4HTFB

Crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
247
Chain Sequence
MQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAIKMAERGHQVILCDLSAQMIDRAKQAAEAKGVSDNMQFIHCAAQDVASHLETPVDLILFHAVLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMSPDYPRDPTQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDCYEALLELETRYCRQEPYITLGRYIHVTARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-adenosylmethionine-dependent methyltransferase from Escherichia coli in complex with S-adenosylmethionine.
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords S-adenosylmethionine-dependent methyltransferase
total genus 88
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4htfB00
3AXSA 5DTQA 4HH4A 3FPJA 4E32A 5K0JA 3TKYA 3SSNA 3DMGA 4BLVA 2OB1A 2O05A 2O07A 3A7DA 4HTFA 3T0IA 1ZHFA 2H1RA 3P2KA 1WG8A 4P7JA 2I6GA 2IPXA 2O06A 3FTCA 3GWZA 5EHGA 9MHTA 5JR3A 2CKDA 2P3OA 3KR2A 3NTVA 2PSSA 2OY0A 1XJ5A 4RTQA 4ER3A 3OZSA 3QOWA 3M70A 5HOQA 1JG1A 3MCTA 5G02A 5GP1A 1NV8A 3GNLA 3MQ2A 1QAMA 4QPPA 5LQNA 3OU7A 2AOVA 3BXOA 3FUVA 1AQIA 1NW3A 1G60A 3FTFA 3GJYA 4PYLA 3FYCA 1FP1D 3H2BA 2BR4A 1XCLA 5K8VA 4R6XA 4OBXA 2F8LA 4P7FA 4QPNA 2ZZNA 4IWNA 3UFBA 1JSZA 3EVDA 3SSOA 1IY9A 2PT9A 4BP3A 4C06A 2AR0A 5LQRA 1X1AA 4RV9A 3A26A 2PT6A 3ELWA 1BKYA 5ERGB 1KHHA 3TKAA 2IBTA 3KKZA 3FPEA 5K0GA 2QRVB 2PV0A 1UWVA 4MTLA 5CIYA 3LGAA 3GRUA 3I9FA 3OU2A 2G71A 5DTMA 3M6VA 1L3CA 2PKWA 2G70A 4P7GA 4E2YA 4YV2A 2UYHA 2CMHA 3OPNA 5GWXA 5GINE 3KQSA 3DLCA 3BWMA 5E2BA 3TRKA 3G2QA 3SM3A 2ZW9A 4X41A 2P1DA 1PRYA 2Y1WA 2ZBQA 4E70A 5JUWA 2AOUB 4ER5A 1AQJA 4RVGA 4DMGA 5BW4A 3NWBA 5BW5A 4CWAA 4RTJA 4E33A 2HR1A 3BGIA 4FR0A 4LWOA 2IP2A 4RTPA 4EKIA 2NXCA 2PWPA 5CM2Z 5HILA 3FRIA 5EIFA 1IXKA 3FPFA 4DKJA 10MHA 5EVJA 3SR4A 1VE3A 5EEHA 5P8WA 2XYVA 3VC2A 4HSGA 3WSTA 5FQOA 2P3QA 4LG1A 4LWPA 2XVAA 3VSEA 3AJDA 2PXAA 1AV6A 3BKWA 2V7EA 1ZKDA 4PGGA 2I62A 1NBHA 4PYJA 5K0CA 3LX6A 3FUUA 1KR5A 3B5IA 2B25A 4Y30A 3UZUA 1B42A 2YX1A 3AY0A 3BWYA 3T7TA 3DOUA 5BXYA 5ICCA 2FPOA 3IV6A 3LDGA 4IV0A 2QE6A 4EVIA 3FZGA 3M6WA 4R8SA 1T43A 1MJFA 4V0QA 5EZSA 1VP9A 1M6YA 4GBED 2PX4A 1JSXA 3R6TA 4ATNA 1R6AA 3GRYA 3JWJA 5C9ZA 3AXTA 5HFJA 2C7RA 1I4WA 5D1NA 2ZULA 3TR6A 2Z6AA 4RSRA 1EG2A 1P1BA 2GA9A 3LDFA 5T6BA 3DMFA 3LDUA 4GC5A 4R8RA 4F84A 3DULA 4PYNA 3UJ9A 2A14A 4YUZA 4P58A 5KYGA 1UIRA 2AVNA 3CJQA 3DXXA 1X1DA 3HA3A 4YMGA 3R9XB 2VDUE 2AOXA 2ZZKA 4NECA 5E8JA 5EKUA 5EMKA 4C4AA 1YFJA 3DR5A 4QQNA 1QANA 3UJCA 4E2WA 4EQZA 4RTRA 2B2CA 1JG2A 3I64A 4OQEA 5GM1A 3DH0A 3C3PA 5IKMA 1ORHA 2Q41A 5LQAA 2BZGA 3TLJA 3ERCA 5CVDA 3FUXA 2PJDA 2PVCA 2GLUA 1TW2A 3JWIA 3QV2A 5DM4A 5EHIA 4OBWA 2HMYB 4JXJA 2OYRA 2Z6UA 2P7IA 1VIDA 4ISCA 1JQ3A 4WVLA 5DX0A 1YZ3A 5FADA 4RTKA 3ER8A 1EJ0A 3C6MA 3HCFA 3UWPA 1RJEA 3UA4A 1BHJA 4OX9Y 2BR5A 3KPJA 1EAMA 5DPMA 1D2GA 5U4XA 2ZCJA 3FPHA 1DL5A 4HTFB 5FULA 5HZMA 1X1CA 4FSXA 4GF5A 3O31A 1QAOA 2EFJA 4PIMA 5GOZA 3O7WA 5F2KA 4EKGA 5DX8A 3TMAA 5DM2A 5FA5A 1ZG3A 3Q87B 1G38A 1UFKA 4CXMA 4OA8A 4GUAA 2YXDA 1QAQA 3LCVB 4YUXA 2R3SA 2P8JA 1YF3A 5BP7A 4A6DA 3A4TA 4C03A 2ZIFA 3KQMA 4CKCA 2ZWAA 1NW5A 4FZVA 3B3FA 3KQTA 4M36A 4XCXA 3C0KA 4CTJA 5KQSA 2UYCA 3TM4A 3ER9A 4HRAA 1X19A 3F4KA 3HM2A 3G7UA 4RVFA 4YUVA 1JTFA 2QM3A 5CVVA 5EIWA 3CVOA 3M33A 4KIGA 3UJAA 1KPIA 2UYOA 3M6UA 5ICEA 1XCJA 3C3YA 5DXJA 5C1IA 4MWZA 5KQRA 4XUDA 4AUKA 1RJDA 3K6RA 3LKDA 2EJUA 3OFKA 2JG3A 2HNKA 1VBFA 4E31A 1Q0TA 2QY6A 4FGZA 2G1PA 3R0QA 2O57A 3FUTA 2C7PA 3TPZA 1YFLA 4PYOA 3CCFA 2PY6A 5CVJA 2IGTA 3P71T 5LR6A 4DCGA 2P7HA 3LL7A 5DRYA 3BGDA 3UJDA 5C0OE 3GGDA 4GQBA 5GIOE 4DF3A 1L1EA 5DXAA 3JWGA 2ZVJA 2ONZA 5E2AA 2AZTA 2BM9A 4E30A 3G8BA 2H00A 2ERCA 2AN4A 3NJRA 4E2XA 4DA4A 3CGGA 1VP3A 3TOSA 1XXLA 4HGYA 1R18A 5K0LA 2OXTA 4BP1A 1YUBA 2ADMA 3M4XA 5FWDA 1G8AA 3BZBA 3ELUA 1NV9A 5EOVA 2O0LA 4BY9E 3HP7A 1JQDA 2FK7A 1R8YA 3G2PA 5CVEA 1SUSA 4POOA 3P2IA 3A7EA 1RI4A 3NMUF 4ER6A 2AS0A 4U7PB 4IV8A 3EMBA 2K4MA 3KQOA 4ER0A 3CJTA 1VLMA 2ORED 3KQWA 1ZGJA 4B17A 2B9EA 4AZTA 1NBIA 1N2XA 4G56A 4YMHA 3FUWA 2UZ4A 3LKZA 4FT4A 4GOMD 5LQKA 2IIPA 3FYDA 2XYQA 1RI1A 3G5TA 1XDSA 1YB2A 3P9NA 2IH4A 3P97A 5LQJA 2BH2A 3P9KA 2XBMA 3DMHA 4OA5A 1FBNA 4AZVA 1H1DA 2Y1XA 3SX0A 2QRVA 1M0EA 5HEKA 4K6MA 5FCDA 4C07A 2PGXA 4C04A 3KPWA 4AZWA 1F38A 1I1NA 3G8AA 4BLUA 2VZ9A 4EMSA 4RTLA 5EMMA 1U2ZA 5GM2A 4PYQA 5IH3A 4EK9A 4KDRA 2AVDA 5CD1A 4X1OA 3P8ZA 5E1MA 4AZSA 2JH8A 2IFTA 1JR4A 4E2ZA 3SXJA 5DM1A 3M6XA 3B89A 4CKBA 4GC9A 3ELYA 2EJTA 3ME5A 3BT7A 3EVGA 1BOOA 3KPUA 3BWBA 1X1BA 1VL5A 1RJGA 3C6KA 3HVHA 3I58A 2HWKA 2ZSUA 5GIPE 4KRGA 5CVUA 4YV1A 4GOND 1N7JA 1XTPA 2YVLA 3JWHA 1TPYA 1RI5A 3BKXA 3I53A 1SQFA 1WZNA 3EGIA 5DLYA 4HG2A 3VYWA 3KQVA 5K03A 4Z2YA 1D2CA 2AOTA 4MIKA 1JG4A 5K0FA 4YV0A 3DLIA 1KP9A 4FT2A 3FTDA 5HIIA 3CC8A 5F2NA 4GOOD 1N7IA 5EZQA 3GRZA 3K0BA 2P41A 3ORHA 2ZIGA 2NXNA 4AX8A 5K05A 5FHRA 2WA2A 5DX1A 2AN3A 3NW9A 3CJRA 3KR9A 2HV9A 3LSTA 1XDZA 3G2OA 2GB4A 3GIWA 3KQYA 2FYTA 4KWCA 2AOWA 5EMLA 5EPEA 3NVKI 2PXXA 1Q0SA 3PFGA 4GOLD 3PB3A 1F3LA 1INLA 3EEYA 3LHDA 3OE5A 5E1DA 5CUQA 3OCJA 1KXZA 2BM8A 2GH1A 2OBFA 2OZVA 3PX2A 1G55A 2NXJA 5T67A 3GRRA 