4HU2A

Crystal structure of ldtmt2, a l,d-transpeptidase from mycobacterium tuberculosis: domain a and b
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
194
structure length
194
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of LdtMt2, an L,D-transpeptidase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords PROBABLE CONSERVED LIPOPROTEIN LPPS
total genus 44
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hu2A02
2.60.40.3780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hu2A01
4XVOA 5LB1A 3U1PA 4GSQA 3VYNA 3VYPA 4JMNA 4K73A 3U1QA 4QR7A 5E1IA 4JMXA 4QRBA 4QRAA 5DCCA 5D7HA 3TX4A 4QTFA 5DZJA 5DC2A 5E1GA 4HUCA 4Z7AA 5E5LA 3TURA 5DU7A 5K69A 3VAEA 5DZPA 5E51A 5LBGA 5DVPA 4GSUA 3VYOA 4GSRA 4HU2A 5DUJA 4ZFQA
chains in the Genus database with same CATH superfamily
5IF0B 4IOIB 3VMOA 5IK3B 4XMTA 1CBVL 4MQ7B 2BHYA 5C0CA 1V7MH 3V4VH 1VADB 3V9EA 1QSVA 1ZANH 2WNXA 1G7QA 4S2SB 5L8LB 1K4DA 2GSGB 2EXSA 4PW4A 5CGYD 3RVVC 2BZDA 4YL9A 1XVSA 3NGBC 4FADA 1ZJAA 3HC3H 1VRSA 1AZZC 1AXTL 1OAKH 1UGNA 3FMGH 5C1MB 3QUXB 3HG1E 3CVCA 3FHQA 4RZCB 1BVLA 2MEJB 4Y88A 4FYQA 1WF5A 3GBDA 4RZKA 4NHCH 1ITCA 4JM4L 1C5DB 5EWIL 5F96H 4NYLB 2VIRA 4PSPA 2XZCH 4IKJA 3GSXB 1FNFA 3KMDA 1HAUA 3R1GH 3K4AA 3ME0A 5AWNL 4P4KD 1ED3A 2DYSB 2FX8L 3L5XH 1BF8A 5IMMA 5CEZL 2R0ZL 1ZHLB 4XTRC 4B3EA 3NIDF 1DANU 4P3CL 4L5FE 3MV7D 3OMNB 4Q9CA 3VXRE 2Q9OA 4FFYH 4ZS7H 2C9XA 1OXYA 3UPRB 5HGGS 2E9BA 4X8JA 1A7QH 2MQ3A 2ZX9A 1TVHA 3MJWA 1KFAL 2QDWA 1IQDB 1MSPA 4JFYA 4P2OB 1EO8H 4FXLA 4J3TA 5AL8A 3DX9A 3TO4B 2FWSA 3TVMB 1OTTC 1WQVT 1GSMA 3C9NB 2CAKA 3U7YH 4XPGL 4NCC2 4BRJA 4RCAA 2JLLA 3IFPB 5D7KE 4WJKB 3CCHA 1R5IB 2BCKA 4Y19D 1KLGB 3PDOB 1UH3A 4KMTH 4OZFG 2YXVA 1P2CB 3DX8B 3FU5A 3Q6GH 1QBLH 1J9TA 1BQKA 1RIVH 2G2RB 4JY4B 3F6IA 3ZTCC 2W91A 2DKMA 4KI1A 4YDVA 5FO9B 1EO5A 2XV6B 5HI5D 1OK8A 3WS3B 4AGOA 3F7VB 2Y7QB 4EZMA 4JG1L 4A7GA 4G42A 1HH9A 2YGNA 5H94A 3V0WL 2XPGB 2X7LA 3UO1L 4JG0L 2JLPA 3EH1A 3K1DA 2NNRA 3BEWA 3WY1A 3QDAA 1YYLL 5F1OB 1RHFA 1HIML 3OAUH 5D7HA 2NY1C 1L0XA 4GKSB 3N9GL 5CHNA 1SHWA 4OLYH 4RWHA 5AVSB 4V33A 3SDCA 3WD5H 3CDGB 2F53D 3BKJH 1U0QA 3PY9A 2PTTA 4M62H 4PR5A 3LVEA 4OVUA 4U0QB 1NCHA 2BVUA 2B14A 1WFOA 2OSLB 1NFDA 1FRGH 5EA0H 2NYYD 4YFEA 4K71B 2O5NA 3JWOL 1BEYH 25C8L 4H8HA 3VSUA 4X9FA 3AT9A 3OLDA 4KKPA 5DVLA 3IPEA 1WTLA 1FFPB 2HJFB 3ARSA 4C54A 4Z7NE 2IDSA 3T0EA 3I6GA 5HDLA 4MNQE 4MA7H 5ERWB 5TD4A 5D7IB 3VXSB 4R97C 3AQZA 4RDQG 3L08A 5G4MA 3GHBH 5AYQA 4WNQB 5EG6C 2P49B 1T1XB 4PJ9B 3HBZA 3SY6A 3ZL1A 3QI9D 5IW1A 2CCWA 3DMMD 4NT6A 1P7BA 1FHNA 4F2EA 2WUCL 3EFDL 2CKBH 1PYWB 4Y2LA 4AG4L 3UJJL 4GQZA 3DXAD 4EI6B 3H1ZA 5JLZB 5I1GL 1KB9K 1BPVA 1S7WB 3AC0A 1KYAA 4GQ9L 3NTCL 4WHCA 3QQ4A 4MHHG 3MLSH 1M6UA 2ICEC 3IJHA 3AG2B 5D1XB 1FAIH 2ZPKL 1KCLA 4QF1A 3KGUA 4D9RE 1EXHA 3GRWA 3FB5A 4G7VH 3MV9D 2OXHB 2C7UB 3TV3H 3UADA 2EYRA 3UZQB 4Z3JA 2ADYA 1E5ZA 2WOYA 4ZPTA 2ODHA 3WNNA 1DLHB 3P4MB 4LPWA 6FABH 1AXIB 4AM0Q 2N7AA 3UTSA 2YD6A 3SQRA 4TVPH 2BNUA 5JQ6L 1BAWA 4JZNA 4BYHA 4PS4L 1IX2A 1X5ZA 4NKOA 3SBQA 3IFNL 1KWKA 1BQHG 1E43A 4FCHA 3DBXA 4B9IA 4L8CB 1NBVL 2N01B 1X5FA 4QRBA 4UQ2B 4QHNA 3VI4B 1UZ6F 4LLWA 4HS3B 4KWUA 3M45A 1HL9A 3T3MF 3WAKA 2W9EH 3D2UB 1IJ9A 1DN0A 3CG8A 5FYLD 2ZIDA 1G9EA 2AI0H 2CIKB 2F08A 4Y4FA 1W0YT 2E74C 4XVTH 2VDRL 3RJOA 5BRQA 1YPZA 5I73B 4D0DA 3DTUB 3KH3A 1A6ZA 1X9LA 4EN3B 3V4VB 1QWHA 4ZFOB 2FBOJ 1PX4A 2XFXB 3O6FB 1A6PA 3ARED 4OCSH 2VR9A 4R8WH 1KCUL 1W72L 5I1EH 4TPRL 2X4PB 4JFWA 4XAKD 4ILDA 1MFDL 1NGPH 4P2YA 4Y16B 1J8HA 3MJ8A 3FQRA 4K5LA 5BMFH 4B5ZA 1ZGLM 4KKLD 3TS8A 1KCBA 1ACZA 5KSAA 2XWTB 4ZTPL 1C8PA 1RK7A 1N67A 3TYFB 1NBYA 7FABL 1SBSH 3ESPA 4HP5A 4UNTA 1KCSL 3EGXA 1E9OA 1QNZL 5IJVB 3P69A 5DJXB 3K6SA 3K80A 3ZHFA 4HUNB 4TLSA 4GRWH 4PCTA 5C97A 4U1MA 4P57A 2AHIA 1AGDB 4JZJA 1N19A 2MQCA 1IGIH 3G5XB 1EAPA 2W07A 2VZUA 2B4CH 4I48B 3RX9A 2A9NL 4JG5A 4KUZL 4DN4H 1S7TA 4NQDE 5CP3A 3S98A 5EMYA 1IKNA 3FC8A 2XQBH 3VXUA 2Q7YA 1HE8A 4W9CC 4DKDC 3UCRA 5CLYA 1CLZH 5CBAB 3IDJB 2OR8A 5I73C 1RJZA 3K7UA 1UCTA 2LOEA 3M1OA 1CS6A 1Y1UA 4GQRA 4QTFA 5D7EA 3FPXA 4JFFB 3V5HB 1BOGB 4POZC 5C0EA 1A7PL 2DWDA 1KSRA 4X0KB 2YWYA 3PAYA 1DQKA 3HE7A 4GMSL 3C60A 1KGIA 1FWXA 1T4KB 5L0QB 5MEPB 1KB5B 4AITA 1XZ0B 2FSEA 1GYCA 4O58H 3O2VH 5FKAA 1PIFA 2EQDA 3ZT6A 1JNHA 1X7SA 4F7EA 1TLMA 2I9LB 3CMOH 3DX0A 5AW0B 