4HTFB

Crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
247
Chain Sequence
MQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAIKMAERGHQVILCDLSAQMIDRAKQAAEAKGVSDNMQFIHCAAQDVASHLETPVDLILFHAVLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMSPDYPRDPTQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDCYEALLELETRYCRQEPYITLGRYIHVTARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-adenosylmethionine-dependent methyltransferase from Escherichia coli in complex with S-adenosylmethionine.
rcsb
molecule keywords S-adenosylmethionine-dependent methyltransferase
molecule tags Transferase
source organism Escherichia coli
total genus 88
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4htfB00
2QYOA 4EKGA 4GC5A 4BP3A 2P7HA 3PFHA 5K0NA 5HOQA 3FUVA 2BM8A 3EVCA 4R8SA 4RVHA 4YV2A 4RTNA 4P7JA 1X1CA 1RI1A 5CM2Z 1KXZA 3HNRA 2NNWB 2PX5A 3FUTA 3KQMA 4FP9A 4HGZA 4JXJA 3BWCA 3G5LA 1KYZA 3LCUA 2AN5A 3OU2A 4KRGA 5EG5A 3Q7EA 3GIWA 3LGAA 5JUWA 5K05A 5LSAA 1JSXA 4H0NA 1P1BA 2FYTA 3HCDA 5BXYA 3NTVA 2YXDA 2P7IA 1G6Q1 4QTUB 4AZWA 3SSOA 1N2XA 3EMBA 4DQ0A 3KQWA 4RTLA 2C7QA 1EAMA 3LKZA 2LD4A 5CVVA 2OYRA 4PCLA 3QV2A 2CKDA 4DKJA 4GC9A 2VS1A 5K03A 2IIPA 2ZW9A 5LQCA 3TR6A 3FYCA 1R74A 2XYRA 2ESRA 3UBTA 1TW2A 3X0DA 1RJGA 1AV6A 3E05A 4U7PB 3EVFA 5IH3A 1NV9A 2UYHA 3R0QA 4HH4A 2PXAA 1X19A 1EG2A 5EKUA 4YUVA 3KQYA 1FP1D 2ZIFA 3BKWA 1D2HA 2XYVA 2ZSUA 4QDJA 2QRVA 4ER7A 4KVZA 5KYGA 3FUXA 4C03A 5FHQA 3P9CA 3ID6C 4FT4A 3LDGA 3BGDA 1YB2A 3B3GA 1INLA 3HTXA 3G8AA 5F2NA 4YV1A 1O54A 4OBWA 3MGGA 4RVFA 1RI2A 3SM3A 3E8SA 5P8WA 1SG9A 2JHCA 3HCFA 4CXMA 3DXYA 4GUAA 3PX2A 2HV9A 1PRYA 3KQVA 3BGVA 2AR0A 2Y1WA 3CJQA 3P9KA 3TMAA 1DUSA 3MB5A 3P2KA 3TM4A 3SGLA 3PLAE 2DULA 2GPYA 3VSEA 2IFTA 4RTRA 3KQSA 3UFBA 3VC2A 5DM4A 2PX8A 5D1NA 5HIMA 4P7KA 5GIOE 4PYIA 3DR5A 2PX2A 4F86A 5CCBA 3UJCA 3DMHA 3FTDA 4EQZA 2I6GA 3GNLA 4GEKA 1QANA 4LG1A 4FR0A 4O29A 5GOZA 4CKEA 5LQKA 3KQPA 5MHTA 2IDKA 3P2IA 4GOOD 1FBNA 3CGGA 1U2ZA 3ELUA 4LWOA 4RWZA 1DCTA 2BH2A 2H1RA 4P7GA 2AOWA 3IHTA 1QAOA 3GRUA 4PIPA 3E23A 5ICEA 3I9FA 4GF5A 2ORED 4WXHA 1QZZA 4A6EA 2JJQA 3I64A 4X1OA 3T0IA 1B42A 1R18A 3BWMA 1N7IA 3KR2A 1JQEA 2YQZA 3AXTA 5FQNA 2AVNA 4U7TB 3S68A 3TRKA 4BLWA 3GWZA 1VIDA 3M4XA 3LHDA 2ZVJA 4IKPA 4PYKA 3B3JA 4Y30A 3GRYA 3BXOA 1MHTA 4POOA 3JWIA 5C1IA 3MTEA 3FUWA 3NWBA 4PINA 1O9GA 3UJDA 3C3PA 4C4AA 3HEMA 3QOWA 3K6RA 4PYLA 5G02A 3BZBA 3NJRA 1EIZA 3LDFA 4KW7A 1P39A 5K0EA 3JWHA 1QAQA 1O9HA 4QVKA 1VPTA 3QOXA 3GO4A 2FRXA 2B9EA 4GOMD 4HG2A 5DM0A 1Q0SA 2EJTA 1SQGA 3REOA 5KQSA 1Q0TA 2CMHA 3UZUA 4RTSA 3PTAA 2H00A 3FUUA 1M6EX 4RV9A 5EGSA 3BKXA 3P8ZA 4QPPA 2P40A 5FQOA 4HRAA 3HP7A 3DULA 1JG2A 2ZWAA 3MCTA 4RSRA 2C7RA 4ISCA 4YMGA 4KDRA 2FPOA 2OBFA 3G8BA 3LPMA 2V7EA 5BW4A 3R9XB 2P35A 2JHPA 1WXWA 3IEIA 2YR0A 4GOLD 2I9KA 1BOOA 1TW3A 3PVCA 3ERCA 1KIAA 1ZQ9A 2FK7A 1VLMA 2ZWVA 3M6UA 2C7OA 1NW7A 4EK9A 5GM1A 1ORHA 2VDWA 5HIIA 1JG4A 1NW8A 3A26A 2IGTA 4YMHA 2Z6AA 3PX3A 5T67A 2ADMA 1JSZA 3GDHA 5C9ZA 1L3BA 2BZGA 1UWVA 2P1DA 1I1NA 4OA5A 2AN3A 4PYQA 4RTMA 2G8NA 5IKMA 1JTEA 2P3LA 5FADA 4QQNA 1NE2A 4FSXA 3TFWA 1SUIA 1BHJA 1ZG3A 2JHAA 2VDUE 2CMGA 2PXXA 3LCVB 3OZTA 4KIFA 4V0QA 3FPJA 3UA4A 2ZZMA 4E2YA 5KQRA 3HVKA 3V97A 3HM2A 3RW9A 3UWPA 3EGIA 5DT2A 1RI4A 4P7FA 7MHTA 3LBYA 3H2BA 4PONA 4E2XA 1XJ5A 2NP6A 2NP7A 3DMGA 2HMYB 2OXTA 4GBED 1XVAA 1MJFA 2O0LA 3O31A 1R6AA 5DX0A 4RTQA 3OCJA 5DX8A 3G7UA 1XDUA 3CJTA 3ER8A 5LR6A 3T7RA 4OX9Y 3KQQA 4YV0A 2HTEA 1R00A 4LECA 5E9WA 3EVZA 3HCAA 5EOVA 2B3TA 4BLUA 1SKMA 4BP1A 3DH0A 3UA3A 1M0EA 10MHA 3FRHA 1ZGJA 3SXJA 4RTOA 1L1EA 2FCAA 3OU6A 4EVIA 4YUXA 2FK8A 3NVMB 3KPWA 8MHTA 2R6ZA 2ZBRA 3BUSA 5EQJB 5DWQA 3U81A 4PIMA 3BT7A 2WA1A 2XVAA 3WSTA 5D1HA 2OKCA 1VBFA 1XCJA 4PGGA 3OZSA 3TPZA 2E5WA 3DUWA 3KPUA 5M5BA 3DXXA 3LBFA 2IH2A 1DL5A 3TKAA 4DCMA 1L3CA 1JTFA 3NVKI 4AZVA 1X1BA 3EGEA 1G8AA 4AX8A 1RJEA 1JQ3A 2A14A 4YUYA 2O07A 2YTZA 5EHIA 1WG8A 3ME5A 4C06A 4YUWA 1KPGA 1NBHA 1WY7A 4KIGA 1SVUA 2PY6A 3KQOA 1NW3A 3DP7A 3EVGA 4KDCA 5ERGB 2ERCA 5DTQA 5GIPE 2WA2A 4PYJA 2YVLA 1RJFA 4FZVA 2GLUA 3M70A 5GINE 4C08A 2NYUA 1F3LA 2PLWA 4X63A 4ER6A 2UYQA 5EEHA 5EPEA 5T64A 3PFGA 3UJ6A 4CWAA 2JG3A 1D2GA 2KW5A 4M38A 2ZBPA 3FPEA 5DM1A 3GXOA 4A6DA 3FPHA 3GRRA 3UJ8A 4E30A 4HTFB 3HVIA 4Y2HA 1EQAA 4OA8A 3CKKA 1KHHA 3THSA 4RTJA 2OZVA 2QE6A 3FTEA 1HMYA 1I4WA 3PS9A 2GB4A 1L9KA 4XUDA 4IV0A 2WK1A 5GM2A 3DLCA 3MERA 4DM3A 3SR4A 1XCLA 3SSMA 2UZ4A 1KP9A 3G2QA 5DSTA 2YXLA 3OU7A 1JG1A 3GCZA 3T7TA 1NBIA 5KS2A 2PWYA 3B3FA 3JWGA 3A7DA 3P97A 4PCAA 1JG3A 2B2CA 3AJDA 3ELYA 3KQTA 4QQKA 3KR1A 1NV8A 4XUCA 5K0BA 2V74B 3EVAA 5LQJA 5BP7A 4F85A 1HNNA 3FPFA 2PT6A 2PSSA 5LQUA 5ICFA 1WS6A 1M6YA 3SMQA 2YXEA 3FYDA 3B89A 3R6TA 5DRYA 5DTMA 1IY9A 3KHKA 2H11A 3TM5A 4C04A 5DPMA 1V39A 1ZHFA 1KYWA 3UJ7A 3I53A 3F4KA 1VE3A 3HA5A 5FA8A 4CKBA 5LQAA 5EMMA 1VP3A 5E2BA 2C7PA 2ZLBA 2XBMA 3RIEA 5EHGA 4B17A 4XUEA 4QPNA 2VP3A 4PYOA 1R8YA 1X1DA 2GS9A 4GQBA 3VYWA 3AXSA 1WZNA 3OFJA 4PYNA 2AVDA 4Z2YA 2AOVA 5E9JA 3EVEA 4QDKA 3DMFA 3CJRA 1UFKA 5E2AA 2UYCA 4YUZA 2Z6QA 3NDIA 1H1DA 5EC8A 3B7PA 1OR8A 1ORIA 2Q41A 3OZRA 5CVUA 