4GEKA 2IH5A 8MHTA 2YQZA 1WXWA 3RW9A 3NDJA 5EKXA 3GXOA 1FPQA 1VQ1A 4C05A 2Z6QA 2XYRA 1JTEA 2EG5A 5FA8A 4ER7A 2PX2A 4FSDA 4PCAA 4ZTBA 4RVHA 4QVKA 3NDIA 3HVKA 3HCCA 2NXEA 5ICFA 1P39A 3VC1A 3R3HA 2GS9A 3HCBA 2YXLA 3BWCA 2AOTB 3P9CA 1FJXA 1EIZA 1G6Q1 1TW3A 4RWZA 3EGVA 1SUIA 2KW5A 3O4FA 4L7VA 4P7KA 2OB2A 1R8XA 4M37A 3OZTA 4YUWA 4MHTA 2P3LA 2OO3A 3LECA 4YUYA 5KS2A 1NT2A 3Q7EA 4RTNA 2IDKA 3BUSA 5DTRA 3MHTA 3IYLW 5M5BA 3A27A 4RTOA 3MTEA 2EX4A 2ZIEA 5LSAA 2QYOA 2JH9A 4XUEA 4X63A 1O54A 3HA7A 2FRXA 3NVMB 3EVCA 3GU3A 3HVJA 5FHQA 1IM8A 5FWAA 2YUIA 3THRA 3OZRA 3RODA 1O9HA 3A25A 4CKEA 3V8VA 3LBYA 1NW6A 4KIFA 3CKKA 2NP6A 4HC4A 2BR3A 2JHCA 3T7RA 2FHPA 5DM0A 4OQDA 4RX1A 1YZHA 1FP2A 5H02A 5B1SA 4F85A 1V39A 4M7RA 3HA5A 5FQNA 4PWYA 3UA3A 2HTEA 1EQAA 2LD4A 2VDVE 4HGZA 4QTTB 5E9WA 5E9JA 5FUBA 1DUSA 2P40A 2ZBRA 3G89A 2IH2A 3PLAE 3PFHA 1Y8CA 3MERA 3LCUA 5EEGA 3ELDA 3KU1A 4DM3A 2AOUA 3UJ7A 2ZBPA 5LQUA 2PLWA 3D2LA 1DCTA 5EGSA 4RTSA 1WXXA 4WXHA 5D1HA 5E9QA 2FK8A 5E8RA 4PONA 1JG3A 2B3TA 1O9GA 1ZGAA 2H11A 2OPBA 4KDCA 2VS1A 4PCLA 3HCEA 5DSXA 1D2HA 1KYWA 1QZZA 2ESRA 3AWIA 2B78A 3P9IA 5DWQA 4CTKA 4FS8A 1SKMA 1L3IA 1NE2A 4DCMA 2FCAA 1P91A 2UYQA 4PINA 3SMQA 1XVAA 4C08A 3LCCA 4O29A 3PS9A 3X0DA 3KR1A 3SVZA 3MGGA 4V0RA 3OFJA 1NKVA 3KQQA 3TM5A 3UJ6A 1HMYA 4X61A 5K0EA 2IBSA 3EVFA 1ORIA 3RIEA 2ZTHA 3P2EA 5EG5A 4A6EA 3KQPA 5MHTA 1OR8A 4QQKA 2G8NA 2NNWB 5ICGA 3EVEA 3HTXA 1KIAA 1KPGA 3SGLA 3NWEA 4IKPA 3UJ8A 3IHTA 2VP3A 3DTNA 3V97A 2ZLBA 3B3GA 3B7PA 3EEOA 4DQ0A 4KW7A 2WA1A 5KVAA 3ID6C 3GO4A 4Y2HA 3FTEA 1M6EX 3THSA 5LQCA 2OKCA 4F86A 3DXZA 3E05A 4UOEA 2C7OA 3E8SA 2E5WA 1HNNA 4U7TB 3PT9A 2YR0A 1L3BA 3G5LA 4H0NA 3GDHA 2CMGA 3L8DA 1BC5A 2PWYA 3LBFA 1VPTA 1Z3CA 2G72A 2ONYA 3KHKA 1EJ6A 3MCZA 3EPPA 2WK1A 3OE4A 3PX3A 2C7QA 4QDKA 3R24A 3FRHA 1NW7A 2CL5A 2N47A 4FP9A 4PYIA 3HCDA 2IDJA 4QDJA 1WY7A 3UBTA 7MHTA 1NW8A 3KPYA 3HNRA 5E1BA 1G8SA 4X60A 1I9GA 3DUWA 4KVZA 3S68A 4PIPA 5CCXA 1XDUA 2XVMA 1MHTA 2JHPA 1JQEA 2DULA 1RI2A 1QYRA 3CBGA 4QVGA 4RVDA 2JHAA 2CWWA 3IEIA 5DT2A 4QTUB 5EQJB 4BLWA 5DSTA 3MTIA 4R05A 4M38A 1SVUA 2P35A 1R74A 2YXEA 2PX5A 3MAGA 5EMJA 4R6WA 4PYMA 5E1OA 3HEMA 1SG9A 1AF7A 3E23A 3U81A 3I5UA 2V74B 2ZZMA 3PVCA 3QOXA 5K0BA 1P1CA 3KR0A 3PTAA 4RYLA 4LECA 5T64A 3HVIA 3TQSA 1SQGA 3ANXA 5DRTA 3HCAA 5K0NA 5K01A 2AN5A 2PX8A 4MQ4A 3SSMA 3EGEA 1KPHA 3T7SA 2JJQA 1R00A 3UJBA 2ZWVA 5HIJA 5CCBA 1L9KA 2I9KA 2PBFA 3E7PA 5K09A 5HIMA 1RI3A 3G2MA 1WS6A 3EMDA 4PYKA 3REOA 3DXYA 1KYZA 4RTMA 4DZRA 2DPMA 5F2OA 3EVZA 3G88A 3MB5A 4XUCA 3DP7A 3LPMA 2ZFUA 3EVBA 2NYUA 3EVAA 5FTWA 2I7CA 2NP7A 3B3JA 4PNEA 2R6ZA 1ZQ9A 2VDWA 3GCZA 3GRVA 2YTZA 3KPVA 3FPGA 3OU6A 3BGVA 5EC8A 3TFWA 2GPYA 4PGHA 5HIKA 1RJFA 2PXCA 2GAFA 1PJZA
chains in the Genus database with same CATH superfamily
2ZT5A 2YHIA 4KI0A 1UJMA 4GX5A 4HH4A 3AI2A 3N70A 4M1TA 3N6RA 4DLZA 1Y8QB 4JUCA 1W8DA 4LOKA 1W4RA 1FMLA 2EZ8A 4DUGA 4XVUA 4AJOA 1JJVA 1TYAE 5EIOA 3GLGB 2INGX 1P31A 3JQAD 3ZDDA 1FDIA 1X7YA 3OAAD 4YWJA 1NOKA 1XRRA 3AFHA 3FPCA 4ZT5A 1ZD5A 3UMJA 3WMWA 2QMQA 3NEPX 5HZKA 3AJAA 3H2IA 1RBQA 4MVWA 3AUUA 4JYBA 1NV8A 4TTQA 2ODTX 1O0CA 4ZFNA 2FRDC 1W5AA 1E0JA 3BXOA 1EB8A 2WD9A 3V8MA 2ON6A 2QZSA 4R2HA 4D4GA 4GAEA 5KNDD 1WUYA 3O1IC 1X7XB 2BR4A 4JITA 4R6XA 5CNKA 4G4SP 1UXIA 4UARA 2WT9A 2WSSD 1D2AA 4FOPA 4OJTA 1MZVA 2JFFA 1WVIA 4K2HA 4LSWA 4FLFA 4W6ZA 4PHFA 3WMRA 3FOBA 5BNTA 5ELMA 3SOZA 3ZR4B 2VPZA 2HLDD 1FLVA 3UT5A 1BE6A 3PCXA 1CR6A 2IYOA 4GMDA 4RA9A 4I36A 3M6VA 3RK1A 4HNAB 3GDGA 3VR6H 2QY9A 3KFXA 4JA2A 5KTKA 3AHDA 1H2YA 3V2GA 1ZGGA 3WISA 2A59A 1FX0B 2VCEA 1Y7TA 2O52A 3CPEA 2C84A 2ZSKA 2QJOA 5ITWA 1JIJA 4A4DA 5F7XA 3DDZX 3RKSA 3R9KA 4OJMX 4BMXA 2HR1A 3NPAA 4GLJA 3Q4GA 3L8EA 3LY9A 4LWOA 2CUZA 3QF7A 3V42A 1B1CA 3A9WA 4OLBA 1ULUA 2Q45A 2SCUA 1IUKA 2UXDB 1IXKA 1W4LA 3BQ9A 4RMGA 1JA1A 2Z6VA 1FUEA 2YIMA 1JNYA 3UOWA 4MX8A 4ZALA 5L7YA 4BKUA 4W8GA 1FMFA 2WR8A 4MV9A 2XQVA 4AZ3B 5JNVA 2GN2A 5AH0A 4OHZA 3EXG2 1GZ6A 1TQ4A 3UJ3X 1QHXA 1CEXA 4HEA6 5JEDA 5JRZA 5EHQA 3K70C 3BWYA 4BRUA 2JGNA 2GRAA 2FPOA 2PSFA 3D64A 3VU3A 2ZSIA 4MB6A 5BYBA 2XI4A 4XVHA 1XHFA 1FS5A 2XUOA 3KLMX 1ZW6A 4Q4AB 5C4GB 1X9GA 4EW3A 5EZSA 2PRYA 2O6HA 3X1DA 1PWYE 3EWNA 5EZ5A 3QXHA 3INRA 3R6TA 1TX4B 2YV4A 3JWJA 4D9HA 1C7JA 2RCYA 1O6CA 4GIBA 4GRDA 1JB1A 4II3A 4QYSA 3TBHA 4CL8A 3PIIA 3QUQA 3THWB 3UGKA 2Y4NA 1QTRA 1PK8A 5IU6A 3JQDA 2CVPA 3VJRA 4FCWA 1TM5E 3HJRA 3SQXA 4LHEA 1LD3A 3IGFA 1BCSB 3KXDA 4NESA 2AOXA 2ZZKA 4QOEA 5EMKA 3O8NA 3UWOA 4DUPA 1HI9A 221PA 2G3YA 2HBQA 3K9NA 2Q3BA 4M0LA 3ETHA 3OG9A 1MT0A 1DCFA 1YS6A 2CD7A 3O3MB 4GOKA 2YVQA 1Z6GA 3IQIX 4NBVA 3OIDA 3RC9A 4PBTA 3SLRA 5FX2A 1N2CA 3PC8C 5E3IA 2H5IA 5FFNA 1GAWA 1KMHA 5DHTA 1EBBA 4QKQA 4Z2AA 2Z6UA 2WAAA 4E13A 4DJEC 4LI3X 2IUTA 1EJ0A 3VH3A 5B2FA 2ZU6A 2MTBA 3D6AA 5IUNC 2CHFA 2P4QA 4WLOA 1T1EA 1Q57A 3G6KA 4YCBA 4XWGA 2EU8A 2DE0X 3E7DA 4FW9A 4IJ6A 4Y2RA 1TVMA 1SGWA 2DT8A 2DUUA 3HH8A 1MQ8B 3ZJUA 4FSXA 4J0JA 1H2HA 2IU4A 3Q11A 5BSKA 5KU7A 3O74A 3NANA 4R1MA 1YOVA 4Q4DA 5A4AA 1YR7A 3W5UA 1R1DA 3UVEA 5L3ZA 1KFKB 1Z18A 5DK6A 4RK4A 4LSGA 3GGCA 5I9LA 2D0DA 3HWX1 4H17A 4TWAA 2ONKA 2R7MA 