HIAA 1IZ0A 3GAZA 4Z99A 3UUFA 1IHPA 1YSCA 3EGDA 5KINB 2LDXA 2H16A 4U7TB 3TLBA 4DQDA 4MR8B 1T9BA 2WI8A 5ALMA 4FWBA 1E9RA 1D2NA 1NM5A 3JZFA 1CSEE 5CLIA 4EATA 1L7EA 4MWDA 3EVCA 4P32A 3QFRA 4XD2A 1ID8A 3G7NA 1WVIA 2BHSA 4MDYA 4RSRA 1VCNA 2JCBA 4RZ3A 3RVLA 4E13A 2YIJA 1CZKA 1PGJA 4HB2A 4LEIA 5LA6F 1MAHA 1N5MA 4YJ2B 1T1GA 2OTCA 3KSMA 4MIKA 4OFZA 4CMJA 2VQFB 3K2EA 1JPNA 3K8OE 1JVNA 1M6YA 1SHZA 1E2MA 2HLNA 3FI0A 2W2MA 2WFZA 1E1MA 1J9ZA 1NU6A 1XNGA 2P4HX 4D45A 5AKKA 2P7HA 2G1AA 3LHDA 4MRMB 4Q37A 3GGGA 3PFCA 2C03A 3GJ3A 3CCCA 4FQ7A 3UBMA 1G18A 3A4LA 3DOIA 3F6EX 5DM70 2ZUEA 1V43A 1C0LA 1P2UA 4BTLA 5LZ4A 2KLBA 3NGLA 2OV4A 4TOIA 3WO0A 1NVFA 2Z2ZA 4ZQBA 3GT4A 1B1CA 4RTLA 1SKQA 3AU9A 2W98A 5IDWA 3AUYA 4IJUA 2VJYA 5JTUA 4L5YA 4LF4B 4U2DA 1OROA 1VL2A 4RF5A 4GMGA 4EA8A 1QOQB 2Z56A 1OBCA 1MX3A 3CIOA 4H31A 4KAXA 3LO5A 1RQNA 2QX4A 1JEQB 3ZGLA 5CAEB 1V7QA 2CLKB 4C4YA 4Y9UA 2ZSHA 2AKEA 4K05A 1CDEA 4OAQA 1T5OA 2R2GA 2VXOA 3PGKA 4UNIA 1TEZA 4EGCB 5C7YA 2X9VA 4QA9A 3U7RA 1IZZA 3A05A 5A06A 3W34A 2E85A 2VJMA 3QQPA 4HH4A 4RK0A 5B2EA 2PWPA 2ZI6A 4DBVO 3HDQA 1JWLA 2VHCA 2HWKA 4JYCA 4NEQA 3O47A 4P4GA 3IR6A 4Z8XA 1NDQA 2H06A 3RYHB 2WWXA 2XUZA 2DUWA 3KAKA 2OFXA 3KYBA 1FDRA 1YFZA 2M1ZA 1SUDA 4HB3A 3FCEA 3EZYA 5JMOA 5K8LA 3ZCQA 5HS4A 1LRKA 1AHPA 2IPXA 2IBMA 2OBLA 3RJ9A 3VO8A 4RHEA 5HJ7A 2A5LA 5HCUA 2P4QA 3LHSA 4PLTA 1W1IA 2PJDA 2HPAA 3FDZB 1EE9A 3EZFA 3K6KA 2Q6LA 4P86A 5ADUS 1YDHA 1WPXA 2O3SA 4KRYA 4MS1A 5LQKA 3BMNB 1KPHA 2PMKA 1XMSA 4XQ9A 5K6TA 4YRRA 4QXPA 1L7NA 2IEBA 1USVA 1I94B 3N70A 1C14A 2LCIA 4G67A 1AZSC 1T15A 4OFWA 5AOCA 4CM8B 1KQFA 3M81A 3UK7A 3ZXYA 1H1TA 4G0VA 4XW2A 3LYUA 3QLEA 2BGUA 3EVFA 5ALNA 1T8SA 2V54A 5EXTA 2X5JO 1Q5PA 2EL9A 4WXHA 3WLLA 3F8SA 3UXHA 1KHTA 1V9SA 2C2WA 1V3TA 3G5UA 1SCIA 2Y1EA 3VPHA 2PZAA 3HJRA 2X0IA 5KDLA 2CLIB 1YR1A 5C5IA 2RG7A 4JUCA 1PWYE 3BTUA 4B6RA 3QNWA 1TU4A 2X2EA 5F3RA 5LXTA 1V8ZA 1R5NA 2BEUB 4RF2A 3FIJA 1NVGA 1GNRA 2XB6A 5F23A 1JAXA 4YCNA 1M2HA 4TV8A 1RT9A 3WLQA 4EB6B 4YJGB 3PCRB 3QTTA 3FR8A 5DEIA 3T3HA 4XVQA 3FTFA 3UK6A 3AUUA 4D6YA 4HYQA 4UDXX 1EGAA 4M3NA 3A7DA 4PXSA 2G04A 3RUAA 5EI5A 4C4SA 1IN7A 1DAFA 1JR4A 1DEOA 2WWFA 1RCFA 4J7UA 1VFNA 5CDYA 5TMPA 4YCJA 4ND3A 2XXBA 2RHDA 1YVDA 3R9IA 