4HTFA 2HNKA 3D2LA 1XDZA 3TOSA 3IV6A 2ZFUA 3P2EA 2HR1A 3KR9A 2P8JA 5K0CA 5K8VA 4M7RA 2K4MA 1G60A 3G2PA 2VZ9A 3P71T 4M36A 4MWZA 3FPGA 3GRZA 5ICCA 1NW5A 4EMSA 1IM8A 4V0RA 4X60A 1NT2A 5LQNA 3HVHA 3OPNA 5EZSA 3SVZA 2G70A 3K0BA 4RVDA 4LWPA 2XYQA 5EZQA 3UJ9A 5FCDA 4CKCA 1PJZA 3B5IA 5CD1A 4M37A 2B25A 1D2CA 1KPIA 1VL5A 3BWYA 3V8VA 2IBSA 5DX1A 5GP1A 5B1SA 2B78A 5EEGA 2ZBQA 5LQRA 5HIKA 5JR3A 5EMLA 5E1OA 4FT2A 2IBTA 4FGZA 4E2ZA 1G38A 2UYOA 4AUKA 5K0GA 3TKYA 2EG5A 4C05A 4PYMA 3VC1A 3T7SA 1NKVA 4ER3A 5K09A 9MHTA 2AOTB 2O05A 4E33A 4EKIA 5K0FA 4R6WA 2BR5A 5CVJA 1KR5A 2PX4A 3MQ2A 1Y8CA 2ZTHA 2Z6UA 5FTWA 3C0KA 2F8LA 1F38A 3EMDA 4WVLA 1AQIA 2DPMA 4RYLA 5DXAA 3KU1A 4ER5A 1BKYA 2N47A 3MCZA 4CTKA 3KPJA 1WXXA 1AF7A 2PBFA 2QM3A 2YUIA 4GOND 4X61A 5DXJA 5F2KA 5CVDA 5DTRA 2AS0A 3NWEA 4ATNA 3NW9A 2O06A 3CBGA 1AQJA 4CTJA 3HCBA 1EJ6A 3EEOA 2AN4A 4OQEA 2CWWA 2EJUA 2AOUB 5EIFA 1QAMA 4R8RA 2ZIEA 4K6MA 1EJ0A 5DRTA 3RODA 4PNEA 1R8XA 1RJDA 5HFJA 4R05A 4HC4A 3R24A 1VQ1A 1XDSA 2OB2A 1VP9A 3C3YA 5E9QA 1FJXA 2ZCJA 3TLJA 4R6XA 3UJBA 2ONZA 2BR4A 2NXCA 2O57A 2YX1A 5DLYA 3HA3A 5CIYA 2AOXA 4BY9E 1FPQA 2PVCA 3ORHA 1YFJA 1Z3CA 2NXJA 2ONYA 4L7VA 5EMJA 5FHRA 5T6BA 4OBXA 4DA4A 1L3IA 3O7WA 5DM2A 1XTPA 4MHTA 3HA7A 5U4XA 3ER9A 3OE4A 3C6KA 3LL7A 3FTCA 4FS8A 1SUSA 3LECA 3LX6A 4BLVA 2JH8A 3OFKA 1JR4A 3ELWA 3M6VA 4E70A 3KPYA 2OO3A 2PGXA 2IPXA 3KR0A 3HCEA 2PKWA 3R3HA 1P91A 3HVJA 2VDVE 5CCXA 4AZTA 2NXEA 1X1AA 2AOTA 2BM9A 2EFJA 3E7PA 2FHPA 3FRIA 5E1MA 2I62A 3JWJA 5GWXA 3THRA 4UOEA 3EVBA 5EIWA 2ZIGA 1YF3A 3L8DA 3M33A 4DMGA 4RTKA 1ZGAA 2XVMA 5E1BA 3I58A 4C07A 3G2OA 1JQDA 4ER0A 4MQ4A 2IDJA 5ICGA 2ZULA 2G71A 2OY0A 3EVDA 4FSDA 3EPPA 3A27A 3ANXA 3BGIA 2ZZNA 3PT9A 2AOUA 3IYLW 3LDUA 3LSTA 5FUBA 5BW5A 2PXCA 5K0JA 3SX0A 3TQSA 3CVOA 1ZKDA 4MTLA 3BWBA 3GU3A 4MIKA 2EX4A 1FP2A 1N7JA 1UIRA 2P3OA 2Y1XA 3GRVA 5EKXA 1KPHA 3FTFA 5FA5A 1IXKA 4QTTB 5E1DA 5DSXA 1RI5A 5HIJA 1QYRA 1YZHA 3GGDA 5HEKA 1YZ3A 5KVAA 3A4TA 2P41A 4PGHA 1P1CA 3LCCA 2IH4A 4RTPA 4DF3A 5HZMA 5CUQA 3I5UA 2PJDA 5CVEA 3P9NA 1YUBA 2ZZKA 3FZGA 3MAGA 4KWCA 3AY0A 4HGYA 5EVJA 4NECA 3HCCA 3OE5A 5E8RA 5FULA 3DOUA 2PT9A 3G2MA 3M6XA 2BR3A 5H02A 2HWKA 1G55A 3DXZA 3G88A 1BC5A 2GAFA 4ZTBA 5HILA 3O4FA 3ELDA 4PWYA 3P9IA 3Q87B 2GA9A 3EGVA 2IH5A 4RX1A 4QVGA 1RI3A 3CCFA 3DTNA 2CL5A 3CC8A 5EMKA 3UJAA 3LKDA 3M6WA 2NXNA 2OPBA 2OB1A 3KKZA 4F84A 1SQFA 4IV8A 2G72A 3G5TA 3C6MA 3G89A 2QY6A 1TPYA 4P58A 5FWAA 3SSNA 4DZRA 3DLIA 1YFLA 1XXLA 4OQDA 5K0LA 2PV0A 2P3QA 4IWNA 2AZTA 2GH1A 4G56A 4X41A 4E2WA 3AWIA 3A7EA 4HSGA 2I7CA 4AZSA 3NMUF 4RVGA 3MHTA 2QRVB 3GJYA 5F2OA 5E8JA 4E32A 4XCXA 3PB3A 2R3SA 1I9GA 3MTIA 3A25A 5FWDA 4E31A 4DCGA 5K01A 2JH9A 3KPVA 3NDJA 5C0OE 1NW6A 1T43A 3EEYA 2G1PA 2PWPA 2IP2A 1G8SA
chains in the Genus database with same CATH superfamily
2YQ4A 3S55A 1WAMA 3ZGZA 3T5DA 3U9SA 4MSUA 1JVBA 3PFHA 3ZK8A 4HI0E 2EBHX 1EP1B 3HYTA 3RK1A 2YYYA 3HCNA 4TQ9A 4YCJA 2CVZA 2WZCA 2ILTA 3LD9A 3NHLA 3D7NA 2GDJA 2VF7A 3HNRA 4B7XA 2VPIA 3C15C 3ONFA 2I2FA 3AG5A 3KYCA 4WASA 5CG1A 3VH3A 5J4HA 1R12A 1Q77A 2CSUA 3LCUA 2Z04A 3L6OO 3LIPA 4LQ4A 2O5VA 2QTNA 4X84A 4YJFB 5DHRA 5L95A 2JVJA 2PWZA 1NKTA 1UJ5A 4ZCRA 3P94A 2L42A 1E0KA 5L7WA 3A0RB 3HBJA 3KT3A 3IDAA 3SSOA 2JASA 3EWAA 4DKXA 2O7SA 4G9GA 4DB4A 1U7WA 1P0IA 2C29D 2BFEB 2LD4A 3B60A 1R4ZA 1XXHA 4ARAA 5LP6B 4D9GA 5I47A 3HBLA 2QI9C 3IAM1 3PXCX 1JHUA 3EXFB 5IXYA 2O5EA 1QP0A 4HDKA 4NQZA 2QQFA 2GZ2A 1N36B 1TW2A 3AL3A 1CUGA 1RJGA 4LHXA 1DVRA 4TL8A 4U7PB 5L3QB 1FP7A 3E0XA 1PV4A 2ZYUX 4D43A 4AULA 2D0OB 1U5AA 3N8HA 4CFZA 4URYR 3V2IA 1J2UA 5ILOA 4NXNB 2ZE6A 3JVVA 3Q9SA 1H4QA 1HG0A 5EI5A 1ZOIA 3NP7A 2EFEB 4IFIA 4RXUA 1PK9A 1T1JA 4XVQA 3GFPA 2D13A 1JLLB 2F4NA 2ZB2A 3B3GA 1Z7GA 3OQVA 1YRQA 1Z6AA 2M6LA 4AFNA 2GRJA 1Z4IA 2DRIA 5LMCA 4L74A 3QITA 1VFPA 3UAYA 3FDJA 4YQZA 3C7AA 1GU7A 3CKLA 3YASA 1GIAA 3A4YA 4M1TA 3RYHA 3I5MA 1TPZA 3A1DA 1B8PA 1UXGA 2Y1WA 3EISA 3TMAA 4HWPA 2ZPTX 4GZ3A 4FHFA 1E4VA 1GLGA 1GG8A 1UJCA 3EWIA 4KAJA 1LBSA 3CR8A 1CZOA 1AKNA 1YHZA 4JBIA 4PGAA 2XZPA 3QXHA 2DMRA 2PD4A 2JFBA 1AN9A 3O75A 4J03A 3DM5A 4D25A 2O8DA 4ZREA 2AUNA 2LZ0A 2WWXA 3ED5A 4BRWA 5I7EA 3FCEA 1JJ7A 1MAVA 4OQLA 1AMOA 4NG4A 5CCBA 3AF4A 3TG8A 3CUUA 3OQIA 4FZRA 1QR6A 4V1CB 1WV1A 3BMXA 4O29A 1GVHA 4DCJA 4BEWA 1L8QA 2A0KA 1VCNA 1N2GA 3KKNA 4GOOD 5TXGA 2RG1A 3V7YA 5C5IA 1W5FA 4HVTA 5B53A 3WS7A 1IY2A 1JU9A 3BAZA 5CPFA 2PLRA 1QFXA 3E3LA 4G1EB 1BD4A 3M5DA 4FWIB 1QGUB 4HZUB 1HDIA 3HGMA 1E1QD 3AVQA 4F6RA 4MB0A 4Q3NA 2Q2WA 1J33A 2JJQA 2XBLA 1RABA 4G0PA 3VKUA 5LNK1 5G0TA 4BNXA 1JQEA 2XPCA 3Q0TA 4U7TB 4IHJB 4DABA 1AA9A 2V9PA 4CQLB 2EYQA 3E81A 1KKMA 1TO6A 1F8FA 3K73O 4GZMA 2A9JA 1JEYB 2HW8A 3T9CA 1NDQA 1T0BA 1PTJC 3DTVA 1GL6A 2HHHB 2AYXA 2GSWA 1MJGA 3DV2A 4LJSA 1TYCA 3EXIA 3BDIA 3EXHA 5G02A 3ZZTA 4BMOB 5BN5A 1X15A 2GPJA 4G1MB 2QTHA 1A71A 2X76A 4V38A 2NPFA 2WV7A 2REQA 3SFTA 4ARIA 4AZ0B 2RHBA 4TWIA 4XR4A 2WIDA 2XD9A 1DIAA 1SQ5A 4R3NA 4CM5A 4B3JA 3NC1C 5DI3B 1MIOB 1E3WB 2PMCA 3BL5A 4TM8A 4KVFA 4B4KA 4K9OA 1A4UA 2C9OA 4P8RA 1LC0A 3MPOA 3JYOA 4WERA 3GLGA 3H1PA 5G53C 3C39A 2ZPAA 1X7HA 3BILA 4RLFA 4EFLA 5F21A 4DQXA 