1G9NC 1WITA 2ITFA 3FH5A 3CVHL 3AWGA 2FHCA 4IRZH 3X12A 2QV4A 5IESL 3UL4A 3WKML 1N6UA 4UF7C 1BQSA 5DMGD 4NO5A 2C9PA 3FSZA 4XH2A 2BCKB 1H6EA 3OHXB 3GJEA 3MV8B 4HZ1A 3FT2B 5CJOH 1HYSC 1WCBB 1AJ7L 4XVSH 4D94A 1OWWA 1QABA 5A40E 1KYDA 4S1QH 3L3IA 5ANHA 4MJIE 3X17A 5E2TL 4YSTA 2R29H 4FP8H 3ZL2A 3RDTA 1TYEB 2CBOA 4ISVB 2QSCH 2Y6TE 3MRJA 5AOLA 2FT8A 4BK4A 2UYLB 3D4GA 2BNQD 2HFFA 4JFDE 4DNLA 2O61A 2VQ1B 3EJJX 2FJUB 2WQRA 2C9QA 1IGJB 3TCTA 4QOKA 3HBGA 4MJID 1QRKA 3TBVB 1MOEA 3HNSL 1S7UB 4H26A 1CFBA 1P5VB 2RD0A 4KH9A 3WEOA 4TL4A 4Y4KC 5ADOH 5LHDA 1CLYH 3HCVB 3R8QA 1JI1A 1EXUB 3Q1SL 4ZTEA 7PCYA 3WHE0 1TQUA 1IC4L 3VDAA 1G0XA 2WXPA 3VFWA 2R2BA 3CV5A 2Y24A 4GAJH 3CZSA 3R06B 4MWFA 1NOFA 2J7LA 1A6VH 2FJSA 3NUKA 1YEDA 3KXFA 5FUOH 1FZOB 4KX7A 2JKIS 5E1AA 3DA0A 3PWJA 2OZ4L 1ZHKA 3DHPA 4LCCB 4RA3A 1F4AA 1I8LC 4HMDA 5ERWA 3GQFA 5EO9A 4M48H 4Q9BA 4DCQB 5EORH 4Y4HD 2Q87A 1SMOA 2VM4A 4X7TB 1XWVA 3B1UA 4IM8A 3V2AR 3VFOB 3U9PH 3WL9B 4KROD 3A67H 4TSBL 1MCNA 4RAUB 4B9KC 5BXFB 1PLAA 1HHGA 5JLZA 4Z8FH 4P46C 2AXWA 3WN6A 5FO8B 4JJ5A 4JANB 1UXWA 1JNJA 1KTKE 4PRPA 3A6CL 5IM7B 3RU8L 4GXUN 4ANUA 5C0AA 4ELME 4LNRB 4UTBH 1G7LB 2A4EA 1WA1X 3S88H 1M56B 1ET7A 1ML0A 3AAZB 1R3HB 3T65A 3QDMB 2LU7A 5JIPA 2VZOA 3B4NA 4FMKA 4K8RH 3EG9B 3I2CL 4NUGH 5J5EA 2EIJB 3ALPA 5K9KA 3UTSB 3WKQA 5FIEA 3IGUA 5LN8A 4OTXH 3FTYA 4CC4A 3TC9A 3X3GL 5F0PB 2GI7A 4L2LA 2Z8WC 4LP8A 3TN0D 1GA2A 3KPMA 4NQTA 1IT9L 4WEBH 1MCJA 1D5XB 2X1QA 3SPGA 5C0GB 3AQXA 5D1QA 3WDJA 4P2RB 1CR9L 5AZ2H 1Z7JA 2EDOA 2HT2D 3HS8A 5I75C 3DHMA 2NRDA 4XZUA 2VXQH 4HV8A 3O6KL 3G5ZA 4RVBA 1QVOB 2E4TA 1C7SA 1T22B 3MREA 3BH8B 3NIDE 3QUML 1T5WB 4XC1L 4LCWB 3NBNA 4QY8A 2D7QA 3B56A 2ENQA 3I3DA 1LO3L 1OQOA 3LMJH 3ATDA 3WNLA 4PIRF 1SVBA 1ZSDB 4NQQA 2PW1A 4HT1H 5I71B 2IOMA 2QKIC 2XICA 3E1F1 2R39A 1XB3A 3EH3B 1V7NL 1P7QA 2GJZA 2Z92A 3BP5A 3GF8A 3NA9L 1J0JA 4CKVX 5E7BA 3K6FA 2VXVH 5JR1H 1L0QA 1M05B 1FG9C 4UTAL 3MV7A 4Y2OA 3ARDC 1MW2A 4K7FA 5HDQH 4E68A 3H85A 3RTQC 4NSKB 3VFVB 5DFVC 4KKRA 4LBAA 1QUPA 3S8WA 1ZT1A 3DGGB 2AJXH 2YBRB 4KY1H 3UPCA 3HR5A 4Q7DA 4PY8I 4ZNEE 1SXSA 2B1AH 3VRIB 1PKOA 2IBGA 1GCFA 4NNPH 1UM6L 3U4BH 2QGDA 3ZIYA 3KHQA 2DL2A 2HVJA 4E41E 5JDJA 1T03L 4U7SA 2HH0H 1DJYA 3GJFB 1DQTA 4NP4L 3BUTA 4X6BA 4F91B 5EO0B 4FL4B 2JKXA 4QRPE 4QTHB 4RMSA 4Z7UA 4WV1C 3V6FB 4AKOA 1ID2A 3Q48A 3FT0A 4NQVB 5JXED 4NQEE 1U3ZA 1PTZA 2CM6A 1IARB 1WICA 4U3XA 1HWGB 1PZ5A 2IFGA 2Z31D 4NRZA 5D2NC 4X42A 1N68A 4CSSA 1E4KA 1KBGH 3APMA 1CPUA 2WINA 1CFQA 1JHTB 1DBAH 3ZO9A 2R0LH 3CQFA 1MF2L 5C9JB 5ESAA 3P4NA 1NUFA 2ZWZA 1F4WL 3CIAA 4LEOB 1AFVH 4N8UA 3I85A 5IV2B 3CFJB 1IGTA 3N44F 4I18B 2L7QA 3HVDA 4ALAL 1QFPA 4ETQB 2I07B 3U46A 3L5WA 4G11A 1A6WH 2FZ3A 1P4BL 2XQ0A 5HHVL 1U8CA 4I4WB 1LO2L 4POYA 2OS7A 1Q9LA 2WLJA 1G1CA 3L4ZA 4J3OG 2O5ZH 2ZYHA 3CSBA 1NA8A 3H55A 3PQYE 1CI5A 4FE9A 2ZICA 1FL6A 2AK1H 2WN2A 1NEZB 4D9QD 1MI5D 5C0ND 2I9TB 3VI4F 3O45A 4NEHB 3FDWA 4L1HA 3SE9L 3X11B 3VFUA 1BXAA 1KOAA 3X12B 1DBML 1JCKA 4HJ0C 1IFRA 4JO1H 4LIQL 5DWUH 3SDAC 3CC1A 4HFWB 4P2QE 3QAQA 1Q0XH 5E2VH 3WE6B 1OSEA 3MBEA 1E5UI 3GZOA 1L5GA 1N0LA 1O7VA 2G0KA 3AG4B 4O2CA 4RMTA 4LSQH 4ZDHB 2FIRT 2JJTC 2JKNA 5MEQB 4LRIC 3GJFK 4UZUA 4PJBE 4BK8A 2FLRT 4HUKB 4I9XA 1JMXA 1LMKA 1MCOH 4CDGC 3CZJA 3QHZL 3NCJH 5EU5B 1U8NB 3MGAA 3RL2A 4GBXB 1Y0LA 4JPKL 2R2CA 1NAMA 2DEXX 3QCVL 3T0EE 1A64A 2AEPL 3RVVD 1M7IB 3VSVA 3HLKA 4NUPA 3A4EA 4M62L 4G1EB 2QZ5A 1WFUA 4PRHA 5DS1A 1YNLL 1OGTA 1QHPA 1KZQA 3D0LA 4X7DC 4ZTOL 3W39B 3VRJA 3QDGB 4X7FC 2LHAA 3AS1A 5SWZB 2CMRL 3QQ3B 2HFTA 3ZRSA 1ZXQA 4JKLA 3FFOA 1R6VA 1XEDA 2FNBA 1CF8H 5GGVL 5D7KD 2OLDA 2QKIB 5D7IF 1D7BA 3BCFA 4BZYA 3V0VB 2DL9A 5DQ9A 3W5MA 3IPBA 5GSRA 1DANT 1OP3H 4NENA 3ESVF 4ES8A 3EXLA 2C4FT 1ZLSH 3U2IA 5ICXA 1OVZA 3MN8A 3GO1H 4YR6B 3U6RA 1FL5B 1I75A 1V5JA 5IWLA 1GXEA 4EJ1C 3MV7E 1AZNA 4G8FB 3NCWA 3NZHH 5BVJA 2BXZA 5CEYA 3L5IA 5J12B 1LNUA 2V5MA 3QAZC 1ANUA 1MKFA 5DMIL 1RU9H 2CCVA 1MWAL 2VLKB 3ARTA 4NCC1 1IAMA 2ARJQ 4P9MH 4EIBA 4IDLA 4TQHA 5I16B 4QIRA 5KVDH 1KY7A 4JY6B 3MRDA 5FLUA 4XXWC 4G7YL 1YYML 4HJIA 2BWDA 5IVXA 3FQNB 2DAVA 2NNXA 3HG1D 3LXUX 4YWGH 3ZRFC 3V8CA 2G9HA 1KNOB 3IJYB 4LHUG 3ULUE 4AY0A 4BSWB 1H6FA 1YZZA 3TJHD 2DM7A 2G75B 4KTYA 4P05A 2MJWA 2X10A 3H56A 3D06A 3QDJE 1NBVH 1AD0B 5FYJL 2YJQA 1A4JB 5JOFA 2HPOA 2Q76A 3I6KB 4HJGB 1ZDQA 5FK9B 5HY9A 1BX2B 1P9MA 3LRMA 