1AGRA 2QP9X 4CM8A 5C18A 1ZG3A 2H00A 4U7DA 1FX0B 4KN8A 3HY6A 4JYZA 1ZJ4A 2IZ5A 4Y2QA 1XHEA 3N2YA 2ZIUB 3NM6B 1IJEA 3DVAA 1H1DA 3P52A 1N6KA 3FBGA 1E2PA 2ZOSA 3DDHA 2WSMA 3N39C 3QE4A 3UCXA 2I7VA 3GU3A 3G8DA 4KQHA 4O2LA 1IY1A 1F3LA 4WEOA 3Q6NA 3R3UA 4NK5A 4UEOA 3ZXUB 4OO3A 5AVRA 5BMVF 2AMYA 3HXMA 2HEGA 3M5PA 3UV7A 7REQB 3QU9A 1CUEA 1IUNA 1FBNA 2RGNC 3G3EA 3Q41A 4ZO9A 1XJ5A 3R5SA 3P71T 3HU5A 2PX8A 4G1FA 4QHYA 1F0KA 3QVGA 5G53C 3QKRB 4W5NA 3S81A 1K97A 2Z4TA 4LTDA 1TMYA 1O0CA 3D4BA 3PFBA 4D46A 3RUIA 3OQOA 4MKGA 1K7EB 1CB7A 1U0NA 2QQGA 3DQQA 3RLFA 2CXPA 4GUDA 1QQ5A 1AKQA 2OBYA 2P68A 4ND7A 2I55A 2VTVA 3DDSA 1OREA 2JAUA 2DBRA 5IW8A 4QYTA 3VPFA 4EUKA 2W11A 3CINA 2H5IA 2I2XB 3QHPA 1YA8A 4P38A 2EQ5A 2ZJ0A 5AVZA 5K51A 4DLWA 2Q0SA 1Q84A 4LJ6A 2Q28A 3MWDB 5LQJA 1JI0A 1P80A 1WUHS 5DGCA 3BQNB 4FGZA 5A1JA 3LUGA 5AD1A 1FVHA 2PFSA 3K31A 2P9CA 4DR7B 4TMTA 2MR5A 2IHVA 5DTQA 2O8VA 3K1TA 1Y0BA 4WLNA 3RYIB 4UZSA 4C0LA 4YRPA 4ALMA 5IT5A 3OEHD 1U3VA 3O5AA 4LV6A 4ASUD 5THKA 3FWPA 4YAKA 3P7MA 4U2FA 3M82A 5F2KA 3WNDA 3TX2A 5DKFA 3BFVA 4YAOA 1Y6QA 3TRJA 3ETNA 3T61A 1Q0HA 4RY8A 4G26A 3UB4A 1EX7A 1BFKA 3EXEB 3OKFA 4OXIA 1QC5A 3EVZA 2CDBA 4XB2A 3U4IA 1YRHA 3FPFA 4AY5A 5HRCA 3IULA 3WDLA 1PZXA 1T5HX 5SY9A 4D9KA 3BBLA 3HABA 3COVA 4DJEC 3D3WA 4YJ2F 1Z07A 1CVRA 3EIQA 4HGZA 5HPYB 2VJBA 1Y37A 4YR7A 3G8BA 1PR5A 3ZG6A 1LW6E 3L79A 1J5PA 4W1SA 1MD9A 2ZWVA 2P69A 1KO8A 3STWA 5JSZA 1JXQA 1AO0A 1YO6A 2C2GA 1O5IA 3FMOB 4JASB 3UA3A 3OFSA 3PKIA 2A58A 3DNFA 4H3HB 1TCBA 1JHDA 3U4QA 2YH2A 1GUFA 2ZK7A 1XWFA 4NJMB 2HA3A 4JOBA 4U7PB 3HK2A 2X77A 2Z2KA 1Y33E 2N3ZA 5AM4A 2WZCA 3VNUA 5REQA 2VC2B 5I5EA 5K03A 4MRSA 2WHPB 3KQLA 1Q1BA 1ZHFA 3FNRA 4EKGA 2IXEA 4XFDA 3ZY5A 2JFFA 4OLAA 1YB7A 2XCUA 4ZMBA 3U60B 1LLQA 4TUYA 1N2BA 2C5LA 1KMHA 1SUSA 2ZRKA 3RSHA 5IFKA 1M2NA 1PR4A 1QG0A 3QI2A 5ALGA 1FS6A 3FOAA 3GJ0A 3OX3A 3WGVA 3U6KA 4FUTA 3MJTA 4HATA 3U3KA 1ZBDA 2HXSA 2FNAA 3L46A 3WLPA 4OHBA 2VG8A 1PCXA 2K4MA 3KK0A 4RLQA 4GU5A 1LTHR 1ODJA 2GVZC 2R11A 3DEZA 3EVAA 4AZSA 2EVWX 4WGGA 3V1NA 1ICEA 1QJ4A 4BV2A 5KQMA 4P3YA 1CC1S 1IEQA 1NTOA 3BH6A 3EIOA 4PAGA 3ZHSA 1RYBA 3I0NA 4L51A 4EOGA 2WUGA 1JDPA 1XEFA 3WA6A 1JTFA 3ADDA 4J7AA 2QTCA 3D3NA 2FR8A 3GLVA 1P19A 4ZI7F 