4RF3A 3B48A 4TKZA 2VCEA 1AX9A 2H52A 4H3HB 4K3VA 4KWEA 2O4UX 5TV2A 1K6EA 1ZQ9A 2FZWA 3Q1LA 1QU2A 2PR2A 1Y9JA 2XE8A 1J9GA 2X77A 3L79A 4C0AC 4ZYWA 1M34A 2B6HA 2H54A 5JXIA 4X1YA 1IU9A 1OAAA 1UKYA 3BPSA 1Z74A 2H2IA 3A9CA 3DAHA 3FE2A 3L7KA 2DT8A 2V97A 2WI8A 1UWVA 5IP5A 4RPHA 3FZYA 3LHSA 4O4LA 1JTEA 2XMRA 5ALTA 3WRXC 4XX0B 3L1VA 3NBKA 5LZ8A 2X0FA 3WQBA 1ZG3A 4Q3LA 1F2TA 2ANBA 1T4CA 3VR3D 3CVVA 4ACBA 2A9KA 5A3RA 1COWD 1JBEA 2OCPA 3NHWA 4Z86A 4E22A 2HUPA 3A9VA 4ZEWA 5K3DA 3NHFA 3P96A 1CUUA 5IJAA 3N2GB 2J9GA 4DYVA 3K1AB 4WBXC 4OAQA 3V9PA 1TZJA 3K9WA 3KEOA 4FOPA 4TL6A 5JLAA 3WGIA 2RGDA 1CRQA 1W4RA 1GQ2A 3OCJA 2E4XA 1GSOA 1LVGA 3G7UA 3IV7A 4U7GA 2ETXA 1OJ7A 3BA6A 3L84A 4OP3A 4U2GA 3HVRA 1YCDA 2Y05A 2ASEA 3F6CA 4G97A 5E9WA 3DE3X 3DLTA 1VM6A 1XJCA 3GZNA 1UEJA 3H8JA 4US0R 3KEFA 4UE2A 5ALZA 1DKOA 2Z2ZA 3PUHA 4LUCA 1U3VA 1IMJA 1BU5A 3NOOA 4CHGA 1A76A 2H0QA 5EZYF 2HPAA 4C7OA 1MX9A 4O4IF 1RPJA 1OASA 1BXGB 1TIBA 1XX6A 1U28C 1ETUA 5K3AA 4HPJB 1D04A 1FVFA 1SHLA 4RGVA 5D1HA 3ZXYA 4L0QA 4PGGA 1V16A 3M4YA 3P5BA 1C0EA 5INTA 4Z4CA 2IH2A 5MGBA 4FX5A 4OSPA 2EFGA 4CT4B 4AZVA 3ZJYA 2EG9A 4LRTB 5L51A 1NW9B 2P6NA 2BDEA 2G3YA 3N8DA 1E3JA 2NAFA 4U3JB 2VP2A 3BM5A 3L7DA 1T2NA 4Y1RB 1ZOSA 1XJWA 5EHIA 5DGTA 1CR0A 2XB9A 1TJ4A 4CKBB 5FNVF 3OCVA 3GRPA 3RADC 1NBHA 3CE6A 1R9NA 1DKNA 2F1HA 1MAHA 5HQ3B 3PPXA 3BSWA 3KKPA 5FYDA 3EVGA 3V6LA 5HZGA 5JCJA 2G80A 1ESMA 4LZAA 2WA2A 5ALHA 3ZCVA 4HDSA 3SAJA 1HYEA 2XYHA 4LOIA 4UHEA 4BUZA 1R7RA 3QVLA 9MHTA 3SK0A 3FYUB 1X1QA 3ZZNA 2CE2X 4IS3A 4R2IA 4X63A 3FYTA 4B0PA 3K35A 1EP3B 1TTQB 1UZNA 2QTGA 4RCYA 3TFQA 2P75A 3V8PA 3VZBA 3GA0A 1A8QA 1KRWA 3PKIA 3K2IA 5DM1A 3UICA 2P4HX 1E79D 1GRCA 1XV5A 5CW1A 1NXWA 1Q7GA 5LDDC 5JH7A 2OHXA 4QE3A 4TS4A 5A05A 4D98A 5FIUA 5JCXA 2QE6A 3JVIA 4HWKA 4P31A 5DI9A 4RTJA 3FTEA 2IS1A 1Z3IX 3GL9A 1NUQA 5BV8A 4U2DA 5KMGA 1SVWA 5H9VA 4X64B 1CVIA 2ZIXB 1MV5A 1PS0A 2IELA 2X8WA 3T7TA 3UWOA 2RCYA 3ZX4A 4MGEA 3ZKWB 1IJFA 2J41A 2GEKA 2PH5A 5B1HA 4RPCA 3KR1A 1K4YA 4XUCA 4DNQA 1DWQA 1EE2A 3EVAA 3FGPA 4C6TA 5CLHA 4QGSA 4BU1A 3B13B 4BAZA 3PHGA 1YUNA 1RZRA 3SMQA 4N3AA 4RK0A 1NLUA 3L93A 3OT1A 1I1OA 5K3CA 1FW6A 1OKKD 1W0CA 3A3OA 3GPBA 2RCNA 3KYIB 3G2KA 1VE3A 2CNWD 5HK9A 4K9SA 4JOQA 4WFJA 1NN1A 1VP3A 3RT7A 2SECE 1DRKA 3M5PA 2Q2OA 2YJNA 3KWFA 4O4JA 1D0SA 3JQFA 2CJWB 3HKCB 4EGJA 3I9V6 2XTZA 5EIHA 3EDOA 2P6PA 3NJ4A 3EYWA 4CPDA 1ZOPA 1OIWA 1YCHA 1B00A 5LA6B 4ZQHA 3WWDA 2QD5A 1A9PA 1TUEA 4C3ZA 2ORWA 4ZT6A 1GPH1 1RAHA 2PUGA 3D1JA 5JHGB 4GR4A 5IM4A 5DULA 1BRTA 5AOCA 4ZVRA 4KXUA 3ENWA 5IARA 2VJDA 4GZLA 4D56A 3OZRA 3Q3JB 1IDN1 3AR9A 2XUAA 2IP4A 3DLAA 4MV9A 3UAZA 5DWDA 2E1PA 3EXEA 3SD7A 2BEWB 4Q24A 4MVWA 2KM1A 2BGMA 1T5IA 4IG4A 5KPDA 4INZA 4BMSA 1OWMA 1VYVA 4MW7A 2FZKA 1R16A 1SBYA 1YJ8A 3IMEA 2A9FA 2NZYA 2UVPA 3QTLA 4UFOA 4XDGA 1ACLA 1RBMA 1E20A 1D6JA 1TECE 3NOXA 4PLHA 2YV3A 4D74A 2OG1A 2FPKA 4OOEA 1XKTA 2GCNA 3BMOB 5EZSA 1RXIA 4GR5A 2A1UB 5FBRB 3WAGA 2WC1A 4H6XA 3L07A 2LUOA 4R0VA 5THXA 2AG5A 1PL7A 2FOLA 3T34A 3DTYA 4BMZA 2F1IA 1FLVA 1AM4D 1P3JA 2GWRA 2HA5A 3IAHA 4LJ6A 4NFSA 4MW0A 5EEGA 1SXHA 2VSXA 1EK0A 4QARA 2FEXA 4PU0A 1HT1E 1YHYA 3WRWA 4IGIA 3FXAA 4B35A 2I2CA 2ZI5A 4OTZA 4EHKA 1PEDA 1T8YA 4U2EA 3BWVA 1VECA 1AKMA 5AI5A 5DBHX 1MW8X 3V4RA 1I10A 1D6SA 3BL8A 4R6WA 2JGNA 4LSGA 4TV8B 4UBIA 1GAEO 4NZOA 3DO5A 3OE7D 4FYPA 3T4XA 1CY1A 5CEFA 3JW8A 4B71A 3OZ7A 5SYNA 2GTPA 4C7JA 4AUMA 2ZUCA 1C7RA 4B2LA 2ZSAA 5DN6A 2NYVA 4P5PA 1E3QA 2I7XA 4ZT5A 1FF9A 1NWHA 1ECJA 1BDHA 1T9KA 1PR5A 5ALLA 4P08A 5ILGA 2EBUA 2DCMA 3VKFA 4XPZA 2ZIEA 4GPZA 5IX8A 2WAXA 4HFRA 5JE8A 2FW9A 3UJ3X 3T3MB 5DMXA 1NDHA 2CDNA 2VT6A 4GQAA 2Q5EA 4M54A 4OQNA 2CD9A 4UZSA 3DHEA 5DYYA 1FDIA 4R6XA 3GLIE 4FJ0A 1E96A 3MFQA 3M6LA 1JIXA 2WKWA 1ZM4A 4AKEA 3IDFA 5AUNB 1ODLA 4CMHA 5B55A 2I7TA 2XT6A 4HJRA 1K8XB 2P9YA 5EE3A 5FHRA 3WVNA 4OL9A 5JBNA 4HQ6A 1PLLA 1RWNA 2GD6A 4M9XA 1UBUS 2IP1A 3VU9B 3VVBA 3MG9A 5EPOA 1AQ6A 1P7YA 2A1TS 2ZYAA 3MHPA 3MS7A 1OLXA 3ZKAA 3DHNA 4OLBA 1XKQA 3O91A 3PICA 2JH8A 4MAAA 4J9VA 3NPMA 4QNMA 5CNMA 5CCEA 1KVQA 3CIOA 1D3AA 3GLSA 1BXRB 3HKDB 3QEJA 4GYYA 4R1PA 3ZCSA 3B12A 3QYJA 1NLZA 4BMDA 2VNJA 2GBLA 3SHFA 3NI2A 1T25A 1ATZA 1FTNA 2ENWA 4UDOA 1ZRNA 1F60A 4P4SB 4DLAA 2JK0A 1P4HA 3JQAB 1ZSYA 3NDRA 3HXTA 4QYXA 2GKOA 1KDZA 2C9MA 1SBZA 3AM4A 1R1DA 3S1LA 4EWLA 1YF3A 1KQFA 3EAFA 1RHMA 1OT3A 2UUPA 2DUJA 3FCOA 2LBPA 3X1YA 3U7JA 4DR3B 2FQWA 4CG3A 3WJ7A 4UAGA 4A23A 2ZULA 4KRYA 2LPMA 2R85A 1HQCA 3DL4A 3CSUA 4MRPA 1JHAA 2I3BA 4JJ6A 4NCIA 1H2EA 4XI9A 3LBHA 3ESDA 3TQSA 2KBEA 4EO4A 4J1QA 1ZKDA 1GKYA 3C3DA 4P82A 5GJWC 3V4PB 1BWRA 4X20A 3TOXA 1AUVA 5FA5A 4DRXA 2D59A 5E4TA 2ZJ2A 1O1YA 2GEBA 4HPWA 1DC7A 5K0ZA 3GGDA 3LLUA 5KNDA 1V8OA 1HYQA 2UAGA 4NMLA 1MOSA 4EJMA 4Y0AA 2XEXA 4K9PA 3AF2A 3LXUX 3R7AA 4WZZA 1GGFA 2DBRA 1IZ8A 1NVFA 2WPDD 4OXYA 1W5SA 2REOA 4NBRA 5J43A 4ZP1A 1HNXB 3AINA 4HFMA 3NRCA 3IRVA 4F6LA 2AWOA 4P7BA 1BC5A 1JDJA 3E8XA 2W7TA 4ZTBA 5LYYA 5BWCA 3FVTA 16PKA 3K5IA 4WKPA 5F78A 3IPLA 4UTRA 5IDYA 5AVUA 4E5PA 3P9SA 2M32A 4BN5A 4MQBA 1QH1B 4ENWA 2X8JB 2PR7A 3NHKA 1OF1A 2NXNA 1ZGCA 2OB1A 1IM5A 3GA7A 3HH8A 1KZ1A 1M76A 