4HTFB

Crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
247
Chain Sequence
MQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAIKMAERGHQVILCDLSAQMIDRAKQAAEAKGVSDNMQFIHCAAQDVASHLETPVDLILFHAVLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMSPDYPRDPTQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDCYEALLELETRYCRQEPYITLGRYIHVTARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-adenosylmethionine-dependent methyltransferase from Escherichia coli in complex with S-adenosylmethionine.
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords S-adenosylmethionine-dependent methyltransferase
total genus 88
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4htfB00
2FCAA 2VDWA 1BHJA 5JR3A 1NBIA 4E2WA 3SVZA 5EVJA 4HGZA 1L1EA 2P7IA 2JHCA 5K0NA 1P1BA 3E05A 5CVDA 2FHPA 2IP2A 4RVHA 3DUWA 3PVCA 2ESRA 4F86A 5K0BA 4K6MA 2NXNA 2G70A 4X60A 1NW6A 3SGLA 2VDVE 3MQ2A 5KQSA 4E32A 3BKWA 4GF5A 2ZVJA 4P7JA 5EC8A 2ZIEA 3UJ7A 2ZWAA 4OQEA 4M38A 1DCTA 3UJAA 4BLWA 4QVGA 2Z6UA 4CXMA 3FPJA 2GH1A 2P3QA 2KW5A 2QM3A 2UYQA 3EEYA 3PB3A 2AN3A 4C04A 5BP7A 3UJDA 3KU1A 3EVCA 5EEGA 3D2LA 4MIKA 5DSXA 3FPEA 3FUUA 3M6VA 1YF3A 2LD4A 1QYRA 4QTUB 2AOTB 1NW8A 4HC4A 1EIZA 3C6MA 4KWCA 5D1HA 4V0RA 1QAOA 4X1OA 4QDJA 4QQNA 5EHIA 4Z2YA 4YUWA 1JTFA 3DXZA 3EMDA 1L9KA 3LKZA 2AOXA 2UYOA 5FULA 1NW7A 3K6RA 3KPYA 5EHGA 1EJ6A 1NV8A 2XBMA 3VC2A 3PX3A 4HG2A 4F85A 1I1NA 3KQPA 3UJCA 2NYUA 3FYDA 5CD1A 3FRHA 3NVKI 1RJEA 3KPJA 4M37A 5E2AA 2NXJA 5HIIA 5GWXA 2G71A 4RTKA 3TMAA 3TKYA 1RI5A 3CJQA 3HCDA 2IIPA 4DF3A 2H1RA 4E2YA 1HNNA 4OX9Y 1SQGA 4GC5A 3B3FA 3OE4A 5DX8A 2DPMA 3EVBA 5CVUA 4FZVA 1KPGA 2ZZNA 2V7EA 4UOEA 3KQWA 3DH0A 1ZKDA 1QANA 1JQ3A 2BR5A 3G2PA 3TQSA 4DCMA 3ORHA 1INLA 1YZ3A 4FR0A 3MHTA 1I4WA 4Y2HA 4R8RA 3FUTA 3ELYA 3GRVA 4CKBA 5LQRA 4AZVA 3PS9A 4PINA 3I5UA 3PFGA 3C3PA 3C0KA 2YX1A 2PY6A 5E8RA 2C7OA 2C7RA 3RW9A 4PIPA 3V97A 2AR0A 3HCEA 5FQOA 3GU3A 3A27A 3I58A 2B25A 3PLAE 2ZSUA 3GRRA 4R6WA 2P7HA 4P7GA 5LR6A 2QRVA 1YFLA 3FZGA 4PONA 3CC8A 3SM3A 3PT9A 1MHTA 5E1DA 2EG5A 2QY6A 3I9FA 4RSRA 2P40A 5CVJA 3G88A 2UYCA 2OO3A 2OB1A 1R6AA 3MCTA 3R9XB 5DRYA 2HV9A 3IEIA 3CVOA 3FTDA 3KHKA 2FK7A 1UFKA 3FUXA 5KVAA 2PLWA 4DMGA 5LQUA 4RTJA 3TRKA 4P58A 5FHRA 3OCJA 5T6BA 5K0GA 1AF7A 4IKPA 3REOA 2Q41A 4C06A 2YUIA 1XDSA 1VL5A 4WXHA 1ORIA 2FK8A 1F38A 3GXOA 1X1AA 5EMMA 5EMJA 4R8SA 2OXTA 3V8VA 2JJQA 5H02A 5FA8A 3VYWA 3DR5A 5K0LA 3SSOA 3ERCA 3G89A 1DL5A 4RVDA 1JG1A 1ZGJA 5HEKA 4L7VA 4BLUA 3BWYA 3NMUF 2OB2A 3TR6A 3TKAA 3UJ9A 4A6DA 5K0FA 3EEOA 1FJXA 4OBWA 5CVVA 4YV2A 2HMYB 4POOA 2P1DA 3EGEA 5CUQA 3EVDA 4OQDA 3OU2A 3NVMB 3LKDA 1B42A 3T7RA 4B17A 3UJBA 4X63A 5F2OA 3NWBA 3C6KA 4H0NA 3LHDA 5DM2A 3BKXA 5K09A 4U7TB 3S68A 3DP7A 3A7EA 4EMSA 10MHA 2N47A 2ZIFA 3MGGA 4HSGA 2Y1WA 3EVZA 2FPOA 1R8XA 4PGHA 1QZZA 2JH8A 4PYOA 2OZVA 2ZULA 1M0EA 4ISCA 4QVKA 4DZRA 5E9WA 4MHTA 3DTNA 2NP7A 1V39A 2G8NA 1RJFA 2O06A 3HA3A 3X0DA 1VQ1A 1P1CA 3U81A 3PTAA 1YUBA 2CMGA 5EMKA 3A7DA 2OKCA 2YXDA 5DM1A 1WZNA 1UWVA 2ZLBA 1IY9A 1T43A 2QE6A 3EPPA 3G8AA 3P2EA 5E9JA 5K0EA 1WS6A 2BM9A 5K0CA 3CJTA 4DKJA 3BT7A 5KQRA 1Q0TA 3R3HA 1JSXA 3Q87B 5ICGA 1XVAA 2XVAA 3HA5A 2GA9A 2B3TA 1OR8A 5G02A 2O05A 5C1IA 4QPNA 4EVIA 3KPVA 4PYKA 1R8YA 3IYLW 3KQYA 5CVEA 4GQBA 2ZBRA 4PYQA 1I9GA 3LSTA 5E9QA 1EAMA 4DM3A 4GBED 1F3LA 3SX0A 5FQNA 3KPUA 2IGTA 1O54A 2C7PA 1JG4A 3M70A 4GOLD 3UA3A 3FYCA 4XCXA 4RX1A 5K0JA 5CIYA 1M6YA 3GIWA 3I53A 1ZHFA 2AOUB 3FUWA 4X61A 3UA4A 2PT6A 5LQNA 2AOTA 5LQKA 4IWNA 5FHQA 3BWMA 3OFKA 4RTPA 3THRA 1AQIA 3OPNA 2I9KA 2BZGA 3EVFA 3R6TA 1UIRA 3BGIA 5FUBA 2VDUE 5FWDA 4YUZA 2VP3A 1SQFA 2P8JA 3P9KA 5LQJA 2ONZA 4U7PB 3MERA 2WA1A 2JG3A 1N7IA 2F8LA 3HVIA 5EQJB 5ICFA 2IBTA 2JHPA 4ER7A 4ER5A 1BKYA 2PWPA 3JWIA 4KIGA 2IDJA 3SR4A 5ERGB 1BC5A 3FTCA 3GRZA 4AZWA 2ERCA 1RI1A 3AJDA 3GJYA 4PYIA 1TW2A 4EKGA 5LQAA 1KHHA 1WG8A 2PX5A 3R0QA 5HIJA 3UFBA 4RTRA 3DULA 3G2QA 3F4KA 2NP6A 5D1NA 1YB2A 5DRTA 4NECA 3E23A 3ER9A 3O7WA 1IM8A 3B3JA 3GRUA 2PV0A 3KQQA 4RTNA 4AX8A 3P2IA 5C9ZA 2I7CA 3K0BA 4IV8A 2IFTA 3SSNA 2P35A 4RVGA 4QQKA 5EOVA 4E30A 5K8VA 2UYHA 2V74B 1JG3A 3P8ZA 2IH4A 1FBNA 2AN4A 3R24A 4MQ4A 3HTXA 2PXAA 2YTZA 4GOND 1X19A 2AOWA 1JG2A 4E31A 1G8AA 1ZGAA 4V0QA 1Q0SA 5EIFA 2HR1A 4XUEA 3ELUA 5BW4A 4YMGA 4GEKA 2OYRA 2VS1A 1IXKA 1O9HA 2QRVB 3DMHA 2PX2A 3MB5A 4JXJA 5C0OE 4HTFB 1ZQ9A 3LGAA 3ELDA 3TPZA 3A4TA 3T7SA 5E1OA 4YUYA 1KR5A 4FT4A 5GOZA 3AY0A 2HNKA 5FADA 3C3YA 5HIMA 2PGXA 1JQEA 4QDKA 4EQZA 2G1PA 3ANXA 3B89A 3LPMA 3KR1A 2GPYA 2ZFUA 3FPFA 4QPPA 1WY7A 3EMBA 1D2GA 4YV0A 4CKCA 1XTPA 5HZMA 2IH2A 2WK1A 3NDJA 4EKIA 4WVLA 3EVEA 4E2XA 2PVCA 5EKXA 4EK9A 2K4MA 2Z6AA 1Z3CA 4PGGA 5KYGA 3KKZA 2JHAA 3DMFA 3HEMA 3OU7A 1EJ0A 3DOUA 4M36A 3LCUA 2ZCJA 4GC9A 4O29A 3ER8A 2NXEA 1SUSA 1KYZA 5K03A 2CMHA 5DWQA 4DQ0A 5B1SA 1AQJA 5DXAA 3T7TA 4RTOA 4QTTB 5FCDA 3E7PA 3G7UA 5T64A 3QOWA 3A25A 1RJDA 3L8DA 4PCAA 3BUSA 3HVHA 4FSDA 4Y30A 3VSEA 4ATNA 5CCBA 2XVMA 4KDCA 3AXSA 2OBFA 3CJRA 1SG9A 3DLCA 5DSTA 5EZSA 5HOQA 1DUSA 2ZTHA 4RVFA 3B5IA 3NDIA 1SKMA 4IV0A 4AUKA 1D2CA 1G38A 2P3LA 2ZBPA 4RTMA 2WA2A 2PBFA 4BY9E 2YVLA 3HCBA 4PIMA 