3QZBA 5DD3L 4UU9A 3OAYK 2WD0A 3ZYZA 1GR7A 5C0BB 2X70B 4LVOC 3HI1A 4HFUH 1NCWH 3HC4H 5CKAA 1WV7T 7TAAA 2XXCB 1HWWA 5LGKA 4TVPD 1EH9A 4GMTH 5IR1A 2KMWA 3LS4L 2EDQA 3U30C 3ZJAA 2HRPH 4KY2A 3U0WL 4QRAA 2CIIB 1YNTA 2FGWH 2OR7A 3T3ME 1HXYB 4YBLC 2IBZX 5JPMA 5KSBF 3OPZL 4A2LA 3UCQA 2WQWA 3EOBB 1LK3H 4PY7A 4MAYA 5GRJL 1N7ML 3VMPA 1KPVB 2VDKB 3ZE1B 4OSUL 2D7MA 4XPBH 5C0BE 1FGNH 1DN2A 3BHBB 1T5WA 4IU3B 3SDXF 4J4PD 1JPTL 2JCCB 4KKCD 1A9VA 3OG6B 4GSXA 5KVFL 1B4RA 2X41A 1KJ3L 1F3RB 1N64H 2YLKA 1GTNA 5HHOD 2WVVA 4NO3B 3KM2A 3SZ6A 1BZEA 1R3LB 3NA4A 3IK2A 1BFSA 1S9YA 3GMNA 4Y4FC 3CDYA 1CZ8L 2OMYB 2V0AA 4OLWH 4PW3A 2LTQB 1P4LB 5DO2D 4MJJA 4LCVA 2GY7B 3DVNA 1BBDH 2AQ3A 4AYFB 2LU3A 3FFDA 2CCLA 3GGWB 4M43H 3KR3L 5L0QC 1X5AA 3AADB 4AC2A 2NOYA 3D25B 2DQHL 2WAQA 3EDJA 4HDIA 4I9WD 1CYGA 3X13B 5FM5M 4JPVH 1CWVA 2NX5A 3TEZA 3FTWA 3A6BH 4YPJA 3Q05A 3A4DA 2I7OA 1MW3A 1PZCA 4JFQA 2WSPA 2V5TA 5CXPA 3UFIA 4A7UA 5EEVA 1BHGA 2VISA 1U8HA 1X3DA 3C6LC 4KTDL 4YGVA 2FDBP 4YX2H 2X4NB 1QBML 3M1CA 4MD4B 5DJDB 4D0BB 1CL7I 3FRUA 1UFGA 3CGTA 2H0FA 3U82B 5F7UA 1AD9B 3Q8EA 3F12B 3HMXL 3SEPA 3VYNA 1I7ZB 2CRMA 3T4YB 2HWZL 4HUVA 4TSCL 1KJ2A 3BD5A 3BQUB 3INUL 4DP5X 1I3RB 5FCUH 32C2B 4OJFH 4MJIA 3MZTA 3SE4C 3T4AC 3DPDA 2PPCA 2J72A 4DP6X 4Y1AB 4UDUA 2BVPB 2OV0A 5ITBH 3BFOA 3S3SA 5F1NA 1N10A 4XNYH 3ZKSD 2IPTL 4X8GA 2HUEA 4N2DA 1EUUA 3OKLA 4L0YA 3QNXA 2D8KA 3VFUB 3QC5X 2ZUTA 5IW6A 1PL3A 4AT6A 2OSXA 2WO3B 1SZNA 4KZCA 5ILTL 1YPZB 2WLYA 3PV7A 4P2QB 1HHIA 4NQXB 3SHSA 3WE6A 5DS8B 3HEIB 1TITA 3P0YH 3TWCH 2Z8VC 3WFDH 4MB4A 3RY5A 1R3KB 3EOTL 5E70A 5EUOF 4DGIL 5AAPA 3C6SB 3PWLA 3UAEA 2B39A 2FB4H 2VL5B 4WTQA 4BDVA 5IMMB 3SBRA 5C0DB 1JWSB 5C7XH 3NCYP 1JZFA 1LQSR 4GSDH 4FLRA 3GKWL 5FECB 4ZAKA 5DSCA 2NY1D 1KJVB 1ZANL 4FN0A 1EEZA 1U8IB 1A3RH 1D5IL 2GBUA 3LV3A 2NY0C 1FV1A 3EYFA 4PJBA 1RZJL 3TASA 3H7LA 4P46A 3SQOH 2JKSA 3IMSA 5I1CH 2F18A 1KN4H 5D6DA 5TGBA 3DPBA 1CGVA 2MTAA 3WFHA 3CDZB 3FUJA 5C0IB 5DI8B 3JV6B 4OZGA 3QS2A 2BP8B 4H1LA 3WNPA 1RHHA 5IHBA 1FFOA 1JRHI 1CFTB 4ONOA 3ETBF 5LNGA 2JF1A 4Y5VC 1XF4B 3HZKB 1ORQB 1U92B 4JY4A 3L3OA 5EOTB 4AZ8A 4NNYA 1S3KH 4FQJH 2BW4A 4HA1A 1ZHNA 4PGEA 3KLAB 2CRIA 4GKNA 4J12A 4GT0A 2PWHA 1IZJA 1RZKH 2AMUA 2WY3B 3RY4A 5BS0B 1B2WH 3M17A 3O81A 3ILQC 4OV5B 2ZP9A 1KDIA 4V1DB 5CBEA 3WY3A 3RWGB 3QQDB 3RWFB 4FI8A 4NGHH 2ZKYA 2X1PA 3WMPA 3HZMA 5E4EB 1M57B 4OZIF 1PG7W 4XNXL 2VDLL 1SFDA 3QIWC 4KKAC 3DYMA 3QCUH 4Q56A 3PGCB 5H37G 3U1SL 1T20B 2VJ0A 3MLXL 4FD0A 1SLVA 1JWUB 1KENH 3IDNB 4I0PC 1UJ3A 1WFJA 3CTTA 3MV9B 5CILH 1BG1A 2O6CA 4XP9L 4OBSA 3L4YA 4NRYB 1BFOB 3MR9A 4I1NB 4KGLA 4HCGA 5I9QC 2DYPA 3SKJL 3W9DA 2HLFD 5G5DB 3M6DA 2A1WL 5ICZB 1OCCB 1TZHB 1VHPA 3O6KH 1VERA 3DSNA 1BLIA 3UG3A 1KBVA 2ADFL 4JQXA 4WU5B 3HG5A 4WNJA 4AQAA 4EVNB 1FNEB 1ZEAH 3K0YA 1JHKH 1B6UA 3N6YA 2XUWA 4JM2D 3ESNA 4FNPA 3ZUNC 4MXQD 1UEYA 3Q0HA 4I0PD 1WBYA 4M8QB 2A7BA 4IDJL 4K94L 4X6CE 5LGJA 1F0LA 4JN1H 4DEWA 5I74C 3U4AA 1IIIA 4GG6A 1XGQB 1ND0B 4YPGB 4H40A 5EIIB 2CR6A 1DE4A 1Q72H 2NY3C 5LXGH 1FSKB 1OP9A 25C8H 1O9VA 2Z0UA 3DJ9A 5HDQL 5J8OA 1I7TB 1B0GB 2VC2B 4QHLB 4YAQB 2WB1A 2GCYA 3ATEA 3I9IA 4BFEA 3WHE1 1J5IA 1DSFL 4PRIA 4U1JA 5B1CA 3DO3A 2F1AA 4R5VA 2CALA 4U33A 2OP4H 1GGBL 1TSRA 2D7TH 2Q6WB 4XPAL 4EE2A 1CDGA 2KHAA 3VXUE 5HGHB 3VFPB 3EDDA 5KYXA 4HKJA 1BBJB 1MVUB 3IJ7A 4AGMA 2YXFA 2EDEA 5CD5C 1EHAA 3U1PA 4F8PA 3N40P 1BA9A 2BFVL 1CK0H 4IIQC 1FCGA 1UD5A 1NFIA 1IRAY 1KT2A 4X6FB 3PWJB 2F54B 2LABA 5DCCA 1SRDA 1IEAB 4OI9A 4P04A 4NQCD 4AUYA 3GSRA 1T1YA 4N6QA 4ZI8A 2GJJA 1KBGL 5FYJD 1WFNA 4NKQB 4JAMB 3IDIA 2F7QA 3PCYA 4GFTB 3ARGD 1EMTH 1ZHLA 2X2UA 2DQTL 1QSFB 2H6OA 3C8HA 4DKEH 3QRLA 1WZ1L 3GBML 2V5RA 3RY6A 6FABL 5IJDC 1NAKL 3JTTA 3GZKA 4BJLA 3KL0A 3EBIA 5F44A 2ZNXA 3ECUA 3LTVA 3VGHA 4KU1A 5K9QG 4Q58C 5A7BA 1RK0B 2MPAL 1A6AB 2VXTL 5IG7A 4LASH 3TVMC 2VLJB 1WISA 4FQIH 1S3RA 4KXZH 5T1MA 1KGWA 5HHVH 2QR0A 4GUPB 2B2XL 1SJHB 3EYVB 1C16A 3QIWA 5FW8A 3ZT7A 5I66A 2BDNL 5I6LA 2G5BA 4MMYB 4YH6A 5F8QC 5A2LH 2R1YA 2HT3D 3LKNA 3M07A 4PG9B 4A67A 3VWKB 5GS2H 4BFGA 5CR8A 2JKLA 4ZSOA 2EADA 2XVKA 3OR7B 3RI5K 5BS0E 4DW2L 1O6SA 4JRFA 2XV0A 5T5FL 1T6VN 4JRWA 4N8CH 4C83B 1R3IL 3T2NL 3K6SB 4PRNA 5DFTA 5TDPA 6CGTA 3RWCB 5GGUA 2UX7A 5DMGC 1EO7A 2FEEI 1J88A 4A39A 1G84A 1KXQE 2BIHA 4NS0A 3P77A 3CUPA 3ZW3A 2XQYG 3L1FA 4F24A 1BFVH 4JGMA 1AQDB 1LEGA 