2F3RA 4P58A 2W2KB 1Z68A 4P35A 3VOAA 4KAAA 4YMWA 3ZHQA 2WKPA 4F60A 1A5AB 1QU3A 2PV0A 3MQFA 5G41A 4K9RA 1VL2A 1QKKA 3AWIA 4XH9B 1S7GA 5E0OA 2ZVQX 4GECA 2FFQA 3QU7A 3VPAA 1U8UA 3E5NA 4MUAA 2ZRNA 3RUCA 1XLUA 3S2IA 2IITA 4GOXA 4N8DA 5AW4A 3IULA 3RC9A 4W5OA 1TT7A 3WSVA 1K7EB 1ODKA 4J16A 4MP6A 3O94A 1X8KA 2PT5A 2RK4A 4AO8A 4BP3A 4F7DA 2K7FA 3KLMX 1WR8A 2W6JD 1Q6YA 3FIUA 1SVNA 3IPRA 1M8FA 3USZA 3K0HA 4ARZB 1NPTO 1RZVA 4LDPA 1K4MA 1GQSA 2E4UA 1N2IA 2QSYA 2VDOB 3E5RA 3HGQA 4HR7A 4JJAA 4OJTA 4PAMA 4Y7DA 1L8LA 3HXKA 1K86A 3HWRA 2VSFA 2ZUVA 3IVXA 4MS3A 3UBMA 1G21A 2ZI6A 3OU2A 3NP9A 1WDKA 4YCLA 1JDTA 3A4IA 2DWPA 3G0IA 3HCDA 2R97A 2YJGA 1M1YE 1QWOA 3PDHA 5DW0A 2IHZA 3KQWA 2O1XA 1IHOA 3ECSA 1VXRA 1MFPA 2WSLA 3LKZA 4MKHA 4NCNA 3VU0A 5L40A 2B0JA 2VYVD 4GX2A 3FAZA 4IX9A 4BATA 5FI3A 1YOVB 3LHFA 2VS1A 4FSHA 4M1EA 4OIFA 3VH4A 4ERXA 2OLJA 3BB4A 3EDRA 2P5TB 2GD1O 2WAMA 3KHUA 2HJRA 4W5WA 4IGKA 1PKXA 2DH5A 4CIXA 3I3SR 3GROA 1H8HD 3E05A 1U6JA 5HKAA 1EUYA 3OF5A 4H77A 1NMEA 4YWHA 2IXFA 3JAMA 1JQBA 2I99A 3JPYA 4HAIA 3MJVA 3C6QA 1MN6A 1RAAA 3QXJA 2X8LA 3RBVA 2JZOA 3HXQA 2VHZA 2FN8A 1VYHA 3RAJA 1K75A 3LYAA 1MDBA 4U2BA 2QS9A 3ABRB 5DYIA 5KYGA 3U44A 2WF9A 5TQ2A 4B83A 4F91B 1GRRA 3B85A 4AJJA 1ZZGA 4YV1A 3FR8A 5E38A 1CJMA 1TLFA 4NH0A 2Y67A 1TAGA 1ILWA 2DKFA 1O5IA 1D5CA 1XK7A 2WNIA 1NVXQ 2XUGA 4QEDA 5EWLA 4J1TC 4CU5A 1W48A 3RBXA 1DOHA 3Q7RA 3KJZA 4FYWA 3VRHA 5JQGB 3DCYA 3PNYA 1L5GB 3OZAA 2CXPA 5FORA 4A0QA 1Y5RA 5EPUA 4DCOA 3PLAE 1YK0A 1G8MA 2NZ2A 5TT1A 5E2IA 3LIIA 2IWRA 1A8IA 4RTRA 4J4BA 1UJ2A 1BCSB 2ZT8A 4EGFA 3P0FA 1PJQA 3WYDA 3UB3A 4BWYA 2QNBA 2CCJA 3F97A 5TMBA 1OLUB 3EG9A 4PAGA 3IP1A 1V5GA 4EFKA 2VLBA 4M9UA 2GPSA 3SBOA 4D9MA 4KITB 5IWAB 2WFMA 3CZ4A 5MHTA 1EVLA 4UMVA 4JHXA 2JLQA 1NI4B 1YI1A 2P4QA 4OV6B 3WLIA 2NGRA 3HKBB 2A3RA 3AQ4A 4CCYB 4ZQBA 3DHWC 2P2GA 2CXNA 3CF4A 2PUTA 3G8CA 3N6VA 1YA8A 4RUKA 4ZARA 3OWHA 3TJMA 4W4TA 2YV5A 4D41A 1JWBB 1Y3IA 4A6EA 1IHXA 1T15A 1ULUA 2H1CA 4DUPA 3I28A 3E3OA 4J6FA 5FQNA 4A36A 3S68A 2HCRA 5B64A 4EHFA 1LX6A 2Q46A 3MD0A 3B7GA 2GF0A 3NX4A 3U7IA 4EBFA 5LMUB 3PTLA 3BXOA 4NOLA 3KETA 1Z26A 2ZYDA 2C54A 2P1RA 2XDQB 3MTEA 2C2KA 5CA0A 3MJ4A 4Z7JA 4GLLA 3CT4A 3GJ5A 1GSIA 1GQOA 1CUZA 1N5JA 2W6PA 3K8ZA 4KR0A 4Q9AA 3P9XA 4D3FA 1USWA 1R6TA 2OHOA 3JWHA 3ADBA 4L9RA 3QOXA 5DGXA 1Y63A 2PL1A 3Q9UA 4NBTA 2XUQA 1R8JA 3VAZA 1T36B 5EHNA 3H2YA 4OOFA 3FDIA 5JD6A 4YAWA 5KWEA 5C2JB 3FUUA 3NCHA 2WYIA 3EIQA 4HDRB 3NCTA 1U3TA 3WTBA 2FEAA 1XYGA 2HYDA 2VK2A 1E9SA 1XZ8A 3DULA 3PRJA 5KIAA 2R5WA 4FBGA 4ISCA 1T8WA 3BXHA 4NK5A 2FPOA 4YP5A 4Z1OA 3WIOA 4E3ZA 1WXWA 2VHTA 2FPIB 1DDGA 5J1TB 3BGWA 2VQSA 2Q3LA 221PA 2PG3A 4I50F 4NJOA 2OHHA 1VLMA 2WMNB 2YXBA 5FBZA 3SYTA 3BH7A 5HIAA 1XPRA 1SUDA 2VAPA 2Q3DA 3HJCA 2IUTA 4ZZ1A 2E1RA 2R5NA 2ZIAA 3N9IA 2ZWMA 3PX3A 1CK4A 3C1TA 3HLTA 1JSZA 3GDHA 3IOMA 1CS4C 4RFLA 5LOVA 4DIEA 2P3LA 1E0DA 2C5FA 2OECA 5JD3A 1UBTS 3ZI7A 1ZR2A 3BAFA 2DUUA 1A9QA 1JAXA 2JHAA 4AYWA 2JLWA 1CE8A 4HLNA 1ETHA 5A62A 2VRCA 1KXJA 3ZCQA 3OMLA 4OFBA 5I8WA 2D5AA 2HWWA 4PGMA 1HH4A 9ABPA 7MHTA 4TQGA 4L57A 4Z1MA 4OXXA 5EWMA 1JEQB 1XVAA 1PJ4A 1X2EA 4FS3A 1MJFA 1L6IA 2HYIC 1C3OA 3AI2A 5JAUA 4L9SA 5DX8A 3V48A 1MMFB 4MVXA 1V45E 4BC0A 4U0KA 1DSSG 1X77A 1LH0A 5KSYA 1HI9A 1P7VA 4WA7A 6REQA 3T54A 4XJXA 2IWHA 3VO2A 3M2TA 3VYTB 1XEWX 1ZMRA 2WINI 2XKBA 5DHQA 4UTVA 1T3HA 3AHEA 1FZQA 2L69A 1HTBA 2CJPA 3I0MA 4AP5A 2MSLA 4LN1A 2ZUBA 4Y6PA 4ECEA 1KMCA 3SQMA 5LFAA 4PIMA 1DRJA 1XGKA 3R9XA 4CM4A 4J1SA 4DANA 3AL0C 2Q6OA 3P5SA 3MC1A 3KEQA 2I1VB 3ZBUA 3GDFA 1RPAA 1IEQA 1X74A 5TQJA 1IPHA 2PIAA 4ZCLA 4YRBA 4KRFA 3CV3A 3ZEIA 1UKVY 2H07A 2R7KA 2ZRGA 5IUKC 1T8PA 3CLVA 4UU1A 5IANA 3LP5A 2COEA 5HKOA 2BPOA 4WGFA 5CLJA 1O4WA 4IQFA 1X87A 2PBZA 1Y34E 3CCCA 4B9AA 4BKPA 1RYZA 1B43A 2PY6A 4KXFB 1X9IA 1DJOA 1USUA 4UDYX 4WX2B 3RREA 5IN5A 3FKJA 5DBOA 3ULKA 5GIPE 1V6CA 3DA8A 2DTXA 3CN9A 3DEZA 1K92A 2GA8A 2WFZA 2XF8A 3PUIA 1YNSA 4AJIA 4DSUA 1MEEA 4WN9A 1FIUA 1V95A 1CG6A 4IMPA 3EA4A 1T2VA 1RW4A 2JA2A 2VDKB 4MNTA 3BRSA 1U8ZA 3AJ9A 4ZVUA 4KJZA 4A0FA 4PO3X 1C4XA 1P2GA 2ZWOA 3GLRA 4Q02A 1E89A 4OA8A 1QIHA 4U6NA 3W9SA 4HXFB 4RVCA 1TZCA 1L9KA 3GY0A 3M8KA 4IIYA 4L27A 5ADHA 3PYMA 1XMSA 6ADHA 1M66A 4BBJA 1L5KA 1NBMA 4B6FA 2IZ6A 1GJRA 4PFJA 1NBIA 2YZMA 1L7PA 4PLTA 1G8FA 1TGVA 5A0TA 3CX3A 1OHHD 1XWIA 2FV8A 2EBFX 4W9RA 5ELLA 5T4EA 4Y2JA 1BNCA 3ZGVA 3ZWXA 2JKVA 2TS1A 2F3SA 3VH1A 4BO7A 4X54A 1WS6A 1M6YA 4NZ9A 3O84A 3CQ9A 1KDYA 2RHLA 3GG2A 4EB6B 1WJGA 3MD9A 3RVRA 4KYIB 3TW0A 5EMMA 3WY9A 4ABYA 4ENRA 3GDOA 2ZJ1A 1K89A 4GW3A 4RF5A 1M2OB 3F3SA 2R6GA 3LY5A 2A0WA 2XBMA 1U9YA 2ZRMA 2VLIA 3BD6A 2RHDA 3KE8A 1AKVA 1GLNA 1A8SA 4IZ6A 4TGLA 2B5OA 3VR5D 4PR0A 1WZNA 5CYFA 4M1QA 1CNFA 3PUVA 2CXQA 4EG7A 3JQGB 4F97A 4RACA 1S3FA 2PX6A 3MWEA 3ZXIA 4NYJR 5I5EA 1DKQA 1C4KA 4G84A 4JIMA 3OIFA 1EVEA 3L01A 5A6SA 1D4ZA 1TZMA 3B6MA 3VC3A 2IE8A 4CCAA 3GLKA 1ZUIA 3WWYA 4WJZA 4MQFA 5LMZA 3JVDA 2WICA 3GAZA 2FW8A 1G5IA 3IV6A 4NENA 5IFKA 4AQ7A 4KPYA 4EELA 2CNLA 3E9MA 3I2IA 6ABPA 4EPYA 1D0VA 2TSYB 3DEFA 4W6QA 5DBEX 1Y1SA 5ICCA 3ZQKA 3OURA 4EMSA 1IM8A 1O6GA 1WHTB 1ZEJA 1Z45A 2PL3A 2J7KA 