4DCGA 3B7PA 2Y1XA 2BR3A 3JWHA 4CTJA 1FPQA 1TW3A 5GINE 3EGVA 4ER0A 5IKMA 3CKKA 3BWBA 4HH4A 1NKVA 2ONYA 3GO4A 2NNWB 3PX2A 5GIPE 1KPIA 3I64A 4PYLA 3SSMA 4X41A 2P3OA 1SVUA 3BZBA 2CL5A 1PJZA 3P9NA 5HFJA 4CWAA 3CBGA 1U2ZA 2CKDA 3HVJA 1VP3A 3KQVA 2VZ9A 4KIFA 4PWYA 5DX0A 4G56A 3WSTA 3MTEA 2QYOA 3GGDA 4BLVA 1P39A 4BP3A 2EJUA 1JTEA 1NE2A 4E33A 1YFJA 1TPYA 5FTWA 3GNLA 3HVKA 1XCLA 5F2KA 4PCLA 2ADMA 4BP1A 2ZBQA 2GB4A 1VBFA 1KIAA 1EG2A 3GRYA 1VE3A 3CGGA 4AZSA 5FA5A 5BXYA 3EGIA 3G8BA 4C4AA 3OZTA 3TM4A 3LDFA 2EX4A 4XUDA 3P71T 4E70A 2PT9A 3KR0A 3ME5A 1ORHA 3M6WA 1EQAA 2FRXA 3O4FA 5DTQA 3TFWA 3G5TA 4GUAA 2B9EA 5EEHA 2AS0A 3GDHA 5DTMA 2ZW9A 4KVZA 2AVDA 2PJDA 5JUWA 3KR9A 1NT2A 1VP9A 1JR4A 3HM2A 4FP9A 2PSSA 2H00A 4RYLA 4C07A 2PXCA 2BR4A 1MJFA 2B2CA 5LQCA 3CCFA 3IV6A 3RODA 3QOXA 4FS8A 2NXCA 3NWEA 5EMLA 5U4XA 4HRAA 4LWOA 4PNEA 2IH5A 4RTQA 5IH3A 3KQMA 5GIOE 3G2OA 3LX6A 2XYQA 3FPHA 3FPGA 2ZWVA 4KDRA 5K05A 2PXXA 2A14A 7MHTA 1XJ5A 2E5WA 2PX8A 3DXXA 3LL7A 4P7KA 3SXJA 1BOOA 2AOUA 4FSXA 2UZ4A 2BH2A 3GWZA 2AZTA 2ZZKA 5ICEA 1YZHA 3P2KA 5DM0A 4PYMA 5KS2A 4RTLA 1R18A 2AOVA 4PYNA 2HTEA 2I62A 3LDGA 3OZSA 5EPEA 5HILA 3MAGA 2GS9A 3OZRA 1RI4A 1N7JA 4A6EA 3FRIA 3UWPA 5GM2A 1XCJA 3JWJA 4ER3A 5FWAA 3QV2A 3UBTA 3P9IA 4YMHA 2CWWA 2H11A 3BGDA 2XYVA 3AXTA 3ELWA 1NW3A 3HCFA 3LDUA 4ER6A 2I6GA 3AWIA 2FYTA 5BW5A 1PRYA 3LECA 4RTSA 3OE5A 1X1CA 1Y8CA 4LG1A 3LBFA 2HWKA 3G2MA 3RIEA 3O31A 4RWZA 4CKEA 4OBXA 1QAMA 2AN5A 4LWPA 4OA8A 5DT2A 2EFJA 2G72A 3M33A 1X1DA 1RI2A 2DULA 3LBYA 3ID6C 2IDKA 3IHTA 3UZUA 1R00A 5DLYA 5E8JA 1KXZA 2PX4A 3HP7A 1FP1D 1WXWA 1D2HA 4XUCA 9MHTA 3UJ8A 1QAQA 1XDUA 1NBHA 3DXYA 2OPBA 3FTFA 3EVAA 1FP2A 1KYWA 2IPXA 2YXEA 3B3GA 3MTIA 2Z6QA 3LCCA 2GLUA 3GCZA 1R74A 4C08A 2ZZMA 2YQZA 5GM1A 4YV1A 5MHTA 3DMGA 2R3SA 1KPHA 5DXJA 5GP1A 4HTFA 3TM5A 1G55A 5K01A 5CCXA 2EJTA 3PFHA 4GOMD 5DM4A 3UJ6A 4CTKA 4E2ZA 2IBSA 2XYRA 1L3IA 4FT2A 5LSAA 1SUIA 1RJGA 3NW9A 4ZTBA 5DPMA 1L3BA 3EVGA 3DLIA 1G8SA 3G5LA 4YUVA 5ICCA 1H1DA 2BM8A 4MTLA 4M7RA 2GAFA 5P8WA 4C03A 1JSZA 1RI3A 2PWYA 3HCCA 3BXOA 5M5BA 3P97A 4OA5A 1JQDA 3NJRA 3E8SA 4LECA 5DX1A 2YXLA 5EG5A 5E1MA 3KQSA 3VC1A 3JWGA 3TOSA 5HIKA 1VIDA 4F84A 2O07A 1G60A 3KQTA 1XDZA 3M6UA 4MWZA 5E2BA 8MHTA 3KQOA 1N2XA 3NTVA 5EGSA 3M4XA 3Q7EA 5EZQA 3M6XA 4C05A 3KPWA 2C7QA 2P41A 1M6EX 3HA7A 4P7FA 5F2NA 3T0IA 2ZIGA 1NW5A 3A26A 1KP9A 1XXLA 1P91A 3SMQA 3THSA 5CM2Z 1VPTA 1L3CA 3P9CA 5EKUA 3H2BA 4R05A 2O57A 4R6XA 3OU6A 4YUXA 3FUVA 2OY0A 1NV9A 2O0LA 5E1BA 2ORED 2R6ZA 3BGVA 1X1BA 1G6Q1 4FGZA 4KW7A 1HMYA 4HGYA 3FTEA 4DA4A 3LCVB 1VLMA 3HCAA 3OFJA 3HNRA 4KRGA 2PKWA 1AV6A 3MCZA 4AZTA 1WXXA 2JH9A 3KR2A 1O9GA 3BWCA 2AVNA 2YR0A 4RV9A 5EIWA 3TLJA 4PYJA 1ZG3A 2B78A 4GOOD 5DTRA 5T67A
chains in the Genus database with same CATH superfamily
2N3ZA 3E7FA 2B0JA 3FNIA 4JL6A 2WYHA 2PSEA 2ZR8A 1N1DA 5EKDA 3RS3A 3U9SA 4Q1DA 2JHCA 4IDAA 5TQVA 2W37A 3A58B 1MC5A 2UUPA 1N3IA 1SBIA 3JTMA 4L9SA 5BSUA 4DMUB 2G70A 1RWBA 1WUJS 1FQJA 1XTZA 2R751 5LZ7A 4CIAA 1LBHA 3UB3A 4TTQA 2OFPA 1H8EA 2Z1MA 3GAAA 5KQSA 3WGIA 5JAPA 5EC8A 4H3HB 5HW0A 2ZWAA 1OYWA 3NALA 4U63A 4KPUB 5IJ9A 2VR1A 1XT6A 5TRTA 3ZQ6A 1GG9A 1R4MB 4L0CA 1UUFA 1VIAA 2GO1A 3KU1A 4FW9A 4DDHA 1DX6A 1PJ4A 1V11B 2R4UA 3DW3X 5M04A 5IASA 4H77A 4MR8A 2WVAA 2PGLA 3IUYA 1NF8A 5JARA 2JKYA 1HT2E 1ZNWA 2Z56A 5KDOA 2GBGA 1NNLA 4Z2YA 2QSJA 4GPBA 2ZZMA 2M98A 1NW7A 4MIEA 4DHEA 2XBMA 2G3YA 1L8QA 1J42A 3AETA 3M49A 4P6VF 1YT5A 2NYUA 3PUYA 3KZVA 1GDDA 3FRHA 4IFBA 5KTMA 1N92A 3LY8A 4C4SA 1A8HA 4CM1A 1Y5RA 3PD0A 3DSRA 5JHHB 1ZONA 2D5IA 2C42A 5FYQA 5AW4A 3T4XA 3UYKA 3H1PA 5GWXA 4OXIA 4RTKA 1TOAA 5K3CA 5CB4A 3PEUA 2IIPA 1D2AA 1NIJA 1JXQA 2XUQA 1Y6QA 1F0NA 1SQGA 3QPCA 4K03A 4MCIA 4MRSA 2EZ4A 1O94C 2CUZA 4IG9A 3F1LA 1MD9A 4FZVA 1H2FA 4MUYA 3U7IA 4EJ2A 1JDBC 1LK7A 2EFCB 2VYVD 5H83A 4Y6QA 2IX3A 2FE1A 1LBIA 4KQFA 5DO9A 4EY4A 2HQRA 2O2ZA 1YU6A 4XPZA 2D4AA 1GN9A 2RD2A 3ELYA 4F9GA 4ONEA 1ZXLA 4B3GA 3WIUA 4MRMB 1QP8A 2CXHA 3IPXA 4TKUB 4YRDA 5IMSA 1NQWA 4X3PA 3NUZA 1QRSA 2XT9A 1G59A 3FLMA 2EW2A 2PKQO 4GECA 4O2AB 3ZJ4A 4YIHA 3MMZA 1UBTS 3RW9A 4JLNA 3A9SA 3O26A 2FMFA 1P7YA 4Q02A 4BB6A 1QC5A 3UATA 3ZBUA 4CFZA 4CG1A 4RFVA 1YAHA 1W75A 4B7XA 3GJ0A 2G1KA 4HYTA 4DLSA 5GONF 2EGGA 1MHTA 3I9OA 1VGVA 4OHCA 1XZQA 2R1ZA 5CDTA 4LHEA 4R0VA 4ESOA 2CV0A 2RGNC 2QRGA 3L7YA 3VKHA 3DLAA 3OZBA 4TV9B 3CLSD 5C2JB 4CHTA 3HV0A 1YI0A 1HDEA 4TXLA 4HWRA 3UK0A 4HDRB 1BS2A 4DMGA 3H9QA 3AR3A 3HSYA 3PHGA 1GQYA 3TRKA 3W5IA 2BFBB 4DMCA 2DFLA 1BE8A 2ROQA 3MGBA 1AZSC 2E4WA 3WWYA 5T6BA 1C8BA 4QLOA 2ETXA 2W8BA 5IMBA 5AVZA 2OCAA 4QXQA 4JXXA 1FU4A 1TZKA 1EX1A 3VR5H 4CCYB 1NJ8A 2Q9UA 5A6SA 2X9QA 1YIAA 3C87A 3R6LA 4EUHA 4N5NA 5K2OA 3EXG1 2ZUUA 4JS0A 4QREA 4HRYA 1L5LA 1PKEA 2WV9A 2OXRA 3MG9A 3UC9A 1BU5A 3D8RA 4POOA 5CBKA 5IUJC 1GA1A 1HKHA 3BD8A 3BXFA 1BMDA 4OQDA 4BKPA 2GWHA 4IJWA 3PE3A 4UXIA 2DSTA 4B17A 3TQOA 1JL3A 1R0KA 1SK8A 3J80A 2A30A 5CA0B 4UHHA 4QG3A 3D6MA 7MDHA 5K09A 3IQHX 1KFCB 1OC2A 3QNWA 4OHKA 3GGJA 1ZN7A 5JE8A 3ZHUA 1KO7A 3AI7A 2ZYRA 2QT9A 1DOAA 3DB1A 5HQTA 1ZJYA 1FLAA 3HL4A 4CG0A 3NTLA 3W6PA 4ZJZA 4GRDA 4BJ3A 5L9AA 1CS0A 3ANNA 