4MA1B 3IDGA 1J8HB 3GZPA 3TA3D 5KW9L 1UWGH 1GTFA 1P9MC 3CFEB 3QIUB 2IEPA 3OX8B 2VQ4A 4PLJD 3CZKA 3IN2A 2EZ0D 5IMOA 5F7DB 4D8PA 2EECA 4MZ3A 1OM3H 1AHWA 2QEJA 2EINB 3ROOA 1V3KA 4WUUD 3WNMA 4HK3J 5EWIH 4U6YA 4F3FB 2Y5QA 4RFNB 1JZ7A 1QRNB 1WBXB 4KJQD 2F7IA 5DD5H 5FFGA 4F8LA 5F6HI 1D9KC 1GGCL 2OJZL 4KGJA 1FZKA 3IRCA 3C60B 1A9BB 3EH2A 4WCYL 3LXCA 4XRCA 1USZA 3C60D 1DP0A 3Q5OA 3D52A 3ZN6A 3PP3K 2OXGB 4G1MB 4HH9A 1NICA 4EO5A 3GRGA 4ZS7L 2GJ6A 3VQ1C 4KO5A 4ADGA 1CLZL 4ZW3A 1L7TH 2CQVA 4DQOL 1UUNA 4GKOA 4RFOL 4ZUVB 1TETL 2PKDA 3QFDA 4U1KA 1N4XH 1WWAX 4MCYB 4G2AA 3LQAC 4ODBD 3QXAA 4RSYA 3PL6C 1OP4A 1KPUA 2AW2A 4MAYD 1PQZB 5CGTA 5IT2H 3RNKB 3TV8A 1C5BH 1W8NA 4GW4A 2ADIA 1UB5A 1JHTA 3O0RH 4HOWA 4D0CA 4Y9CA 3UZQA 2BOLA 2PWEA 3QW9A 5BJTA 3CK0L 4NZRL 2WVTA 4O58L 3MUHL 2MKWA 3B2VH 5T1JA 1MWAA 3ARZA 1W8EA 3U2SB 3M17B 2ZJSH 2K78A 1RULL 4AIXA 4YJZL 1J9QA 1RLWA 2CK2A 1S78D 3GWJA 5BW7C 4IRSB 3BLKA 4L48A 2WZPD 2FLBT 2NQ3A 1WZLA 3DBXB 1OP5H 4U6VL 2A4CA 3GMPA 3M7OA 1FN4A 4GRLC 4AENA 4ELDA 3IGLA 2E47A 1AJ7H 1ZJBA 1OP5K 3ZKXC 5IVZA 5IK3A 2DDQL 2OBGA 3QULB 1LEIB 1NEZA 2DPKA 4XCYA 1BEXA 2E0PA 5C09A 3UC2A 1M9SA 1P5UA 2W9DH 3N9GH 1T21B 2D31A 2IWFA 1OV8A 3DIFB 2KKQA 4PBWD 5DTFB 2R1WA 4F9LC 1MNUH 3EH5B 3WUWA 2Z31B 2MSPA 4Y5YB 1A6ZB 2PO6C 2WIIB 1XCTA 3K6NA 2AJUH 1OHZA 4L3FA 3SKUD 3RKDD 3WLBA 2VT0A 1WYJA 4V2BA 2HZHA 4LU5L 1R5WB 5ADOL 5D7LA 4ERSL 3O0LA 5KANG 5I6OA 1FP5A 1RJLA 5IF0A 1KIRA 1J8HE 4CU6A 5GJSL 5LAXB 4AKPA 1TDQA 3IAPA 4PVNA 4X6DB 2YWZA 1G7QB 1ESOA 2KDYA 1CXHA 5E9NA 3TP4A 5JNYA 2Z3FA 2P3YA 1CZ8H 3NEXA 4PH8A 1I8AA 2C3XA 2QSVA 4JHAL 4HKZB 5ESQB 1QFWM 3UBGA 3C6LA 4PJCE 1LQBC 4ZW7A 3FCSA 3DVIA 4ZXBD 1VZGA 2VKXA 3LKPB 4RFEA 1XSIA 5KJRH 2X4RA 3TCLA 3OXSA 3ARYA 1F3DJ 2WWNA 4ZO7A 1I7RB 1CICD 1S7SA 3WJJC 5HXMA 1MN4A 3B9KC 4NM4H 3EG9A 3IXTA 5F93C 2C3VA 4OJCA 1R5VA 3LEXB 5FM8A 2XTJB 3N1GC 4N2KA 2J8OA 2HKFH 5I17A 4NENB 3JZ7A 5A6LA 1XGUA 1YJDH 3F85A 2BW5A 4CU7A 2K6YA 3QO0A 4P23C 3D8MA 3EO9L 4W4NA 4YHPB 1SM3L 3KVDD 3DX9B 1ZLVH 3K72B 4M7JH 3E2HB 1HCVA 3AWFA 2CGYA 1BQHB 5DJ8A 3IDXH 1E8ZA 1NGWB 2DWDB 2KQMA 2YQ2A 4LVHC 3RE0A 4PJ5B 3TWYA 6PAZA 4UQAA 5MEPA 2JMRA 4KRPB 3O3UN 3B2PA 2VSDA 2R69A 3L5JA 2SODB 4OLXH 5E2JA 1KUMA 2X3BA 4ZFZA 3S35H 2N3JA 2A74C 3NN8A 2PCYA 4NOBA 1BCIA 1OGAA 2GEQA 1AHWC 4QXUL 1EEYA 1HILB 4N0UA 3UBXB 3U6XA 3AG1B 1EA9C 1YC8A 5SWSD 4U1GC 2D0FA 4OZ4A 5TF0A 4JPSA 4DGYL 1W0WB 1NANI 4PTTB 1JPST 1E9PB 4J4PC 2VR7A 2ZYSA 3QNYB 4PG9A 4YSOA 2R9HC 4B5EA 2HKHH 1JSYA 3BSZH 1JGUH 4LPUA 3VQ2C 4HIQA 1T1WA 5EUOA 2N0KA 3GMQA 1T83A 4HT1L 1AZCA 5EZOL 4ODVH 2E46A 4LPXA 5EO0A 4G9FA 3VU1A 1JRHH 1EJFA 3X1FA 1TYRA 3ZDZB 3D18A 1NFDB 5AOJA 1J1OL 1OCZB 3ARBA 1ORSB 3S36X 5JR1L 4DGIH 1RZFH 2EVHA 4NCDA 3V95A 3X3FH 1FJ1A 1CU4L 4EDWL 1BSIA 4H8VA 4BUGA 3ZTJH 3A6OA 3O3DA 2B4CL 4CUCA 3L1GA 4XNAA 1AXSB 1EJOH 1QACA 1Y6MR 1YEGH 2VDRB 4E42B 3NK3A 2EH8L 5J11B 3LNHA 5T33H 3U7WL 3BUDA 3PDDA 2XQBL 4QRRD 2AP2A 1N8ZA 2C4XA 1AI1L 4C4KT 1KELH 3D85B 3LZRA 5CINH 2B15A 3RP1A 4X4MA 2BNQA 3SE3C 1INEL 2Q8BH 4M1CD 4IOFC 4K7PL 3UPAA 4K71C 5CLTA 4A63A 5GJTH 4BM7A 4JFZL 3EDFA 5F3FA 4EZLA 1DVFA 4FQXB 4LO9A 4HKBB 1JK8A 2FQGA 1KN2H 5I2IB 5K69A 2WWMC 4U3SB 3FUHA 1B4TA 2B1HL 3TBWA 1S3KL 2ZP0T 2H0JA 3EOAA 4XXCC 4JPWH 1MF2H 2DIJA 1F97A 3H2QA 5C0FA 4C8XA 3CMOL 3MMEB 4L8SC 4YXLL 3PP4H 3K6IA 4KQ4H 4ZO8A 3KW7A 4YSEA 3TONA 2UZIL 2XA8L 4XNBA 4IOFD 5GZOC 3RNKA 3L3DA 1A4KA 1MCPH 2GUYA 4G6MH 3GBNL 4JM2A 4ICWA 1BW8A 2PXYA 3ZZSA 1T0MB 1YEIL 4ACPA 3PJSB 1CFSA 4HBCL 3KE0A 4OLUH 3FB6A 4XNMA 1AR1C 2UWEE 5HD8D 1BMWA 4FP8L 1D2PA 2YSSB 4PJEA 3QPXH 3EDEA 3QI9B 3MRBA 2MHAB 4JN2A 2FL5A 4PB0H 1HXKA 4H7VA 4FFWC 3ZK0A 3KS0J 2OL3A 4FFZH 2ATPA 4JHWL 4J3WA 1D5XA 4QR7A 3TO4A 1F58L 2R8SL 2X4QA 3JWNG 4XB3A 2D7PA 4WJ5B 2WKOF 5KTEH 2A1WH 3GBEA 4AW7A 1I3VA 3CHPA 1E6OL 1FFNB 1MQKL 4JR9L 4N24A 3IMRA 4KZDH 2XWBB 3MLPA 1XSKA 5E2WH 3V79C 3D07A 3MCKA 4I48A 3VXQA 4PS7A 3WO4B 2B7DT 2Y22A 3NK4A 4LBEA 4APXB 1RIHH 3V7MA 5AVZB 3O3EA 1BMGA 2AEPH 4X9GA 2Z7UA 4BE6A 3CX5J 4JNXA 3H7BA 1E2ZA 4GIAA 1IC5L 3JWDC 4FOMA 4G8GD 3BZFB 1GJIA 2ZONA 4YR6A 2YC1B 12E8H 4OCWH 5F8RC 3VGBA 3D0LB 5AVQB 1NBYB 5ALCH 4ZMPA 3L9EA 5LXGL 3FB7B 4UV4L 3JV4A 3B9EA 4AGNA 3H42H 3RBSA 5MEND 4JM4H 1OWRM 4KV5E 5EEZA 2IMMA 3TIDA 5DJYB 2GK0A 3HPLB 1CB4A 2J1WA 2HKAA 4TSAL 3TYGH 4KJYB 2NUPA 1G5GA 3RPBA 3FQ2A 