1KBQA 1QGOA 2POCA 2QD3A 4MROA 1LVHA 3SXJA 1ONOA 3C5WP 2AJDA 2YFHA 3DE2X 1M5TA 4YAEA 4CMEA 2O9JA 2OZVA 1T6YA 4MVCA 1APBA 4YONB 3SQLA 2R6R1 2GBCA 1FL9A 3KBBA 1KTIA 1KQOA 1R6DA 2V58A 3PFIA 1XCGB 4IIGA 4M6WA 4CNQA 1F48A 3KZKA 1OAOC 5IT4A 5LU9A 1UKYA 1MGOA 3GOHA 3HCWA 1RZRA 4MQLA 2PKWA 3NIBA 3VZCA 1Y8RB 2YFYA 1Z0SA 3EF3A 3UAXA 1ZK3A 2OILA 1INLA 3OM8A 2B1JA 4Z0PA 3E27A 3C3MA 3R3VA 3I6BA 1NX9A 2IJGX 5KOHA 3JD0A 1E62A 1J24A 3THYB 3WLOA 5EMKA 4O63O 2BFBB 2PJRA 3SBEA 3IUMA 1G41A 4HDCA 1MC8A 3R0XA 5EHGA 3VPDA 1QH1B 3TLGA 1WS6A 3CPEA 1DAOA 1ZIYA 3O2JA 2EL7A 4RABA 2CNWD 1CY0A 1BMDA 2IXBA 5C8YA 2UU9B 4QAQA 3CC8A 4F3YA 4G9EA 1NRJB 3AHCA 2Q5HA 3A9RA 2D5IA 2O20A 2X7HA 2O52A 3REFA 1F8GA 2A7QA 5KTNA 4E15A 5BN5A 1RPAA 2HHLA 2QTMA 4Y6SA 5G0WA 1UANA 1TOAA 4Z0HO 2FV8A 1NF3A 3FFTA 3H0KA 2BYTA 5TNXA 4QBHA 6YASA 5JXGA 2Q50A 1FUKA 4NFSA 5U9CA 5JHGB 3KXPA 4MB0A 4RL4A 4QVIA 3G2KA 4KXXA 4E3ZA 2QN7A 3SHFA 5CRIA 2Y2VA 4IFIA 1Z22A 2BI8A 2JLVA 5J2UB 4R3NA 4Q9LA 1H93A 3H0CA 2DQZA 3CN7A 1T26A 2BFEB 1EPUA 1J21A 3FCOA 3OD5A 5GZ6A 3U7QB 2BHTA 4KAFA 1ZC4A 4LOLA 3MJCA 3R09A 3F6BX 3B48A 5FYQA 1LS1A 3HFGA 2YOHA 1ID1A 1YWGO 4N0EA 5JCXA 4QJ5A 3RS8A 3AJDA 3K5IA 4Z7JA 5HK8A 3NDBB 2WYVA 3AR8A 5IUJC 5JV5A 1MJGM 1PFUA 2H2FA 4I4IA 3TKAA 2JGMA 3PEFA 2HD4A 1GRVA 4QBGB 3CUUA 2J9XB 1YL6A 1CPYA 2IY8A 2JASA 2VF7A 2YXEA 2P6MA 1WXFA 3PRJA 1J8DA 3PVSA 4JGBA 1HF3A 4BLTA 1MT0A 3PUIA 1MH9A 4AY2A 3ROMA 5DOZA 1TECE 1SQGA 3CO5A 3GEMA 3FPAA 2C9MA 3NU1A 1ADCA 4QTXA 1T6XA 4L73A 5AVWA 2QRHA 3F6PA 3JQ6A 1CF4A 2XF2A 3L0OA 2P2NA 2ZYUX 4C03A 1HZZC 2OR3A 2I6FA 4M1OA 3QBVA 5KHLB 3D7SA 4TLBA 2H0QA 1QIKA 1DL5A 1WZNA 3I4CA 3AY6A 3FHOA 3N6VA 3RABA 3IX7A 1X7ZB 5E0KB 3V46A 3VYVA 4QM7A 3C6BA 3MN1A 2Q2NA 3ACDA 1LW7A 2FG5A 4XPIA 3T1VA 1V39A 3NWOA 3F7NA 2QS9A 3HN7A 1O97D 4KAJA 5FQOA 3VVMA 5DISB 1II8A 3O1JC 1GAXA 2WWWA 2D8MA 4DLUA 5AQ1A 1O95A 3BGIA 4Y0AA 1RXVA 1AJEA 1ZCBA 3P9SA 4L15A 1WEKA 3OCCA 2C9OA 2BEVB 5TR9A 2WSSD 2FPGB 2OCXA 2HMWA 1QS0A 2ZKIA 3EDOA 4K8OA 4PLZA 3MJ4A 2C5FA 3Q5DA 3ONFA 4O4IA 2KLHA 4UBKA 5LB4A 3TZHA 4D97A 1RW4A 1T9CA 5CVCA 4MMYB 5EKTA 4DQUA 2ENUA 2H7VA 3KPVA 3PFKA 1ZCAA 1A3CA 4DE5A 2AXPA 3UJ6A 3Q98A 1MW9X 1SZJG 1KYZA 4XR9A 2ZRPA 5LP6C 3DJFA 4C43A 4Z6KA 