2IYWA 1I0IA 2YXDA 3KT6A 1NVMB 3D0KA 3QMPA 2QTLA 3A4TA 2WIDA 3L1VA 3MOSA 2W2OA 3AZPA 3WL8A 4LMRA 3PA8A 2VHXA 3VISA 4ZGGA 2GYVA 1QFXA 1VBNA 3F4KA 3O93A 4HRAA 4RVFA 4EATA 3OESA 3DZDA 3VO9A 2ZBVA 1L7OA 3OT5A 2UYOA 3ESDA 4O4JA 4ZQEA 5ICEA 5IM4A 1NP3A 3T5GA 2W2KA 1SOUA 3Q1LA 4BLTA 1UT5A 3OKCA 4A6XA 4CMAA 4E31A 5J3JA 1F4PA 1ST2A 2X8WA 3FUTA 1W5FA 5HGJA 1G2PA 4PYOA 2JJ1A 2VA9A 3UKOA 3EVTA 1MJHA 4A0QA 3O95A 1SXGA 4UUNA 4PRLA 5HQ3A 3R5HA 3CT4A 3DB2A 1N6RA 2I3DA 5C0OE 4S1OA 5EQDA 4DF3A 1LLQA 3O38A 3QPAA 1JU9A 1JKXA 1RXCA 1JX6A 1WSDA 1ZOIA 2J09A 3P52A 4WI1A 3KL2A 1IM5A 3E81A 3JAMA 3PD7A 2E4VA 4YJGB 1CIPA 1WF3A 1HY3A 2VSQA 1SXIA 3LBIA 4O2AB 2CLSA 1XUOA 1XXLA 2OXTA 3KB8A 1RNLA 5DNDA 1MB9A 1QK3A 5JSZB 3C24A 3JXEA 3WB1A 3OIWA 3I1JA 4N6OA 4PHCA 4AICA 3MRTA 4UATA 4XKJA 3A1FA 5F64A 4O1HA 5ITZB 4DNPA 1JDZA 1KU6A 3BXFA 3M2TA 4IXMA 4MJ3A 1DQPA 3NMUF 3SXPA 3GD5A 2PPLA 4RQAA 3EMBA 4ZAVA 4RHUA 4ISBA 1AQ6A 3VJLA 2Q2VA 4KK4A 3ESXA 3KQWA 3D1VA 4LVCA 5JPDA 1DZ3A 2G08A 2AJLI 1U3VA 3RYTC 3WIUA 1F0PA 2D5IA 1WUJS 2IPAB 3IUBA 4LGCA 3SS9X 1AGPA 3UT6A 1ZVMA 3M1LA 1E6EA 1XCPA 3W8DA 4FT4A 4YMLA 3PIDA 1T8YA 2AC2A 3CUVA 1JT2A 4N41A 3ZJVA 3TWOA 3OPYB 2XYGA 4R83A 4UZEA 1GSAA 3UXEA 1ZYUA 5BXQC 3CW2A 4U7JA 1T9KA 2A5GA 2ANCA 2XRMA 2Y1XA 3E9YA 1K08A 2BEJA 1SUPA 1XZKA 3ESAA 3SEFA 1J0XO 4P4LA 2FZCA 2J4DA 1I1NA 1A76A 3KJXA 3F0TA 5C8VA 4RL4A 2XUGA 4DA8A 5IH3A 4W5RA 3TSZA 3ESCA 1XZCA 2B30A 2Y0PA 1L4UA 5A62A 1TEVA 1LBSA 1Y6QA 1SHTX 3AB8A 3GG9A 4W4TA 4ZT4A 3A6LA 4BO1A 4E2ZA 1RHJA 2VHQA 1V4VA 2YCBA 5K3OA 1DUIA 1PZFA 1F9AA 3I72A 3NETA 2PT5A 1RABA 3OOJA 4LC1A 4X1YB 5DBEX 3Q3IA 4QG3A 1CEEA 3PP8A 4GZLA 1N8KA 4E5MA 4D4LA 1ZITA 3EWSA 5GONF 1BFUA 2ZRGA 4P84A 2I22A 1X92A 4ZU3A 4O2RA 5AHWA 2ZVQX 3VDMA 1Y3IA 4IGKA 1U8EA 1ENZA 2E6KA 5TPZD 1XU7A 4J2HA 1K9SA 2HNBA 5TXGA 4K8RB 5K03A 1EQUA 5F7OA 2WQ7A 4ESOA 4YX9A 1VLJA 2BMVA 3X3HA 4GOOD 3HHPA 3KQHA 1I2AA 3TF5A 4BBPA 2XEDA 4PQYA 1HFKA 4WNIA 2WA2A 1GU1A 3SVZA 5P21A 1CW2B 1P73A 2QMEA 5C8DA 1YV9A 5CDHA 5JJCA 4HDAA 2VSNA 2ZJYA 2D0IA 4ZVSA 4HS9A 1F3LA 2FR8C 1P7PA 3QFHA 3ISTA 1KXZA 4LNUB 4UMFA 3S7ZA 3RSSA 2AEFA 3SY8A 3WGTA 4EJ6A 3PLNA 3EODA 3ZK9A 2MU1A 4MV5A 5CYFA 4ND8B 1X7DA 5MGBA 2K6GA 1F5SA 1F8XA 1JA0A 1QZUA 3PL5A 4Z4HA 2IIBA 2CK3A 3I28A 1V47A 4KFTA 4PQFA 4YGXB 1YIAA 5BUCA 3NDIA 4IX1A 1E63A 2NXEA 4K8OA 5DLEA 3HJTA 5FJJA 4CGYA 1ZOOA 2QD5A 4IKOA 5SZIA 5DCUA 1DPFA 1JEQA 1HLGA 5DT9A 1K7YA 3I8OA 4JT9A 4W8HA 3ZK8A 5HRUA 2ZT6A 4WFIA 5ALIA 2KW5A 1OIVA 3NT5A 1D2RA 4LJ7A 3OP4A 1T1IA 1QGAA 4P7KA 5EJAA 1NA5A 1II8A 3C15C 1HX7A 4CVNA 2R62A 3SZRA 1KRWA 4MDYA 1DKPA 5C3MA 4IXWA 2UUPA 3NJ4A 3RTGA 2M2IA 3JQFC 3FSRA 5BR1A 5E6SB 1WCXA 4FFRA 3KVRA 3BXPA 5C7LO 5IG2A 3PQ2A 1NVVQ 5AJZA 1VHQA 4XQGA 5AVKA 2ZRAA 1E2BA 2YWRA 1OU0A 5ECDA 4W5TA 4IVPA 4N18A 4BWFB 2BONA 3DGEC 4B75A 1FVFA 1I4DD 1RBZA 4A8JA 2I65A 5B36A 621PA 4DSNA 1TT7A 1SG6A 1SB8A 3FPAA 3M5PA 4OJYA 3QX3A 1IM8A 4N0EA 4B32A 3OZBA 2E4YA 4GKVA 3VUEA 2JJ2D 2VDOB 2BEWB 1XMSA 2IEBA 3E22B 3VYVA 2NSYA 2OD7A 3VR4A 2EWVA 3PJDA 3FYUB 5JJKA 1J70A 1LTKA 1XELA 3NM5A 3ZU6A 1YUMA 2AEMA 2G7ZA 4EB6A 1OSNA 2V96A 4F4JA 4D8TA 1A0OA 4XYBA 1T35A 1L5OA 2VP9A 1BMDA 4OHOA 3RVDA 3MT8A 2X8LA 3H84A 3WDSA 3U4QA 4MAAA 2M6KA 4CE6A 5C18A 2ECPA 3S81A 2ZSJA 3SXJA 5IN4A 5ADHA 1U3WA 2AJBA 1C3OB 3PFHA 1WCWA 1NQUA 3SU8A 4RJTA 1L5YA 3JYLA 4LJ4A 3QLJA 4NMMA 5DSZA 4CMIB 3EC7A 2QB5A 2J9GA 5I7VA 1KZ1A 1CXZA 1RAGA 4RKFA 3KBBA 4TPKA 4B6RA 4P9NA 1NASA 2WJVA 1XHLA 1XZGA 4MCJA 4R1NA 4WXHA 1M2OB 1KMQA 4Y6PA 1MO2A 1RKXA 3GZNA 1YUNA 4EPVA 5JC8A 4LBVA 2CXQA 1IZ9A 2JFGA 3BK1A 4I9NA 4O2AA 4Q12A 3OX4A 4IRXA 3ROQA 4HXEB 5CA1B 1ISIA 1VB3A 1KI4A 3HU5A 3CKYA 2J6IA 2FMUA 4K2AA 4HLQB 1OW3B 4FYYA 4R1TA 1KY5A 3CZQA 4ZT7A 4V0RA 5CDUA 1JKIA 2Y4OA 3OZXA 1HE5A 2HPAA 3NB0A 1ORIA 3ZS8A 3QVTA 3RIEA 4FVTA 2FW6A 4KIJA 1LFDB 3H2SA 4D8UA 4XVCA 4YP6A 2DUJA 2PEZA 3I2HA 4P54A 5EHIA 1CUHA 1TUBA 1ORRA 1WCIA 3VGJA 3PEYA 2Z5LA 2DWOA 4LYYA 3EEOA 3DTNA 3H9EO 5TR9A 3TRIA 3CX8A 4MGYR 4RBNA 4IDEA 5EWMA 4QAQA 2P2CA 5I9BA 1ZL0A 2I78A 2NUPA 5I51A 3L93A 5BOSA 2FSUA 1HK7A 3HYNA 3IV9A 3OLYA 2A1TR 4OK3A 1D7AA 4Y2SA 4D9FA 1HNNA 4Y2YA 5JWRA 4MS3B 2F3UA 5BV1A 3WJ1A 1Q0PA 1PHRA 1TM3E 2CLHB 3TW8B 3U2QA 1IZZA 3IMGA 4CCAA 3A4YA 1FLDA 1ECPA 2ZDGA 2DU8A 2PRKA 3JR7A 1N9ZA 4EJSA 4H3VA 1HTWA 3E5HA 4IDHA 2FR0A 4BIMA 2KWIA 1AKUA 2QUBA 3B1FA 4KP7A 4PLCA 1NW8A 3I42A 4XI9A 3IDZA 2VNIA 3ZGYA 6REQA 1JHAA 2XT0A 1OI2A 4ASUA 2WAYA 1M2NA 2X4GA 1HQDA 3EPHA 1P1RA 3Q72A 1XZEA 3MRXA 2VDPB 5ALDA 3ZIAA 4BTVA 1F17A 5HBRA 3DL0A 3G5MA 3HFRA 3JD2A 4MDHA 4TM7A 2TMDA 3R40A 3WRYA 4BMCA 4BXOA 2B1QA 1C4XA 2HF2A 3CX7A 4NCKA 2PCLA 4WT7A 3KXIA 3AF2A 5JSHA 4CKCB 4R8KA 4TV8A 1KP3A 5B53A 4ALMA 2V7BA 3AY6A 3U81A 2YZ2A 3DLAA 3W4KA 1IVYA 1QDEA 2RC5A 4U7DA 3AVTA 3SCZA 2FMTA 3MWJA 1N34B 3ZDCA 1E2EA 1PNRA 1EAYA 4M46A 1SN7A 1ZWLA 3Q1KA 1WDTA 3MMNA 2J46A 1KOFA 1OASA 4BV8A 5IK2D 2PD6A 4HK4A 2GN6A 1JSCA 1GT91 2X13A 3C8ZA 1QFZA 3VMFA 4EDFA 3GYGA 2IYQA 2KBEA 1E6MA 3E84A 5L53A 3E4CA 4R54A 1XMPA 2RGBA 2XODA 5HF8A 4OQLA 4BYMA 2EZTA 4F72A 5AIBA 4WKPA 2JGAA 3E22A 5FTKA 5CCEA 3B3JA 3AF6A 