4PI0A 4QD2E 1CN4A 4PJ8A 4XC3H 3WIAA 3QFGA 3TBCA 1JZEA 3Q5TA 2JB6B 2WBWB 3CHSA 2W88A 1SJMA 2X5PA 4ZMTA 4KVPA 2VM3A 2EVFA 2BSCA 4FFYL 2DF3A 4RRPM 5IB4B 3VD4A 4Z8FL 2WWKO 4ZZFA 5K33A 4HXBL 2Z93A 1E28B 4X8XA 1QG3A 2P8PB 5FOBA 1QHOA 3IDMB 2FWOA 1AIZA 3GI8L 3L48A 5DJ2A 3QQ4B 4JFED 4FULA 3S3DB 1BQUA 5IHZB 5KZCD 2Y69B 2NZIA 4NZJA 4OGZA 2XWCA 3U7YL 1AGCA 1H8NA 1M7DA 4LRNH 5BZWA 1RAMA 3O4OB 3STLA 1RSYA 5KYWB 4TYUA 3TA4D 3GM8A 3EOYG 2DWXA 4AIOA 4JZJC 3RRQA 3HMWH 3WTYA 1WPCA 4PD4J 4J1UB 1COBA 4L3EA 3EIFA 3BP4B 4OUUA 4XBPA 1WVZA 4IS6A 2DLHA 1TQSA 3CFJA 2I69A 1YY8B 1Z9OA 4Z23A 1HEZA 2R2HB 3F7YB 1SJEA 1I1AC 2WK2A 2B9BA 1EX0A 1WZAA 5FYJH 4N25A 5E0FA 3NZSA 3ZL4H 5AW1B 3D7PA 4ODXB 3HI6H 5HDBE 3GIVA 2DMHA 5KOVC 3V6OE 1WAAF 4CBPA 1R17A 1DYZA 1CD0A 1ZV2A 4GT7A 4F7CA 1P1ZA 3FFCB 3K46A 2LLGA 1T1ZA 1IBDA 2BOCA 3TBSA 3WI9A 4OLYL 4DW2H 1F3JA 1F1DA 3IAQA 4OI7A 4MWFB 4AX3A 1IM3A 3GMRA 3BKJL 2GABA 2WYIA 2X0WA 4E9XA 5J11C 4GLRH 2AJVH 2XY2A 3BJ91 5DEZA 2EE9A 3BQUD 2YN5A 3BE1H 4PY7B 5G5DA 2OYLA 2AJ3A 2Y2YA 3VTMA 4PRAB 4JO5A 4XI5D 3VUAA 3MNVB 5JW4R 1JZ2A 3LRSA 1HHHA 1RZKC 4B3VA 1AC0A 1MI5E 3ZQWA 4ATTA 3RX8A 1EVUA 4YHNA 3NSFA 2VMCA 1D6EA 1JN6A 5C0CB 3QO1B 1S5HA 2IH1A 4QNPE 3HC0B 3RJQB 3MRRB 5GHWH 2EP6A 4WEUD 3GSUA 3LHPH 1HQRB 3LY6A 4O2FB 4IKNA 3FRPG 1IC7H 4X4ME 2X44D 5F7FA 3UC0L 3P11L 3SDDD 1TLKA 5IZ7A 2EIZB 3BMWA 3P9MB 4TNWF 5IUCA 5DJXA 2HPTA 1Q9KA 2ESVD 2PCFA 4GQ9H 2RFXA 4K3JL 2GIMA 4H88H 1NCJA 4PI2A 1O9WA 2Y7OA 5DRWB 2X4PA 2PP8A 2WYZA 4F9LA 2RJMA 3Q2LA 3M7FB 3O6MH 2AQTA 3GD1C 4MZIA 4DOHE 4KUCD 1UWXK 4TTGA 4OW6A 1UZ8A 3MRKB 3EHBC 3BUBA 1F4WH 4PCYA 5I1HH 4JPQA 3MLZH 4EN3A 2AGJL 3C09B 1PVHA 3ARPA 3UX9B 3ZE2F 2BNQB 4E2OA 5JQ6H 4B0MB 4OCLC 4PRHE 4HAFA 1OB0A 4FG6D 4ZFOA 3P3UA 4OCRL 1FLRL 1NC4D 1Z0MA 2FX9H 5FAAA 1E2WA 4F9PC 3H4HA 3MOBL 1QEWB 3B2MA 3D39B 2E56A 3DROA 1KCWA 4XNUH 2HT3C 5IB5A 5JMOC 2X6CA 2OK0H 1XHHA 4P8QA 3V52H 3PDOA 3PS6A 5SWZE 1K5NA 3QP3A 5D72H 4BGLA 2PPEA 2ZKWA 1JPGB 3AMLA 1DFBH 5DR5L 4XN2A 1J1PL 4KZ0A 3H4FA 4WKZA 4QHPA 3MRQA 4LL9A 3GC3A 4PLNC 5CSBA 3NFPA 3ZDZF 2JKJA 4MXWH 4XHJD 4DAGL 2ZD0A 3HMXA 2DOCA 1J0HA 1GJUA 2CJUL 2CHZA 4P99A 3T6WA 4H5SA 1QP1A 4NSKA 2IPTH 3FQUB 3HAEB 3LDBB 2FO8A 2CM5A 4MCMA 5HHNA 3QNXB 5I82A 1MPAH 4CL7A 2BWQA 1C1EH 1YEKH 4PYHA 1XZ0A 5ICYA 1UADC 3VCLB 3ZZ1A 2VC2L 3MUY1 2ZCKH 5IFHL 2AC0A 3DX3A 1D2OA 4KX8A 1U8KA 4XCFH 3D4YA 4ENED 4PRDA 5D1ZD 2W38A 5F1SA 3DX4A 5TDPB 2JJVA 1QLFB 4C4UA 4F27A 5EOCL 5KSVA 3OD3A 4D7PA 3AGWA 2H6UA 1AR2A 2DN7A 1IKNC 5ACLA 4NJAL 3GK8H 1D5MB 3MRLA 2A2QT 3ARDD 3CIQA 1CF8L 3EJQA 3MV11 4HIEB 4HLZG 4M3HA 2AK4B 5DK0B 1NJ9B 2IQ9L 3KWUA 4AZ8B 2C7UA 1DQMH 1OY3B 3NJXA 1KTRL 5H35B 4B27A 15C8L 4M7KL 1A3RL 1D5IH 1MG3C 3ZKMD 3QORA 5IMOB 3IVKB 4YC2C 1XIWD 4JHAH 5DHYB 2IANA 3S4SB 2RALA 5F7EL 3T9WA 1OCRB 1UA7A 3P0VL 3QZLA 1S7XB 3PV6B 5B8CC 2ICWB 3AY4C 3NSXA 2RR3A 4L4VE 4IBQA 4F1SA 2YQBA 5JQHC 4MD0B 3A4FA 2V9TA 4CJ0A 3QYCA 4E9RA 4FYSA 4AE1A 3DOSB 1IL1A 4G6AD 4U1KB 4XMLH 5M95B 3PWNA 5A2FA 3DYPA 3CFIC 2YUWA 1I8MB 2BVOA 2HCZX 5EZJA 3SPVB 5B7MA 2LW3A 4JRYB 2A6KB 3MODL 1XGPB 3VVVA 1ACYL 2F74A 1KGJA 1D6VH 1F5WA 1N6VA 1X5JA 1YJDL 2D3NA 3O2VL 4M8UA 4JVPA 1F4YL 5INCA 3KPQB 2UVFA 4K8RD 4HIJA 3MNMA 3WN5B 4APQC 2KLRA 2ZOUA 4PRPE 3IDXL 3RPIA 2I32A 2ZQKA 4N1HB 2NY7H 4Y5VB 2HT2C 4NGHL 3VH8A 1AGFB 3A22A 1RUQL 2YMTA 2CK0L 4Q6IA 3FCUB 3MYJB 3IFOA 3MJ6A 4WO4B 3K74B 2HMID 2GG1A 1T7VA 2OMTB 3F7RA 4AVHA 2XTSA 4J2QA 1W15A 3F05A 5GS0L 4WO4D 4LSPL 4ODSL 2R29L 2LV4A 2R51A 3B2UC 5DD0H 2NX5D 4LCYA 4N2HA 1WIOA 4R0LB 2OPCA 4TS6A 4YLQT 4APQB 5BV7L 2ADGA 1X9UA 5D7IE 4WW1A 4HD9A 1N70A 1U8JB 5E8DH 4APQD 4MYWB 3EW3B 2IDQA 4TTDC 4WEEA 3RFZA 2GCYB 4OQTH 5D1QB 1YNKH 2AXJA 4LAJH 1PZBA 4JDTL 3ABKB 2VLRD 4Z0BL 3E6FA 4OSUH 2ZKHH 2OMUB 4FNUA 4IOSD 3U4KA 4NJ9H 1G7JA 2M26A 1V10A 4PJ9D 1JJUA 2AF2A 2EXTA 3MLYL 4X4XA 4H4NA 1NAMB 4IBTA 4M7ZB 3QXUA 1ZLUK 5B22A 3O4LD 1IC4H 2DM2A 2O4EA 2VZ1A 4Z77A 3MBEC 2YD2A 4P5KB 1CO1A 1KIPA 5FF6A 5LN4A 3JUYA 1URLA 4N0FA 5FO8A 2ETWA 2WHVA 3N40F 4LSUL 4BUHA 4DP8X 3HNTL 1OF0A 3ZYJA 1TUPA 2KI6A 2P8MA 3FB8A 2P5WD 5C0AB 4GBXD 4OBRA 2K1MA 5DS2A 5I24A 5DVMA 4E0RA 3Q8FA 5AUMA 4HUCA 2Q2LA 1JZ6A 3IDIB 2GK2A 1BD2B 5HJ3A 1DSFH 1MUJB 2PN5A 1NFAA 5AYTA 1RL1A 3NACL 2YBRA 1XXDC 2RAMA 3RGBA 4I3SL 1XCWA 3FSAA 1J9RA 2JELL 4DO5A 1JNHB 3GEWB 4KJWC 2J57A 4F7EB 