4AS2A 2AG8A 5EMHA 3EOAI 2O2IA 3QKRA 3MWEB 2ECKA 4A0HA 4YI5A 4CM4A 3ST7A 5AJYA 4KPEC 3RTBA 1BXKA 1KGDA 4BNDB 3NOXA 3L18A 3T9CA 1FFSA 1NM5A 2W4MA 5KWVA 5L3SA 1QMGA 2FJUA 2HQSA 2OO5C 4D81A 4Q6BA 1V6AA 4Q03A 2HK9A 3K6KA 2HXGA 5H4HA 3SIRA 4BWYA 3WK7A 2WSLA 2IIVA 1ZOSA 4AJPA 1X13A 2XUPA 1VSBA 3COYA 3I09A 4YAUA 1RQ7A 1H2YA 1TJ4A 4KMOA 1OU4A 2DUNA 3T7AA 2B7BA 2VL7A 1KMMA 1SU8A 2Q62A 2WG2A 3GNTA 1YA8A 4FGUA 4QRHA 2Y0BA 3I1IA 3V46A 2JLBA 2ZUTA 1HRKA 1REQA 2AFIB 3ROKA 4C0AC 5FEMA 1CY0A 5HZKA 2QK4A 1UBOS 2IU0A 1T5BA 1Z6TA 3QWIA 3ZKWB 2YBEA 3IE0A 2CLEB 2CDBA 2TMGA 1TA4A 2XNDA 4Y8VA 4EJSA 4IS2A 1FUKA 1QHSA 1RCTE 2NU9A 5TV2A 1E0JA 4XCXA 4B0OA 2ZJZA 3LO8A 1H05A 1R4AA 2Q3JA 2ZI7A 1YB6A 4X0EA 1EE9A 4LYYA 3VPHA 5A4MS 3L07A 2GVNA 4JR2A 3T3DA 1TVKA 2ZJYA 2QRHA 4TLAA 4F56A 4MUNA 2W6OA 3VO8A 1C9MA 2E4VA 4MPPA 4PCVA 4E4TA 4JB3A 1IOVA 1I3MA 3JYNA 2Y6UA 2HSDA 4LDNA 4NK4A 3R7WA 1W1UA 4XQGA 2H7CA 1ILWA 1RYHA 1Y7PA 2V55B 5DHUA 4GZLA 4MMZB 4NEQA 2CV2A 2BVNA 2H5JA 1FDRA 1GLGA 1Q1QA 2CLMB 2XOKD 3CEHA 1SD1A 1X7YA 1MQSA 4ZO7A 5KMGB 1BVUA 1RI1A 5C1OA 4CFYA 2O3JA 1HQDA 1GCIA 1N9KA 2IE8A 4QNRA 2Y92A 4F71A 3UMCA 1YR7A 1UEXC 3X3HA 5D1NA 2VRCA 2ZAYA 5ESXA 1PT9A 2R62A 4CU5A 1JT9A 3FZYA 3JQGB 3O7WA 5IP5A 2P11A 5LP6C 3ULKA 5J2TF 3VUEA 4UTNA 1EXDA 2H2HA 1UBRS 4KV7A 5C9ZA 5IJ0A 1C0IA 2I7CA 2PSFA 1QYIA 2G28A 3BIXA 4MTCA 1P5FA 4QULA 3IQEA 4E51A 2PXHA 1YZTA 4R7ZA 5FFMA 5L45A 1J5PA 3HBFA 2C9DA 2ZBUA 3LHSA 3PFFA 4IF4A 4KBFA 1LPNA 4O1IA 4IRMA 1GNVA 3CQ9A 3WIBA 1Z7EA 2R96A 4B3TB 1WF3A 4TTVA 4TX1A 5DN6D 5J4YA 4L76A 4B6EA 5HJEA 2QYHA 5ADVA 4H1WA 3VU9A 4TRJA 4Q16A 2RH5A 3LGAA 3FDXA 3F49S 2FPGA 3QF4B 3A4TA 3SDSA 1RXSA 3CRMA 5BSFA 3L0PA 1C1HA 2ZR9A 4Q3AA 4Z9FA 1T5TA 2B7LA 4II7A 2GSWA 3QVMA 1HE4A 4GT1A 3OM0A 4XWTA 4YCSA 1E0KA 4Y6RA 2G1PA 4IXWA 4OXXA 4C4XA 3A6LA 1I3CA 1NFQA 1QJ4A 3NFRA 2HHLA 3L4KA 4KXXA 2PVCA 3IR7A 5A3RA 2ZTUA 4HQFA 2HA0A 3U39A 1A88A 3MMNA 3H4MA 1J0AA 5JXIA 4CT5A 2JFHA 4V0OA 2AXQA 4UDYX 3AVQA 3LCUA 4BO5A 1M2KA 4OU4A 1Y8RA 5L7TA 1JDJA 2AF3C 1FYFA 2RGXA 3C5CA 4WESB 5SV2A 1BIFA 4JUDX 4UNNA 4ZOLF 3V8PA 4ZDIA 4RTOA 2B1IA 2ZUWA 4PCAA 4AVYA 4QOEA 1KY3A 1P9RA 4Q9DA 1U0LA 5BN3A 1QS0A 3RT9A 4ZPJA 5L40A 2O8EA 4BYGA 1KIMA 1CJSA 3CJRA 4IXTA 1H42A 1M6WA 1MO4A 2B5OA 2IZ7A 4M76B 1IHDA 3I6QA 4EPTA 4X84A 2IYXA 2CNWA 4ED9A 4IQGA 2W70A 4M7PA 5CU7A 4MP8A 4FI3C 3HDYA 1Z0JA 3S44A 1Y9EA 1QV6A 2HN9A 2RHMA 5G0WA 2C92A 4DCGA 3B7PA 1Z6GA 4FGLA 2OHIA 4BQEA 3RYIB 1U7HA 5KJ1A 2POQX 1OFHA 1ZM2A 2VO1A 3O9VA 2HLNA 4UM8B 4BMNA 1DJMA 1TJ3A 4ARBA 4N7BA 2AEJA 4R69A 5HCUA 3T99A 1XZCA 3FMGA 3IALA 5I5GA 3FNQA 3KV1A 3SG0A 2RGGA 3AL0C 4F3YA 1RBMA 2FWRA 3DS8A 2BGNA 3D59A 2HTFA 1G6OA 3TEJA 3N2KB 1Q19A 4NDZA 1V8PA 3FOBA 1L7VC 3LYHA 4Y2JA 4IKEA 2QNBA 1Q44A 1RCFA 2OV8A 5TVKA 3KAKA 5IEBA 5DIFA 3NKVA 2FN9A 2A0UA 4M0CA 1F12A 3W6UA 1NUUA 4QAQA 4NDNE 3P71T 4JA2A 2C78A 4F0JA 1IBCA 2FMIA 2V7PA 1XVLA 3NX4A 1ZGBA 1KZ6A 1ZMXA 2FQWA 1JECA 3L92A 3QBVA 4IDOA 2CMFA 1AG9A 2FFBA 2P6MA 3GAFA 2VBCA 1E98A 1Y48E 3E9QA 2F4VB 1G3UA 1E60A 4MW2A 3AM4A 3KV3O 3G0OA 5ALZA 2QMQA 4PNZA 3CV3A 2XUAA 2XYGA 2VUIB 3I6BA 3AR6A 2XDQB 3HPRA 4LWOA 2PS1A 2XNHA 3PJGA 2NZVG 1C80A 3L7KA 4R40A 4AKEA 1ZKMA 2AR7A 3FPGA 4D9GA 5AW1A 3OJ0A 2HA4A 3I0NA 4OQ4A 4AMZA 3SXJA 2Q7OE 4WI1A 1MW8X 3VU3A 2HRQA 4BZQA 1T0UA 4JEMA 2Z3VA 4XX1A 3GR6A 2C5GA 2D1TA 2WWIA 3A0RB 4N12A 5KS2A 3LY7A 3FIJA 3OIYA 1JJVA 1M2HA 3HLKA 3DE5X 2I1QA 3A36A 3VHRA 4F97A 3CLSC 3L4BA 5DH9A 1LPSA 4X1IB 5JLJA 4WZAE 2OQ2A 4UXJA 5GM2A 5LP6A 1EWVA 2JA1A 3M0EA 1TF2A 1Z4PX 2TS1A 3HA2A 4ER3A 4GBMA 5L6MB 1T0IA 3IUNA 1PAUA 2AJCA 1J56A 2WWHA 1HL3A 1R6XA 2YWJA 2IF0A 5IZ4A 2R79A 2CLFB 3WYDA 4CM5A 1FTNA 1PO7A 1PRYA 1ZMTA 2FMXA 3CGWA 2HF9A 3ZWKA 4ZHQF 1LKZA 3G1UA 4JEIA 2HWKA 1ZGCA 3K4PA 2VHZA 4HDKB 1B14A 3DJYA 2B98A 4WACA 3RIEA 3USES 2VTBB 2BSXA 2H1SA 3TK1A 1QAMA 1NONA 4ZYWA 1WP4A 2JF0A 1DLIA 1JDPA 4X65B 1P80A 3MEQA 2DM6A 4O1HA 1PD0A 3AL3A 4ZREA 1YACA 4KXQA 4M0LA 4DWOA 4RVOA 1SXJC 1HDIA 1WXWA 3P5SA 4HWPA 1F20A 1G21A 4X94A 5BOSA 3KVRA 1G2PA 1ORTA 2FDRA 1RMTA 2QU7A 2XQIA 4UTRA 5AW7A 4MVJM 3GCZA 1CULC 5ESDA 1WMEA 4L7QA 7REQB 3KL4A 4UEJA 1RZUA 2RJNA 4ZDKA 5D6NA 5C3UA 4LMRA 3VBEA 2VF4X 4QOFA 4V0SA 1FUYB 4WNYA 1V5GA 4EHKA 3LBIA 5JT1A 4OHBA 5KCMA 4EYEA 4HDSB 4P4SB 3JX9A 3RNOA 1S02A 2O5RA 2YFHA 4I1SA 4CM8B 2NWQA 2QVXX 4TUYA 2G6BA 4B31A 5KVVA 1O0BA 1JP7A 3C7TA 4HYEA 4ENTA 1VG1A 4AJ2A 4ZVRA 4CG2A 3PDUA 3RSQA 2OZPA 4B3JA 4ZEMA 1PNRA 3D6FA 3NM6B 1LI5A 2ES4A 1YRBA 3U44A 3KZOA 3DUFA 2XNJA 3KYBA 2ZJAA 5FKJA 1XDZA 1PWHA 2RARA 3M6UA 2B1JA 3OPYA 4QFCA 4UHEA 3SEFA 2AEEA 4URXR 3RUAA 1IB6A 4C05A 4J8PA 3GMSA 5DHTA 4EUSA 5CA0A 2CMDA 1PNQA 2D2FA 2CF5A 4E5SA 4KE8A 3DE6X 3IP5A 4CMAA 1GTRA 4RXTA 3CUUA 1IK4A 1L3CA 2VT7A 5IJ9B 3QELA 4H7EA 1EGQA 4E21A 3U5ZB 3KK0A 4TKZA 1HM5A 2XUKA 4BFXA 1CWUA 2QRKA 3W5JA 4E08A 3GOHA 1CS0B 2G0NA 2GCGA 4L2IA 4RHYA 1NQXA 4LTMA 3U5TA 2WWFA 5BVGA 4NCAA 4D97A 3FJ1A 3AR8A 5MN4A 3STUA 1KVSA 2QEQA 2P9TA 4YB8A 1QG6A 1SCBA 2ZAIA 3BWCA 4UNRA 4PYJA 1ZZGA 1ENOA 1M2JA 2QRNA 5BUQA 2B4QA 2O1SA 2AW3A 3TQIA 2FUCA 3A1FA 1GILA 3VPBA 1Q6YA 4R9NA 1EG7A 