1REQA 1RLOA 1QTIA 3KPVA 3PUKA 5LMUB 4OKIA 3AZQA 3BRCA 3CUUA 3E1GA 3NHUA 4UAVA 4EY5A 4DMFA 3FYSA 2X6QA 1SHKA 4K81B 2R65A 1XCGB 4AMUA 4I6GA 5AUOB 2HQBA 5KTMA 2VP5A 1C8LA 2A9VA 4TZ6A 3RYFA 1JR2A 3H1EA 4PO8A 3T0IA 4K26A 2QOEA 2H0RA 1WG8A 2OXEA 1Z8FA 2HRBA 3VI4B 9MHTA 4OQYA 2O5RA 3STWA 4CG1A 1M2VA 1XZLA 1EX9A 5MN5A 3ZCSA 4JK3A 2UZIR 1RAEA 4ZMRA 2JANA 4TXNA 5ITSA 1DINA 3QPDA 3AF5A 1C9NA 1AXRA 1EK5A 4X7PA 1NW3A 2PGIA 5FNZA 1V6SA 3FTFA 1ZIYA 4BTLA 3DZKA 3KKQA 3D0OA 3NGMA 3HK2A 3AVWA 3E18A 3UF0A 4YMUA 1XCLA 5K8VA 3TX2A 1L5LA 2ZWPA 2F8LA 2BCEA 2ZAGA 3F6EX 2D2EA 2OGWA 2R4QA 3CHYA 3KM0A 5FWYA 4Z1OA 3CURA 1D4AA 1XZDA 2ORYA 1YQDA 3BX1A 3WWEA 3K72B 4MI1A 3QIVA 2C0QA 2H0AA 2JCBA 3GUZA 5IEJA 5I45A 3ZGNA 3ZH9B 2PKWA 5E95A 4RK5A 4EQ6A 5JAMA 4CIXA 1NF2A 2AUNA 1ORDA 2P2ZA 1NF8A 3FWNA 5AVVA 1JAIA 3MILA 1SRRA 2BGLA 5EZYB 1MX3A 2AOUB 5AI4A 5WRFA 4ZHQA 2IIVA 3NWBA 1ABBA 2ENUA 2CJYA 3BXXA 1NVBA 3G6WA 3EYAA 4OB8A 3K0CA 4MI6A 4X8OA 3WKBA 4L74A 4NBNA 4EKIA 3T9BA 2B1IA 4BC1A 1N0IA 3FDZB 4BJ6A 4DKJA 2XTNA 10MHA 2Y1LA 1VE3A 2YN0A 5EP3A 1IUPA 4RD1A 2F2TA 3FPBA 4TV9A 3WWYA 1RPAA 2J3LA 4B8WA 5HUHA 3D8NA 1RXVA 3AJDA 2HKIA 1RZ3A 1J6UA 4NBLA 4PGGA 1KI7A 1SKYE 5JPIA 2VQ6A 3HMQA 4EUNA 1L6RA 3MT0A 3ZLUA 3G1TA 4RGYA 1XEAA 2DMRA 3I3SR 3KT3A 4W1RA 3V3TA 2Q5CA 3HI4A 1DQRA 3PPIA 4LDPA 4UEOA 3SF8A 4B46A 5ANRB 2NTJA 3I2KA 4BN5A 2J0UB 4F1KA 4IPTA 1M6YA 4F8JA 4G8DA 4DDHA 4E12A 5LNK6 5IRCD 3L6CA 3EG9B 3BSWA 1KMNA 5IPFA 1XR3A 2FEMA 2XH8A 4DOMA 4YIHA 2DGDA 3GGGA 2H0QA 4GYWA 4NJOA 1SXJC 4RDIA 4YROA 1QDUA 2RHDA 4OPMA 1M2GA 4Z99A 3L0OA 4MEAA 4ZVPA 1R5BA 2G06A 3BH0A 3K9GA 2IYZA 4M1ZA 5K3SA 4COKA 5CD9A 3R8FA 3WQRA 1PWXA 2QK4A 4K0RA 2I6QA 4ZARA 3WGNA 4GWKA 3LP8A 3DL2A 4CG3A 3KDPA 4Q9HA 4MUNA 2HDNB 3WGJA 2J67A 2PFSA 2RAFA 3TRFA 2FZWA 2GK7A 3RC7A 4EUFA 3OJFA 1PJTA 2EFGA 2XDQB 1UBJS 3RYCB 1RQXA 2PJDA 2PVCA 1EXNA 2PZFA 1OYOA 3JWIA 4MQMA 2UVDA 4JJIA 2P9BA 5DIZA 2AFIB 3D3QA 4DZTA 1SXJE 4AF6A 1ISFA 4KR2A 1W34A 4MZXA 1HYGA 5AICA 1E9RA 4YDRA 4AVYA 2VRNA 4EFKA 4YT4A 2V3VA 4DIFA 2BLNA 4YRIA 4B8YA 4KLAA 1ZVKA 1I1HA 2HA4A 2F43B 2QZPA 5HPYB 1XDDA 1X1CA 4M86A 4MW0A 4DJFC 3UV6A 4MLDA 1E4OA 2B2NA 2DR0A 3RVJA 4PIMA 5JSFA 4YCDA 3K15A 1EFDN 1LX6A 3KEOA 1FJ2A 2J48A 3FGZA 1GZDA 2VDWB 4RMIA 4PN7A 4LRSB 4F60A 2AXQA 2J6HA 5BP7A 5JBQA 2PH5A 4XSVA 5GZ6A 1DTEA 4DHWA 1QVAA 4OLJA 3ILYA 1B6TA 1R9GA 3IQGX 2VWQA 5AW4A 4H7PA 2ZJOA 5KQSA 4Q9LA 2QAGB 3DOJA 4RORA 3JVUA 1X19A 4UREA 3U3OA 2J07A 1ISMA 1DO0A 1NVUQ 1P17A 1M34A 1U1CA 1WTAA 3JAKB 1KPIA 3M33A 1CY1A 2VHTA 4FFDA 5IARA 3QXGA 4P86A 4RCVA 3EDCA 5K1ZA 1IONA 4OI1A 2J5RA 4J7AA 4C0HA 4G89A 4XGRA 4JLSA 1KAGA 1Y4AE 1Q0TA 1UOPA 5HX7A 3U39A 1OTXA 2BHTA 5AHOA 1YFLA 1PO7A 2OZLA 1MC4A 1ODIA 2PY6A 2WM8A 3ONEA 3G9XA 3LUJA 3JD0A 4HQOA 1BO6A 5KNDH 4DMHA 1L7EA 1ML4A 2GR9A 2DHDA 2BFNA 3HE3A 5GV8A 3WXBA 5DNYB 1REQB 3TDNA 3CRQA 5KSZA 4WJLA 3D7KA 3LAWA 4RK7A 5CEEA 3QVGB 3VAAA 4H7FA 1TE2A 2CDRA 4LJ8A 1H6BA 1YWGO 3DDOA 5IMBA 2AZTA 3IXMA 1WPRA 1DGQA 5KU1A 2BDUA 2MOKA 3FTQA 5KDOA 2E82A 1U8UA 5BVHA 4CR6A 1N2JA 5BNIA 4TXMA 3DWIA 4PBSA 3GQBB 1F0KA 1NVAA 2DT5A 2JGDB 1FFHA 2Q6OA 4MIOA 2PZBA 2DBYA 1CJBA 2BEVA 2NM0A 2YRXA 1HDXA 4MR8B 1CU1A 4UU1A 3ZX4A 3A7EA 5JMTA 4TV8F 5IW8A 3ZK7A 1V41E 2B98A 2XTMA 3WIVA 3M3HA 1LW6E 5DOVA 1BEUB 2PKYX 4ER0A 1VLMA 1ODTC 2MMGA 3STHA 1PGQA 3OX2A 4M8SA 1SELA 3BFJA 2OHXA 3EEBA 3PK0A 4G07A 2PUEA 3O9MA 2FEWB 2WYOA 2CJWA 1RC8A 1Q0RA 1YZTA 2H4ZA 4A15A 2V6IA 1I3CA 4GOXA 4FBLA 2QRNA 4X6UA 1PZXA 3I6ZA 3CEMA 1TUEA 5HBGA 2Q8NA 3AQ4A 4BZPA 2Y1FA 1EGMB 1CC1S 4XEHA 3IRVA 5FBHA 3L46A 3JX9A 3RYFB 2FSVC 3I9OA 3IQWA 3R3SA 3U31A 1JILA 4ZO7A 5H3CA 4BMSA 4BLUA 2QX8A 1P9RA 1WHTA 1MQAA 1D0SA 4REQA 4EK9A 4GE0A 4MITA 3RAEC 1QU3A 1DKQA 2C92A 4N6NA 4RQBA 5TEVA 1ZR4A 1E7SA 4UUQA 2WJ3A 3MYYA 5NLLA 4EDHA 2F00A 5A0TA 4MVJP 4KEAA 5M04A 4J2TA 4Z0PA 1OZGA 5BYJA 3V8PA 4E7PA 4BP9A 3SQLA 1ZN8A 2F7SA 3ZGLA 1CRWG 1RJGA 2O8FA 3E27A 3IAHA 3ROZA 1ZUHA 8ADHA 3O92A 2JLWA 3R1IA 4Z53A 2EOAA 3WJ7A 2E21A 3OOSA 3DWFA 2AG6A 2ZBEA 2JCSA 2RE8A 4KVFA 3P0RA 5AVWA 3TVTA 1PX2A 3RBAA 1XKQA 4HAOA 3RT9A 2OV4A 2P5UA 1IL0A 1GQYA 2HJWA 1V9CA 2TMKA 3CV3A 4JQZA 3C8HA 1WD5A 4TQ9A 3U56A 2XLCA 2D74A 3FROA 2J0UA 1VJCA 1O03A 3KLPX 3QVMA 4UEQA 3WJAA 4U6QA 3B82A 3MQFA 2A58A 2ORWA 4UNIA 1Q12A 2ZDHA 5JSQA 1Z0JA 4Z3DA 5HZHA 1SCNE 4QBKA 4BFUA 2L17A 5LLDA 3OTOB 1MVNA 2H2HA 2JAWA 4L0QA 2YNMC 5K5EA 1GSOA 3GRRA 2QRQA 4X8LA 4Q3KA 4KPYA 3OPQA 1RM4A 3U09A 1G9TA 2C5AA 4B2IA 1W0CA 2VPWA 3KALA 4LE1A 2OFXA 1M2OA 3HU3A 1FIUA 3A1VA 2QLBA 3D8RA 2PZGA 5IVPA 2Y0DA 4ZYVA 1OF1A 5G2OA 2Q0HA 4D9EA 3QPCA 2Z0MA 2EZ9A 3HCCA 5HMMA 3WAJA 2XWJI 3EMKA 4ARAA 1RXYA 2GS9A 4DWVA 3NTRA 3ILSA 4JX8A 5FUXA 1PJSA 1X7ZA 3N2YA 2O8DA 3ELBA 2G4CA 3ADBA 2CJFA 1XO1A 1M33A 2HADA 4TV9F 3MJ4A 4I5IA 4RHCA 1PUJA 1JAYA 2DECA 4AKTA 2HZBA 2Q7XA 3AP1A 4N5IX 1EGQA 2H7YA 3ORRA 1IXYA 5L95A 2YS6A 3QEJA 4DC9A 3J7AC 2VYCA 3IP5A 3FBGA 4GYKA 1G21E 4X1KB 2ATXA 1XLTC 1JFFB 5IJ9A 2IDKA 2VHZA 2YASA 4WBSA 1KF0A 3GEIA 4P3PA 2ODWA 4MGIR 3A27A 3IHLA 4YJ2A 1H9CA 4IEEA 1V5GA 5C52B 2DFPA 2VQSA 1GNPA 1U65A 3L43A 3S28A 1TPZA 3EVCA 3IT3A 