3M6MD 3MLAA 1FQWA 1NT2A 3OQJA 4V0RA 3TLGA 1PG5A 4GBMA 1KRHA 4D7AA 4LWPA 4G5QA 3Q85A 3WI7A 4J0DA 4MV3A 2C96A 1BKDR 3PWKA 3QVJA 3VR2A 3WMRA 4EGAA 1PYDA 1RWBA 1KY3A 2ZIZA 1PF7E 4RDXA 5HKKD 1GT91 3O9VA 3PQ2A 3NS7A 4QRDA 1NUPA 1YCFA 3VUFA 1X7ZA 1V3TA 2YASA 2YIVX 2PUFA 3SQOA 1YFZA 1CY2A 1QYWA 4DA7A 2PFGA 3KOUA 1M5TA 2BF4A 4DRYA 1WNTA 1DEKA 1YZFA 2Q2QA 3PZRA 3W5SA 3AVXA 4M0LA 1YR6A 5LXTF 3ZCUA 5K0FA 1DPGA 1KAMA 1HO3A 3P1JA 4RDIA 5T4HA 2O2YA 5EUMA 1FVOA 3L9XA 2D1SA 1THMA 4WECA 1RBZA 3WB2A 1ESEA 3WBBA 3ZE6A 3L0YA 5DIFA 2GJKA 3KJIA 1Z12A 3DMRA 3ANYB 3WZ2A 4HXEB 5A6VA 1EU1A 5FEUA 4QNNA 3EGCA 3PC3A 3HCBA 4E1AA 2DQYA 2PZAA 2Q4OA 3H11A 3KCNA 1BFUA 3OC6A 4H4DA 4ZU1X 1EJ0A 2EP8A 2I78A 1UXJA 3F5SA 3G0GA 3PFIA 2QUIA 1UDWA 2VI5A 4JLJA 2FPUA 3VMMA 4GP7A 1PJ3A 2ASVA 3BD9A 2OMEA 3D2AA 2BFAA 5FRDA 2I1LA 4BE4A 2NTEA 5EMJA 1QFSA 3C4JA 3D6TB 3KBOA 3AOEA 5T6BA 3T7CA 3PXGA 4A9AA 4EUNA 3QWBA 2H06A 2B8JA 1EFVA 1EB9A 3L4EA 3BC1A 2QSUA 3L8YA 3P45A 3WZLA 5NULA 4FYJA 1SXQA 1FMJA 1XTTA 1ZIPA 3RRJA 4M8SA 1W8DA 2BEUA 1MRSA 2ATXA 5B2EA 2AMJA 3FHJA 4FD2A 4EH1A 4Q66C 2P2LA 3R3HA 2P9BA 3VFDA 4IHQA 4ILEA 1NXVA 3R3WA 2AHOA 3C6BA 3EOAI 4OJNA 4OLHA 3HJNA 3X1WA 3U26A 4J91A 3U62A 3D7RA 4UOEA 2BIFA 2XGSA 3KYDB 3A3YA 3JYPA 1MA0A 1M2VB 3R75A 4MVJI 3K2EA 4D4IA 5HF6A 2CBGA 1H5UA 1JQDA 1TVEA 3F4LA 4ER0A 5C52B 1NVEA 5JD4A 1ZCZA 3T7DA 1SRQA 4QDUA 2FSFA 4D4KA 1W5AA 5KSOA 1N2HA 2G71A 5HBGA 3NBUA 2IY7A 3VSDA 1K08A 1NNLA 2H8GA 3MWFA 1JN0A 5EZYA 3E15A 4H1UA 1V3VA 4O4IA 2DBQA 1E0JA 5IAKA 1M73E 5IT0A 1QVAA 2YWFA 4BIIA 1OY1A 5AFSA 2QEQA 1IXKA 1CQIB 1Y33E 2FX2A 2V7VA 3RIYA 3AIMA 4WWHA 4CTOA 2PU5A 1HL7A 2PPVA 5CX4A 3A6DA 3IKJA 3VQTA 1X70A 3B20A 3HXMA 4L22A 3V8MA 2ATVA 4CM3A 2FUNB 4QU9A 5CUQA 2PJDA 2WYWA 2WM9B 5EP4A 5L3ZA 3ZLBA 4I7EA 1LPPA 1SXJA 1P1FA 4OI4A 4D9CA 3LGSA 3UVEA 3HCCA 4A8JC 5E8RA 5IBPA 4DLZA 4EF5A 4H35A 1ZD2P 3OCZA 5U9CA 3G2MA 1RT9A 3LA8A 4TUYF 1G55A 4OHKA 4KFUA 5KNCH 3PVSA 4RJIA 3BRCA 3JYLA 4K9MA 5MGNA 2GYUA 3AEXA 4DWWA 1BCRB 3I6MA 3DOHA 1J06A 1L1QA 1S8NA 3H7IA 4ZC8A 1CR1A 1OLSB 2CL5A 3G7SA 4KXNA 4E4TA 3G59A 4KWHA 1GCAA 4TOIA 1LXCA 4O6VA 4X44A 3GFQA 3U1TA 3UPDA 3PG5A 4HNTA 4KUHA 1B26A 2PL5A 1R50A 3BREA 3GJ0A 1KI2A 3R5TA 4WFKA 5F1KA 5KYUB 3H0CA 3MFYA 2D2FA 4Z3DA 1T5OA 4OQDA 1M7BA 1Y4SA 2VYCA 4I5IA 3UJNA 1Q0UA 1OMOA 3AR5A 3FMOB 3RG2A 4BO8A 2CXTA 2BN4A 1E6CA 2AYYA 2D7DA 1RZUA 1A04A 1AZLA 1JE0A 3MHTA 2B92A 3EHDA 3AR8A 4N5HX 4JUIA 4MDYA 4US1R 3A25A 2C59A 3KOXA 3T1YB 4EPXA 5J5CA 3B51X 4RD2A 2YKGA 4INAA 1JJIA 1XL0A 1QHGA 3RSZA 1AUPA 3O73A 1KSFX 2I2DA 5D3QA 4QFBA 3DNFA 1EFRA 2I0FA 3KSZO 2Q8PA 1YS7A 1ZJYA 2F43B 4P7JA 3K0CA 2ODEA 3QVGA 4HAXA 1CEYA 5AK0A 3FPAA 1KJIA 3U7EB 1I3CA 2AFHA 1Q92A 2E6UX 4E08A 2O8EB 5A04A 4YA6A 3L1HA 4XYBA 1NDUA 3RAFC 3B36A 3G5LA 1KYZA 1ZGGA 1QBGA 2W37A 4GX5A 5EP3A 3TLEA 4AO7A 2D62A 1EESA 1VDZA 3ETEA 3S8YA 2CHVA 1ADBA 1I0IA 2EP5A 2C42A 1JFRA 3EEBA 2H7CA 3NTVA 3OY7A 4KK4A 4RZHA 1ZRHA 3L7CA 3LT2A 1NZFA 3OQHA 5F4ZA 1N32B 4J7CA 1TRKA 4Z54A 1CUIA 2P9FA 4P2GA 1N2CA 3IE0A 4TZ6A 5H59A 2VQFB 2C2WA 5EJ2A 4MGYR 1DEHA 1FDSA 4CFYA 3A1VA 4BL5A 4A5OA 1UBMS 1YWGO 1G4AE 1CF2O 4OFWA 2XLCA 3N0WA 4K88A 4MS4B 4W7IA 3EVFA 3P0RA 4DWJA 3B8HA 3NFRA 1NOJA 3LFUA 5KC8A 1BIFA 4LZLA 1FPMA 1ECFA 5KC9A 1FFGA 5JS7A 1OB5A 1KAEA 1W49A 1GKIA 1X19A 3LPCA 3NIWA 4YUVA 4I2NA 3TZKA 2VXCA 4A16A 4I14A 3KAPA 4LJYA 1GFWA 3ONWA 3PQ4A 3QKRB 3TW4A 2J46A 5FHQA 1PO7A 2E18A 3TIIA 2PZMA 4YJ3B 4ZHSA 1AO3A 4L6CA 3SDSA 4EVQA 1YQ9A 4Q4HB 3SM3A 3NOVA 3CHYA 3EJWA 4JUCA 4P3KA 5JJIA 2RAFA 1VJCA 5AVWA 2YUTA 3TCNA 1NNI1 3R7WA 5LUBA 3ZWOA 1SZPA 1Q0RA 3V6MA 1Y9ZA 3KSAC 2AF4C 1H1TA 4MPDA 4WZAB 1D2NA 3DMTC 2LE0A 1QVRA 2DULA 1ODCA 2WTEA 3T9EA 4R9NA 5HZKA 1WLYA 2XQVA 3KQSA 4YLGA 1W96A 4ND6A 1VJ1A 2VSYA 1TX4B 4KTVE 4MW2A 3Q7TA 4P53A 4P7KA 1C1DB 1CQPA 1U9CA 1P18A 1II8A 5SZIA 3WBJA 4F86A 3DYIA 2YMMA 3JV7A 1MO3A 4I5DA 1Z8NA 1F0YA 3ETNA 1XD2A 1F9EA 2I6GA 5FFNA 3RVLA 4NIMA 1I32A 1DJMA 3X1MA 1USIA 3I42A 5ES4B 2YV1A 3P2IA 5EN4A 5L45A 1XPOA 4BQNA 1KEEB 4X5OA 2BH2A 3O8QA 3EX7C 1N6RA 1SOVA 4XIGS 5TPWA 4MPJA 5LVAA 2XRZA 1XLWA 2XDWA 3AO0B 1CUSA 3GJRA 4FFBA 2GXSA 2FSVA 3LK6A 3R7LA 1OB2A 1E3TA 1R5BA 5KBYA 3AF6A 3FMFA 3BGSA 2PKRA 4HLCA 2Q4DA 3EW7A 4INJA 3LZDA 2TMDA 1R18A 2JDID 2BLLA 5AOAA 4CV3A 1R3DA 2WVJA 4I08A 3GJXC 4MUNA 2WFLA 3A32A 1PCXA 1CF4A 3B8EA 3GRYA 4EEKA 3CUTA 1WULS 4R9SA 2F55A 4AY6A 1PL0A 1PZMA 2FPLA 4JWKA 3U4MA 4TXJA 3BHMA 4DJFC 2GM3A 1O9GA 1J2JA 1HE3A 3AESB 1OBFO 3F6BX 4YI5A 5JCOC 4JAVC 4GBJA 2YY5A 4J90A 3BORA 4C4AA 3HEMA 3BRWD 1YQQA 3N8GA 4DHEA 4KW7A 1Z0KA 4OMCA 1N0WA 4G2TA 3ZE7A 4IHAA 3MLEA 4LNUA 1CB0A 1Q17A 4FILA 3O4HA 4M87A 4DVGA 1Y1PA 1E61A 2YINC 3FHLA 4H1VA 5A7HA 4C7XA 4RFSB 1X7WA 2EOAA 3PGA1 1W85B 2HRBA 4H18A 4HRAA 4NVRA 4ALJA 5LB2A 5P21A 5JT1A 3QWFA 4F3TA 4KDRA 2QIOA 2I3DA 4EGSA 5JQWA 4HQ0A 5CYOA 4BO1A 2GNAA 3LVBA 2X2PA 1JHQA 3IEIA 3OF3A 1CUBA 3QVTA 1TW3A 2NT4A 2JLXA 2ABWA 4HGQA 2C5AA 3VNRA 2B21A 2W48A 4O1IA 3TXXA 4B4UA 4R7TA 4MGKR 3IRUA 1UM8A 2Z6AA 5HIIA 1S4MA 1K8YB 3DE2X 3F78A 3LQ2A 2VT7A 2ZJOA 1H3EA 3ANNA 4YX9A 3NTUA 5HTOA 4F9EA 2FXVA 3TTWA 3PVZA 