1X0XA 2R8BA 1O2DA 3LYLA 2GNPA 4RK0A 2HRDA 3ESQA 1RJ9B 1V71A 2IEZA 3EWIA 2ODPA 1ZM7A 1EBBA 3IVAA 4F86A 1HTBA 4KR9A 2ANBA 2HJRA 2GYWA 4RPGA 4LVCA 2VKTA 2AMYA 3SGLA 5HRAA 1WXHA 3KJHA 3QVGA 2V0NA 3QU9A 1ML4A 1IUPA 2B61A 2ZVJA 3IC5A 4MVJF 4Y1RB 1VGRA 1J5XA 4A5OA 4M38A 4LJSA 4B4KA 3ZVKA 4CCWA 1N2IA 1SC3A 4H0CA 3C45A 3FPJA 4JC5A 5AI5A 4C3UA 4Q7LA 1A97A 1JLKA 4MJ3A 3UJDA 2I54A 2J0UB 3JYHA 4FZ5A 2RGRA 1O5TA 1LTQA 3FVRA 2IUUA 2WICA 1U94A 1E62A 2X6TA 4E5PA 4EUKA 5ALOA 2ERXA 3V6MA 2WWXA 2QAIA 4EVIA 2WIJA 1DAOA 2DWCA 2XTJA 1NDHA 3KETA 3PRKE 3EXFB 4AMVA 2BKUA 2UYOA 1QIEA 3KRTA 3P52A 4B09A 3H05A 4UJ3A 3UT0A 4A0FA 4ZAZA 3TZCA 3VYRB 1PUXA 2FUNB 2JGJA 4C89A 1G2QA 3GFVA 1JQLB 4UW9A 3R7WB 5B36A 5ETJA 3O8QB 3CH4B 4O8CA 3KPJA 3R0JA 3FPCA 1K8RA 4ND5A 1I2AA 2G76A 2RIRA 3DP9A 3X1WA 1GSIA 2GEUA 2X0FA 4J0IA 1YHNA 1CQIB 3A3OA 4ZFNA 2LUOA 3AL2A 2PUCA 3UV7A 1SY7A 3FIUA 4FUQA 1DXOA 1IONA 2Q27A 1PL7A 2QUZA 4GC5A 4JVMA 3B3FA 8AT1A 1EUQA 2AT1A 2WKRA 2DPMA 3GA0A 4AZ3A 5TXGA 1R6TA 1PR3A 5K9ZA 4GRAA 5J2TA 3AUAA 1A9XA 2G63A 2QMOA 3M5CA 2BR5A 2Z83A 1I4WA 2HHHB 2VTEA 1VSQA 1Z0ZA 2P3SA 3N8DA 2VH1A 3U60B 2UXBB 4ZMSA 2P4HX 3F47A 2BTEA 3N76A 3E9CA 4I08A 2BEWA 1KDPA 3S8MA 2P9QA 4NY1A 1N6OA 3ROMA 1XZMA 4ASUA 2I2BA 3QFRA 4IY1A 3BDIA 1JEDA 2V7UA 2P1RA 3AUFA 3V9PA 4BU0A 4L9WA 2IWHA 3PK0A 1E8DA 4MO9A 2ZS8A 2MOKA 3EEFA 4DM7A 1QP4A 3OX3A 1YC5A 4KR3A 3K8QA 3U1TA 1GU0A 3OQ6A 3VU9B 3OLYA 1PV2A 5I3ZA 1VBNA 2AHOA 1H2WA 2WUEA 4RE6A 2ZSDA 3PUIA 2RH9B 5ECWA 1E1DA 2XVYA 4PQRA 4MV3A 3ZTYA 1RRFA 2RONA 3MBKA 2FPWA 1R6AA 4MS3B 2VJKA 5BO5A 2CB0A 4PQGA 3JQCA 3FMIA 3LT2A 1KEEB 1M10A 4A2PA 6REQA 1AS2A 2P9GA 2J7KA 4QQ8A 1U5BB 2ZAMA 4FFMA 4IUDS 3NT4A 4OO3A 2FKNA 5IAGA 4ENRA 4RTJA 4N5MA 3V34A 1UT6A 2ZUVA 4UUMA 3C6BA 1C9DB 1E3MA 1QV9A 1RMQA 3KSMA 1LUAA 3R1IA 2AX3A 3I6YA 4HQNA 1T9DA 4IGFA 1YDFA 1DIHA 1WXIA 2GNAA 1QIIA 3PWTA 1ECGA 1HG0A 2C8KA 4HZUB 1WB6A 1JX6A 4Q93A 4UMEA 2HDOA 4R1SA 3WWOA 1BMTA 3U1VA 1CS4C 3EAQA 4MJXA 1T5HX 5EQTA 4JLWA 5IT9A 3G89A 1UMDB 2E1RA 2YMPA 3UKDA 3FVVA 4A6DA 4M0PA 3EGWA 1EA5A 3KZKA 2HW8A 2P1DA 4XM2A 4MQ5A 4J6FA 1Y3HA 3UYLA 3EULA 1I7PA 1CUSA 1QHGA 2NM0A 3VO1A 2ODTX 5DCLA 3QBEA 5AIBA 1EP2B 3FWNA 4MVJE 4OSOA 4XVCA 4RZHA 1XYGA 5JSYA 1AMUA 1V43A 4P82A 4LVOA 4R8VA 3GEIA 3LHDA 5D01A 2XTMA 4DQKA 2XUGA 5EJEA 3BRWD 1VRCA 3OP4A 4K0KB 1KAGA 1P1KA 1UK9A 3L84A 5CXXA 3ZZ0A 1FVXA 1E2KA 3HSKA 2WTEA 4UE3S 5I9IA 4EI2A 4R9RA 1IZ7A 2ZQ5A 4BNGA 3CISA 2BV3A 4QWMA 3DTNA 3EVTA 3A1DA 4Q7KA 3HP4A 3KT3A 3JSXA 2VATA 1FBTA 2DH5A 3NYRA 4K40A 2W2PA 4EUFA 4BGEA 1U0FA 5EZ5A 2NSYA 5A9SB 2HQBA 1JQ5A 1ODCA 1Z88A 3K1ZA 1LY1A 3FDFA 2V6IA 2ZRBA 5BSTA 4K81B 1NSTA 1Y4ZA 1JHUA 1K4MA 4KMRA 2GILA 4Q7MB 4MAAA 2VEOA 1ZK1A 1XBTA 1QHNA 1U2SA 3LYUA 3NO4A 4NATA 4W99A 2PANA 4UTVA 4ZGBA 5ICGA 4DG8A 2W6QA 2B3TA 4ALKA 2RHHA 2VHCA 2K5UA 1DIRA 1XZPA 2O05A 2W22A 3D7KA 4IS3A 2P4EA 4QODA 1G0NA 4LY0A 1DIBA 4ZP1A 5IF3A 4QGBA 1EI9A 3BHNA 3OZWA 4TPKA 1CF4A 3VHXA 1RHQA 3EUEA 3WBFA 1A71A 1JJ7A 1G291 3IDQA 6PFKA 4HGNA 1I9GA 1J4AA 4YDQA 4N8SA 1LSOA 1TZJA 3IAM6 3NNDA 1C8LA 1NP7A 1SKBA 2F7SA 4KPUA 1TVCA 4PWZA 3E8XA 2GASA 2IGTA 3DYVA 3TOCA 3IR6A 5AI9A 3WZLA 1DKRA 3BMNB 1E2BA 4C88A 1B8OA 5AVTA 3DAPA 2ORYA 4XD7A 1P3Y1 2G5CA 4S24A 2VBIA 3K8YA 3O3CA 4MI6A 3RSLA 1G5TA 4X00A 1JHVA 4MEJA 4E6PA 1U0JA 4N3GA 1JWAB 2PS3A 3WY9A 4OFXA 1MIHA 4WAUA 1G8HA 2XF2A 3IIKA 2BZGA 5M7EA 4MCHA 5CLHA 4YRKA 3FOEC 1CNEA 5JSQA 1RXEA 4YPVA 3EFOB 1OX4A 2VRCD 1ES9A 2VHVA 4QXOA 4YJ3B 1N32B 1RP7A 2O8CB 5KNDA 3LUCA 1N7IA 2F8LA 2UKDA 4N8DA 5K4GA 3O1HB 4JT9A 3OZCA 5EIAA 2DPXA 4G9GA 3PGVA 2HCBA 2EERA 1PJQA 2IDJA 1G63A 2A0WA 2HREA 3B1JA 3RIGA 3QF7A 4RGQA 5AVOA 3BXXA 2QJRA 4HBZA 4AAYA 2CZGA 3GJYA 3MJSA 3OQHA 4PYIA 2AE1A 2NU6B 3R0QA 4Z3DA 1WKVA 1NUPA 1V5IA 2IQIA 2RG7A 3AKDA 1YB2A 1U3FA 3L6DA 3BCUA 5DRTA 1C9YA 3U4CA 3FUCA 3DA8A 1NAIA 3E58A 4RIFA 2QE7A 5JZMA 4DR1B 2C8JA 4UVHA 1A77A 1P0CA 3K73O 4A8JB 1SD5A 2WTAA 3FZEA 5MGNA 5EOVA 3QEJA 4RA9A 2A57A 4JX9A 1AGYA 1F2VA 1CRPA 1JFSA 1G9SA 1QO0A 2GYUA 4D9CA 1OT5A 1PYOA 4O2BB 2WF7A 1Z4QA 2P27A 1VHJA 3MTBA 5I7AA 4J0DA 4V02A 5FH9A 1O9HA 3WE7A 1U98A 3UPTA 5DTJA 1X3LA 2XR1A 2LNDA 2Q9CA 3AQ4A 3DDZX 4JJ7A 4G5FA 1EVLA 4QATA 4HTFB 2PWZA 2CL6X 4KO8A 4NG5A 1V4NA 3ELDA 4WXYB 4YAEA 5BXQC 1XCBA 4W8GA 4XYMA 3GL9A 4DMMA 2BAGA 1PJTA 1XSEA 3ET4A 4L72A 5FT9A 3JQQA 1EDOA 2ZFUA 3SHWA 4B73A 4LF8B 1EIWA 3MT9A 4YV0A 2I91A 1FNNA 4ZO8A 1WSWA 2YWXA 3ILSA 5K3FA 3IJEB 3CH7A 4ZHQB 3MIIA 1EFUA 1FP4B 2JIBA 5JBNA 1KEUA 2A0FA 3DMFA 3OU7A 1TKRA 2QP9X 3L7DA 4JJKA 2C5SA 4M36A 4UVDA 4XR9A 1A7UA 4HMQA 4FILA 3OPYB 2R86A 4KE6A 5KNCH 4B46A 5CFLA 4DQ0A 3D8HA 1XD2B 3LBHA 2I4TA 2PYZA 4OFBA 4IOMA 1ATIA 2V1XA 1EE1A 3QVTA 4ZOBA 1RKXA 1T1JA 5BSWA 3RAFC 1TI7A 1Z0UA 1NRJB 4P0PB 5BR4A 3MGKA 4WE3A 1IHUA 4EATA 1EESA 2A7XA 1HG1A 3G49A 3QELB 4L15A 4IZHA 4H2DA 1I9CA 4YR9A 1VPLA 2BKLA 2FE4A 3C85A 4DCUA 1OMOA 3DOOA 4IILA 3KDAA 3BK1A 4LXXA 5BVGB 2AKEA 4ZYLA 1GXSB 3VPCA 3WAJA 3HXTA 3QLJA 4QUBA 4TXJA 1U2DC 2EX1A 4BC1A 1RC1A 4ZV4A 2CXRA 4U7FA 3FNEA 4BGDA 2HK6A 3DHWC 5A3SA 1C14A 2UUCB 4TSRA 1JA9A 2VDWB 4IWYA 4CLHA 4YYZA 4E4YA 3IBGA 