3NHLA 5FHQA 4R81A 2ACVA 3CNBA 1O9HA 3RODA 1H23A 1ULTA 4KIFA 4MS3A 2DP4E 2O7QA 3ZKWB 1MH9A 2WVJA 3F5QA 1E2DA 2XVXA 2FEAA 2I4LA 3OJCA 3QX9A 2FE1A 4NLLA 4MUXA 4RX1A 4IUBS 4TSKA 5BOSB 1WZ2A 1KDVA 4TLDA 2P6RA 1GGEA 1BROA 2ZB7A 1V39A 3P9ZA 1YA6A 3ZY3A 2VJOA 3RS5A 1X38A 2F90A 4YQZA 4L5JA 1VI5A 3VU9A 3RYIB 1A7KA 2I8AA 1EM8A 4J0QA 4BGIA 1OFUX 3PR1A 3RSCA 4DUGD 2I6TA 1P0PA 3FMOB 3PD0A 1PG5A 2WKWA 1JW9B 2QRKA 4HRYA 1AKWA 3OAAA 1X7WB 4MRRA 4QBFA 1XZFA 2B36A 3V2UA 4IOJA 2WV7A 3QWHA 4MV0A 3OTGA 1OLXB 2C9BA 1L5RA 3QPWA 4AU1A 4MVJH 1ZGAA 2XD9A 4RD3A 3H5NA 1RLTA 3H5AA 4H7IA 2ZYGA 3BCRA 3CTPA 2ESRA 5L3QA 1E5LA 4DY4A 1X1RA 3F67A 3AMVA 4KE8A 3FGPA 4G86A 1P91A 1NI3A 1WCV1 2OC9A 2Q50A 1VPLA 2DFKB 2MSWA 2Q49A 4FJ1A 4W1QA 5ALWA 1VBMA 2QN2A 3GNSA 3U3XA 4YRZA 1H22A 3LXUX 4TXHA 1NLUA 2EL9A 4NQZA 3BPSA 3TM5A 2GLXA 5K0EA 1BWRA 1HMYA 4X61A 4R40A 5CH5A 5BPHA 1E7QA 4KDFA 4GX1A 2RKWA 1S1CA 3IT1A 5AOCA 1X80A 1MB4A 2BDTA 2FMXA 2QVXX 5DHQA 5JCOC 4QHSA 5DM70 1DFGA 4HH1A 1F2TA 4PHGA 5JOQA 1E8DA 3AI7A 1PEKE 4L5CA 5GTDA 4NDAA 4UC0A 4QUKA 5D85A 5KTOA 5LMNB 3OKPA 3L2OB 3FTEA 3K3PA 3ZYCA 1SBZA 4FILA 3QF4B 4NEQA 1Y48E 1CHNA 1KEKA 2V4MA 3O03A 3ITEA 1DKLA 3KZMA 4IJVA 2H8KA 1GGVA 4CV3A 4D96A 1RQ2A 4LPKA 4LXQA 5KX5F 2PWYA 1G4HA 2I4OA 2C1XA 4S1PA 1IOVA 4FFNA 4FDTA 1LBTA 1P7CA 2Q99A 1TLLA 1J2TA 4A5OA 4HVTA 2HA0A 3IURA 4ZOCA 3D3WA 1O4VA 4XSHA 5E9AA 2EHJA 3ZWDA 3LDHA 2ZUCA 2O2SA 3IH5A 2GBLA 5DN9A 5FUVA 1QYVA 3OJXA 2ATIA 3JZMA 1NQTA 1WPXA 2LNDA 2QW8A 4N5NA 2H1VA 3V8EA 3A1UA 4PPNA 1LDYA 3HADA 4KC0A 2WJ6A 3KKPA 5DIFA 3BIWA 2WABA 2XZPA 4XPIA 4LCEA 1T4MA 2JHAA 4IM7A 2Q8PA 1D8AA 1NZDA 4FE3A 1Y34E 3CG0A 4JNCA 4WXRA 1DOAA 2QLJA 1T5TA 2WINI 5EQJB 2O7VA 2VRCD 5DDIP 1KJNA 3RCBA 3S7TA 2FE4A 2FUKA 3T9CA 4C76A 3U17A 5KYYA 1ZW1A 4EJSC 3IPXA 3FG9A 5CGQB 3N28A 3HYLA 5AW1A 1J1ZA 1MB3A 1H2RS 4U2EA 3TE6A 4BS9A 2DJ5A 4YMVA 4X1IB 1Z7BA 4EX6A 1VB5A 1N6KA 4TUYF 1JU4A 4X00A 1RZRA 1YK1A 4A82A 4BMZA 3FBTA 4AJ4A 4Z8YA 2A1UA 2C9ZA 1GTJ1 1UF9A 2BTOA 3R7DA 4CIVA 1ZJ5A 2JPDA 4JBLA 3UJBA 4ZT3A 4Z6KA 1DBRA 2YZNA 2ZKLA 1ODJA 2DYKA 2ZAIA 2BRUA 1R4MA 1JZQA 1BRTA 1MAAA 1SY7A 2Z5VA 3PGJA 4HLUA 3DMNA 4BX3A 3G88A 3B38A 3IR5A 1N7HA 1DT3A 4C0SA 5ER9A 1VJ0A 1J33A 1TEXA 4ZOBA 4RTNA 3ZUPA 4LSZA 4W5WA 3CSDA 2W37A 1FFSA 3PFIA 3UCEA 4D4JA 1ZK0A 3C3MA 2C54A 4I9FA 4KG7A 1CNEA 3GRKA 1CUVA 2EV9A 3VDRA 4JN6B 1GOTA 5KYUB 1R3UA 2J9XB 1HURA 3PHBE 3RRYA 3MLAA 2EJVA 3GLUA 2O06A 1EFRD 4QDZA 2QTFA 1UM9B 1L4HA 4P08A 4DQDA 4PLGA 3RVNA 2J5XA 5J4YA 2DBVO 3OZSA 2ZRIA 4ICIA 2OBXA 5EXXA 2VC2B 1KQ3A 1NJSA 2RIPA 2VHWA 3WC4A 3IAM6 3Q0IA 2FG7C 2HF7A 1Z26A 3D6NB 2IBMA 2CLMB 2Q1UA 1Y7HA 3OU7A 1AQIA 1X15A 3CE9A 4GFDA 4QRIA 3S0JA 2QVZX 4EPTA 1V96A 1O6BA 3QKIA 4BE7B 4Z51A 1QGZA 2QVCA 2IQIA 4EHNA 2FPSA 4BO7A 2RCNA 1WDMA 4F12A 3ZHCA 1G21A 1OFTA 3W7BA 3E3OA 3B20A 2AG0A 4MKXA 4MQEA 4NAHA 3GGJA 3UAZA 5CYGA 2XUDA 4OB6A 3ELWA 2F6RA 1PS9A 5KYKA 3D1LA 1MMFB 4F93B 4TWRA 2AMJA 1NPTO 2QQEA 1YZQA 1E9CA 4NEHB 3LZDA 2L0XA 4QNRA 1PS8A 2MMCA 3F8TA 4NATA 2YJZA 2KLBA 4G26A 5JQWA 3UHAA 4YV2A 2EWMA 1T3HA 4WA8A 3QVXA 4P0TA 1G8PA 4XGIA 2MCFA 1W0JD 2NMVA 3ZZUA 3HUDA 2AX4A 3BSYA 2F4VB 1J06A 1DBQA 5DGXA 4E70A 4OJKA 1E2FA 1KEZA 3T52A 1U0HC 4DMGA 4RLFA 5TY0A 4RTJA 1IAVA 3F97A 4HYYA 2VUHB 3LY8A 5IZCA 4F6CA 3UATA 3VAZA 1T9ZA 2MSNA 3B2QA 5ER6A 2AG5A 3MINA 3LDAA 1KEWA 2YWFA 2WTNA 3M9WA 4IF4A 5ALMA 1SVOA 1J24A 1YCDA 2GM3A 4LHYA 4F96A 4WACA 3IL2A 3GOQA 3C3AA 3IXLA 3GLIE 2EFHB 1M8JA 1ZCAA 4E0BA 2WD7B 2BGGA 4YK7A 2WZCA 4X6LA 3SQDA 3UZUA 2AYXA 1KFEB 2H1FA 3AY0A 4FMDF 1IY0A 1MV5A 1UBRS 4QWMA 5FBWB 3QX8A 4C0AC 1J0AA 2OCBA 4D9JA 4YRKA 1U63A 1G3UA 4HFNA 1R2QA 2V7WA 2PSEA 5IYZB 3R75A 1LJ8A 2JAPA 1ES9A 1V37A 1JECA 1JWAB 3EIOA 1TTTA 2NO4A 5LVAA 5COQA 1V5EA 3HYRA 1RYBA 2IODA 4Z49A 1T2AA 2J4FA 3BGWA 1X87A 1P4AA 1LH0A 1E3DA 5EWJB 5LYYA 5T6BA 5AI9A 4C87A 4GC5A 4UDNA 3WSWA 4TYQA 1VC2A 1I36A 3FJ1A 3DLHA 2CCGA 3O8QB 1H3NA 2O2CA 4J6EA 4EI9A 2HK6A 3FETA 3HO6A 1NUAA 3BF7A 3IE0A 3G0CA 4UVEA 4QQNA 4EQZA 2C3PA 2JGJA 1JKMA 3I9MA 1WO8A 1T10A 4PEVA 2O8BB 1DKUA 3FVVA 3M1YA 3UHFA 4LF7B 4MGEA 5I7SA 1LNQA 1HOXA 5DE3A 2Z56A 1KI6A 3AC0A 3MTJA 1SBHA 1ISJA 3C5CA 3QV2A 2GVDC 4W9RA 4EGSA 4GZ6A 2A86A 1HDZA 1ZRNA 2HBRA 2KJQA 2ZTUA 3K4HA 3ETCA 5M3BA 4XJTA 1JG6A 2AN9A 2H3EA 1FX0A 2BI7A 5AKHA 3M4JA 1OU4A 1NNSA 3D4NA 1NSTA 1CZHA 4JR0A 2IXAA 3FPHA 3B5EA 4EG4A 4AF8A 3LLMA 5EE5B 1P29A 3WK9A 1IBKB 1TCBA 2DQ4A 1MB2A 4OQMA 1QDLB 3HDGA 1C30A 3PC2A 5TPZA 4EGAA 3FVQA 4J6FA 5JXJA 1OJ7A 4N49A 2V9CA 3Q87B 2NN3C 4L0CA 3NOXA 1T36B 4N7MA 1CZLA 1TJ4A 5LZ7A 1XGKA 1DRJA 3LUFA 3E3AA 2E3JA 1Q1BA 2RGAA 4A6DA 4BFYA 4WRRA 4F9GA 3CVVA 4IXTA 1OCEA 2BELA 4FZVA 1SC9A 1Q44A 3OOEA 1UZUA 1A9XB 1M8GA 5AUPB 1JIKA 3OFSA 4YCJA 3QITA 2JB9A 4MUKA 3WICA 3TZEA 3WFZA 4OXYA 4B43A 1E3QA 1OX5A 2JFUA 2Z9DA 3L6BA 4Y6GB 3X1MA 2IPLA 3L1IA 1U8YA 4L16A 1R9NA 2HT1A 2WYHA 2HNKA 2QROA 5HKAA 1UBKS 3PQ4A 1UZNA 3OO1A 4ERNA 3PRYA 3THWA 4NU5A 2O8FB 1QE5A 3JVDA 4A91A 1JWBB 2ECKA 1EFVA 1G7CA 5CVJA 4BEWA 3RUFA 4BKOA 2YJ3A 5DRYA 2VA8A 1U0JA 2CXUA 4FXPA 3CINA 1N5MA 1ZOSA 3UUFA 2GVNA 3HWWA 2CFOA 3IIIA 4WNYA 4HDNB 