5JQGB 4MDEA 3KLBA 1NSYA 4QTUB 3B1VA 4R3UC 3O75A 1MU0A 2OWEA 3GL9A 1JU3A 4TTAA 5JISA 3RADC 2H1RA 5DHUA 1YCGA 1Y7IA 3JR7A 3LJKA 1IK6A 3ZVLA 4E2YA 4JLPA 4S1TA 1F4PA 3RC3A 2A9OA 4GKKB 4R8RA 2I1LA 2FEMA 2WWHA 4B80A 3KLOA 4F0JA 4AG3A 2AZDA 4IL5A 5DP1A 5C0OE 3WSTA 1F9EA 2QQFA 1OSNA 3K1AB 3D0RA 4WDQA 2ZS9A 4O8ZA 1ZOSA 2N42A 4DPLA 3LX8A 4LF8B 1K75A 1ZKMA 3D7KA 2W93A 3OJWA 1Y5NA 4CF3A 2QTGA 4PZLA 5IAOA 3DTVB 1SWVA 4WY5A 2QZ4A 2J6CA 3DDNA 2F8TA 3ZHXA 2G4CA 1J5EB 2FSUA 3A9VA 3MF4A 5DU2A 4B9AA 3OOHA 2JATA 1A5TA 4DGQA 3HEBA 3CJRA 3UMSA 4ARCA 1DFGA 1IQPA 1L4LA 1L4GA 1NSTA 1KRXA 1Y98A 4BU0A 3GLSA 4HRXA 1DB3A 4OQMA 1TM7E 1MO4A 4CM1A 4CF5A 5CB6A 3RSQA 3BSFA 5ENZA 3LGSA 4EFNA 2G5CA 3FYCA 1F20A 4KQXA 2FPSA 2XUDA 1FU4A 5ELXA 3PG5A 1EG7A 3SMVA 4G1BA 1B6GA 4EPTA 3U9SA 1F1JA 4DJJA 1VJ5A 4PFQA 4KLRA 2GZMA 1BQ3A 1IB6A 2A5DA 4Y7DA 3THWA 1XMPA 1DAEA 3PC4A 2ZI3A 4JU9A 1EVKA 5AVJA 4DQVA 3IMEA 2B4QA 2XGOA 2Y2UA 2ZUSA 3NC1C 4K8RB 4LE2A 4QYMA 1WHTA 1Z6QA 3PPWA 3P0IA 2GKOA 2C4HA 2Z30A 3PNSA 4AG6A 4IUDS 3WS7A 3VPBA 4EG1A 3JAKA 1ODCA 5CT5A 2DJ5A 1REQA 2WJ3A 2R7LA 4H0NA 3WWCA 2X1VA 3CPSA 3JALB 1H6CA 2OCDA 4Q1DA 4C20A 1WHTB 1IZ8A 4GYWA 3C45A 4NMHA 3V1YA 3WGKA 1AKTA 3DBOB 3DFZA 4F9TA 3CZCA 2XXAB 1FUUA 2EW1A 4DMLA 3ZGOA 2JH8A 4JI0B 5J43A 3SZMA 2GYUA 1P4AA 1WD5A 2DYKA 3IVGA 1EDZA 4MKHA 1M0TA 3KQWA 3OKPA 2PX4A 2RHWA 4PIVA 3U4CA 4PYIA 3L4EA 2HRCA 1H0HA 1KJWA 1VMEA 1V1MA 5AVKA 1EDOA 1NW6A 3G49A 1J8YF 3PQ2A 3Q7QA 4R5HA 3WLHA 5CIQA 1J2JA 5IAKA 3GLHA 3KOMA 4JYMA 4EGQA 5EJ9A 5EHZA 3UJHA 1O08A 1N6NA 2WUVA 3RC8A 4B31A 1Z37A 4TRJA 4G8CA 2XE8A 1SFRA 3HCBA 3O4GA 3MWYW 1B8VA 3T52A 4YA6A 3OU2A 1JKJA 1JQEA 4AG5A 1HNXB 1N25A 4HPJB 1LF0A 2EARA 5BR4A 3OSZA 1MQ9A 1ICIA 2GD6A 4OB8A 1ORHA 4YAWA 1NN5A 2W2KB 1NBOA 4F3CA 3KL2A 1CUHA 1DDIA 1EFCA 1X8XA 2JRCA 1HE2A 1OTYA 2FZVA 1FTNA 1UBSB 3AI1A 1TO1E 1JG3A 2D0IA 2FEPA 3SR0A 4IF6A 1EBFA 2PKXA 3NH6A 3KZ1E 3E5MA 4RZSA 1T0PA 5DGHA 3CNLA 5CNJA 1IY0A 3TMYA 4PPYA 2HX1A 3M4XA 4LG1A 3V2UA 1T8RA 2GZDA 5FBHA 3L0SA 3IUYA 2UZ4A 1UXJA 2XYRA 1JSLA 4XCVA 1NKSA 3N0VA 2PMWB 3OX2A 1PUXA 2ZBRA 1GO2A 3B5IA 4RMJA 3T7IA 3O9VA 4TRNA 3RGWS 3L4JA 4KXUA 1L8QA 3WK7A 3DHNA 3ER8A 1V48A 2ZJ3A 3NWJA 3S55A 4A2PA 1MJ5A 1OZFA 1R0CA 