1PL6A 4MLDA 3T5AA 3FPSA 4G56A 4Q3LA 1TVMA 4XD2A 3OZIA 3WB0A 4ZVQA 2AQHA 4Q21A 1W581 2PA0A 3PT5A 1FSGA 3GAMA 2YJ5A 3W5SA 4LK2A 4EDFA 4J03A 2HA7A 1P2FA 4IDGA 2GO7A 3D6AA 5KOHB 3AIIA 5FIUA 1VBFA 2CJWA 3SBXA 4CV3A 1XLWA 2YNMD 3EZNA 5BXYA 1H65A 1JVBA 3UQZA 2JARA 1Y3AA 5JQWA 1GO2A 5CJJA 5DTQA 4MQEA 3LTEA 1V11A 3ROEA 2BC9A 1EHIA 2AS0A 1ZH6A 1J20A 2ECOA 2UZ0A 3C2QA 2VP0A 2XZPA 5CA1B 4LX8A 5JUWA 4MZXA 3QNMA 3DKIA 2Z2ZA 4KO2S 2B2CA 2X9GA 1SUDA 4M8KA 2XVXA 5AI4A 2QZPA 3UIEA 1UPAA 2DQKA 3L1KA 2D7DA 1RAIA 3HKDB 5IH3A 3C1AA 3LP6A 1NASA 1ORDA 3UHAA 2K2QB 4I1UA 1LTHR 5HK8A 1IIBA 1EWKA 2NN3C 3N74A 3NTRA 4HDCA 4M21A 3IDFA 4U6QA 2RBEA 3CN9A 1E3SA 5ICEA 1HUQA 5KKNB 1KI6B 3FI0A 1DDIA 5CB4B 2GJAA 3L8MA 2J0VA 3UOGA 1XEXB 3L04A 4L8FA 4DA7A 5B64A 5KTPA 5TMEA 4K88A 3WO0A 2H1OA 1KQ3A 3PIRA 5BY2A 1NT4A 2YIDA 4TTPA 1OAOA 1W0KA 4JQSA 5K4HA 4JJ4A 4JSYA 5LZ8A 3TZKA 3ZIAA 3PXAA 2YHIB 2YQ5A 4DLUA 4NBKA 4QUAA 4R51A 5JPDA 2I66A 2QMUA 1NP6A 2J6HA 2QSZA 1S3SA 4Z9XA 1U2DA 3P45A 2QGZA 1JA0A 1LWOA 2CNLA 3HU3A 3LDUA 1GGMA 4YP1A 1UXOA 2WSSD 3GT3A 4P08A 3UHJA 1QHXA 3OE5A 4C7JA 1FK8A 3AF6A 2I99A 2JAWA 4XD7D 2IZOA 3L43A 3ZWOA 1JKIA 1DO8A 1H9AA 2IY7A 4AJIA 1WZIA 3S1LA 4B4OA 1WHSB 1D2RA 2OR3A 4GKVA 5BSGA 3W77A 5KYUB 4QT0A 4AJLA 1EWRA 4H18A 2G72A 4KQ6A 3PYXA 4IINA 4NYMR 5H59A 1RFLA 1NNI1 3IHTA 1PK8A 2QRPA 3UZUA 4JDUA 3VRHA 1O08A 2XA9A 1H6DA 4PTYA 3OKPA 4Z3OA 2LKDA 1UKEA 5JD3A 3TDMA 1VZ3A 1D2HA 1Y98A 5JG7A 3ZUPA 4QELA 1Y6GA 1YCGA 4M0DA 1OV6A 4B4WA 1R10A 3EVAA 3MRXA 5A4DA 5A4KA 2HD4A 1PLKA 2FSFA 1NYTA 1CRZA 3F7OA 3NGLA 1LJLA 3KB1A 5P21A 3KTDA 3VH2A 6ADHA 4FR2A 1YVEI 2EYUA 4QUJA 3GLFB 1E89A 2HRBA 1KQNA 1DO2A 2PKXA 2QMEA 3KLOA 3MGCA 4LQCA 4KYTA 4YS6A 3IL2A 1Z83A 4AX4A 4WBNF 4G63A 2BTQB 3I4FA 4BUZA 4IIEA 3DWEX 1GT91 2AJDA 3LQYA 3DEAA 3O0TA 3G79A 5LSAA 3O8DA 3JPWA 5LDDC 1GQRA 2ZBEA 1R64A 5EZYB 4B35A 1U6JA 3GB9A 4GLBA 5ED0A 2GPWA 2KB0A 1TX4B 1GZ7A 2AKYA 3VZRA 1FFGA 2PT5A 1JR3E 5JW6A 1D6NA 4PPFA 3E8SA 4UHCA 4DG5A 5IAOA 1EDZA 3KQSA 3EF1A 4OUDA 1U11A 4AS3A 2PZLA 2WD7A 2JIDA 1PWEA 1YBAA 5D00A 1C4KA 3ZDAA 5H3HA 5JYCA 5EUCA 3O4JA 3AKZA 1KQOA 4CKWA 3KPWA 3IP7A 5F2NA 1J2TA 1KJNA 1DXQA 2G07A 1CERA 1NW5A 2NTNA 5FL7D 2O6HA 4B6PA 4DHWA 1GYPA 3RVQA 1SMKA 1K98A 2GPJA 2ZYUX 5F98A 3DMYA 3ZGXA 4FKZA 5LVAA 3GUCA 1K5DA 1YCHA 3VDXA 3ZDQA 4RCVA 4OIFA 2HL6A 3P9RA 3W06A 3QKRB 2QW8A 3R7SA 3SDZA 4GHWA 2HHJA 2GERA 3HCAA 2MYUA 4OMFG 1N6IA 2ASVA 4BNDA 3KOOA 1TO1E 1YNSA 4BX8A 3M5PA 4KZPA 5A4JA 2H1LA 4MNTA 4A7PA 3A28A 5EIWA 3VKGA 3OTOB 3E8MA 3M9LA 4RKFA 4E15A 2PUFA 5KYTA 1AT1A 1JPJA 2Q4EA 2GM9A 1BHJA 2V8BA 1NBIA 4HJXA 3MCVA 5JR3A 2R6FA 2FEWB 4OJNA 4Q9AA 4R2WA 1XRMA 4HHEA 3HJHA 1Q84A 1E2MA 2ASEA 3AHCA 3V8RA 1DVRA 1MO5A 2V03A 3N2KA 3RJMA 1NW6A 4PCUA 5GONB 2Y1GA 1P9WA 3I1JA 1Y9AA 2CVOA 2AFIA 2X5OA 4BYMA 2R8RA 2FUEA 4KO4S 1YULA 2YOFA 2Z43A 4P5EA 3NDBB 5EGNA 3ZKWA 3COPA 3R9WA 4BO9A 1JI0A 1S8NA 4JBIA 4LRXA 3ZWVA 3DCYA 4XSHA 1RE0A 1SBZA 3Q6MA 3BMNA 4KI7A 4M8IA 4U39A 3IA7A 4I9UA 4MW9A 3D7SA 1ENYA 4PHGA 3VI3B 4K3VA 3SJBA 4F2WA 1DB3A 1VL0A 2NG1A 1WSAA 3NHYA 2LD4A 3AHFA 6NULA 2KWIA 3VH1A 2XLCA 2OEPA 4B8YA 4JH0A 3UPUA 3W1VA 1H6AA 1P73A 2ZXUA 2XAAA 3FFTA 4ALLA 3NXKA 1JR3A 3KDPA 2V7XA 1QGAA 1VLZA 4N65A 4TKVB 3NBKA 3WHKA 5HKOA 4M2LA 3LLUA 4XGRA 2JZNA 3MQFA 3JRWA 3ZGYA 1KO1A 4XTCS 1VG8A 2BELA 3QW2A 4KIUA 2B9VA 3G0DA 1Z6YA 4YEDA 4JHXA 4BLRA 3BIFA 5ER6A 4D80A 4YRBA 5HS4A 3VV2A 2GJKA 5KUTA 3ODGA 5D5HA 2WUFA 4ALNA 1NWCA 4URVR 4RE5A 4RA6A 3W1WA 1O77A 3TKYA 2D59A 3GEEA 2GHTA 3TMAA 3IDSA 1G1AA 3L7LA 5ALMA 2WQ7A 4B83A 3C5HA 5FTNA 4FJ2A 1VG9B 2YWFA 4ZRNA 1WLSA 3FH0A 3QWFA 3CR3C 1RYNA 1WCXA 2DSNA 2E18A 4M1QA 3B38A 2L19A 2XT0A 3UV3A 5JSFA 4LJ7A 5IJ0B 1PZFA 3LNTA 4KXMA 5IKPA 3RVBA 3L7OA 2QW1A 1XN1A 3INGA 4MB6A 4QYWA 3TLGB 3D3QA 1HNZB 2EL7A 4H1TA 1Q7EA 4NPHA 4AZVA 5JEEA 1Y89A 3I5UA 3MAAC 4WNCA 4O6VA 3IO5A 1YR3A 4J0HA 3DCJA 5BVHB 4ZK2A 4JYCA 1AXEA 4IIDA 1FRZA 4KK3A 3VFDA 3ICVA 4HDKA 5F1OA 2DLCX 5JH7A 4CKEB 4TZ0A 4BJ5A 1RQXA 2GRUA 1V95A 3ZBPA 4R1QA 4FN4A 2BMEA 4LYAA 3C3XA 4CTNA 1T2FA 4YJFB 3UK7A 2G7ZA 4ZEVA 2DUUA 5LIRA 3K2BA 1X42A 5G41A 2JGEA 4ZCMA 3U4QA 3TQQA 1JLRA 4G8DA 3LQ4A 3FCAA 5LLSA 5DRYA 1J39A 2PNJA 4F6RB 1ONPA 3VYVA 1A2BA 1Z37A 2LIVA 3G2HA 3ZWWA 2RI1A 5CFQA 1GAXA 1J07A 2X6QA 5E4JA 2DQZA 4WMLA 2XUFA 1Z08A 2WUGA 1KI7A 3G2JA 2BGTA 4F3CA 1X2EA 3VDRA 3I01M 1CUFA 3OZVA 3OC0A 3P9SA 4W7HA 3RO7A 2Q1XA 2G77B 4AJHA 4WESA 4R8SA 3AGQA 5KTNA 4KAJA 1R0ZA 4UUBA 1QDUA 5FA8A 1U6IA 4KN8A 2XGMA 3GLHB 3NC4A 5HUHA 3GCDA 2EGUA 1ISPA 2GJ4A 1RWWA 3NMUF 1COWA 1Y7IA 3CLTD 3GJ3A 4NFHA 3ZJTA 4YGYA 2DX7A 4U9IS 1KRWA 1THGA 1F4PA 1Z5VA 2QT1A 4NWIA 1G2IA 1MUUA 1PDWA 3M4JA 4DQVA 4NSNA 2A9QA 4NP6A 2H3EA 4UHKA 4FYIA 3ZN2A 4NOMA 3RAJA 3K9GA 4KN9S 4X90A 5AJTA 1V2GA 4US0R 4WZBE 5TQ0A 3RUPA 1XNQB 1KETA 2J7PD 3KUXA 3EXG2 4WK0B 3S68A 2BSQA 2OCXA 4JLOA 2DWQA 4HV4A 2OV4A 3CMMA 3WICA 5BUSA 2H57A 1A4RA 1Z8DA 3N0XA 4LOKA 1MX3A 4UZSA 1M0EA 5IUKC 2Z04A 5E9WA 1ZYUA 3PJRA 1XQWA 4JDPA 4REOA 3IBFA 2IELA 2CB9A 1VA4A 2C3PA 2ZDHA 3HA3A 8GPBA 2NUPA 4F7WA 2EDAA 1L5ZA 1CYDA 4IBOA 1JR2A 4NG4A 2OKCA 1D2MA 3JQ8B 2R6AA 