1O77A 4HDNA 5FAKA 2W43A 4OJYA 1AZTA 2QLTA 2BSAA 1EVKA 2JHGA 2XWJI 1AKYA 4MWBA 4MHOA 1I3LA 4RIEA 2I65A 4L28A 4LZZA 4LVUA 2LKCA 2XHEA 4ZO7A 5KQRA 5KVQA 4HGRA 3HM2A 5AVZA 4RJTA 1W0JA 2ZYRA 3WGGA 4EAAA 1P2TA 4REQA 3F5DA 3A1FA 1QVVA 4P4NA 5CK5A 4A6XA 5COAA 4RETA 1EA5A 2YWEA 5KYVA 1YA6A 1YVRA 1X14A 2W6OA 4RAOA 1L7BA 1DCFA 4OL0A 2V4UA 3CB4A 2O2SA 4LJLA 3R3YA 4F5WA 4BO5A 1QCCA 2A5YB 5CRIA 3JTEA 4TLEA 2OCIA 3E22B 3EN0A 4MVJE 5ED4A 2UZ1A 2ZJ3A 1SKMA 2FSHA 2B3TA 3O38A 5ESRA 5LLSA 2W6ZA 4PTLA 2IX3A 3CT6A 3TFOA 1BKSB 2EGHA 2J7PD 5GPBA 1E3MA 3FJOA 1GILA 1RXEA 3JQBC 4OSOA 5DLQC 4BDTA 2QTRA 5A4MS 5EHZA 4MI9A 1KZ9A 4ED9A 3WSTA 5I7SA 3ZV4A 3EQ8A 2YBEA 4ZDKA 2WJWA 1T0IA 4Q3CA 5DWVA 2COKA 2V8BA 3VU3A 2DPHA 1ZDMA 3G9UA 3LBFA 1NVBA 2MTBA 3I1IA 1CERA 3N1UA 1DL5A 4QPJC 1LF5A 4X7RA 3TKAA 1SCDA 3P9ZA 2PJUA 1FYDA 3GH1A 3MXOA 4HNGA 3NHJA 1L5RA 2XUPA 1HE8B 1R4MB 2KQUA 4YUYA 3SICE 2YTZA 4E5MA 3X1XA 1EM8A 4IYRA 4OMFG 5SV2A 3RK4A 3UIEA 3CX7A 2QRHA 3OE1A 1ADGA 4QUEA 2NYRA 3R0XA 4KDCA 4KL8S 4TRJA 3NORA 2ZE8A 1Z2AA 4R16A 1A8PA 4CF5A 4F45A 1V1MA 2YVLA 1E2FA 1G59A 3P0IA 4Y2QA 5A03A 3TQRA 2XODA 4D80A 1N25A 3U9TA 1NAIA 4FOLA 2Z43A 4NSNA 3FWZA 3VC7A 1ENYA 3ZI0A 1UADA 3LWDA 2JG3A 1TVKA 2YZ7A 4H7JA 3RSHA 2OBBA 4BFVA 3W1VA 1ZEMA 2BISA 3CH6A 4L4UA 4UHDA 1YB5A 1IXSB 3ISJA 2HEGA 1XLVA 2WG0A 3IAS1 4AJPA 1YE3A 2XHZA 3Q40A 3U5TA 4MQLA 1P6UA 2FUG1 3O82A 4FDUA 4IIJB 4LCEA 4MVJH 4RMGA 2OAQ1 3K6SB 3G2QA 4Z4EA 3LK7A 4FI3C 2BEVB 3FI9A 1MW9X 1JG1A 5TRTA 1FQOA 1NULA 4N76A 3KJXA 4L08A 2EVWX 3ZHRA 5LQDA 2J3EA 4HAYA 4TTPA 2VF5X 2X9VA 1VMKA 2B37A 4B40A 4QO8A 2PT6A 5JAZA 3BJEA 2CFCA 1FXSA 1ND6A 2QROA 2J6CA 5LQMA 3W5BA 4FZ5A 3B89A 4HYEA 1AKRA 2WB4A 1KH1A 3I9LA 4OKSA 2JCGA 2NZVG 4D8UA 1JAIA 3L92A 3CX6A 3R2JA 2GUWA 3CURA 3F4KA 1T1SA 3H2SA 1ADCA 1TJPB 2ZROA 4H7PA 1T5BA 1MXFA 3B9RA 2EU8A 3UNXA 1P0CA 1XTBA 4XD2A 2HFJA 4TKVA 5B4TA 4XQ9A 2C4MA 2NX2A 2ZLBA 2ZTSA 3JQ9A 3NKLA 5E6RA 3X1ZA 2WWHA 1VHWA 5ULLA 4B80A 1CQJA 1TEZA 1EQ2A 3TBFA 2Z1DA 4BVLA 5C7IO 2GS9A 3CUEF 3BJZA 3FF1A 4GQBA 4PS1A 1KORA 3EXG1 5A5FA 4XYGA 2IS2A 4JL8A 1GN9A 3DZIA 3OFJA 4O5AA 1F5NA 2CDCA 2QT0A 2AOVA 4LTMA 4QDKA 3DMFA 4FFSA 2BHRA 3ROEA 4FWTA 4X62B 3W9BA 1MG5A 1P4GA 3RVNA 3A2KA 4Q4CA 1XZEA 2F90A 2Q41A 1Z2DA 4JJ4A 1YMUA 3HRKA 4ND1A 2P6OA 3PWTA 1Q11A 1XNQB 1NVTA 2XWBF 1XOIA 2IHUA 1QG2A 2ZRJA 3THOA 3TOSA 1PR0A 1CZUA 1TU0A 3U39A 3E7XA 3DSRA 4HBZA 4OHUA 4I1YA 4UMFA 1L7XA 3ZGLA 3K9HA 4Q4LA 4UHJA 3N2IA 4LFAB 1FEZA 2FW1A 2D2XA 3PR2B 3X1KA 5CDHA 1S7CA 1X1SA 4GO1A 3AW9A 4HB0A 4KE9A 3FG9A 4Y2GA 5H68A 3TI7A 5FCDA 4G0VA 1SBTA 4D0GA 2DWOA 3COWA 3LZ6A 2B25A 1SCBA 1KPIA 5DX1A 2I6SA 5K0TA 4KQ2A 1Y82A 4AVYA 3DUFA 2E49A 1E6UA 3GRAA 4IR7A 1Q1GA 3QENA 4QBFA 1JDBB 1NZDA 4M7OA 2E48A 4QGFA 2E37A 4LVNA 2PUVA 4AUKA 3INGA 4JI6B 5EINA 3DTVD 4ER3A 1F12A 2PMBA 3AT1A 3KYJB 5LPNA 4D6XA 2AXEA 3UYKA 3EDYA 1R8QA 4NF2A 1DEAA 3ZW8A 1BHQ1 1WKBA 2E5FA 1QE3A 1ZK2A 3GBPA 2IYEA 3KZOA 3TZHA 4NXMB 2PV7A 2OM2A 1YDGA 2Y1GA 4EPTA 3L7JA 1ENOA 3ANMA 1R6BX 2N47A 1CUFA 2W2TA 5CNKA 2A0FA 1JDZA 2PPLA 4NV1A 4LY9A 5DGIA 5DXJA 4DTIA 2DHDA 4CIWA 1XU7A 5IWCA 2VK1A 1PQUA 2YWBA 1CY8A 3TSAA 1CRLA 1EJ6A 1JFVA 2QM0A 4HUQA 3FFAA 1KGSA 1NR7A 4GVPA 1QCZA 1VRVA 4WCFC 3B1FA 1WW2A 1RJDA 3DZFA 1KJJA 1RQXA 1CRWG 4GLBA 5CM8B 5L6MB 1EGMB 2ZU6A 4RJ2A 3GVIA 4WOBA 4I50A 2VZEA 4NDNE 3ESQA 3OQ1A 3REGA 3RRBA 5GTDA 3U60B 1QC5A 1XPUA 1WSBA 3N0VA 4UUQA 3LFTA 1RVV1 4QVIA 1L5OA 1PJ8A 2PVCA 3TR0A 4BY9E 4GT1A 4N3GA 2J9FA 1ISJA 2QTTA 1P80A 3I5YA 1EK6A 4L75A 4TLDA 3VYVA 4TWRA 2JAHA 4HGPA 1WZUA 4OBBA 5FPQA 4AF7A 4OJMX 2EHJA 3D3KA 3FTCA 1SQSA 2QUKA 3PQFA 4G6ZA 2ZVPX 3OA0A 2P77A 4KXXA 3PNQA 1Q0ZA 5K3SA 4XWKA 3UV7A 2MU1A 2XNCA 4N1AA 4X3OA 4M4SA 1L5HA 3RFVA 1EK5A 5AJWA 1OXTA 1VPEA 3AERB 4WACA 1CYDA 4YJHB 4LTDA 1PT7A 3TIXB 5IG2A 3F71A 4XQ0A 1A88A 1JA1A 3SHOA 2OXCA 3VX3A 5K3EA 4PQYA 5KEIA 4BLOA 4YMTA 1YAHA 3VR5H 3EIFA 1JR3E 1JECA 3RYIB 2FHPA 3VNSA 5KO2A 4Q39A 3JATB 5JFOA 2HA0A 1Z8DA 2R7MA 4GX0A 4UU7A 2ZIGA 4FR2A 3VU8A 4Y3UA 3HYLA 1BX1A 2XUKA 1Z47A 3H2KA 3I58A 1SXGA 2FVYA 5E4FA 3A2LA 4KGZA 1O58A 5AO9A 2OCGA 3R23A 4JI7B 2Q62A 3A27A 3BGIA 3LX4A 4P93A 4UVHA 3LSYA 4N8EA 1DUIA 4URZR 1ZR4A 2AC2A 3MRXA 3U3JA 4JP3A 1E3IA 3JASB 4OP1A 1JQ5A 5B1DA 4N41A 3A6PC 1N78A 4V0NA 1IRXA 1YE5A 3ES9A 2P3OA 1OFUX 2P62A 4LWZA 2R1ZA 3EUEA 4LV8B 4LQCA 4RE5A 1VGRA 1WBJB 2PGJA 1UXIA 1DQZA 1KI8A 2PSFA 2I8LA 1B3RA 4LZJA 2HIAA 1JFLA 1ODIA 4FLFA 2YVKA 3ONNA 2IHBA 1RRMA 5WRFA 4C20A 4DLPA 2C9DA 2Z95A 4DNOA 3KXKA 1XEXA 2VJMA 1Y8ZA 2RGUA 4JS0A 2Y2VA 3MEQA 2ZTLA 4ZOCA 1U8YA 5DEOA 1CZKA 3VU1A 2RJOA 4DPKA 2H1OA 1FQKA 4YDQA 3DEYX 1XRLA 2VDQB 4LMPA 1QQTA 1UBKS 2R8XA 3CLTD 1N8TA 2D06A 1E69A 4ROSA 2A0XA 3DXZA 4OG2A 1CHDA 3ZCRA 1GV0A 1NYTA 2DHQA 5AK4A 3VHQA 4LW8A 3GP8A 3DFMA 4Q3KA 3C6XA 5EIEA 2B8TA 3ZE0B 4CV1A 3CC8A 3U61B 4G1FA 3C3KA 3LKDA 1ZOOA 4PC7A 5U4QA 4MZDA 3ND7A 1SHUX 3EA5A 2XMCA 3JZIA 4ILKA 1OC4A 1I36A 3MWGA 4J1NA 2QTFA 4WXRA 1A5ZA 3U19A 3CVWA 1TPYA 2CHUA 5TVGA 1W44A 2QRKA 3CF0A 1ZIOA 4TTAA 1SJ9A 1RMYA 1PNQA 1Z5NA 2HCBA 4GM1A 4HMPA 1Y5MA 4LHVA 4QRIA 3UH1A 5JW6A 3Q3CA 5TARA 2VUUA 5JDCC 