1G7RA 1NDHA 1XAHA 4TM8A 5FLEX 2J3DA 5TV2A 2ODAA 1W7AA 1JSLA 1Z56C 3I6QA 4R16A 2H00A 2JCYA 3DBRA 3PUYA 2EXXA 3K96A 3NV9A 4LK3A 4D0RA 2I4NA 3EFOA 3VR5H 1IXRC 4U6SA 2MSKA 2J3MA 3DDWA 1P61B 3P0JA 3SHVA 3FY4A 4JI2B 3NKLA 3PUWA 1CZNA 1DTSA 1RRGA 4RVOA 2ODBA 3D7LA 3G2PA 4CDRA 2KLHA 5T4FA 1RVV1 3F98A 4F4FA 3VNBA 1R8SA 1EP1B 2C94A 2FI1A 2WKQA 2Z30A 4FMDB 4IEFB 2D1QA 4LYAA 1N5OX 5SZJA 5TE9A 1GA6A 3FH0A 3IIJA 2YV1A 4MVJI 4MVJG 4Q3OA 4EFMA 1V2GA 2VT2A 3K4PA 3TS1A 4HR7A 1F0NA 4Q82A 5ELXA 4N0QA 3A2NA 2XYQA 5I5EA 3ASZA 3ES9A 1USKA 2FSVA 3EIFA 4AFNA 4DDKA 3G0GA 1V8BA 1X77A 1UL1X 2R84A 4GI1A 2QQ0A 2BKXA 4OA5A 2D8AA 5PGMA 2C5BA 5K6AA 2EKPA 3PFKA 1K89A 2WYWA 2I3BA 2I3GA 2BFFA 4OXXA 4R7ZA 4NP6A 4J3NA 1XNJA 4PYQA 1FSSA 1TIKA 3GV0A 1RMYA 3OF2A 4L4YA 4O2BA 4BWGA 5CD1A 3HO8A 4RDHA 4MVCA 3AIMA 1H1LA 3BMCA 4PG5A 1C3VA 2I71A 3PHGA 3LG2A 1Q1GA 3T7CA 3OZWA 8GPBA 1JWLA 2MJLA 4PFQA 1JQBA 2JNWA 3DMTC 3DXFA 1X1BA 2JRCA 3I58A 3Q10A 3GFOA 1IIRA 1U7PA 2A67A 2ZSUA 4KRGA 4PZLA 3W6NA 4BU1A 3BMXA 4YQYA 3VPCA 4E5PA 3DJFA 5HNKA 13PKA 1GKKA 3TRHA 4R1UA 1TO1E 4I19A 3RS9A 2FSFA 4G81A 3KQVA 2QYTA 5GAJA 5HJ5A 5BWBA 5ICSA 1O7JA 3CSSA 1CUAA 4YV0A 1KP9A 2AFHA 3KP1A 4AECA 4PX3A 5JAHA 3ETLA 1PG0A 4I7EA 5C1BA 2NWQA 2P2DA 3W5BA 3GLIA 3JY6A 4RF3A 3RS8A 2A8YA 3U44A 2IVFA 5TMPA 2FETA 2CLFB 2GZDA 3A8TA 4CMEC 3SX2A 5TS3A 1WQ3A 2PXXA 1Q50A 1C1DB 3B2EA 3W7AA 3LHDA 5E1DA 1C30B 2XMCA 5JFOA 1U1IA 1BX1A 2F1OA 1U99A 5GQSA 1CYDA 2Y0EA 4G6ZA 4WLVA 1TKBA 1KETA 1TDJA 4R71A 2YWDA 1ZR2A 1KOGA 2XVZA 4DXAA 1VQ1A 4EI8A 3JCZA 3NM6B 2Z4SA 3Q2OA 4EYQA 4BZZA 1N2BA 4BQPA 3RVRA 4EEXA 1G19A 3TKLA 4RVCA 4C3OB 1JHRA 5MF6A 5GVRA 1H2EA 3HVKA 3RU7A 4DARA 4RFVA 2RI1A 3DHWC 3HCBA 4DRZA 1A95A 3BWCA 4DDUA 5B3KA 1R6VA 2QAJA 3ENVA 2J30A 2V6GA 4RWZA 3JQFA 2H57A 2OKGA 1XRQA 3QYFA 4IILA 4MVJE 5FAKA 2ZWMA 1CVIA 4Y2QA 2GEVA 4YUWA 3JWEA 1UBEA 2XGGA 2GKGA 2YWXA 1JIIA 1SBQA 1U28A 4KO2S 3U1VA 2B8EA 1DEAA 1JF8A 2IHBA 2SECE 1ODLA 1F2TB 4H6XA 3W2HA 3P27A 3HRHA 3ZS9A 4ZCIA 2PQ6A 4HDNA 3PD1A 2NW6A 1DIHA 3DLTA 4JNKA 5JS2A 4A8JB 3UXYA 2HU2A 3TECE 4JLOA 4RC9A 2QTNA 2VAPA 5HWSA 2ENWA 4MJLA 2ERYA 2JAXA 3I2YX 3QFRA 4B40A 3A25A 5FB3A 4OUKX 3RR2A 3X43A 3SSAA 3C7CB 3ZU4A 1R0RE 4MO9A 4TLEA 5IDQA 4C7OB 4CETA 4KR3A 3FDIA 1YZHA 1FP2A 3GQVA 4YA6A 1BXRA 3N5CA 4IG9A 3W1EA 3SS7X 5JNLA 1R4ZA 2MDTA 2PM8A 5JD6A 4YAKA 1RPZA 3R4CA 2JEYA 3W04A 1AH2A 1K88A 1ZO8A 5CFNA 1OROA 1XMQB 2QMYA 1AHIA 1DKOA 1FDUA 1S02A 1TKAA 2VHJA 3GZJA 3LIIA 3QJYA 5FUBA 1L5KA 2IH2A 3D8TA 5TGZA 5FT9A 2VF2A 4DSOA 1E9SA 2II6A 2Q3CA 3WYGA 1AUOA 1MEEA 2HJRA 2WMOB 3EUFA 3N76A 3T8YA 2XITA 1N2OA 1D07A 1XF9A 1GFWA 2Y92A 2YCLA 4L8WB 1QBKC 2ZRFA 2ZYTX 3GLGE 4E88A 1MABB 2POQX 3TVYA 3ZLVA 1C8KA 4YRCA 4PONA 1QIGA 2OPBA 1W1UA 2OO5A 5FPSA 3ROKA 2NO7A 1JEOA 2BGNA 2XKKA 2L19A 4RXMA 2B78A 1U2GA 1E3IA 4O08A 4U6NA 2PZLA 2CF6A 2JI4A 2Q8QA 2WC1A 1RRMA 4ACBA 3TX6A 1PAUA 3RU9A 4O29A 1K7XB 1UAGA 3WYFA 1FVXA 3FSGA 2OV2A 2ZR9A 4DJ5X 2M9MA 3H42B 1HTBA 1WZCA 2BFWA 4PC1A 1VHWA 1U7TA 3UFXA 9ATCA 4ZRMA 3BHMA 4UM8B 3I9KA 4QQKA 2G8NA 3HO1A 2GZMA 5GGYA 3QQ5A 2W00A 1V7CA 4AG6A 3KSAC 2ZS7A 4CMGA 1NP7A 3NWEA 2I6UA 2H5LA 3QELA 4WNCA 3SQMA 4DQ0A 4C88A 3HLYA 4LJLA 3QYPA 1QHYA 1ZXLA 1IWPB 4LQDA 1IQUA 4A23A 3IIEA 1JFVA 1OE0A 4GPD1 4UOEA 1JE1A 1ECJA 3PC6A 3SDSA 3S99A 4D43A 3FW1A 5L45A 2NQTA 1KJIA 2WKRA 1IIBA 2CNDA 3LBFA 4H7DA 2ZUBA 1J97A 1Z3CA 2SICE 1U3DA 5B7QA 5HQTA 3VH1A 1B8OA 4A5SA 2AGVA 3EPPA 2EHDA 3FFTA 3VZDA 1YJXA 3UK6A 4CV2A 1Z8NA 1SURA 2FMHA 1XQ9A 3BGOS 3ISVA 3K9BA 2OZLB 4FP9A 4ZHSA 3CLSD 2Z98A 2YIJA 3H8JA 1FDSA 1NWHA 2KSQA 4M9ZA 5KYNA 3WQHA 3E8XA 2OBYA 1EQ2A 2ZJ6A 3DMYA 1DO2A 1JQEA 4R8VA 3T3OA 1RI2A 2O0MA 2GYWA 1J2YA 3CG4A 1IXZA 5B3JA 1PT5A 3IEIA 3FZYA 4HX5A 2OFPA 4KACA 5DT2A 2UUAB 3OWOA 1AGRA 1M7HA 2JLSA 3BMOB 4YRBA 1UBFA 4JUDX 3ZE2B 2H2WA 5BUZA 3SHQA 4RPHA 4IIJB 3LS2A 3MAGA 2RHCA 3JQBC 4H31A 5E1OA 5KYYB 1EWYA 3LHFA 4TSRA 3ZV5A 1ONSA 3DCIA 3QBEA 5DHRA 3ZZNA 1ZHOA 1O97D 1J0DA 5AT1A 5K3FB 4YB8A 1W52X 2HCRA 4PSKA 3IERA 3LQFA 2H4HA 4FOTA 3CCCA 4RZUA 4JV5B 4Q21A 3F3MA 4IDCA 3R7NA 2AD5A 1R00A 2ZWVA 2XGSA 5FI0B 1L9KA 3QHAA 1PZGA 1HLDA 1HR0B 2WG1A 2I2BA 2YMMA 3JQRA 3P9XA 2OXIA 1VRVA 4QYMA 4FZ5A 4UTZA 3FHOA 2K5UA 1DXHA 4ZO8A 3HWRA 5BYKA 3DHVA 4ECEA 3E58A 2BGIA 3OCZA 3EVAA 5FTWA 2X9VA 5BNFA 3KO8A 2GVZC 1UPCA 4PNEA 3OU6A 2HZ7A 1PUIA 3D0QA 1V6CA 2D5AA 2PZAA 2YJGA 3QU4A 3MS2A 2CLKB 1RJFA 3D2AA 4GPBA 4IFBA 3HR8A 4LXTA 4DMCA 3L0DA 1H6DA 3H0EA 4MMYB 5K0JA 2PRZA 2G9RA 4HNAA 4YH1A 4C2TA 4R1PA 5CT6A 4M22A 2O2XA 4QUAA 1Y63A 1JEDA 1HYHA 1GLNA 1JQ5A 2P62A 2QQFA 2XTJA 5AI0A 4MS1A 1DKNA 4ENRA 1S3GA 3UYKA 5GJCA 4JUIA 4WK6A 3WYNA 2BJHA 2P5TB 1KFCB 3KR2A 5DGHA 1CUBA 1ZD1A 4IJQA 4W5QA 1AZWA 2OHVA 2R60A 1VECA 1UBHS 2JKZA 5KNBD 1BJRE 3UWDA 4M49A 1R7RA 2XX3A 4HSEA 1KKMA 4FNAA 2P77A 4AKHA 1YZGA 4F2DA 2GD2A 3PC8A 1WWKA 3GIDA 3LC1O 4FFSA 1MQ9A 4UMVA 2PSDA 3DWGA 3KJFA 5D5QA 3RARA 5KDDA 3CVUA 2XMRA 7REQA 3EHDA 4UUPA 1JSZA 2V8BA 1K8QA 3UFBA 4QEZA 3K1ZA 1IHXA 5C1PA 3W8FA 4CBVA 4BXOB 4E03A 3FSJX 3A26A 2Z1MA 4PAWA 1V7PC 4J2OA 3WLIA 5IJ9B 1PT7A 2BP7A 3FPEA 5IT0A 1ONPA 1I80A 3OIVA 