4CMCA 5CW1A 2FLVA 3P0HA 3UW1A 4UCWA 3BHJA 1TAHA 4JKYA 4R3UC 3B1KA 2RGNA 4U02A 5K0EA 4PC2A 5HBGA 2V3VA 5I9MA 1K6JA 5LBIA 3WQHA 1TLLA 5ALTA 3O9MA 5IZCC 4NBVA 1WP9A 1MEEA 4I50F 1U6KA 4RKEA 4G4SP 4GI2A 1EQUA 1NVEA 2A1IA 4PFSA 3OHMA 1FJHA 1YCFA 4N5IX 5G02A 4BP9A 5AKHA 1QGZA 2AG5A 4KQCA 4RCYA 3CEAA 1FZTA 2FZLA 5J43A 2E4ZA 1R8YA 2XADA 4BVFA 4QPDA 4YA6A 3WB2A 4C21A 4OLBA 1K5HA 4B6OA 3D4PA 3H3XA 3TSCA 1A5ZA 2VDMB 4OV6B 5BQOA 4TOIA 3CO5A 4HB0A 2VWQA 3ZLVA 1ZD9A 5FQNA 4B6QA 2R00C 4RK4A 2AK3A 2G9RA 3LQKA 4GOLD 4WADA 3QGMA 4C87A 5HUJA 4PANA 4DEXA 5CIYA 3DLHA 4QYIA 3CT6A 3SMVA 3OWXA 1DEAA 4KTVE 4OVKA 3H2IA 1DBIA 1RAAA 2XWSA 1UM9B 2W6ZA 3I5AA 4GICA 2R48A 4GD3Q 3PE4A 4LTNA 3HM9A 1X0VA 3GN2A 3PXCX 1PJ8A 4UBNA 2C54A 3O3OB 2CSXA 4X91A 4I4LA 2JLZA 2MINB 2VDUE 5FTJA 3WSVA 2IEDA 1V8FA 4U7PB 4LC0A 3L93A 1U1CA 2SECE 5DBOA 2D1SA 2GFHA 4H6XA 1MTZA 2IBTA 2JFNA 4NCNA 2JHPA 2ZRIA 1AUPA 2PWPA 3TLEA 1A2OA 1C1DB 3OM9A 5ALXA 3ZVMA 4S3MA 3ZNOA 1QUFA 4G4SO 2G7MC 1TW2A 2V4MA 4LJ5A 2VXBA 1TU3A 1TD9A 1G66A 2JL1A 3DULA 1DJLA 2C2YA 3LW8A 3PGKA 4G0PA 4NECA 4YP7A 3R5JA 5IULC 1MNQA 1G7CA 3PEFA 1ZOIA 2OO5A 4RTNA 1W6UA 5HTOA 1SPXA 1ADCA 3FPLA 4AUEA 3P9PA 4HQLA 4IDCA 4KQKA 3ZHCA 2RH4A 2PYDA 4WY2A 3MBOA 4O0MA 3P8ZA 5EXEA 2DPLA 1LNSA 2OFWA 3KSUA 4IUYA 4MQ4A 4HQKA 2VAVA 3STTA 1USKA 4TL7A 5F4BA 2GARA 3A2LA 1TVEA 5GGYA 3S2EA 1GU7A 3H0KA 3EXHA 3IPAA 3V80A 4Q7QA 2FNAA 5EIFA 2X2EA 4Q9NA 2ECQA 3T8YA 1VLJA 3WAKA 4YCCA 2GT1A 3QUSA 2HK7A 1KNQA 1QC5B 4XWWA 1JG7A 4QRDA 3KTAB 1U65A 4NXMB 3MB5A 3SF8A 2E1PA 4JXJA 2GZHA 1UDBA 1Y4UA 3BXHA 1IBRA 2PVPA 3H2HA 5HNKA 4I4IA 1PBTA 3IDOA 3QBTA 3KBOA 1T26A 1E18A 3L06A 4QDKA 3PDWA 4CM8A 4Q3OA 3NHBA 3LUPA 4G97A 3KZCA 3PR2B 1WY7A 2OAQ1 1N78A 3EVNA 5IAAA 2YJGA 1YR8A 3R4CA 4BATA 1XVTA 3T1VA 1Z3CA 1LLDA 1P6QA 3N86A 2V7QA 3FWZA 2DFTA 4LJRA 2W8BB 2BM1A 3GCXA 1QGDA 4RQBA 5FWYB 3KT0A 1PEKE 4HZUA 4BQOA 2JLWA 3ER8A 4YCNA 2WMNB 5ALKA 1ZOLA 3YASA 5L7WA 1IXYA 5IX8A 1MGPA 4CKWB 3KEGA 4X1KB 5FCDA 1RJDA 3K0SA 1WDLA 1GRNA 1K86A 2HY7A 3STXA 2IV2X 5SY9A 4KYVA 2WJHA 1OJLA 1EVIA 2HU5A 4NABA 1LV7A 3CWZA 3WNZA 3EPHA 4JA0A 3NDIA 4Y6SA 1ICEA 1DUIA 1VJRA 2XHZA 2P75A 2PMFA 4B82A 3HJNA 5MFPA 2I22A 1WR8A 4WKNA 2QF7A 4IHJA 4TZTA 4L2IB 4FTWA 4RFSA 2A1TR 2W98A 4WZ6A 5K3SA 3UK2A 4ENSA 2GM4A 2GN6A 2YN4A 3WWCA 4P9NA 3GFRA 4TN1A 1X15A 2QZSA 5K6AA 3F98A 3RVLA 3IAXA 3LXXA 2GR9A 1TQ8A 1FTQA 1YHZA 2FLWA 1OFUA 4UD2A 2Q45A 3EFHA 3STYA 1IQUA 4OQYA 1V8ZA 2GCPA 2PTHA 2HXSA 3QKSA 1U2ZA 4WBNA 1XRRA 3AUYA 1XQ9A 4R8KA 2YS7A 5DHAA 3RLIA 3PI6A 1UOOA 2QYOA 1DV2A 3MWEA 3QXCA 2GN9A 3C14C 4ZPXA 4O2BF 1U02A 3ZEIA 1Q50A 2BEUB 2A2ZA 2G36A 3FYUB 5H0IA 4MRRA 2V6GA 5EJAA 4EI7A 2BCGY 2WF5A 1YVPA 3KP1A 4QVIA 1YQEA 1UJBA 4P22A 4C4OA 1AKEA 4WWHA 4MVJA 4O4IB 4ZYXA 1R0XA 4KBGA 3U7EB 2DERA 1JDNA 1Y8QB 1W88B 2QTMA 3DE4X 4UM5A 3LK7A 4IEFB 1TJNA 2GRJA 1H9BA 3FI9A 3L8FA 5FNZA 5IXYA 3VA7A 2YZNA 3LOUA 1VCIA 4OFZA 4C07A 5B2FA 4D9IA 1RYMA 3FPKA 2I4RA 4B4DA 1IH8A 2HRZA 5EJ5A 3E3MA 4B3MB 5GGXA 2IW3A 3NDPA 1BWRA 1DPFA 2REXB 4IJVA 5AH0A 4F6LA 1I01A 5F9HA 3IT1A 1O94A 3G2OA 4C6SA 3LX6A 3GLIA 3G82C 2GKOA 1D6MA 2A14A 2BMDA 1XJ5A 3EH2A 1XZHA 3TBFA 1U2TA 4CMJA 4TM7A 3IOBA 3GWZA 1GRVA 1TVKB 3OZDA 3HVUA 4WLFA 4KIJA 1W36D 2J9ZB 5IH7A 2VF7A 4PYMA 3QVXA 4JB0A 5JPIA 4IDHA 3K70D 4ON9A 1ZESA 2ZRNA 3NH9A 3VISA 3R4VA 4DUYB 3ZXSA 1OI7A 5AXDA 4YJ3A 5KPDA 5C18A 2MSNA 3AR7A 1RI4A 4O08A 1E1QD 2XQVA 4QUKA 3UWPA 2LVBA 1VKZA 3QV2A 2OTCA 3D4NA 1QU3A 2D4HA 5DN6A 1SOWA 1PFVA 1PUIA 2ZGVA 3LG2A 1Q12A 4LJ9A 2GHIA 2H1IA 2Q6LA 1NW3A 2WZDA 4N0EA 4PLGA 4XJSA 3BN3A 1Z2DA 3B60A 1NATA 4G1FA 1JMYA 1ITZA 3RWOA 1X1CA 3ADOA 1Y5LA 1Z2NX 3EXHC 3K5WA 4OGLA 2YIVX 4K1LA 5A5EA 1BXRB 3O31A 2QL7A 3R6WA 4HKTA 3T5GA 3T7CA 1NP3A 4KAAA 4LWPA 4G23A 1OBCA 4KAXA 1Y1KE 3B52X 1M0WA 3HE3A 2IDKA 4MR7B 2WF9A 1A5SB 4UMFA 3WLSA 4GP7A 1KXZA 4BX9A 4PG8A 4P5DA 4D9MA 2ETVA 4BE7B 4XUCA 4PSDA 1AE1A 3T12A 3DXYA 4Y2RA 1Q21A 3FBGA 4URHA 2Z6QA 3A6HA 4WSOA 1FMFA 1UDXA 2H1FA 2QTTA 1GCOA 3GEMA 3FVTA 2FR0A 1BEUB 1BHO1 2WFZA 4W1PA 3N6RA 1L1QA 3H9CA 4N18A 5EJMA 1QXSA 4YO8A 1MN6A 3UJ6A 1QZUA 4RDHA 3C6ZA 3FTPA 1JEQA 1NN0A 1W94A 1YJCA 2W6JA 4MS4B 4M53A 1RJGA 3ZGNA 3OJXA 3EVGA 3UPDA 1PR2A 4MTLA 4DBLC 2WHEA 1PP4A 1SHUX 4AJ9A 2XQFA 1RI3A 2IPOA 4JK3A 4ZHQA 3HBLA 4GS5A 2ID4A 5CURA 1P3JA 1X80A 3PNVA 4LJYA 4C0LA 2EC5A 3HCNA 1L7XA 3F3SA 4H1HA 1ULBA 4WDRA 2A84A 1ZC3A 5LZ5A 5E2BA 2G4VA 4WLOA 4H7FA 3E3AA 2VJDA 4LISA 4XIYA 3TAUA 2AD1A 2PA3A 3DV9A 4U00A 4OQQA 5C8XA 5LP6F 3R3UA 1XK7A 3N5KA 4ND8A 5F7ZA 5THQA 4RL6A 4UHDA 1AF4A 1XIVA 5AVVA 1XXLA 2BDUA 3C41J 1S96A 3WGZA 3KJNA 4X1YA 2CVZA 1AZTA 4U2GA 5EESA 4EKEA 2ORWA 3R5FA 4OLAA 4Y2VA 1B76A 1CQWA 1PZXA 5AHXA 4AMUA 2O2XA 2O4UX 1A9RA 3AHJA 4OOFA 1QZXA 1VZ2A 4BB9A 4FDVA 4BLOA 1RTTA 1S4QA 1L4EA 2AYXA 5KYYA 3K9LA 2PZBA 1ZX1A 3JQ8A 4TQUS 1HKUA 3TLKA 1CY1A 4C7OB 1B8PA 3RGGA 3C97A 1O9GA 3VZPA 2VOEA 5HOEA 3OMXA 1ZNYA 5EWJA 2QTVA 4QFDA 1T0JB 3GFOA 1YZUA 3T95A 4RJLA 4EI8A 1R3UA 2WJ3A 5SYNA 3SSAA 2F1OA 4L5IA 5K0NA 3BL5A 2X15A 5CT8A 1PCXA 1KBOA 4O4LF 1Y4SA 1KVTA 2WY2D 4HNUA 2JIZA 4F5ZA 3ZHBA 4KVFA 2N0SA 3S2GA 5TT0A 