3RIXA 4QULA 4GMHA 3BE6A 1THTA 4X8HA 3FDFA 3W9YA 3EEFA 4Q1AA 1W8IA 1YTUA 2GGSA 4ZRNA 3DKPA 2NV2B 1XDWA 4MWTA 1Y9DA 1IJEA 2AKAB 2CE7A 4EQ6A 2RBGA 3FWPA 3OKCA 3MMXA 5D6OA 2LCQA 4Q4AB 2C3PA 2BJHA 1CP2A 4R8SA 3EVCA 2H51A 5IJ9A 1RZRD 1M6VA 4YAGA 1P7PA 2G7MC 5B3JC 5CAEA 1QS0B 3I23A 3CKYA 5I6DA 3GLFA 4URUR 4MKRA 1ISPA 4ZXFA 2CLOB 4JYMA 3U7QA 3AONB 3M49A 4GXQA 5M34A 5EG5A 5E6SA 1BH6A 1XAGA 2ZU0C 4O02B 5K05A 2BGKA 1QYVA 4MO9A 2LCFA 4QXRA 3PNMA 3DBVO 3KAJA 1KTIA 4AY4A 5BURA 5GJVC 2CZGA 5HNKA 1GDDA 2YWJA 3GFBA 1OXSC 1R4NA 1TAHA 3CEPB 3HA2A 4AY3A 3ZD7A 1D8AA 2Z09A 4H59A 4MV0A 2XYRA 3O90A 1TF7A 2ZGVA 3QFTA 5D5PA 1NRWA 3X0DA 4HVLA 3ABQB 4EG4A 5EWJB 5IJ0A 4PG6A 1JQKA 1Y7HA 2HU5A 2IZ1A 2VF4X 3AI1A 3KZMA 3BSYA 2HBRA 4YJ3F 1Q0QA 2BGRA 1XQVA 2FG6C 2HU2A 2ZJ8A 1H3FA 4I46A 5CLIA 5A02A 4BB9A 4AMYA 4KXWA 2V7GA 3FSGD 1HLGA 4HS9A 3ZWKA 1W73A 3KTAA 2IYLD 4YFVA 5FOXA 5KOJA 5LP1A 3F2VA 1EINA 2Y71A 2XOKA 3ROGA 2P79A 1RM5A 3C16C 3TLZA 5I48A 2D7CA 2VP0A 3CH7A 3MGGA 3ON5A 1FUIA 4ZDJA 4GPTA 3T3IA 3M2PA 2GK4A 4KHZA 2ODPA 4G4JA 4UAUA 5K9ZA 1KTVA 1N3YA 4QECA 4AMUA 4K87A 4RKQA 2SCUA 2FWBA 2G76A 2H59A 2H5IA 1IJBA 3SGLA 1UJ4A 3GEHA 4PBRA 5CNIA 3NO4A 2XB6A 1ZH6A 3Q2IA 5BVHA 2VJOA 5DM4A 3W1WA 4RDHA 4OYHA 3NWPA 2EYUA 4JZYA 1U6IA 2OZKA 3NV9A 4C0JA 3CVJA 4LBZA 1BAPA 1K7SN 4I3FA 2Q9CA 4K3UA 5LXTA 4YDRA 2Q5QA 1JKJB 2Q28A 2CHEA 4WCVA 5T3UA 3COSA 1G3MA 3FOFC 1YS9A 5T3YA 1UJMA 3F5MA 5C8XA 4TSFA 1U2ZA 4EKNB 3CRW1 4KAFA 4ND4A 1YJBA 4YLYA 2YHIB 1SB9A 3QTBA 1WPQA 5GY7A 1DOZA 4EYEA 1H0RA 1R5JA 3AVPA 2Q3CA 1VJ5A 4FEYA 4KPGA 1LD3A 5B3LA 2O8NA 2XDAA 1P72A 1H4SA 3GELA 2X1LA 4RM3A 2V1XA 3F49S 1HT2E 2Z1NA 3T0IA 3M34A 4Q3OA 1E8MA 2YQZA 4YRJA 1Q1ZA 1N1MA 4LKRA 4IKPA 3NEPX 4YAOA 1D4AA 2OV3A 3CCBA 4FC6A 1WUHS 4QGBA 3W3AA 5D01A 5KREA 4B45A 5I4KA 3G85A 5TR9A 5BMVF 3SDBA 4I4NA 4QJ5A 2OPHA 4J2HA 5CA1B 2H1HA 3HFRA 5REQA 4JLNA 3R7BA 2OGUA 1KERA 1KY2A 2ZYGA 1E2IA 3LGXA 4N3BA 3WLHA 4Y2XA 4QG3A 2WAYA 1XMPA 1EIZA 3I01M 5AR1A 2I66A 3HHPA 4JC5A 4H15A 4EY5A 2G77B 3GEGA 4FTWA 4BAUA 5D6NA 1CUHA 2RBEA 4LZWA 4RV9A 1EM6A 5DV9A 3UOAB 5LP6C 4E1BA 3TQFA 2C7RA 4BVHA 4TKUA 2FQQA 4LMRA 1CEXA 1EUQA 2MSEB 1QRRA 3CUSA 1M0SA 1UXOA 1JDVA 2QU7A 2BP7A 3LPMA 1KVUA 1D1QA 2BE7A 2XSZA 1WMEA 1NVKA 2SKDA 2YR0A 3ESRA 3HRIA 4I6EA 5C5CA 2VP4A 1IG0A 1VG9B 2ZIUB 2CUKA 1GY8A 2RFLA 3ZWVA 1QHHA 4Z3OA 4X3CA 2XTAA 4HF7A 1YK1A 2P11A 5BO5A 1FUUA 5BSRA 3HY6A 4CMEA 4CN8A 2FSIA 2ZWPA 3I05A 5CTJA 1L4EA 1LSOA 1P9OA 1QZTA 2FMUA 3IR6A 1B14A 2FRDA 5B1YA 1CD5A 4EKDA 1RMQA 2ZB3A 5I5GA 2UZ3A 1I94B 3QVXA 3DDZX 3JZAA 1HKUA 4FSXA 3TFWA 3IUPA 2VH5R 2VDUE 3ZHOA 1BDIA 2D5BA 5J4LA 4LJ8A 2J6BA 3AIOA 3ENKA 1J7KA 2Z9DA 1QH8B 5AOBA 4H7EA 4FYIA 1RI4A 3GJ8A 1MTZA 3T0FA 1Y80A 3JVEA 1XJ5A 3B2EA 5DM60 4E2XA 5I7UA 1XU9A 1DQPA 1AJEA 4RTQA 1R6AA 1W19A 4EUSA 1Z73A 3TN7A 3L6BA 3FWNA 4NZZA 1TM1E 2WABA 3L8FA 3UO8B 5LR6A 1NG1A 2GUGA 2ZCUA 4TUYA 2KYRA 2I4NA 2AMYA 3G02A 4W8GA 4NDAA 4BTVA 1JLSA 4HO1X 5LYJB 3GRFA 4AY2A 3OLZA 3RJZA 1IN4A 2J6HA 3ESBA 3JS5A 2ARKA 2YMLA 1SCNE 4TWJA 2IUUA 3ZVKA 4CEIA 3AF3A 3MTGA 3PEEA 3MLBA 1L1EA 4UBLA 2P2ZA 2VO1A 2VHWA 3SLGA 1TYDE 2JFNA 5TB5A 2P2DA 3ZEAA 2V4MA 4INPA 5EQJB 3OEWA 2A7QA 1UAYA 3Q12A 3U9LA 3ZCXA 1A27A 4PSDA 1W88A 1SKYE 1F14A 1U7ZA 3E3AA 3JYQA 3F9RA 4PZDA 4RS3A 3TPZA 1XROA 2HQBA 1PV1A 1SA0B 3WB9A 5K99A 4QBGB 4XCVA 3NVKI 1NVVR 4AURA 3PWSA 2FOXA 1BGWA 1ODJA 2O2GA 1TMOA 4WXEA 3JR7A 2BGNA 5I8ZA 3COPA 1T6BY 2FW0A 3NM4A 3ZQUA 2JLYA 5BN3B 2EKZA 1GTZA 5BT8A 3HXLA 1WD5A 1U65A 3I34X 4MRMA 2PZLA 5DF1A 3ZHYA 3HYNA 1OT5A 4I4IA 3TIVA 1VGVA 1JB9A 1K3UB 4A1OA 3OZIA 4BNLA 3GRKA 5IXJA 3IXMA 2ERCA 3P52A 2XI4A 3LLMA 4R9VA 3WMFA 2O1EA 2JAQA 5K7SA 3S99A 5EA2A 4HFJA 5HMMA 4LDNA 2ZETA 1XP5A 3DKKA 2PCLA 1B6GA 3W7VA 1TU3A 1CQZA 4RM2A 4OGGA 4QX6A 1YDEA 3GR6A 4QUHA 3TL2A 4R1TA 1NXTA 4KR6A 3C48A 3GXOA 3FPHA 1E0AA 1QJ4A 4EECA 1L5FA 2OFWA 3H0KA 2RI6A 3KFVA 3WNDA 1XVUA 5EJ6A 1MC8A 4GOKA 4IPTA 2E87A 2PA0A 3MIIA 3WADA 1YRLA 1Z17A 2GB4A 4JLVA 4MA5A 3WK9A 1KI4A 4HLDA 1FU7A 2AJBA 4FJ2A 3ORQA 5JI2E 1DHTA 1TIKA 1YRWA 5BNTA 4FYMA 1DUVG 1WRBA 2M1ZA 3U56A 2QMZA 3A7DA 1CNMA 2OV6A 2R62A 2VPXA 2XV1A 3L6DA 3O47A 2Q21A 1X2BA 4QQKA 3COZA 3C7KA 2XB2A 1Q83A 1Z0JA 1GL7A 3BF7A 4AIIA 3TJZA 1UDXA 3OZDA 1TKAA 4MWOA 1E98A 3ROMA 3RRZA 2KPOA 3CEJA 5ICFA 3LQYA 2HA6A 4Q4JB 1VI6A 3A1CA 4CMAA 1XZPA 3A31A 1KC1A 3QQ5A 1YS6A 3A6FA 4D3YA 1OXKB 3U1VA 4DLTA 1IZ9A 2VTVA 3ZXXA 4NMHA 1JFFA 2BGJA 3IVRA 5E2BA 4B34A 5G1OA 4A5SA 4XOIA 4TV9B 3QXCA 5TS3A 2UUBB 2F1OA 1Y48E 2AFRA 2IY8A 2IYNA 3LF1A 3V1TC 3DS8A 4F46A 4B47A 1FFYA 4JBLA 1VE1A 1YDMA 4QICA 4WVFA 4Q7MB 4S2EA 3THXB 1V1RB 3AXSA 4CMGA 1FLAA 1KR2A 1RM4A 3VR4D 4O0MA 2NU7A 3PNPA 3NM5A 1IBRA 3R3SA 1KFCB 3DVAB 3SX2A 4OHFA 2YC2C 5BPHA 3I76A 5K1ZA 1UBSB 2NOAA 2PQ2A 1XXHE 2QTBA 4RHFA 5TJ9A 4C4PA 1KMIY 4ME6A 1Z13A 2IPMA 4NNJA 5KINB 3J81k 4C5CA 2VPTA 4KE7A 3KSDO 1PSWA 1ZD9A 3ZE8A 1FJHA 4F96A 2IQIA 1A7AA 4BNYA 3KCQA 3KR9A 4LE1A 2F62A 3TPCA 2O7QA 5BWBA 3AL2A 4MWZA 3SEAA 3G0CA 3W8EA 3DL0A 4MR8B 4AWXA 1NW5A 3VZPA 4YRMA 1SHZA 4F11A 4WI1A 3E9EA 4DR5B 2NU6A 4DVJA 1GTL1 3NRJA 4R1OA 3OEED 3W34A 4J7UA 