4UREA 5G1NA 2APJA 1C7IA 2NPIA 1WETA 1KKUA 3K9GA 2ZUUA 1G6HA 1HSOA 1T3LA 2IITA 3I4LA 4OQZA 2RAFA 3NHRA 2JIQA 2W37A 1A4RA 1L4EA 2OQ2A 3A14A 1OLXA 3VZRA 1FNBA 4JENA 4UHJA 3TWOA 2B5WA 3QEMB 1AKYA 5AM2A 1CR2A 1ULSA 3GVIA 1Y8ZA 1T4CB 2OAGA 1GSAA 1VKZA 3PLRA 1PJ4A 2A3RA 4LYDA 1N78A 2EZ9A 2DF8A 5FQNA 2H3HA 1A77A 1TYAE 2FPMA 4B43A 5JBNA 4DLTA 1H9CA 1IDN1 5CLFA 1LV7A 1SZPA 1Y7LA 4KKXB 1BH2A 2RK3A 2WR8A 2AD5A 5GAJA 2ZJAA 1M2WA 4Y0VA 3EIXA 3DFUA 1NFRA 5UKDA 1CS0B 1NZDA 2D5CA 2AG8A 1I5RA 4OSOA 3W90A 1X42A 4B6OA 3RVSA 1M6NA 2PU5A 4JEMA 4UTNA 3QKWA 4F5WA 4X9XA 3D4OA 1GPNA 2J59A 1DXOA 2AEJA 1FZQA 1RVDA 5JD5A 2WJGA 1O8CA 1G291 5JLJA 3SZ3A 2NO7A 2P4SA 1BQ4A 3DF9A 5JDIC 3ODGA 3OEWA 4D4KA 3QMVA 1JB1A 1N3LA 2Q8QA 3BD9A 4HPXB 3VPSA 4EDFA 4EG7A 4CLHA 3HUUA 4M21A 5IULC 3BGOS 2G06A 3BN3A 1SUIA 2XEDA 3EYWA 2F43B 3TLCA 2Z2YA 3E2IA 3UMGA 4ZDWA 5C1OA 4FNGA 3KFLA 4MA0A 4PYQA 3K9LA 1EK2A 4DR4B 1K4YA 1E3MA 1H2ZA 3LYAA 4S1WA 5ADWA 5CCDA 1ZEMA 4C2UA 4EKIA 5FBRB 1VKNA 5AT1A 1XRPA 2XMBA 4D4GA 3MOSA 1AKEA 2DTEA 1SJ9A 1YNOA 3AFIA 3BVPA 4PLFA 1GNSA 4JQSA 2O8FA 4JT9A 2I2WA 1L5ZA 3GFGA 4TS3A 3VX3A 5IZ4A 3KZXA 5BN5B 4BQPA 4Z4EA 1NR7A 5ESXA 2QE6A 3Q15C 5JJLA 1Y1TA 1G21E 3I3OA 3UWOA 1IOVA 5K05A 3FYSA 2P2YA 3KUXA 2D5LA 3H5AA 5A4IS 4QSHA 4R16A 3RUCA 2R6GA 4EUHA 5HUJA 1CK4A 1RQ2A 3RTDA 1UP4A 4CDMA 3T7SA 3U19A 4W8HA 1HKUA 1QH1A 3VDQA 4KR9A 4K2AA 4BVEA 1G2PA 3D4IA 1XZGA 1IM8A 3GVHA 2V45A 2HIAA 4EG4A 1QVAA 3QF4A 4IVQA 1ZD5A 2UYYA 3P5BA 4UBNA 4UVGA 2GN1A 3T38A 3WYCA 4YMWA 2WWVD 1U2TA 5B3KA 1E4OA 3K0FB 1ZSNA 3FUCA 4FOOA 3ONEA 4D8WA 3VGJA 3KQVA 1Y80A 3EVNA 3NNNA 1ND6A 4EYGA 2ZVDA 5AW8A 4CFYA 2VRWA 1RAAA 3PKZA 4JUBA 3IP8A 5A3QA 1PT9A 1A0OA 1YC2A 1E94E 4J0GA 3NLLA 1NQXA 3P19A 4KIUA 1OXTA 5HRUA 4BTEA 3UJDA 5HKKA 4PHCA 5IZCA 1JG6A 3B7PA 3QUSA 4M86A 4PC2A 3OE1A 3LF2A 4F4UA 5TF4A 1KVTA 4Q3OA 4AWAA 1TMGE 4TYQA 3NP7A 5DDIP 2NTJA 3OI7A 3TF5A 3BE8A 3E0XA 4NCBA 2JGNA 4GAEA 1L5YA 4TGLA 2J33A 4UAVA 1YRAA 3ZWDA 1Y3IA 3EQ9A 3IOYA 3KHKA 2E82A 2HT1A 4XWTA 1HT1E 1U3CA 4JFAA 3FPLA 3R0VA 5JS7A 2C4TA 2G0NA 1L5QA 5DT9A 1H2BA 4OYLA 5IH7A 4KOAA 1K4KA 1QP8A 2TSYB 2OAEA 1BS2A 2FDRA 3KYJB 3PLNA 1DLJA 3Q87B 5EUMA 3CMMA 3SE7A 3UN1A 4U5XA 4Q3DA 3QLVA 3BGDA 1ECGA 