4HTWA

Sivmac239 capsid n-terminal domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
142
Chain Sequence
PVQQIGGNYVHLPLSPRTLNAWVKLIEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIRDIINEEAADWDLQHPQPAQQGQLREPSGSDIAGTTSSVDEQIQWMYRQQNPIPVGNIYRRWIQLGLQKCVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Gain-of-Sensitivity Mutations in a Trim5-Resistant Primary Isolate of Pathogenic SIV Identify Two Independent Conserved Determinants of Trim5alpha Specificity.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Viral protein
total genus 42
structure length 142
sequence length 143
ec nomenclature
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4htwA00
3MGEA 5HGNA 4XFXA 1E6JP 2M8LA 4INBA 1GWPA 2V4XA 4U0CA 2XGUA 1D1DA 2GOLB 2Y4ZA 2WLVB 3P05A 4WYMA 4U0EA 4PH0A 5HGOA 2EIAA 1QRJA 2M8PA 1M9YC 5HGMA 2PWMA 2LF4A 4B4NA 2X82A 1EM9A 4XFZA 1EIAA 4LQWC 4XROA 2X2DD 2JPRA 1M9CC 2KGFA 2PWOA 5HGKA 2WLVA 4U0FA 1L6NA 4U0DA 4E92A 1G03A 4DGEC 1M9EC 4PH3A 4U0AA 4XRQA 4DGAC 1U7KA 4J93A 2XGYA 4XFYA 2PXRC 3H47A 4U0BA 5JPAA 2X83A 2XDEA 5HGLA 3H4EA 1M9FC 3BP9A 1M9DC 4PH2A 1P7NA 1M9XC 2M8NA 4QNBA 3NTEA 1AFVA 1AK4C 2GONA 2XGVA 4NX4C 4HTWA 4E91A
chains in the Genus database with same CATH superfamily
3MGEA 5HGNA 4XFXA 1E6JP 2M8LA 4INBA 1GWPA 2V4XA 4U0CA 2XGUA 1D1DA 2GOLB 2Y4ZA 2WLVB 3P05A 4WYMA 4U0EA 4PH0A 5HGOA 2EIAA 1QRJA 2M8PA 1M9YC 5HGMA 2PWMA 2LF4A 4B4NA 2X82A 1EM9A 4XFZA 1EIAA 4LQWC 4XROA 2X2DD 2JPRA 1M9CC 2KGFA 2PWOA 5HGKA 2WLVA 4U0FA 1L6NA 4U0DA 4E92A 1G03A 4DGEC 1M9EC 4PH3A 4U0AA 4XRQA 4DGAC 1U7KA 4J93A 2XGYA 4XFYA 2PXRC 3H47A 4U0BA 5JPAA 2X83A 2XDEA 5HGLA 3H4EA 1M9FC 3BP9A 1M9DC 4PH2A 1P7NA 1M9XC 2M8NA 4QNBA 3NTEA 1AFVA 1AK4C 2GONA 2XGVA 4NX4C 4HTWA 4E91A
chains in the Genus database with same CATH topology
3MGEA 5HGNA 4XFXA 1E6JP 2M8LA 4INBA 1GWPA 2V4XA 4U0CA 2XGUA 1D1DA 2GOLB 2Y4ZA 2WLVB 3P05A 4WYMA 4U0EA 4PH0A 5HGOA 2EIAA 1QRJA 2M8PA 1M9YC 5HGMA 2PWMA 2LF4A 4B4NA 2X82A 1EM9A 4XFZA 1EIAA 4LQWC 4XROA 2X2DD 2JPRA 1M9CC 2KGFA 2PWOA 5HGKA 2WLVA 4U0FA 1L6NA 4U0DA 4E92A 1G03A 4DGEC 1M9EC 4PH3A 4U0AA 4XRQA 4DGAC 1U7KA 4J93A 2XGYA 4XFYA 2PXRC 3H47A 4U0BA 5JPAA 2X83A 2XDEA 5HGLA 3H4EA 1M9FC 3BP9A 1M9DC 4PH2A 1P7NA 1M9XC 2M8NA 4QNBA 3NTEA 1AFVA 1AK4C 2GONA 2XGVA 4NX4C 4HTWA 4E91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGE A;  5HGN A;  