1NQ5A 1UKAA 3OQPA 4DILA 3DS8A 3I9FA 3WHPA 1L3CA 2NPOA 4JHLA 1YR2A 1CD5A 4YP5A 4R51A 4WL0A 1OXXK 3H18A 2VZ0A 1EVQA 4I55A 2GO7A 1UKBA 4PG4A 4XTRA 3EEFA 5DYGA 1RYFA 5JLJA 1KXJA 2JGFA 1YHNA 4QT4A 5BW4A 4O3MA 3Q9SA 4LRXA 4RPIA 1BXGA 3JQGB 4PX5A 1WLYA 5LBIA 5H8WA 1WNFA 1LSOA 1H3FA 4JQYA 3RYIA 1V8FA 2V6MA 1Z6PA 4FW8A 4KNWA 2VQDA 2WYUA 3CBQA 4JI3B 4HSGA 1J23A 3H4VA 2ZYAA 4B3RB 2UZ0A 1A2BA 3QA9A 4WN9B 4DR1B 2PXAA 1AV6A 5I9MA 1YVDA 2WEKA 4TUYB 5EKDA 1YZLA 2APJA 2BFPA 2H2AA 4MWOA 4WD3A 5K0CA 2OBBA 2NTEA 2VJMA 3IAXA 2IYUA 3H0KA 4NCNA 3BC1A 3SBOA 3V7FA 1I7QB 3JQ8A 1OQAA 5BXYA 3PNOA 1H8HD 4CEJA 1EWRA 1S2OA 1Z5UA 3IEUA 4NE7A 2Z2KA 2NO1A 3V4VB 3QVLA 3UFXB 4PLPA 5CYPA 1WOYA 3Q7IA 4Z8XA 3RFCA 4CRWB 3NT4A 1OBHA 4J16C 2WKPA 3TG8A 4I3GA 1U0NA 2BBWA 3EZXA 4CIDA 2C7RA 1XMJA 5CU7A 2OYCA 5IP5A 4RD0A 2C8VA 4IO0A 4ZVKA 1SXQA 1P1BA 3OTWA 4TLAA 4KXMA 1OYWA 2XWBF 3LDUA 4QQFA 5AW3A 2G4VA 4RPCA 5EFZA 3HXTA 4JJZA 3ZHBA 4AZ0A 1EFPA 1IH8A 2G5GX 4S3MA 1LVUA 1J8DA 1BDJA 3L79A 4P58A 4PSVA 4HV4A 4Y2UA 1BA3A 1W47A 4K3UA 2OAEA 4MUGA 5LUAA 5IHXA 3AIIA 1JS1X 1R88A 2YN2A 1XX6A 3FCEA 4RHEA 1H6CA 1GT6A 5TF4A 5HCUA 4RQUA 2IXBA 1ZXBA 1BWPA 1N5KA 4I4TF 1OB2A 3DMRA 1O0SA 4ZVRA 2RHGB 4LY3A 3W9UA 4HKTA 4GLOA 2QSZA 1UFOA 1ZUD1 1EM8B 1H66A 2Q6IA 1D6JA 1NNLA 3FPLA 4HYTA 4NNPA 1L5NA 1JQ3A 2BV3A 1L1FA 4B48A 1FU8A 2EP5A 4Y6RA 3PJEA 4RLQA 3F47A 5DCLA 1THTA 3JQCA 4L22A 2V6BA 5FBLB 3B6KA 2FW8A 1KOLA 4K9QA 1LSJA 3WZ2A 3RASA 2XIQA 5BOVA 2Q3HA 2EW2A 1A04A 1QFSA 3OF5A 4MS1B 4QHTA 3FOAA 5IHPA 1NJ8A 3DL7A 5EAIA 4FYIA 3LF2A 2IITA 2I87A 3H6KA 5DO9A 1TK3A 4AY5A 2EGUA 3CNOA 3OQOA 2H9YA 1QAOA 4JIGA 4QJ5A 2GESA 1WQ4A 4LE2A 1ZESA 4MQBA 2JARA 3KG2A 2QTCA 5DM2A 2GN1A 4BDSA 3LE8A 1NSYA 2W0SA 4TMZA 1EFVB 4HH0A 3G1WA 1M1YB 2YFYA 3DUFA 4IIEA 1UEJA 5CT9A 3D3EA 1WE2A 1NFFA 2P9EA 3KVYA 3OSUA 5AXDA 5JNTA 4G23A 5A5GA 2FKAA 4UPDA 3B3FA 4DCSA 2O7NA 2Z95A 3C0KA 2E4ZA 2G25A 3CLRD 3DEYX 4HEQA 4QUJA 5AK6A 4CTJA 2V3CC 3WX0A 5KDLA 1XQYA 4BX9A 5EIWA 5JAQA 1NQOA 3T3DA 2F48A 5ENDA 2ONCA 1Y4UA 2SHKA 5DXJA 3BTSA 3EAFA 1UQUA 1RJDA 3TJRA 1BN6A 4WCDA 4QG7A 1AK1A 1M75A 2GTIA 2Y66A 2J7PD 1JEYA 5BQFA 5IJXA 1ITZA 4UBIA 1ISSA 1I1QB 1XQXA 2IHVA 2IDMA 3VHRA 2VYFA 1GWNA 1R5OA 4LJYA 4O5OA 4CV0A 4S05A 1UBCA 3BGDA 4DV6B 1XK6A 3DBLB 1TD9A 1XYYA 3L7LA 3TCXB 3GGDA 1DXYA 1Z47A 2W2XA 2JD1A 3BMOA 1NULA 2ZUTA 2IV7A 4XOIA 1YRQA 2YZMA 2BM9A 3R3YA 3P0IA 1QWSA 1ULAA 1L4NA 3UAXA 4S1TA 1MT3A 2BKLA 4RJLA 3KEMA 3S3TA 4H3SA 1C8VB 4KV9A 1U7UA 1VP3A 3HYCA 3LPDA 3D3KA 3ET5A 3E53A 4FYJA 4YDHB 3M4XA 4KQ2A 5F77A 3VKUA 5FWDA 5FL3A 4M98A 3BZBA 5C5CA 1GPAA 4P7BA 4ITVA 3KD2A 3GY0A 3F5FA 5FOXA 1C1DA 1R8YA 2AFRA 1KMMA 4BFWA 4P4NA 1NXPA 3M3DA 1T15A 2JDIA 1RI4A 4O4LF 4BFVA 3Q7SA 4LDAA 3CLUC 1U3TA 3S1AB 3KQOA 3ZZ0A 4EHAA 5BR8B 3GJ8A 2M6SA 2AG8A 2RHMA 1CSEE 4B17A 1C9KA 1CRLA 1JDBC 2IU3A 1K6IA 2YQ5A 3FMVA 3IT2A 2G0TA 4I1UA 3CWCA 5DNEA 4FM9A 2WSLA 4KHPB 4TQGA 4N3GA 3ZHZA 4MMXB 2J45A 2HW8A 3OFND 5IAAA 5DLPA 2OWEA 4OAQA 3FYUC 2IIPA 5H80A 3LGXA 4JOCA 4OTZA 3SHFA 4D0GA 1G4AE 1YB2A 1WUHS 3P20A 3OH8A 3T1QA 1A9TA 1GPBA 2WNHA 1PEYA 3N9IA 5TDHA 2MYNA 3ONDA 5AJHA 1TMOA 1W9HA 1PIWA 1YRYE 2ZI4A 2ZJ0A 4DDVA 4I0WB 1PFUA 2GKSA 2HMAA 1CUZA 4HH3C 2F1IA 2RSLA 5HJ7A 1OREA 1WDWB 1K27A 4Q9NA 3VR4H 2WU4A 3WLOA 4BE9A 5BN5A 2FWMX 4C78A 1SHZA 4RZSA 5AQEA 4B9AA 1YTLA 1Z2PX 4KDRA 1X1QA 2VBGA 721PA 4OLHA 1ZH6A 4JLNA 4CMBA 4IIDA 2QTTA 2XCLA 1DJMA 1TCCA 3G2NA 1AK9A 5C5EA 4YVFA 1BHQ1 1V25A 3QEKA 2GZ1A 4CMKA 2J3IA 4OHPA 1C8BA 3HVHA 3T5BA 4R2IA 4RSGA 6GPBA 2EBUA 1CDOA 4E4RA 4MR9A 1CVRA 1N7JA 2F1KA 2OCXA 1TAGA 1WMSA 4W1SA 4WFQA 4YAGA 4Z0TA 4UBMA 3EGIA 1WZNA 1XFAA 3GVPA 4NK5A 4LYEA 3R76A 3X1WA 1HZZA 4AZ3A 2ZYWX 4LOHA 1NX9A 3MBKA 4Z4CA 3MCUA 4OYRA 2H08A 3WRVA 2CVHA 1YBHA 1U8XX 4AMZA 1ODCA 1RPTA 1QV6A 2JASA 2P41A 3M5WA 2DWUA 3BOSA 4FYKA 1CJTC 4IDOA 3QPBA 4HWRA 4UPVA 1SUEA 2EARA 2PUVA 4FHCA 3AR4A 4B3BA 4XWOA 1OI3A 2I67A 5CURA 3T1YB 1C7IA 3ZD9A 4O1MA 1XZAA 2FZKA 3QXJA 1A4IA 4IDNA 4L4XA 4O2AF 1MAVA 1RAFA 3W3AH 1RCTE 2WIBA 1UOOA 3FNFA 4AJIA 4JX9A 3ZWBA 3LT0A 2D0PB 3B8EA 3LOUA 2IH5A 4S0XA 2DHRA 1FSGA 3D7SA 2XUIA 3HL4A 1TVCA 3M8KA 3R0XA 4AYWA 4F3TA 3JARB 1CK4A 2C4VA 1G8FA 2KB0A 5DYNA 4Z5XA 4D56A 4FSDA 3DE6X 5IZCC 1ZZGA 5ARDA 3EPRA 1VTKA 3F5DA 3JZAA 1ZJYA 2BFDA 3L7BA 2JLXA 1Z7EA 4J1TC 1NJ1A 4JJAA 5L3SB 4JJGA 2YXLA 5EMHA 2DPYA 4JI1B 1K6MA 2G4LA 2QTBA 1FY2A 2XOKA 4OH7A 3OZDA 3EGVA 3U7HB 2GO1A 2W2MA 4A1OA 3T4PA 4LGVA 3W8EA 4B4DA 5KIAA 2TMGA 1DIRA 3O4FA 5JCPA 4BGDA 4LTNA 1ZD9A 1IN1A 2J3EA 4GMXA 2HLPA 4D46A 3HYSA 5EL0A 5A4JA 4KTTE 3ZCUA 3C5WP 4YUYA 1P0IA 1OZAA 1QO0D 3NHMA 1XA4A 3JSXA 3EFHA 3REFA 4YRDA 1CFZA 1ETHA 3LYUA 5DTRA 4CKBB 1NT4A 5ALUA 4ARBA 2G9QA 3TJMA 4MAMA 1SVWA 3IP8A 1WDKA 2Q6TA 4FYPA 4JA0A 4ZVMA 3VMMA 4BMYA 1KBOA 1DU4A 1O77A 1KEPA 1L9XA 3HVJA 4QUBA 2ATEA 2JZOA 5CFLA 3O5AA 2YINC 4GOJA 3M7IA 1SOAA 2CEAA 3E03A 3E3LA 4I8IA 4Q00A 5IJAA 4C4SA 1LSSA 4LK2A 5IVHA 1QF6A 4BATA 2R7LA 3A6HA 5CDGA 2X1MA 3MUOA 3NBQA 1T91A 4O0MA 5IDVA 4ITUA 1JLLA 1W4BA 2W6IA 4P3XA 2HO4A 4CT5A 1JDNA 3CRZA 4M1EA 1HQYE 2D1RA 1Y7PA 1NR1A 2LIPA 4I4TA 2AXPA 5ECYA 