4WK4B 2XCRB 1GZDA 4D9BA 4EUNA 3O8LA 1SY7A 1SXQA 2IHNA 1UT8A 4DNPA 3O93A 1S96A 1RC0A 4NBLA 1D9ZA 2QSJA 1XVAA 3W2GA 4YCAA 1SVNA 3NR2A 4Y2HA 1ZD3A 1TW3A 1GYQA 5TF0A 5I8PA 1NMYA 1EX9A 1VE3A 4GPZA 3C98A 4IILA 4KR0A 4FSXA 1G4AE 4XOUA 3NRJA 1RR6A 4RZUA 8ABPA 4WLVA 5IBQA 3LZ6A 2HSWA 4DRXB 5JROA 3MCAA 3PHHA 5LZ5A 4WAUA 1QE5A 4AB1A 4U8GA 1UBFA 2LUOA 1PEDA 1SA0B 3WSWA 5GM2A 1OAOA 1FFBA 2OB2A 3KKQA 2Q3DA 2XQIA 4H3VA 5G1PA 1QM5A 3QLJA 1YCFA 4Z8YA 3O74A 3M5WA 1DELA 5EIFA 4JBGA 4AVYA 1KU0A 1HSZA 1U3FA 2IY7A 2YKGA 2ZR9A 4WQMA 1ZK4A 5I3CA 2MSCB 1NY5A 4UUMA 3WBFA 3VVLA 3MD0A 5KYWB 3HZOA 1CIVA 4C7BA 3WNBA 4ZV4A 4X94A 3D6NB 4KTTE 2HU2A 4CQMD 2GT1A 1MZPA 4M88A 3RK4A 2ZW9A 1K92A 3RIMA 1PS8A 4PPFA 1T5BA 4WX2B 3AR9A 3LVBA 4YROA 2E21A 4IJQA 3OLXA 4QUDA 2YW9A 3COYA 3EY9A 2XDAA 4PNZA 421PA 1IN5A 3DB2A 4CHGA 4ZGGA 2JFUA 4JBYA 2AUTA 2H2GA 2Y1GA 1F8UA 4PGMA 2RC5A 2ADMA 3KQOA 4QREA 3FNHA 1KFCB 4DNXA 1PZFA 3EIFA 1BAPA 1I4EB 3VDMA 1QKIA 2OENG 2QAJA 4F11A 3PNYA 4HQ6A 2ZRMA 2MSNA 2VNHA 4LN1A 2PDAA 1V4VA 1E1NA 1PT5A 4M9ZA 2Y3IA 3SFVA 3HDYA 4ARVA 2QUJA 1YZTA 3QX3A 1Q3KA 3CLRD 1QFSA 2B7LA 1QHHA 1GL3A 2YJ6A 1EK0A 3QW2A 5DX8A 4MRPA 1ORIA 2NOAA 3JS5A 4BVGA 1A5BB 5JT1A 1JHOA 2P27A 5IN4A 1P5ZB 1UMBA 2OBMA 4OUDA 5FPYA 3T3PB 1U8ZA 4NV1A 3GLTA 3SYTA 1OX4A 3EK2A 3MWGA 2UYCA 3I5XA 2VNKA 4MA5A 5U1PA 4R69A 3NEAA 3M6LA 2OUIA 3HFSA 4PYJA 1VCIA 5H3HA 3H97A 2FOXA 1B00A 3QFSA 1TUEA 4DPKA 2PUWA 1C81A 3TOXA 2Q6OA 5TS2A 1C9YA 5DI3A 1CE8A 3JQCA 1TXGA 2R751 3JVIA 5LZ2A 3LBNA 5IBCA 1AO3A 1YS9A 1XYYA 3H9BA 3KM0A 3MJFA 2ZAGA 4XLLA 4YAFA 1W9HA 5GGXA 2OYRA 2X23A 2UDPA 3BK1A 4XM2A 3ZDFA 1RRKA 2QVCA 4YUZA 3F2VA 3UOAB 1I2MA 3DVAB 4FJ2A 3UYLA 1KJYA 5ITSA 2G9UA 5C1IA 3RK1A 3IHKA 3H9UA 4IHQA 3B3FA 2JKZA 3G9ZA 3SLKA 1B74A 3UH1A 5HIKA 4RPIA 3R74A 4AJPA 3T7DA 3KB2A 1CUCA 2JBAA 1O97C 4NTZA 3AUSA 3VVCA 2DBYA 5MDHA 3ZNPA 2WFLA 1MZVA 2IH2A 2OEPA 4G81A 2HMYB 4K88A 5JSYA 1PVVA 2FFJA 1L7PA 1XTKA 5FDFA 3KKKA 3CLSD 2ZROA 2AOTB 3TDNA 4WCFB 1X13A 1AS0A 3ER6A 3IYLW 2OCBA 3LU1A 1QB7A 3KWJA 4JLSA 4QFCA 4V03A 1ESDA 2BFOA 2GBPA 1VJRA 3DWGA 3K94A 1NZJA 2EKZA 2P35A 4P82A 2OP0A 3L8HA 1BIFA 1EFVB 3GOQA 2WKPA 4B3FX 2XJ9A 3KTDA 3ELDA 4GD3Q 1C1DA 2WUWE 3UMJA 1MB2A 1RWNA 3ZW9A 3M33A 