3QZMA 4N2OA 3QNFA 5CINL 1Z3GH 3H6JA 1NOLA 5SX5H 2I5YL 3MLUH 5CCKL 5T1MB 1Q4NX 1PJWA 2F54A 3UTPD 3UTTB 5A1AA 3ROLB 3RU8H 3ENEA 5I6XC 3I6KA 4HJGA 4G82A 2UV3A 5BRZA 5E08L 4UTBL 2B5IB 4JFZH 1CTOA 1MY5A 1A14L 2C3VB 4J6IA 1VFBA 1O5DT 2C9SA 1ZE3H 2ZZUT 1XF4A 3HZKA 3CN2A 3IGAB 4JB9L 3VRIA 4CU8A 1OAZL 1QSFA 1UWEL 2W59A 3EZ8A 5L2JB 1G4RA 2O93L 2HB0A 2OMZA 4DERA 4HSCX 1WZ1H 3GBMH 2BVQA 2HN7B 3INUH 4LARH 4MMZA 1F02I 4CW1B 2XWJA 5D70L 4OJFL 3PP4L 3X3GH 4JJHA 2IBBA 1E5AA 3VSTA 1RMFH 1MXDA 3BWZA 1YEJL 4P2OD 3TCXA 2VR5A 1KF9B 4NQSB 3WIFB 4J3XA 4I87A 4HLEA 5C08B 5ITBL 1CR9H 2WO4A 3BP7B 2DQFA 4HGWB 4IRZA 1JZDC 4RAVA 4ZSOE 1WBZB 5C3LD 4GRWB 4KXCA 1DVYA 2XKNB 1A3ZA 3IJEB 3B9AA 3IRZA 4BQ9A 3QA3A 4BBWA 4RDQF 4OFQA 1IB5A 4PB0L 3UYRL 3BAJA 1U58A 4UYPA 4GH7B 4IRJB 1GIGL 2VH5L 3HUJA 4HFWA 4NWTL 4WK2B 2I85A 4UT9A 1UXSA 1XD1A 1YVLA 3VMNA 3L4XA 5IFJB 3EOBA 1RI8A 5I6NA 5IB3A 2BSEA 4KAQL 3GXDA 2LVEA 3S8FB 2OMVA 2UUDH 4JCMA 5AEAA 1TR7A 4FQQB 2J8UB 4IRJC 4QRTA 3T2QA 1UZ6E 2E59A 2FB4L 5FGBA 2PUQT 4QOKD 3ZMRA 2COVD 4QRRA 2ZWLT 5EBGA 5A16A 4GG6E 5FYLE 1DBBL 2NXZD 1RK1A 3CVIL 4XWGL 3WXWH 4ZMXA 2XOTA 1N5YH 2WMPA 4FA6A 1SDAB 4ZAKC 4EI5C 4P23B 4FQCH 5DQJA 4NNPL 3U4BL 4OCWL 1OM3L 1RZJH 1QLFA 2NY5C 5EOCJ 2LLNA 3FU6A 2H8PB 4NX0A 4RGOL 5JIMA 3DTXA 4X83A 1HSBA 2NTFB 2WXMA 2KDGA 1VENA 2GJPA 2A6JB 3NFSL 5D4QA 2NZ9C 1H8SA 4U1SB 4UQ2A 2OJZH 3QXDA 2DS4A 3TYGL 1MJ7L 1WEJL 3CQQA 3KM1A 2YD7A 3K6OA 4NKIL 4NN6C 2VW7A 2MOQA 4GSQA 2H26A 4XMWA 4AW4A 3SJVE 3HHMA 4E9TA 4X7TA 1GZQB 3ZE2E 3U4EB 1I3RA 5HGBA 1YUKB 3MV8E 1MI5A 4HQQH 1L7TL 2QPEB 5IQ9A 2UXFA 4RFOH 4DETA 2DQJL 1F18A 4DQOH 5SWZA 2E75C 4YGVB 4X6FA 1P84J 1T5XB 2Z7YA 2NY6C 2AABH 3CDFA 2VE6B 5JHDD 1LLAA 2WQSA 3LKOB 3C2AL 3QEUA 3ARXA 5E1QA 1KY6A 2PETA 9PCYA 1MJ8H 3ZDYF 5JHDB 3T6XA 4LRNL 1LE9A 3G5ZB 4MS8C 5I2IA 1FLTX 3O0RL 4ZXBB 2BP0A 1HX0A 1CT8A 2X6BA 3ARFD 3BWUF 2V9QA 2EEXA 1JERA 1Z3RA 3W2DL 4KDWA 4G5AA 1W72A 4OUOA 2NMSA 3EYOA 1XIWA 1BZOA 3QORD 4Y9BA 3SD5A 2O26U 1KENL 1V3JA 4FLOA 3SKNB 3HZYA 4AV0A 5CILL 3F7VA 5J56B 2R0KH 5KVFE 3K71A 1Z5LB 2C7FA 2D9CA 2J73A 2OSLA 1ILSA 1J10A 1TNMA 4OZHB 2P52A 2WLLA 5SV4A 5LDUA 1PKQA 2O6EA 4XPTH 1PDKA 2R7EA 4DKFL 5JUEH 3C5SA 3QUXC 3HI6L 3FXIC 1MCOL 2FBRA 3F7LA 1EAJA 4W4OA 3AY4A 3OJ2C 1T4KA 4GKSA 4O02A 1Q1PA 1TYJA 4S1RH 1U8IA 1UQSA 5PAZA 1X9QA 2X87A 1SN0A 3A0OA 1OTSC 3LKPA 4PJIF 5HDBF 9CGTA 5TE6L 4R96B 2WBJC 1OT2A 2AQRA 3WFCH 2WTRA 5H94B 3S3BB 4QTIL 3SOBH 1JF1B 4LCWE 4OFYD 4OY9A 5GGRB 3KGSA 4PWIA 1WH0A 2XTLA 3FB5B 5TTRA 5KBDA 3C5ZD 2NTSP 1ITBB 5CN3A 5F3HB 2ZCHL 4XPAH 4QXVA 3GHEH 2EYTA 1MFEH 2FEEL 3FO2A 3TXAA 2L8AA 3LHPL 3QO0B 4PJCF 1KC5L 3W81A 4AEEA 1T0OA 2P8MB 3FB8B 1T04A 2IWGA 3KVQA 4M5ZH 4PLOB 4QTHA 3DETC 4L29B 3V6FA 2I07A 1IGFL 3MJ9A 3TIDB 1GVIA 1J86A 3HOGA 3P9LB 4FTVD 4IU3A 2EIEA 3FU7A 4W9IC 4DPRA 4BH8A 2EDKA 5LO7A 3H9SB 5ISZD 5H37A 4RQQA 2XN9E 3FUDA 3O6ML 3WNJA 4Y2DA 2I9TA 5EU7C 3WIHA 1EZUA 1REIA 3GYRA 4DZBA 2X4TB 1T20A 1R3LA 4KJPD 1U8QB 1RPQA 2YFNA 4G7YH 5I1AB 3TN0B 2DM3A 1L3NA 4R7XA 4AV4A 3OKDB 4JFOB 1BIIA 4X5XA 1IAOB 2P8PA 2QMJA 3PGDA 1O75A 3CN0A 5MHSE 1FZMB 3ORJA 1H6TA 2K9UA 3GPEA 1I3UA 1ZRUA 3EUDA 1A9EB 4BHUI 1CD9B 4V1DA 5CBEB 3ET9F 5F9OH 1P7QD 2QVTA 2JXMA 3GSWB 4GO6B 2J3SA 2PYFB 4ZFOL 1KTDB 5DC9B 4ODHL 4B41A 5CGMA 4UIKH 4XXWA 3ZU8A 3HS0C 4YL4A 5BXFA 4ELKA 5D6CA 3QEQD 1BD2E 2VDOB 4KOCA 5D2LE 3SYOA 4WWKD 3KPSA 1FG2B 3QDJA 3EJSA 4YZFE 2HRPL 3GMLA 3UZEA 1ECYA 3IF1B 4WWKB 3V4VA 3U0WH 3F00A 4S1DC 4R7DB 1G6VK 1LGVA 1YEFL 3NPZB 5E4OA 2LAGB 1YPZF 2VLKE 4PTTA 4I2XE 1CGWA 4LCCA 4LSSL 4NPYA 1EZSA 4Q9QL 4LGPB 1VGEL 5DZNA 4XPBL 1ZHBA 2BNRD 3QZOA 1KLGA 4Y8AA 1YEKL 1F1GA 3LD8C 1E3ZA 3C5JB 1CDBA 3MJ8B 1CQYA 4CN4A 1E4KC 4GXFA 5C0CE 2GTZA 5KSAB 3QUYB 2C1PA 1AGBB 4DQAA 2VLME 1RCYA 5KSAD 5ENWB 2WIIA 4PLKD 3BZ4A 5EV7A 4KZEL 5C0GA 4P2RA 3LIZA 2GPZA 3EFFB 1NC2D 3S36H 3OZ9L 3VDBA 1JGVL 1MLBA 1T7XA 3LNIA 4XP6L 4M43L 3QWOB 4DPBX 5C6WH 1SXAA 3EF7A 4FYTA 5TQ0H 1P0SE 3T4YA 1EJOL 5TFSL 1OD7A 4YBLB 5AVWB 3HC0A 1JUFB 4PP1D 1P2CA 3DX8A 3HKZA 5B39B 2ALWA 3LZLA 4X99B 2ZUVA 4LCUB 1GC1L 3LV3B 1W8OA 1VFOA 3FTGB 1KELL 4W9EC 4H25A 4PJAA 2GTQA 3OHMB 1GGUA 1IGYA 1HT6A 3CHOA 2CLVB 1RFDL 1RVFH 4U4IA 4FC3E 3GLZA 3RX7A 1SHXA 4JM0A 4I13B 4FTVE 4AEIH 5GJTL 2WLIB 3WG7B 4ZODA 5ABAA 4OT1H 5DJ6A 1FO0L 2QGCA 1IAIL 2X42A 1QKZH 1T1XA 1D3CA 4PJ9A 3K8MA 