3X1ZA 3K0AB 2QUKA 2J9XB 1Y3BE 2NU8B 3ETJA 4MKIA 5CPFA 2BFMA 1YZKA 4MW1A 5DYGA 2OM2A 4NENB 5FNVB 1EDBA 4PNPA 2MCFA 1JLHA 1M73E 4AL4A 1B74A 4ZZ0A 2YVQA 2VNIA 4JJZA 2A1TS 3NFYA 3CX3A 2FW8A 4KAFA 3SKXA 4WV3A 3AYXB 2NUAB 4N6OA 3EVCA 1YCDA 4QWWA 1B93A 3LD9A 1UBMS 2R47A 1DFGA 2O1XA 3GQVA 4MGKR 4HS9A 3D43A 2F3UA 2OP0A 4KR6A 1YXMA 4HC4A 2D1FA 4AURA 2HGSA 3FR8A 4FU0A 2KYRA 2WJAA 3JYOA 4E0BA 3DZHA 1RAEA 1FC0A 3LKZA 3T3GA 4DQLA 4F8YA 4QO7A 3Q41A 1ACJA 2ECFA 2WP0A 4IOLA 3ROXA 5EJGA 1VXRA 3TTXA 3HH8A 3TGPA 4JEHA 3DMNA 4JI7B 3ZH2A 1IXZA 1QCDA 1BMQA 2GZ2A 3AHDA 3WLEA 1XOIA 2PH7A 2ZYWX 2NXJA 3NG1A 2FCRA 1WWKA 1X14A 3G2IA 4M8SA 2OCLA 3RC3A 3HCDA 1LGYA 2CLOB 4ZAYA 1RLIA 1UK8A 3R3XA 5F52A 2NZ2A 3KQNA 4J2HA 4WBXC 5HFNA 1D3AA 1HTTA 2F64A 1VMIA 3L2OB 4QU8A 5DX8A 3ZV3A 2BCJQ 1F2UB 4WY5A 3CY6A 4D9JA 8ADHA 2YDYA 2NQ8A 4IJ6A 1ADBA 4UARA 4BIIA 2RGEA 1X87A 1A9QA 3AFGA 4P3PA 1Q7RA 1XWWA 2YHIA 2ZJ1A 3GJ4A 4AKGA 2Y99A 5HKKD 1AUXA 4ZO9A 4S2UA 4ZALA 3OZUA 2IHTA 1UBNA 4RKWA 3UUEA 4ZJUA 4RHFA 2GJSA 3WNBA 3H1AA 1U0EA 1NVTA 1A9OA 1ZD1A 1AA9A 2Z0MA 3BREA 4DPMA 2XKKA 2ZCUA 2AXNA 2LCFA 3I05A 1G8KA 2NPOA 4BECA 2A35A 4QLAA 5CHEA 1U8XX 1MX5A 4PO9A 5ALHA 2PLAA 3IVCA 4EY6A 4I9NA 5CVTA 4KPGA 1QMPA 3ZW7A 3UW3A 2FN4A 2ZRMA 3M6AA 4EL5A 4BPBA 1YZFA 2B8JA 2OG1A 2HLDD 3C7DB 3CIFA 1DDOA 1DEXA 4ZZIA 3HBNA 2CHEA 4I36A 1Y1TA 1N6RA 3T5PA 3OCYA 1PHPA 4FOTA 1FQWA 3C8DA 3M2TA 1MT3A 3G9XA 3JQ7A 3DBOB 2QT0A 1GZHB 3EIUA 2XJ9A 3K9FC 1U9IC 1OTYA 1V7CA 2PZKA 1Y1PA 5BT8A 4XM1A 3P2YA 5B6PA 3REOA 2CYAA 3GRCA 1BWPA 4V0NA 3VNUA 2H2DA 1TJYA 2EG9A 2PFKA 1XPOA 1KC3A 4QJ4A 4XARA 1KDYA 4GXRA 1T6YA 1NUSA 2AH5A 1T34A 3FN4A 3G5UA 3QY9A 1BRMA 3BE8A 4NFSA 1ESEA 4J0KA 5HEKA 5IARA 3ZOKA 5ABPA 5CP8A 1SBNE 4LDJA 3W7AA 4RO0A 1BS9A 2ZPAA 5K0FA 5I7EA 2LDXA 5ALWA 3M83A 3ROPA 2AQKA 2JJ2A 4FZJA 1SG0A 3DQZA 2XGJA 3ZWQA 1G3MA 3DUFB 4YALA 1Y1RA 1BJTA 1O95A 3NOVA 7GPBA 2R0QC 3H5VA 4U6SA 4XVHA 1NOIA 1KS2A 5F2OA 7ABPA 2VDKB 3GJSA 2QPLA 3RE1A 4D5GA 2OLEA 4AFNA 1VE7A 3TIGA 2NSDA 4HSGA 4L6CA 1PQUA 5BRAA 1QCYA 2TMKA 3RRJA 2GWRA 5D7NA 4E03A 3QLTA 3W3AD 3CPHA 1E3JA 5LB2A 2HYDA 3TJMA 4DJAA 5GADl 3T0FA 1RLTA 3H0CA 1R37A 5IHXA 4PX3A 1NLMA 1M1NB 2VDRB 3AVVA 2QGNA 3GPCA 2AXPA 1FFHA 1Z56C 2AFHA 4LNUA 2Q5QA 4GKJB 3QXJA 2GK3A 1B6GA 4C1NA 1UWVA 2K2WA 4ZT7A 1A9YA 5KOHA 3IAEA 1E4VA 1JZSA 1XWIA 3E2MA 1Q0TA 2E48A 3K94A 1T2VA 1YQDA 2HCFA 1SU6A 3IFSA 2HX1A 4O4LB 5G2OA 3ADDA 2Q9BA 3MF4A 1PR0A 3ICOA 3LM8A 1T3SA 1ZRSA 1SZDA 1GZVA 3RVRA 2JW5A 3NONA 2V9ZA 4JSTA 1MA3A 1K2WA 2I71A 2VDJA 4KQIA 5AJVB 4ZXFA 1WXEA 1BD4A 1PL0A 2EBFX 2X22A 4MX8A 1B16A 2IU6A 2V54A 1OBHA 1NZFA 1J2UA 4AJ1A 5EYPA 3GT4A 4UC0A 1U9IA 5FJIA 5FLKA 3VH3A 5JNRA 3OZXA 1MJ5A 3THWA 3KJQA 1Z6PA 3TOXA 1CNMA 1ACLA 3M70A 3S70A 2QRZA 1Z4OA 4R9SA 5F7XA 2VP9A 3QWAA 1MF7A 4UPEA 4OB8A 1YZQA 3Q88A 4ZYTA 1EHYA 2WJYA 4HYQA 3C5VA 2QD2A 4IRUB 2BF4A 1EPUA 3OPNA 1J33A 2X1MA 3HYRA 1C7RA 1F5SA 3C5WP 4RVCA 4G26A 3HXMA 4YAWA 5CDFA 3RC2A 3F73A 3P9KA 4DQUA 5B1HA 4IG4A 4MYDA 3SHQA 4UM7A 1SCUB 3C3JA 4WZZA 5CH3A 5JD6A 3V32A 4JI2B 2PUJA 1U0SY 2XIJA 3EZLA 2GCOB 5EPUA 1AK2A 2JVJA 4BVHA 3HXOA 1DXYA 1ORVA 1R9MA 1BC5A 3LT1A 5JAHA 4LYEA 3FSGA 1ZJWA 3ND9A 1KZYC 5DYIA 2XEXA 4RPJA 1VLVA 1ZNQO 2JFOA 4QOIA 2YHBA 1BA3A 4QDUA 1E77A 4A9AA 1SUFA 3FXAA 4NR0A 1CHNA 1ZRNA 1OFVA 2AFHE 3ZK8A 2OQRA 1GU1A 3HHPA 1R5BA 4JP3A 4S04A 2PS9A 2IH4A 3ZLUA 4EZIA 3H8WA 1D9ZA 2CXNA 3UN1A 5BVHA 1CC1S 3Q8KA 2VUTA 1WPXA 3ZD8A 3F3YA 4BIMA 3AFNA 1IK6A 3IT0A 1I2ZA 3FOAA 1OXBB 3QJGA 5DGTA 3NGMA 1Z68A 4KQ9A 1BS1A 2MHCA 4G5HA 1ML3A 4U7GA 1Q11A 3HKCA 4KQ1A 4A91A 3U09A 4BMVA 4X24A 3H5AA 3ASZA 5IABA 5CNMA 1RMYA 1FMCA 5C1PA 4DR4B 4JLKA 3WDSA 4B8WA 4LRUA 3RSSA 3TTVA 2A8YA 2W11A 3Q2OA 4N39A 3OBIA 6REQB 1XTBA 4J0GA 1Z2PX 2GAJA 1KE2A 4ARZB 1E5LA 3CO0S 3IMFA 4PZCA 1B00A 1T24A 1THTA 2C0CA 4P31A 5LBUA 4FEYA 1MJNA 3X44A 2GYYA 1L7MA 1YMVA 1DC8A 3ET5A 1CUXA 3ICWA 4JBHA 4XIJA 4Y0VA 3H2KA 1V7QA 4O29A 5FPTA 3AVTA 2NXEA 1OGYA 4K6OA 1E9CA 4OUKX 3CXUA 4KUGA 1RHJA 1VSVA 3PYLA 3QW4B 3FNBA 3GUUA 2EF0A 1WZCA 3EIOA 2C2WA 3UFBA 4DEVA 5KZMB 5FF9A 4MUGA 4ZANA 3KJGA 1WRBA 1Z28A 4L8WB 4GGMX 1EK0A 3VNAA 2E37A 2IZ6A 1XMPA 1BA2A 4FDAA 3Q7RA 3U7QB 4HX9A 4DMKA 4IZIA 1G38A 3P96A 1UPFA 2FPPA 1O96A 1PLLA 2C4KA 2IUFA 2YH2A 1ELOA 2WA2A 2FN3A 1N6HA 2OG2A 2OHJA 4MSUA 1QHEA 5BSKA 1C9JA 2C7GA 2A0YA 2WPDD 3V1TC 5CVCA 1GG8A 4KH1A 4PC7A 3V1MA 2Y1XA 2OHHA 5TQ0B 3O0DA 3GRFA 4Z8YA 4CTJA 3EXIB 4X44A 1J00A 3K4HA 1LA2A 4NX2A 5JXJA 3RRXA 1FFWA 3SC3A 2DQYA 4E12A 1U7TA 2DFDA 1GPYA 1TUGA 1QRUA 2FI1A 3T1YB 5EWJB 2B21A 3AZQA 4G84A 5JCJA 1MZPA 3C3BA 3SPXA 3SIWA 3VVMA 4QNNA 3WSTA 4ESEA 3MTEA 2DTEA 2JD1A 2SICE 3SYRA 1PQPA 1R66A 4IEEA 4IIYA 3IIMA 4C3ZA 2FEAA 2I76A 2FW1A 2Z1DA 3ZBTA 1YFJA 5GONA 1CDOA 1MAWA 3EQ9A 1JHMA 1XZEA 4UAGA 5FTWA 2JGDB 3DFFA 4K0RA 2G82A 1JJIA 1HMPA 2G0TA 1VE5A 1EG2A 1GN8A 1IOLA 2YFQA 3KZXA 3ROTA 2D0DA 2BFPA 4B3CA 4NONA 3WZ2A 3KSRA 5AXBA 2R60A 3OZTA 3WG9A 3OE7A 4P4GA 3V8EA 4QM7A 2ONKA 4ARAA 1O9BA 4N01A 4ZK6A 3KL2A 3KR0A 1N8KA 2FQYA 2BJHA 3WKBA 3O21A 2OLJA 4MOWA 1JB9A 1E1YA 1VJ5A 3DKPA 5H7XA 4D9KA 2H18A 3KR9A 3M7IA 