4OHFA 3UMCA 1B43A 3CVWA 3JQ9C 1CETA 1F7VA 1P6UA 4FFVA 3RC7A 4B1FA 4I1RA 2O8EB 2BIFA 2GARA 2P5UA 1LZLA 3H87A 1D0IA 3FMFA 2DC1A 1E3SA 1XLTC 1M6EX 2QTAA 3LP8A 4ALKA 1B16A 2XITA 3IIKA 4JQOA 4L1KA 2WZBA 3KAQA 4GR5A 3F47A 4KE6A 3BMNA 4U9HS 4DMUB 4RF4A 2Q5EA 2V6BA 4ER5A 1UWCA 3PXAA 4I4CA 4JP3A 3RRJA 2PAAA 1E7MA 4S3MA 1O9GA 1I3MA 3TIXB 3TQRA 5CD9A 3PZRA 4B85A 3A2NA 1P1CA 4CR7A 4UFPA 3FNFA 3H9GA 1SOVA 2GJ9A 2PGNA 4KPYA 3PYXA 3KKPA 5T7BA 4M1TA 1I4LD 4WUTA 1CR6A 1KPIA 3CF4A 3WIDA 1IIRA 1WVMA 1Z0UA 3CLVA 5AW4A 4HGQA 4NH0A 5AI0A 3RYHA 4GM4A 1I3KA 1KNQA 3RYFA 4AROA 3F98A 3MGAA 5JZBA 5EIEA 2QIPA 1G5TA 1VMIA 2DHCA 1USWA 4YI3A 4RJIA 5FO0A 5TC4A 1MTOA 1ATIA 1M6HA 4N5LA 4R1SA 1IBKB 1T0UA 3HBNA 4U6QA 3WOVA 2XF8A 1GDDA 4NDAA 3TFWA 1ZUD1 2QTWB 3U49A 3NUQA 3HO8A 3L4KA 5IF9A 2Q4RA 4D9HA 3V7UA 4XUGB 2RIPA 3FDFA 1NW8A 3H2YA 5CVTA 1C3OA 2C5HA 1O6FA 1OBHA 4FR5A 4A0GA 5CFOA 4EG5A 1Z47A 3CWCA 4GBGA 4A36A 3AVXA 1O03A 4G5XA 1W5AA 3AKYA 4UTZA 4GPAA 1XRLA 4DCSA 4DZRA 2P5YA 5EMHA 5I9IA 3CVXA 4UUBA 5EPUA 1SC3A 3WISA 4C5AA 2Q8PA 2KYRA 3R6GA 4RANA 5EJIA 1Y42X 3P0JA 3PFGA 4HTFB 1IY2A 1YJXA 3SSAA 3WLEA 1JMVA 2WF9A 5BN3B 1XMOB 3NHKA 4NCNA 1Y4UA 3HB0A 4CR8A 1OPRA 4K6OA 4C78A 4C2BA 2BDTA 2VA9A 2XD4A 3N2IA 4HNAA 4AN4A 4BEVA 1X74A 3CNBA 2XT9A 4RPHA 3LUBA 2F00A 3M5CA 3UAOA 4DB4A 1VKHA 1NQWA 1GYRA 3VZPA 4D8UA 2F8SA 2EZUA 2IOHA 2OORC 3ZBQA 4EFKA 5BUCA 1U1IA 2MINB 2BMEA 3O8NA 3OLCX 3KS9A 4JDUA 3Q6IA 1LSUA 5JNLA 5IMBA 2QU7A 4QG3A 1WCV1 4AC9A 5EL0A 4YJ2A 1Q95A 5ALSA 3D7LA 1FBTA 1R3UA 4UNPA 1G21A 1YOVA 3BM5A 1Z5UA 4LJ9A 2HWWA 4LJ4A 4MB6A 3TQCA 5GTDA 1OV6A 1UT5A 5GY7A 1Y3AA 3H11B 2VKQA 2WD7A 3ABQB 1RLJA 4PWYA 4QEZA 3S8MA 2ZVQX 1AMUA 3SQWA 2HLPA 4EJ2A 2WU0A 4IGAA 3P9YA 3MA0A 5AOBA 1UQTA 5JVDA 4UC0A 2FWJA 3LSYA 4M9SA 3C41J 1HPLA 2P6UA 3R76A 1ZHOA 2G70A 1UADA 3IBSA 3KUUA 3L6CA 3P97A 2ZJ6A 2XT6A 2EKLA 1E7YA 1XCJA 4ESOA 3AYXB 2D1SA 1RYZA 3TRIA 2PLWA 1Y6ZA 3QY0A 3U9TA 1JBQA 1KI1A 1G1MA 1N0WA 2WIAA 4XASA 5K0LA 2PUAA 1KO1A 3F4KA 2BBSA 4HDQB 5JALA 3OAAA 1O89A 4R7ZA 3MUFA 5ALUA 5BT9A 4RKQA 4YCDA 1R4MA 5FOXA 1JHAA 3EGCA 4PO8A 1EXWA 3FFXA 3H5VA 2VXYA 1XVTA 1YDFA 5BOSB 1EQAA 2ZSAA 3ZDYB 3EPHA 4C89A 1M54A 5J23A 4BNNA 5A4MS 1YBMA 3A04A 4Q9IA 2BD0A 