4XFX A;  1E6J P;  2M8L A;  4INB A;  1GWP A;  2V4X A;  4U0C A;  2XGU A;  1D1D A;  2GOL B;  2Y4Z A;  2WLV B;  3P05 A;  4WYM A;  4U0E A;  4PH0 A;  5HGO A;  2EIA A;  1QRJ A;  2M8P A;  1M9Y C;  5HGM A;  2PWM A;  2LF4 A;  4B4N A;  2X82 A;  1EM9 A;  4XFZ A;  1EIA A;  4LQW C;  4XRO A;  2X2D D;  2JPR A;  1M9C C;  2KGF A;  2PWO A;  5HGK A;  2WLV A;  4U0F A;  1L6N A;  4U0D A;  4E92 A;  1G03 A;  4DGE C;  1M9E C;  4PH3 A;  4U0A A;  4XRQ A;  4DGA C;  1U7K A;  4J93 A;  2XGY A;  4XFY A;  2PXR C;  3H47 A;  4U0B A;  5JPA A;  2X83 A;  2XDE A;  5HGL A;  3H4E A;  1M9F C;  3BP9 A;  1M9D C;  4PH2 A;  1P7N A;  1M9X C;  2M8N A;  4QNB A;  3NTE A;  1AFV A;  1AK4 C;  2GON A;  2XGV A;  4NX4 C;  4HTW A;  4E91 A; 
#chains in the Genus database with same CATH topology
 3MGE A;  5HGN A;  4XFX A;  1E6J P;  2M8L A;  4INB A;  1GWP A;  2V4X A;  4U0C A;  2XGU A;  1D1D A;  2GOL B;  2Y4Z A;  2WLV B;  3P05 A;  4WYM A;  4U0E A;  4PH0 A;  5HGO A;  2EIA A;  1QRJ A;  2M8P A;  1M9Y C;  5HGM A;  2PWM A;  2LF4 A;  4B4N A;  2X82 A;  1EM9 A;  4XFZ A;  1EIA A;  4LQW C;  4XRO A;  2X2D D;  2JPR A;  1M9C C;  2KGF A;  2PWO A;  5HGK A;  2WLV A;  4U0F A;  1L6N A;  4U0D A;  4E92 A;  1G03 A;  4DGE C;  1M9E C;  4PH3 A;  4U0A A;  4XRQ A;  4DGA C;  1U7K A;  4J93 A;  2XGY A;  4XFY A;  2PXR C;  3H47 A;  4U0B A;  5JPA A;  2X83 A;  2XDE A;  5HGL A;  3H4E A;  1M9F C;  3BP9 A;  1M9D C;  4PH2 A;  1P7N A;  1M9X C;  2M8N A;  4QNB A;  3NTE A;  1AFV A;  1AK4 C;  2GON A;  2XGV A;  4NX4 C;  4HTW A;  4E91 A; 
#chains in the Genus database with same CATH homology
 3MGE A;  5HGN A;  4XFX A;  1E6J P;  2M8L A;  4INB A;  1GWP A;  2V4X A;  4U0C A;  2XGU A;  1D1D A;  2GOL B;  2Y4Z A;  2WLV B;  3P05 A;  4WYM A;  4U0E A;  4PH0 A;  5HGO A;  2EIA A;  1QRJ A;  2M8P A;  1M9Y C;  5HGM A;  2PWM A;  2LF4 A;  4B4N A;  2X82 A;  1EM9 A;  4XFZ A;  1EIA A;  4LQW C;  4XRO A;  2X2D D;  2JPR A;  1M9C C;  2KGF A;  2PWO A;  5HGK A;  2WLV A;  4U0F A;  1L6N A;  4U0D A;  4E92 A;  1G03 A;  4DGE C;  1M9E C;  4PH3 A;  4U0A A;  4XRQ A;  4DGA C;  1U7K A;  4J93 A;  2XGY A;  4XFY A;  2PXR C;  3H47 A;  4U0B A;  5JPA A;  2X83 A;  2XDE A;  5HGL A;  3H4E A;  1M9F C;  3BP9 A;  1M9D C;  4PH2 A;  1P7N A;  1M9X C;  2M8N A;  4QNB A;  3NTE A;  1AFV A;  1AK4 C;  2GON A;  2XGV A;  4NX4 C;  4HTW A;  4E91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...