3B2DC 3L3OB 4CNIA 4IW4C 5DHXB 2I9LA 4JY6A 1FYTB 3TT1L 3ZDXE 2PYEE 3KYKL 1Q9WB 1SDDA 5IVNA 3IDUA 2WZ5A 4U1GB 2W0LA 1UVQA 2F9BT 4IYKA 2P43B 2RCSH 3L7FB 2UZIH 2A6IA 4RH4A 5FYLH 4V2CB 2VLJA 2VQ1A 3WFHB 5CLWA 3VWJB 1NDMA 2BSDA 4OV5A 2CLRA 4U3CA 4QO1A 4X9BA 3VWJD 3NG5A 1TZGH 4G7QB 4HBCH 3G6JB 2KLTA 5EOQL 3BVTA 3RIAK 3Q9PA 3D5OF 1PEWA 4XVOA 2OULB 1IGMH 1M2VA 4ZUUA 3O9WA 2G5UA 1FH5L 3PGCA 4UIMB 5D1ZC 4JN2B 4NQCA 2Q8AH 3S4SG 4N85A 5AKSA 3T0BA 3MTXA 4TUOB 1QBBA 4WFFD 4ZS6C 2WNGA 2MNWA 4DN3L 2WQXA 4MSWA 2H1PL 3SE3A 3LPPA 3TM6A 5IROC 4DFIA 5TK2A 4HSQA 4KKBD 3FQUA 3HAEA 3FT3B 4NJ9L 2EJ1A 1MHHB 2CXGA 5IB1A 3MBXL 4HOZA 3TO4C 1JVOA 2E3VA 2F2HA 5E4IA 1KB3A 1RKRA 1IGCL 2ZUYA 2NDFA 3TH4T 5J6GB 1E4WH 1QSFD 5EEWA 4UZSA 5TF1H 1N0XL 2HG5A 2L04A 4JKKA 3N85H 1IC5H 2XN9A 4R26L 4F37F 3QISA 1NC4B 4JZOB 3NEEA 1THAA 1M53A 2BC4A 3MLWL 1O7DC 4JZNB 1K5WA 1N0LB 3UJIL 4FG4A 3H3PL 4HXAL 5IUSA 5MEQA 3S8GB 1KZYA 5IBLC 2XVLA 1NAMH 1PD0A 2R56L 2DTML 4TSAH 4YHYB 1MIEL 2VUYA 4WW2F 1BJMA 3QEHB 1T0PB 3LXBA 1KBBA 1EAOA 5I8EB 1NEPA 2A73A 2EEBA 2GFBB 1JF6A 4HWBH 4CGUB 4ORGB 2DB8A 4PS8A 4J1UA 5SX4I 4MKMA 4QCIA 4R3SB 3GBLA 4LHUB 4PV8A 2C9RA 5CAYB 3T0WA 3O6LH 4YXHH 4HXBH 1JWMA 4MXVE 1YN6A 3SJVD 3ZDYE 5JOEA 2VRAA 4MQXD 1B0GA 4QHLA 4YAQA 2AMGA 3E6HB 4Z7NB 4M7JL 4TUKH 3DDGA 4ZDHA 2SEBB 4DP1X 2CHDA 3T77A 4U1JB 1JGIA 4YDNA 1I7UB 3PFQA 2A74A 1FZJA 1UENA 3QJHA 3QR2A 5CWSB 4JB9H 4RWYH 4IIZA 2WXGA 3V4PB 3RURA 1PFOA 5I1AA 1RH8A 2GHZA 3MNWA 6PCYA 4YLBA 4TQ8A 2DLEA 5CIPA 4LARL 4HUVB 3BH9B 5FXCH 1PS3A 3EZJB 3WMQA 4GG6B 2N7SA 1CGTA 3L9RA 3QG6A 4Z7VF 3LEVL 2IFFL 4J3OH 1NMCC 4WTZG 3CFDA 4HC1A 4QXUH 1YEJH 4MA3B 1A7BA 2YGVA 3DURB 4OF0A 5GGSY 4PRAA 4F5CA 3U6RB 1A6AA 3W39A 4B97A 5B8CB 2BK8A 4F8OA 2GUOA 3VA6A 5HPMA 3MRGB 2E5EA 3QRGH 2AJSH 2G5RA 2QR0B 4GUPA 4ZX4A 1IM9D 1T22A 3KXFE 3CCHB 4HF5H 2YKKA 3EDKA 3U48A 4F20A 4HG4K 1MREH 4PP2A 5DQ9B 1P1ZB 3FFCA 1TFHA 3BSZL 4YHOL 1HCZA 3U9UA 4LCWA 2AQ1A 2NW2A 1INQA 3OR7A 1R33A 1U4FA 3GMRB 3PL6B 2G9HB 1AQHA 2PTVA 5D2NA 3DHJA 3FCTB 5GRZA 3KPMB 1HDMA 4P2RE 2PABA 1MG2C 1KT2B 3ABMB 3NESA 1B3JA 4NDMB 5DF0A 2OR9H 1JYVA 2GQHA 1WS7A 3VI3B 4HIXL 1G7JB 5E4AA 1WDAA 4WUUB 5HVHB 2FX7L 3S96B 3ZZQA 1HH6B 1MCIA 2IH3A 4CVZA 3BD3A 3C60C 2YGQA 2F53A 1E90A 1FFRA 5E94B 2IAMC 2XZQH 1OARH 4QHMA 4I2XA 4HZLA 3KPSD 4X4YB 3EYQC 2K3TA 4HALA 4OJDH 3AT0A 1T7WA 1S5IL 2QSQA 3BAIA 3B6SA 4I18A 4KV5F 5F6IB 1YEHL 3FUFA 3HKFA 4LP5A 4F3FA 2RFXB 2Y1ZA 1KPVA 3RIFK 2E6PA 3TF4A 4BZ2A 3UJTL 2QVKA 4K7PH 2PO6A 3OF6A 3S5LA 1XH1A 3GS7A 3KYNA 2BP8A 1JDDA 1UWYA 5KUMA 4GG8B 2M8XA 4DZ8A 3AFLA 3OX8A 4JQVA 2AKRB 2ED8A 5T3XD 4FA7B 3DSFL 4GY4A 3MRQB 2CD0A 4JPWL 5GRVL 4NIYE 1FNAA 2NY5H 3X11A 1XIWC 4LVOB 5DUBB 1T6WA 3PXJA 1R0AH 1Z9SA 2O6DA 3MC0A 4HU8A 4Z7IA 2BH0A 1CICB 3FU8A 5AW7B 4NRYA 1W91A 2HX9A 3ZGHA 2PNDA 4AJWA 3RFRA 2O5XL 1MJ8L 4XP5L 3OTTA 1JNNH 1INDL 3WFBL 1HZKA 2YPLE 1QLEB 1A9BA 3TBVA 1OGSA 1AGCB 1M7DB 2B2XH 3V6ZB 2P5WE 4ATWA 2EDMA 4KMTL 3ZVVA 3N5AA 2BDNH 4UM8B 5HTSA 5E9DD 2V2TB 1FPTH 5D1ZI 5HYJB 4ENZA 4FQ2H 1J8KA 5A3IC 5ESAB 4O51B 2ZXBA 5E8NA 3VW3H 1RD6A 1AHWB 3CC5B 3V0JA 3QFDB 1O0VA 4HIHB 2ED7A 4TQEH 2Q3ZA 1YY8A 2JI1A 2XI9A 4IU2A 2CHNA 3GTVA 3KPTA 1L9RA 3IKKA 1EZVX 4A7QA 3F65A 1HTYA 2TAAA 3OKOA 4R97B 1WIPA 5D1QE 4AVKA 1FI8C 2MIZA 2DEWX 3X1NA 2CPCA 3RL2B 1YMMA 1F45A 4FNRA 4XRCB 3VD7A 3GJFH 4KTGA 4RIRA 4LNVA 1RIHL 2EDXA 1ETA1 4FABL 1KJ2B 1MEXL 3BQUA 4TLUA 2XTJD 2GJRA 5CSZB 3V0GA 3VFOA 3ULVC 5KBPA 1IM9A 3COOA 3SDAD 2ICWA 3FO9B 3CSPA 4BZ2H 4P07A 3UP1A 12E8L 2NT0A 2DKSA 2WSDA 1NKGA 3DVFA 2BS71 2VN3A 4MCYA 1LP9A 2YAQA 1QFWL 4JFYB 4I1RA 4G8FA 3GMOA 4L4VA 4P57B 5CJQL 4GW5B 2ZOLB 5KG9B 1AIFB 3L81A 3FRUB 1GGCH 5A2BA 2VZ3A 2JIXB 5DK0A 1H9DA 5E95B 3MX0A 2F8OA 2PCXA 1AS8A 3VD0A 3DARA 4QY8B 1HSAB 1Q0YH 3QDMA 4PRID 4FDWA 2J5LC 4OR1A 4AM0A 3VFNB 1DVQA 3Q9QA 3SDXE 3ZDWA 2IOIA 5GSRB 3VFGL 5F2FA 2CKBL 4IMLA 4PUBH 5LBSA 3UTQA 4JKNA 2WVSA 4QYOA 3S34L 5DFAA 2KL6A 2YA0A 5JIKA 2LT9A 3ELAT 2WN3A 3DWTA 3LKRA 3LEYH 3D05A 4H8WH 5DEJA 1M7UA 5HI5C 2FUQA 5EZIH 3DLQR 3NIGF 3RNQA 3KHOA 3GB7A 5I0YA 5LUMA 1AQMA 2FJHB 4K9EL 3WENA 1GZQA 1F90L 3MRDB 4N90D 2X70A 2DWYA 1T21A 1GL4B 4A6YH 2PR4L 3T0AA 3RVTC 4Z7QB 3QYMA 2B5IC 4LLAA 3QHTC 4FXGC 1UGKA 3FFCE 3OC8A 2KQNA 2FJGA 1KXQA 3MACH 1TVBA 3RQ3A 5EF2A 3PXLA 4OD1L 2QLVB 3NDYE 3C6EA 1AMXA 4NQVA 1IM3D 