2IV7A 2W8BB 1C7QA 3JQ8A 4TWBA 3OX1A 5DNDA 1D2CA 2V65A 2JAUA 1ZN8A 3KVVA 3OAAA 4MV8A 4MW5A 3QKIA 4DEVA 4YY3B 1I5EA 4YRQA 2HL6A 1T9BA 4C21A 2VCHA 2XIJA 4TXNA 4I9FA 2G6TA 2AG6A 4YLEA 2C4UA 3GFRA 3EW9A 1VCOA 3FYUC 1Z88A 3ZHTA 3AM5A 2RE8A 1VIYA 2CUNA 3FM9A 4BPBA 3AKCA 1G8PA 1T34A 3KZVA 1KDPA 4JLMA 3M89A 2J3KA 4TL7A 4BN0A 4ZCMA 1RWWA 3Q1KA 9GPBA 4HDCA 4OCZA 5CVJA 4Y9RA 4I5GA 5HPYB 1UQUA 4JBYA 4ZPJA 3BOSA 2Y8EA 1KC3A 3U0BA 2BEKA 4I99A 4RW0A 4FFPA 1M2WA 3PEVA 3GPDG 4N7JA 4RYLA 3V8QA 4B7UA 4BC1A 2ZPUA 1YI8A 2YUIA 5EVCA 4YGYA 5FKJA 4GRIA 2X0IA 4URHA 4Z6KA 1PT5A 5CJ2A 3NW9A 1YVEI 4PNHA 3MT0A 2XRMA 3W6OA 4C0BA 5A9RA 1FSZA 2O23A 4HQOA 4BX0A 2GTIA 1M1NB 2FB9A 1R8XA 3G3EA 1JKMA 5LN1A 4R2XA 3V80A 4G8CA 2PE5A 3IUQA 2B7BA 3C3YA 4DLYA 4JT4A 1LEHA 1SG6A 3KTOA 4B82A 2VHYA 3QZUA 4G0NA 2YX1A 1GZDA 1GPUA 1NJ6A 2LVBA 3SC3A 1QUEA 1CDEA 3IP5A 4NABA 1T26A 2PT7A 5BN3A 1OPRA 4RGBA 2TMKA 5DM2A 1N4DA 2P1ZA 5JSKA 3IIEA 3TBKA 3C87A 1S2NA 3OE4A 3UOGA 2BFBA 5JZBA 4GP9A 1IWOA 2QD1A 2FETA 1KFKB 1XKXA 2DSNA 4NHOA 3ENNA 4IJ5A 3UUEA 4NBLA 3UWSA 1R9MA 5FLKA 2C61A 1VJDA 2H8KA 2IOHA 3C24A 3SQLA 5A1TA 1J0BA 5BUSA 2OCYC 4CM8B 2H1VA 3BCUA 5D85A 4EHHA 3KR0A 4G67A 1P91A 1X8LA 2VRCD 4HOYA 3RI3A 3CG0A 4LJ4A 2NV0A 3H99A 4COOA 4HNHA 5EJ8A 2WTAA 2PZKA 4Z1MD 4ZJZA 1GT6A 1U04A 1VIVA 4D82A 4NZYA 3E2MA 4X8LA 3TR5A 1UBCA 2GDZA 1A3CA 1DV1A 2V7WA 3H8VA 4JB0A 5B4VA 2DUMA 5E1BA 3GLGE 2G67A 5BNFA 1UMDB 3WO1A 1P9WA 1MR3F 1ORVA 2IZZA 2P9ZA 3DMDA 3U49A 1UDRA 4JMPA 1QUFA 3GT7A 5I9BA 4ZI3A 1C14A 1SCUA 3N0RA 4JUAA 3ZDFA 7REQB 4BBPA 3AKZA 4ZK2A 1FP4A 1M34E 3W78A 2JGRA 3GCWA 3GJ3A 5JNVA 1YVDA 2XXAB 3T3HA 1Q1EA 4GI7A 3CLTC 3C3AA 3GU3A 4M89A 4IQ0A 4MIEA 2RHCA 1KU6A 5K6AC 1HE1C 4WESA 2NUTB 4V2UA 4Z4QA 1LB1B 2EWMA 3TL6A 3TTUA 2Z1MA 3MRVA 4LNAA 2ZYWX 3A04A 4JH0A 1JI3A 2GVZC 3U40A 5JAIA 5KVAA 2VQ6A 4WTOA 5LU9A 3GLIA 2R7LA 1F8XA 5LJIA 1YR2A 2C58A 4B3TB 3ADOA 4JQOA 3G2LA 1N0HA 4GSLA 4R68A 4UCXA 4HVCA 4Z0NA 1M2NA 3I9NA 3FOCA 3QV1A 3ZLVA 1DKLA 4KQ9A 3DEJA 2FRVA 4CTJA 3QLTA 5BWMA 4UPEA 4K6KA 1DT5A 3RB8A 4WMLA 4I2VA 4E6PA 1C7EA 4BRUA 5M04A 1TZ2A 3UXYA 3NBFA 2TRSB 3V7NA 2QUJA 3RIHA 3DTNA 3G2JA 3AB7A 4RHCA 2WSMA 1JZTA 3M6WA 4NICA 4GBGA 4IV8A 3OOYA 2FZ5A 3PLNA 2P5YA 4HNAA 1LRLA 2G5GX 1OFGA 3W06A 2NNLD 4DE5A 1VKZA 2QZSA 4ZWNA 3PQ7A 3HBMA 3RC1A 1XTKA 4DN6A 4OM7A 2OQVA 2YN0A 1RTKA 1DB3A 5H83A 2ZSEA 2GH1A 4E2WA 4EP1A 2BUCA 1EFLA 2OOKA 1KYQA 1LQUA 1QOPB 2Y1CA 3KSRA 3L0ZA 3NIGB 2BCGY 4NPCA 3T6KA 4EB8A 2AI2A 5JLJA 5CT9A 1DXYA 4K9LA 3WMEA 5FWDA 5EJGA 4DCGA 1CEEA 1NBMD 3NDJA 2D5LA 1HC7A 2GEFA 3KE9A 1U11A 3U3RA 1ZMOA 3JQFC 2Q7DA 1M54A 3LUGA 2HGZA 2F8SA 2QLBA 4J7XA 2Q6LA 5CFPA 3NXSA 1GNRA 1XE3A 2L17A 3LUHA 4RH3A 4XRGA 2B7LA 2FLVA 4ZRDA 2C5SA 4FMCF 2HT6A 1SQ0A 2HRQA 2CC2A 2JLBA 3Q8LA 1W2HA 1NN0A 1Y1QA 2F6RA 3OLQA 5HF5A 2OLEA 3Q8MA 1VE7A 4MUYA 4PRKA 1N9GA 2JIMA 5C1BA 3MINB 4DJJA 3BWCA 3KP1A 5THQA 4YRIA 1OZ0A 5FXMA 4JLAA 5KX5A 1QGDA 1R88A 3DEIA 3QFRA 1UJBA 4BNZA 1Z0DA 1O9BA 3Q7EA 5A4AA 1QP4A 4H0NA 1AGRA 4ZMRA 1VA5A 1II0A 2FOIA 1OU4A 2V45A 1GPWB 2P7IA 1HYGA 1TUBB 2B3DA 4QTUB 1N2XA 4WN3A 3FOBA 5ALJA 3RC2A 4XJVA 3AETB 3H4MA 4HX9A 2QORA 3KAKA 1NG9A 3QV2A 4IMIB 3BA1A 3IQXA 5KUTA 3VKGA 1S8OA 1V0JA 2A5JA 2H08A 3FW1A 3SHVA 1ZUHA 2JAWA 2ZW9A 4BASA 1ZGBA 1YFKA 1PK7A 1SCKA 5HGJA 2ZXFA 4NCXA 3L7IA 1ZYUA 2DX7A 2NZ8A 2FGKA 1DAOA 2IU4A 2XUHA 4RL4A 3UUFA 2Z58A 4KB5A 3D3WA 1B7GO 2GCOA 4G65A 4R01A 2Z4TA 4BFXA 4MVYA 5A3VA 3QYPA 1NBEA 1JHZA 3HCWA 4G5FA 2HSWA 4XFKA 3ZG6A 4QDJA 5CDYA 1GN8A 1TCVA 2QRVA 5AVSA 2QSZA 1FVXA 4IO1A 4IOLA 3GT0A 4RULA 3BGDA 5PNTA 1SK8A 4UTOA 1K7FB 3LCRA 1LJLA 4NZNA 4D5GA 4OBWA 1H2RS 1HDGO 1ZU5A 3T7EA 1OWNA 4IDBA 1JH8A 4HNVA 1YUMA 2JD1A 5HX7A 4GUAA 1UZMA 4LCBA 1WDTA 2WE8A 4N6NA 5HJ2A 4PTYA 3IVGA 5ANRB 1PRYA 3S7TA 3CJQA 2BGWA 1CDOA 1NURA 2IXDA 4O2BB 3U16A 1F8YA 2HEIA 5ESWA 3B1JA 5LDHA 4NJMB 3DFFA 3NNNA 3HYRA 4QTXA 1WY5A 3HPQA 2CN1A 1Y3FE 3GW8A 4AKSA 1M8KA 3KL2A 1G20B 2G28A 3HR7A 4MI3A 5GGYA 3VPGA 3R4CA 3RWOA 5AVTA 1R0KA 5C4IA 5L9AA 5ALYA 4MCAA 3BMQA 2FMHA 2C4HA 4OF4A 1IQPA 6NULA 5KOHB 1O0CA 5GGXA 4M46A 2M6RA 3PF8A 1JYSA 1HR0B 3CGGA 5CB4F 1G8GA 1WMAA 1C9NA 2AFVA 5DKFA 2HLDD 4B0OA 1P2VA 4E07A 4QJ3A 3IURA 4TZ0A 1ULHA 2C5BA 1T2UA 3VPHA 4HN9A 1H69A 4G37A 4NMWA 2ZITA 2BSXA 3ZNPA 2HSGA 5JXGA 2MSKA 2HJVA 1FU8A 5AXAA 5EJ5A 5G0WA 1OFUA 2ZJAA 1R0ZA 1AGPA 3QMMA 3R7NA 4ZYUA 3FPLA 1DELA 1NLMA 1LTQA 3FNFA 4Y30A 3LHDA 4BLWA 4ZT4A 3CR7A 3NGXA 3RYFA 1YS2X 3D8UA 3IAEA 1V1JA 3KX2A 3S81A 2I7DA 3E6AA 4S24A 1HKHA 3GUUA 3UQYS 1LU9A 3S70A 1OX5A 3C1OA 1K66A 2GBLC 3OD1A 1KH3A 2VKTA 3JY6A 3K9LA 4JVSB 4PF1A 1NOIA 1EFHA 1PR6A 1U8EA 2B4QA 2GLTA 3P9YA 4YJKA 3U6KA 1AHHA 2GM4A 3TW8A 3V1NA 4B7ZA 1MAWA 4AJNA 4LJ5A 1BX0A 1IMOA 3GO4A 4NE9A 3WNZA 3T5BA 2GK6A 3WHLA 5C8YB 3T95A 5JADA 4DMLA 3CPEA 1N6PA 1BE6A 5LD2B 1ACJA 2ATIA 5FX2A 1A9OA 1JZSA 3TQOA 3RAGA 2P8SA 3DNMA 4N4AA 4D57A 2HF9A 4JJEA 1JG2A 4OKNA 3ADDA 2G8LA 3DE1X 1EX6A 4MZXA 4A73A 3HSKA 2DFPA 3UAWA 2JPDA 3G8BA 1K6IA 2CY0A 2V7UA 4RD0A 3K20A 5IKPA 1JFTA 3DT6A 2BTOA 2PJRA 3EFOB 1JV2B 2RGXA 1B1CA 5I01A 2JFXA 2IX9A 4NCKA 3CO0S 4FWBA 4M9ZA 4S1N