2OCLA 3U4MA 1A5ZA 2JK0A 3OQHA 5LQMA 2ZQ5A 3I61A 4I9GA 2UZ3A 2NV6A 3THYB 4PHTA 4FONA 3UAWA 5J1SB 2AOUA 3UJ7A 2B1RA 3WLSA 2PWAA 4D6YA 1ZJWA 2PAFA 1B0PA 2E4XA 2PH1A 3WDLA 4D42A 1DCTA 3H16A 2ZI3A 3AHIA 1WVGA 3ONWA 4L8FA 1HYEA 2LCFA 1KZ6A 1Z5WA 2IXGA 5J2TF 4IIBA 1MJ5A 3EQ6A 5DWQA 2P1ZA 3T5CA 3ECSA 4H77A 1GFIA 2FCAA 3JYNA 2EL7A 3QKTA 3QHQA 3ZU5A 4P4TA 1MEOA 5K99A 1KH1A 1YGYA 4HAIA 3EGDB 5JMOA 4WCFB 2Q1SA 2NU6B 5DW0A 5FD8A 3NAMA 1UAYA 4P0PB 4GX2A 1XD2A 5CW1A 4DCUA 3NP7A 3IDSA 1FFXB 1ZC3A 4P81A 4PO9A 2B7BA 1RQ7A 2XUPA 4HEA1 4NXMB 3LUPA 3KVVA 3SC6A 2NNWB 3DB1A 3A6ZA 3TPCA 3VHXB 3EXEB 3UJ8A 1QU2A 3HGMA 1T2CA 1M73E 1SUAA 1QIEA 2ZLBA 4MQUA 4I3HA 1OIXA 4KW7A 4NX2A 2PNFA 3V4OA 3HCNA 1T9DA 1EUQA 1AX9A 4FFWA 4CKXA 1GR1A 1SXJA 1XEXA 3OVMA 2NUBA 5JFTA 1CYEA 5AFSA 4Z9YA 6CHYA 4G65A 2JGLA 1HNZB 1JXOA 5HK8A 2DSTA 1P6UA 2IHYA 2DG2A 1CZKA 2ZI6A 2YMLA 1T3ZA 1M8PA 2EKLA 2ACKA 3HHEA 4GMKA 1DMRA 4CUZA 1UJCA 2PH3A 4L0DA 4EENA 3EA5A 3BHJA 2AEJA 3R24A 4I55B 1NW7A 3ZV6A 1NF3A 2FZ4A 3H3JA 2NADA 1XXHA 3TW0A 1HT2E 1UBLS 4CUKA 2BAGA 7MHTA 3V4ZA 3K9CA 2G7MC 4B3JA 4HPXB 4J0KA 4X60A 1S2IA 1CRPA 3P5SA 3BWXA 4O1IA 5FL7A 5A05A 1Z4OA 2YS7A 4D98A 1JFLA 1QYRA 4L6AA 4DNXA 2G9ZA 5EGNA 3K2IA 4GP7A 1H2AS 1U6IA 2WHRA 4PC3A 1U0TA 4GMFA 4BLWA 2R8RA 1RYYA 2QTZA 2CHUA 4KFCA 2PUHA 5KZMB 1LV8A 1WMEA 3FKSD 4Z9XA 5EUMA 4ZYZA 4F2GA 1PGJA 4DXDA 4QQ8A 3AL0C 4PYMA 5EE0A 3CRNA 5EHZA 4JFRA 4RIFA 1X7GA 1M2VB 4NOLA 2F59A 3HB1A 3PTAA 5FKJA 3RUAA 1KQGA 2PJUA 4E2FA 5AKGA 3MJCA 4HQ0A 4FEEA 4K6OA 4EBFA 4HGOA 5LOVF 4HEHA 1YL6A 4BMVA 1ZD4A 1U8CB 4H6PA 2XWPA 1ODSA 2R7NA 3QXSA 1LPPA 3JAWA 4MWBA 4EBBA 3LPCA 1WBDA 1NU6A 1LS6A 1RJ9A 2RI0A 4ALLA 2V7QA 4RTMA 4XUCA 3G02A 3GFTA 2V1XA 1AK2A 2NYUA 2NP7A 2I7CA 3MB8A 2HQSA 1A7AA 2VH2A 2PKCA 3EGCA 3PX7A 3LUHA 3RUIA 4Z54A 2D2XA 4HDRA 4IGAA 4P5EA 1IN5A 2PO5A 3C3DA 3KUUA 3CNQS 4K9DA 4RVGA 4RY0A 4Y1RA 4AP6A 3MT9A 3GLHA 1ZI8A 5LZ2A 3RABA 3I0ZA 4NBWA 3TKYA 1HZZC 2ZJ3A 3U7EB 4QOIA 5JO9A 3DMGA 5FTLA 4GNRA 2O05A 1SCBA 3O84A 2BP7B 4KO3S 4BV9A 3PNLA 2Y67A 5D00A 3N8GA 3PICA 4GNKA 4OKNA 3PVZA 1CUYA 3FF4A 3LWNA 2YVKA 4OLAA 3EGXA 3Q12A 4UBOA 1F2VA 4AULA 4QXOA 2IGBA 4M9XA 5AXBA 3Q41A 4HQ6A 2FUNB 3AVXA 1A8UA 3T1NA 4B8ZA 5IJ0B 1YVEI 2DQYA 4JLPA 1G60A 4D6PA 4DLNA 3R8XA 1FP1D 2BISA 2R8ZA 4OXNA 4K9MA 2RGRA 4XW2A 3SN6A 2XXAB 1IUOA 3C5VA 3OJEA 4OSEA 4B83A 2D7JA 5FPTA 4Q4HB 4ZI7A 1PGPA 4IG4A 2A5DA 3H1FA 5LQRA 4YC7A 1LJUA 5KOJB 5ERGB 3SMVA 2IBTA 5CXXA 4HWTA 1ZINA 2OXFA 2GDJA 2ZKIA 3CY6A 5JVDB 4MTLA 3B36A 2YJ4A 4GD3Q 7GPBA 3EH1A 4M9QA 2YW9A 3D5TA 2UYHA 4ZDJA 2F8TA 3WYCA 3KQSA 3K20A 3VX3A 3G2QA 1BW9B 3TB4A 2ZW9A 3BE4A 3FIJA 3I4LA 3BD7A 4HEJA 4D74A 3NV7A 3ST7A 3O82A 2FFJA 4DCMA 4NZ9A 1SULA 1Y5NA 2F3SA 4OJQA 4JENA 2AZXA 2O5VA 2VHCA 2IP2A 4G84A 4LV8B 4XDZA 1V48A 2C9YA 1N9GB 2GXAA 3WTBA 1MORA 1SCUA 4L6IA 4RM3A 3KZOA 4DJDC 4W6QA 1GG8A 4WY2A 4GM0A 4AXBA 4IHAA 3W7VA 2BE9A 3VSEA 1KVTA 5K2OA 1N2ZA 4LZNA 3GZ4A 3M3PA 5JBNA 2B25A 1ZFNA 1BH6A 4LJSA 3FYUA 4RELA 1H4TA 3BXHA 1UANA 3KS9A 1TC2A 4D57A 5HM6A 3T0FA 3AJRA 1G7TA 3TTXA 4CQLB 4BX0A 5KSYA 1ZX1A 1YKGA 1ST3A 2ZVDA 4V0MA 1VA5A 3A1SA 1VP9A 1YB4A 1TMYA 2DKOA 2XRYA 3MUNA 1Z07A 4PW0A 2VT7A 1W36C 5GJBA 2ZSBA 4ZREA 4IDGA 1HFJA 5HFJA 3QKRB 1PZHA 1EZ1A 3MZ0A 3V4FA 1EG2A 2QLMA 4ARZB 2I8LA 4DUYB 3MWEA 2SKCA 3KUXA 3O0DA 4HCJA 4YUAA 1NGSA 5TQ2B 4R8RA 2G9NA 2QT9A 2VOEA 2BFCB 1LJLA 1R4MB 3GFRA 1A8QA 2C88A 1XEFA 4Q16A 3GEMA 4MVXA 5F5XA 1NRWA 2C1ZA 1KSHA 4P3NA 1HDOA 1T4CB 1F8GA 3RH0A 1E0DA 1JG2A 2EKDA 2Q0SA 1G21B 1YE3A 5HP4A 4YPOA 4LF6B 1QOZA 4HYEA 1GKYA 1OFUA 3OPYI 3B85A 2BZGA 2RG7A 4LFAB 6ADHA 3KXPA 1TW2A 2X0EA 5AWFC 1SU8A 4QZVA 3ZIUA 2HK8A 3AY3A 1K75A 2D06A 3GZTB 4J8PA 5JXWA 1GQRA 1TMGE 1E3LA 4MCIA 4YALA 5T8KC 4JJ8A 2E6UX 5LIRA 1G5IA 2HV8A 2YQ4A 1Y1RA 2W2TA 3KUKA 4IX9A 5JEEA 4KYIB 1V43A 1VI2A 1CUCA 4K3VA 3CPHA 1XRMA 2PDAA 1A8SA 1U7XA 3TXAA 3JVEA 1CUWA 1GTVA 1TZKA 3RTDA 3M1AA 3B1JA 2WF6A 4N39A 4OYLA 1Q0HA 4QM7A 3KTOA 4QPJC 2OCDA 3EBPA 1U7WA 3VI3B 1IBCA 1UFKA 1ZWKA 3H5VA 3DLBA 1V3VA 2A9KA 4ZVLA 1M2HA 1ACLA 2KS6A 3PRKE 2OQVA 5E6RB 3ZE6A 4TTAA 1KQPA 4JKYA 2OBMA 4HY3A 1RADA 2VJCA 3RGWS 2ZRQA 3CEAA 1R64A 2H3HA 2OSVA 3ECAA 1Z06A 2IW1A 3QG1A 5EJ5A 2KMLA 1PFWA 1GG2A 5ES4B 3IX7A 4PYRA 5MN4A 1CVLA 4QELA 2X0IA 1QS0A 4YUVA 1RIFA 4N8SA 1Z6ZA 1HC7A 3QVJA 4KIGA 4ZOLA 5JCJD 5G1PA 5K51A 3O8OB 1RYDA 2CY0A 5KQRA 4ZDKA 5J5CA 5I4CA 4AUKA 3LKDA 1UP4A 1A5SB 5H16A 1N57A 1QGDA 2QVBA 4RF4A 4WIAA 4N03A 4OP1A 4TRRA 2QY6A 3UXMA 1QXSA 3AEZA 1BFDA 3CLTD 2NVWA 2HSWA 4U8HA 1W6RA 3TPZA 3AF0A 4A3SA 3TZCA 1LK5A 2AG1A 5KKCA 2C77A 1A9PA 4KWEA 2DKNA 4BVBA 1FMJA 3K8OE 5FXMA 3K0FB 1E6CA 4Y98A 3PHLA 2I2XB 1K68A 2HEIA 1J25A 3DAOA 3JWGA 4WDRA 1W94A 3AP3A 1KI3A 4DB4A 1LDMA 1AKMA 2B94A 1P19A 3R5KA 1JR6A 1AGNA 3D6MA 5AKEA 2FXVA 2ADMA 5I7EA 1XG5A 1YBAA 2ZRHA 1GZHB 3B60A 1OVGA 4RZQA 3GLHE 4LHVA 3T4EA 4XR4A 1V1MA 2D2VA 3E9ZA 4P2GA 2BZSA 1W96A 2VNJA 3HZZA 1VDMA 3CZPA 4JGBA 2VLBA 1N9GA 4B73A 4MSUA 4Y2PA 2VYQA 3D6TB 2JKYA 2PZMA 2X8JA 4U9UA 3PKIA 4OGFA 3OMWA 4WV3A 2OV3A 3T5AA 4YASA 1YAJA 4EYOA 3LY5A 3IBYA 1VJGA 4L02A 3ZDYB 4YAFA 4X71A 3UJPA <