3H86A 4FN4A 1YHZA 1S3GA 2GD0A 3B7GA 5TARA 4QSMA 1CNMA 3A1UA 3SJZA 3TINA 2YIDA 1O5OA 1XCPA 3PX7A 1S89A 2AFRA 2JA2A 1WP4A 2WPNA 3DMRA 3TSWA 3X2EA 5K0BA 3K1ZA 3PYLA 3OECA 4Q4CA 5KO2A 4JQCA 4JB3A 1A5SB 1SQ6A 3HVHA 3SNHA 3T1QA 4OQDA 5LOVF 4EDHA 2HSJA 2QSZA 4F7WA 1HYBA 2W2QA 3EH1A 3H17A 1R4ZA 4XQ0A 3A9UA 1H4TA 1PFKA 2CW5A 3LBYA 1NJFA 4XD7D 1XD8A 4OI0A 5KNDA 1U8AA 3EIHA 2NT4A 3WMXA 3QYJA 1M5RA 2GZ2A 2VWPA 2C2YA 3D3KA 3CVYA 2YWHA 3GH1A 4GMHA 4KFUA 1KQPA 4NMMA 2H2IA 1A7JA 1F4VA 4G5FA 2H1IA 4NVRA 5FUWA 4EF4A 4E6PA 3AKZA 5JXHA 4W63A 4K81B 5F9MA 1AIPA 2W70A 3M89A 4ZCPA 1BA3A 2RH9B 2I6TA 2PRSA 2I1WA 2CXUA 1K2VN 2UZ3A 3S1LA 1NDHA 3AXTA 3I34X 3K4HA 4ZREA 5EWJB 5I4CA 1KAMA 1USIA 2IXTA 2JFZA 3CKKA 4W7IA 5ECDA 2H1OA 1D2RA 4R2KA 2WK1A 4H6PA 4KO2S 5F1OA 4A4DA 1LLCA 1WX1A 1VSUA 1AE1A 3LT2A 4KC0A 4AMGA 721PA 3U7FB 1DRVA 5L3SB 1R0BA 2VT2A 3K3PA 1AKRA 2AK2A 1TDJA 3OPYB 3VHRA 2XZLA 1JB9A 1PSDA 2IOFK 4LGMA 2YS6A 4A8PA 1U0LA 3AM5A 2HH9A 2AE1A 2OG1A 3WHIA 2I76A 2PLAA 1G5QA 3E9CA 3QXJA 1TM5E 3BERA 3EWSA 1FMJA 3VFDA 3TD9A 1WUJS 3SQDA 1V25A 1P2VA 1YT5A 3PT5A 2KBEA 5EXSA 4FN5A 3JQFC 4RV5A 1TNDA 3K6SA 5DM4A 1F5SA 1GZVA 2RJ3A 3D1VA 5FJJA 5LQMA 4RTQA 2HU8A 2AOUB 2VYND 4UM7A 4N8DA 2FSGA 3T7EA 2VEOA 1N5OX 2I33A 5MN5A 4N76A 4FUQA 3WKEA 4OHMA 4E7PA 4DXHA 4Q4DA 3OPYA 3KHSA 2OAQ1 3A9WA 2NZWA 1B8PA 2XMZA 3A27A 3TNYA 2VLBA 4MKIA 3JAKB 5DBGA 2QENA 4U5QA 3R5JA 3RGGA 1V9LA 3RFUA 2QV0A 4EVSA 1K0FA 3S7ZA 2R5FA 2XA9A 1Z5GA 3CX7A 4N12A 1Q7GA 1WMFA 5F52A 1VJCA 1P9WA 3BMXA 3BIWA 2WIGA 3O83A 4Z49A 1GYPA 2TMDA 3BJZA 2ODTX 4H59A 4KWIA 3AUAA 3N1UA 2JS7A 1HDRA 1A2QA 3A6GA 1BCSA 2FWPA 2XNDA 4P3NA 1OC2A 1VXOA 1YR7A 3HXTA 2X5OA 3Q2KA 3PGVA 4HAOA 2NSDA 1GGNA 3DKIA 2FUG1 3V55A 3ZYZA 5U4QA 5IZCC 2QRPA 3PWZA 4LRYA 3LDAA 4WNAB 1UPCA 2ORED 3GFFA 1Y6FA 2D2XA 3K0EA 5DM0A 1Z82A 1IAQA 3ZH2A 4HRYA 5K8JB 4OH1A 4EVRA 2C59A 2EJWA 3G2JA 3WLIA 2Z4SA 1I7LA 2FWAA 1GT6A 2ERCA 5CYOA 4ZD6A 1QLJA 1Y4SA 4U39A 4X97A 4LRWA 1P4HA 1DE0A 1IHYA 2Z58A 5BUQA 1ZW6A 4MWBA 1J09A 1PO7A 2H2DA 2NW6A 3AHGA 4YRCA 4CM4B 2XYGA 4ZYZA 1IWPB 3OP4A 1IHXA 1YUBA 1CR1A 1RADA 3PTLA 2NM0A 3JQAB 2G67A 3U3MA 4BAUA 3IPYA 3WTCA 3C1AA 5ALJA 2FFRA 2V5VA 4MGYR 4NPCA 2NUAB 4B3HA 1TZMA 3TS1A 2DERA 1L4FA