1NA5A 4R1UA 3LXMA 2Z8XA 2NACA 4WK6A 5HMMA 1I36A 3SZLA 4CR6A 2Q0QA 2Q6IA 4AO6A 3KSZO 1UOPA 2PZFA 2G5GX 5IBQA 4PNEA 4RTQA 3SEQA 2XGGA 2J59A 2CWDA 2XYQA 1T8WA 4JYPA 4N54A 3V4ZA 4KACA 4QD3A 2RAUA 3IKJA 1GQ2A 1P2UA 4QYIB 4ZEWA 4C0JA 4YUAA 4OG2A 1C0PA 4AN4A 1XLTC 1H2XA 1W46A 3NHPA 3PXEA 1U0GA 4G37A 4ZQIA 4RF2A 3WJ2A 3NWPA 4AF7A 4EW3A 5C35A 3IUEA 5LOVA 2QTWB 1R18A 1WXDA 1BCRB 2QQ0A 2Y4NA 1LPAB 5GPBA 2PUWA 1XCGB 5A02A 1F2UA 4BJHB 1W48A 4U0JA 3PICA 1OROA 2G04A 3VXKA 3ENNA 2FDCA 1RHUA 2EBWA 5SZHB 2A5DA 2FW7A 2ISSD 4AMGA 2YL2A 1GV1A 4ZYZA 4Z0PA 1Y7LA 4WRRA 3USZA 2J9YB 4OHVA 1Z6AA 2GZ3A 3BDAA 1SBQA 3Q1KA 4MWOA 4A0RA 4TKUA 2RHTA 1U8TA 1UFVA 3VVCA 1XPRA 3AIOA 2NU6A 2VBGA 1R5NA 3HNOA 1DWOA 1Y8CA 3ZCVA 5FOVA 3VTAA 1JLLA 1EVZA 2XTZA 1MLDA 3QH4A 4Q05A 4RWZA 5TR9A 4KPYA 3KLMX 4OA8A 4EBFA 2QRMA 1YOVB 1T2AA 3EH1A 2ZT8A 4RH1A 2OFFA 5AW5A 3F6CA 1DP4A 3AR9A 3Q6IA 2WYIA 3IESA 1RM5A 3HFGA 4NCXA 3WP1B 2BFAA 4R16A 2PMDA 5HYVA 1DAEA 4MITA 4ZI7B 2CXSA 4OP2A 3PA6A 5ALPA 5SZJA 3TG8A 3R7DA 3JASA 4LBZA 2D7CA 1K89A 4ZI7F 3R20A 4CQLA 4QYMA 4XGNA 3ZWCA 4CL8A 3C98A 4FQ8A 4J3JA 1JE1A 4QSHA 5C5CA 3G8CA 3X1KA 2QW0X 2RGDA 4QJ3A 1QM5A 4OQMA 1UL1X 4GOMD 4OMDA 4MMYB 1LW7A 2VNSA 3PD1A 2X58A 3DPIA 5BYBA 4D5EA 3NANA 4D9EA 4DLWA 4GX2A 5JO0A 3GDWA 3KHSA 2JJ1A 4QBGB 4WN9A 4M8NE 2BY4A 4MDHA 4MKFA 3PFWO 4W9RA 1C3OA 1OZGA 1OZ0A 2G9ZA 2LXNA 5HCNA 2O0JA 2UZAA 4BNNA 3U7HB 4ENVA 4QU9A 1D5WA 2YXLA 1IL0A 4B34A 2Z2IA 1S01A 1Y37A 1Z0AA 2G1JA 3ESBA 3SICE 1BH2A 4F84A 4RBNA 5FWYA 1UODA 1TCUA 2WHPB 4L4YA 1KO8A 2QZ4A 2V6MA 5EGSA 3M4XA 3WGLA 3G3EA 4V39A 3ZHZA 1M1UA 4BCBA 2F3TA 4LE1A 4OLFA 1Y6RA 2QZJA 2HBQA 2XX3A 4G89A 3HHEA 3DFZA 1E6LA 1RWKA 3O5AA 5GMOA 4D96A 2C31A 5C1BA 4M9QA 1YUMA 3CUWA 5ADWA 2VTDA 5FBRB 3FUVA 2K6GA 3GGOA 4PQFA 4YMLA 1M5TA 1MJGM 5DGHA 5EHQA 4RU1A 1DRWA 3UT5B 1BRTA 1HMYA 3A4LA 3L0SA 3NIBA 1RS0A 4ROTA 4B40A 4DAEA 3KT8A 3FOZA 2UU9B 2DQSA 3B20A 4IYJA 1Z0IA 3HDTA 1CNFA 4MRAA 5AKLA 5L3SB 2JH9A 3MOIA 4EYGA 3L46A 1KDZA 3IUPA 4DDKA 5B4VA 2VH2A 3KYJB 4V0KA 5AM4A 3K2QA 2BL4A 1SOAA 4EEKA 2P2YA 3JD2A 4DV5B 6CHYA 3EEIA 2FCAA 2A9OA 3SQWA 1UT8A 1M34E 2XMRA 3LY9A 4K9QA 3L1HA 1RLJA 1MB0A 4BGUA 4HGZA 4O4LA 4K9PA 4EG4A 4L02A 4JV5B 1XKXA 4ALJA 2ID8A 3CWQA 1LDYA 2YV5A 4JY7A 1P62B 4PZEA 4J0EA 4KN5A 1FZQA 2JIPA 3W2IA 4AJNA 2H7YA 3KFXA 2W6PA 4DMHA 2JGNA 3TSYA 2C7VA 4EGAA 2KS6A 3VR4A 5KNBD 5DBHX 1T1IA 3M3PA 3THWB 4F2DA 1Y3CE 3MD9A 1NXSA 3KTOA 2FWNA 5JDIA 1KBQA 2DP4E 3Q8XB 1SCAA 4JNCA 4UU8A 3JWPA 3IIIA 5FWNA 3BIOA 2YHSA 3A6FA 3AR4A 2AOTB 1NW8A 4MV0A 4Q00A 5EP4A 4V0RA 4YUWA 1NXPA 3D6HA 4I7EA 4LZJA 1K8XB 4HSEA 5AHKA 4ETNA 1TK2A 2I6XA 3PKZA 2MSKA 5C32A 4C30A 2VYVA 4CF7A 3ZXXA 2HNBA 3BGOS 5BYAA 3CNBA 3KQPA 2Z8ZA 1RU3A 1G20E 2RI0A 3K8OE 3BYZA 3U37A 3GLIB 1P3DA 1PN3A 5BRNA 3TPFA 1DG1G 3B9RA 4KEAA 2GM5A 2ISCA 3IBTA 4OL9A 2I3ZA 4R2IA 1DHTA 4MQFB 3QITA 4YLGA 5HIIA 1S4MA 3GCWA 3KJFA 1O6CA 2J08A 3OFVA 4ZCQA 5T4BA 2VKQA 2WAOA 2C4WA 4CF4A 1GRCA 4CNBA 3W8DA 1CV2A 3ENKA 5IDYA 5CLGA 1H0HA 1ZCAA 5KWIA 3ML1A 3I42A 1EX9A 3AKEA 2E3JA 1F14A 3LUHA 3TB6A 3E84A 2D62A 2BEVB 1N5RA 2VDNB 3LRPA 2FW9A 4AIRA 3GUHA 4OP3A 2XHEA 4HAOA 4EPVA 1NKSA 4CLOB 3FUTA 4MKHA 4ZT5A 2GRAA 4BL5A 2IUEA 4CKBA 3LOPA 2Z30A 3GPLA 4OM8A 1ZI9A 3LNCA 1S9DA 3C3PA 5J5AA 1XRNA 2A9JA 2EKPA 4D0LB 1U2PA 5JMOA 2W9XA 3O92A 2JANA 3BS4A 3DDUA 1M34A 2YN0A 3OD1A 3EC2A 4UCFA 3A27A 3MUFA 5TJ9A 4OAPA 4PFKA 1ISHA 1OGJA 5LR6A 4CT4B 4CE6A 4NNOA 3ESAA 3HKCB 2XMDA 1H6BA 4QUHA 1DXHA 3PC7A 3PT9A 3SM3A 2QQEA 4CV1A 2QY6A 2VLBA 5CVJA 1QTNA 1BVRA 2OO3A 2WB4A 4G9BA 5LQMA 2WWYA 3VJMA 1FDVA 2HIGA 4GOKA 1ZOOA 4C0BA 2QN6A 1OVGA 4LDRA 4RJIA 3FB1A 3WHIA 1UBGA 5AKXA 4HB3A 2HT6A 1K7FB 2OBNA 2AC2A 2H3HA 5GJWC 3RS7A 3K9NA 1P7ZA 1ZI8A 3VPAA 3HWRA 1K8ZB 2GYVA 3EEQA 3WGHA 4URZR 4AJKA 5JNLA 4EY8A 2XCSB 1E2GA 2JBAB 2VXCA 4RL4A 2QXYA 2WVJA 2WBLC 3OLWA 5EMJA 5ITWA 2IODA 2ZIWB 2OXTA 4MW6A 1BVHA 1VHQA 2C4HA 3DR5A 3RSGA 2VXOA 2WIBA 2GXQA 3ZWYA 1JAYA 3A1UA 1DEOA 2HO5A 3BWYA 4L5BA 5F1YA 1O6FA 2D5LA 3DVLA 3SQLA 4BLUA 5HPYB 4PLTA 1QKKA 3H5TA 5CDGA 3KAJA 4YV2A 1CZLA 1VGQA 3GK3A 3R5HA 2HT1A 1CT9A 2HBRA 3AX6A 2ATVA 4OUDB 1I6WA 3D3JA 3LKDA 3ZIDA 1VE6A 3T7RA 1MKYA 1SIBE 2C1EA 3AOEA 3BA6A 1NG1A 3GVXA 1KORA 1G19A 2HK8A 3EA5A 4M0UA 4OJQA 4EHNA 1L4LA 1SAYA 4OQFA 1DMSA 1W2WB 2QTGA 5D86A 1LJUA 3KZMA 1AKVA 2CXUA 2VYQA 3IURA 2X5XA 1YRLA 4O25A 3RG2A 2AD5A 2INGX 3SVTA 4H35A 4YACA 1DBWA 1GZ4A 5KHLB 4X1YB 2II6A 1JGTA 1V35A 3GUZA 3GJZA 1RVDA 1WUIS 4JLSA 4PYOA 3MJDA 2JK1A 2ZTLA 1VM6A 3GH1A 4MV6A 3ZDXB 1JUDA 2C4NA 2WIFA 2W42A 5CNKA 3IP8A 2A9KA 1O0CA 2ZSAA 5KYYB 1YQXA 2PJUA 1JDSA 2OORA 4ZEOA 2I2AA 5AJWA 1EWQA 1GFZA 2CUKA 1UH5A 1T43A 3DEFA 3QG1A 1N1EA 4PC6A 2HJSA 2PUDA 2JCVA 2OLKA 3CJTA 3N07A 1FL9A 2X40A 1L4FA 4NAUA 1HFEL 4PFJA 4XDGA 3BT7A 5MN5A 1E9VA 2IL1A 4I5IA 2XKBA 1Y8QA 5JI2E 4MA5A 4QECA 3QEKA 1XLVA 1YI1A 3ZE2B 3RAEC 1A5AB 4N5DA 1PVVA 2AX4A 3UHPA 2XT6A 1X92A 3Q1LA 1FP6A 1RLMA 1F4LA 1QH1B 1SBTA 3GH3A 1B41A 1N57A 3L7MA 3UVEA 3KQYA 4P53A 1KEWA 4BQPA 3RGWS 1TZBA 2ZP1A 2O20A 3GLFE 2XMGA 2V45A 3ABIA 4NENA 4OXNA 1QP7A 3TJZA 1MC8A 4B3IA 2JLAA 5AKKA 2ACVA <