3OXSB 1A4AA 2P5PA 3SBWC 1E0OB 4PWFA 2YAOA 3VH8B 2NYYC 2V8LA 1LE9B 3FONA 4R2GD 1CFMA 1J48A 2WJ7A 1NIAA 3DYOA 3GUFA 1HESA 4LOUC 5IB5B 3TFKD 3SCMB 3L3HB 3P2BA 4D3CL 3UTTD 3RWIB 5I16A 4B9ZA 1GAFL 2BOBA 3H7BB 5GS0H 1KB5A 2BP5M 3KBHE 4KNQA 4XAWL 5CLZA 3AITA 5ISZA 3BDBA 4OI8A 3TF7C 3WHXB 2ATKA 4X5PA 3TJHC 4TM9A 3QQXA 2BSRA 1NIFA 1B0WA 4WZ9A 2AJVL 1YECL 2P5WA 2R69L 4HJJH 1AD0A 4ZW6A 1DQLH 3QIBA 4PJ5E 3CZFA 5F9WB 5GRVK 3NMEA 5HDRA 1ZGLB 1JMZA 4ZMZA 4OV6F 1MLCB 5BVPH 3QDMD 5J13C 4ERSH 1ILUA 3LEXA 1PLCA 1FVCB 2NW2B 1TQCB 1V54B 1RERA 3CSYB 3L5HA 2I26N 3H9SD 5T1DL 3UAJD 2EDDA 3DMMC 4ELMB 4U7KA 4EQ2A 4AL8C 2VITA 1WWWX 1MWOA 3OKKA 3T0EC 1HXYA 7FABH 3PRZA 1Z9PA 3DVNB 4LSUH 1E9QA 3UC0H 4PV9A 4HUXA 4RSVA 5FV2A 5B1JA 4DVRL 1QUNA 1HFUA 3PDGA 4PVBA 3SDYH 1KPUB 1W16A 5BOZG 2B8OT 3MRLB 4H88L 4IRJD 2D4FA 1XZWA 4BWWA 4LVNC 4LESA 4WQOA 4HUWA 3ARGB 4M4RA 4PRHD 1JYWA 2IANE 2WO2B 1G7HA 4JFDB 3UAJC 1D9KB 1Y0LB 2CGRL 2MQ0A 4KOBA 1VKXB 3FH7A 2Y6SD 1K3ZA 1AGEB 4JFQB 4FRWA 2BY3A 3VACA 2NR6C 2OXGA 2QV2A 4G1MA 4HH9B 3QFJD 5IVXF 1S9WA 1H5BB 5DO2C 3W0WA 5JW4N 2GTWA 2EE3A 2PYEA 3DHUA 4P2OA 1U8MB 3ETTA 3K91A 2WANA 2JCWA 4HMEA 2FWOB 3BN9C 4WHDA 3BI9X 3P2DA 3QXAB 1DVFD 2WXHA 2IGFH 4Q8BA 1SDYA 5E99H 4R4BA 5TH2A 4PAZA 3MRPA 1OPGL 2GB2A 1FO0H 4CILA 3AY2A 5HYFA 1PF3A 4XCYB 3RIFF 2MCMA 4G3YL 1ES0B 4UT6H 2FHFA 4Z7VE 2D0HA 5DVOA 2XZAL 1WBYB 4M8QA 4MXQC 4GS7B 1BP3B 2WXFA 4JVWA 4W9JC 5LGJB 1SUHA 4J8QA 4R90L 2YZ8A 3PU7A 5D93C 1XB6A 4EDXB 4N9GA 5C0RH 3ULVE 2BVPA 5AG8A 3WAJA 1L7IH 3Q01A 3JZYA 1HAWA 3PPEA 1ICTA 4A2EA 3QWRD 4E9LA 5H37H 1DDTA 3TJEH 3G3LA 1QW8A 3VWKC 2PWGA 2X9WA 4NO0A 4JFFA 3UAAA 2XA3A 3C9NA 4X6EB 1U8PA 2ICEB 1UCBH 1JWSA 1LWRA 3EXJA 3RYMA 1MAJA 2DQ6A 1W9XA 3GIVB 5EHFA 2X4UB 2XN0A 4XPHH 1AE6H 2ZAGA 4IKLA 4AL8L 2B9AA 1AKJD 1J87A 2CNYA 3G9VA 4UQIM 4OB5L 3HRZB 3N0AA 5H4YA 5KBMA 4NZ8A 4GW1A 4LEBA 4WFHD 2F5AH 4RBPK 4UAOB 3U7AA 2Y7QA 1I8KA 3VJ6A 5HJDA 3S3CB 2UWEB 1Q38A 1XMWA 4E5XG 1CLYL 4NM8L 1Z9NA 3GS0A 1R5WA 1TCRB 4N2AA 2XDHA 4YHZL 3T6QC 3LN9A 3OSVA 3B9DA 1TJIH 3BPNB 3QJXA 4NQUA 5CHNB 2NDGA 4GAJL 3ULUL 5DQJB 2TRHA 5FF6B 1KIQA 3QCTL 4PBXA 3HC3L 3T0XA 2ODIA 4FXGA 4BQCA 5D5ME 4X5WA 1E65A 2AXGB 1JZJA 3VB8A 2VE6A 2JJSC 4W1TA 2J8HA 4DFHA 3GMOB 4L4VB 1J1XL 1L9TA 1E67A 1F4XH 3TEYA 2D73A 1UOKA 4O9HH 4GYBA 5DJ8B 1TQBB 3N1MC 1T0MA 4XMLL 5EIQA 3CDZA 5EORL 2P42B 1GZPB 4KK5D 2NY2C 3HS0B 4TOYL 5DSCB 3WFZA 4WGKA 4J3OC 4GUQA 3PUCA 2K6ZA 3FFCD 4XN1A 2HTKC 2QQLL 4QAWA 4UANA 4YDIH 2BWIA 4GPVA 4YXHL 3CXDL 3LCYA 4EI0A 4YXLH 4KBPA 3MROA 2CLVA 3RHWK 2AABL 4BKSC 2VDOL 2WXOA 1CFVH 4GG6F 1IGJA 1FZKB 2YPVL 4OFDA 3VD5A 3LKQB 2FATH 5MENE 1LDPH 1ZA6A 2F19H 3PHOB 1RUQH 4RWYL 1SXZA 4OZFB 4J27A 4P5SA 1FL6B 1A7NH 4PJXE 4CNIB 3WCYA 3LN5A 3Q6GL 4IOSA 1QR1A 1TEFA 3RG1C 1IC1A 1HHKB 1DLHA 3HZYB 4L5FH 5KVEH 4GP4B 1GMEA 4U4BA 2PR9A 3JSSA 3PHQB 3GUTA 3NFPB 3D39D 3SODB 4FFZL 2R8SH 5TDOA 5DGQA 3AB0B 4XI5C 1JXDA 3B1TA 2VXQL 2GSIA 4QHNB 3VI4A 3BKML 3QUMH 3ZE0B 1PSKH 4D0CB 3IJEA 1MREL 3MLYH 3ZKND 5J57B 4IJ3B 4X5RA 5J12C 4M6MH 1XX9C 1V7NH 4AUUA 3FQYA 2XTJE 3JTSA 4PJIA 5EUOE 2NNFA 1FNSH 2E27L 2UZXA 4RLDA 2VW4A 4ZOEA 4KKZA 3V0AC 4YUEH 3HNTH 4I3RL 1HNGA 1XL4A 2P48B 3LXAA 5KWYC 2DBLH 4TULH 5I23A 4JBSA 2D2CC 2UWEF 4HW6A 4WI8A 4F7TA 4HCRA 5DMKA 1I1AA 2JE8A 4L3AA 5EBWA 5FDWA 1QPPA 2VDQH 4UDTB 3DBSA 2OMBA 3NACH 3IE4A 2ADJA 3OGCA 1BVZA 1I82A 2HTLC 2G3ZA 1G43A 1VB9A 4HEPA 4MA8L 5T1KB 3REWA 4K55A 1T03H 4YDKH 5D9SA 5DHYA 1KC5H 1JXJA 1KV7A 2D0GA 2XETA 4Z7WF 3LN4A 3FW6A 1NSNH 4URKA 1S5IH 2I5YH 3MLUL 5CCKH 1T89C 2W94A 5E8EB 1R46A 5K5YA 5JW5B 2VN5A 2QADC 3MLSL 4Y5VA 1HJBC 2AQ2A 1UD8A 1AG6A 2XFGB 2P7TB 4GRLD 4M56A 4YHNB 3G5VB 3CH8A 2V3FA 1N5AB 3DSFH 2CO2A 3G6JF 1PG7X 3TEWA 2UZYB 1S9XA 1CFNB 4EXPX 3WMSA 2VJXA 1WTGT 3IU3A 4YDJA 4R0LA 3GFUA 1PY9A 2MHAA 3TTSA 5D55A 1E3FA 3MJ9L 2Y36L 1MAML 4NZTH 5I9QB 1KXVC 1R24A 3JTTB 2KS0A 4QHUB 5DHVH 1MHCB 3P9MA 2VXUL 1T2JA 1UWFA 2WLZA 4QWWD 1M42A 3SYPA 3Q43A 3EF4A 4UTCA 3CZEA 5EO1A 4RRPG 3IFNH 2UXVA 5F9JB 4LT7A 4NPYB 4YHYC 4L18A 4XP5H 2LLLA 5GZOA 4X6DE 3OMZA 1M05A 1S7SB 2DQGL 2VDNB 5BW7A 3II3A 4OD3L 5L7XL 2XT1B 4S11A 4HS6A 3ZPDA 3LKNB 1R1CA 1OOAA 3I3BA 3VFSA 1D6EB 2RB8A 1QFWI 4ZMVA 4ELKB 1EEZB 4WFHE 3S7GA 4JO1L 5DWUL 2OSWA 2R59A 4LCIH 3FSVA 3RI5F 2TRYA 1WGVA 4PR5B 1Q0XL 1J0YA 1RK0A 1A0QH 1U8JA 2CLZB 1BF2A 1FVEB 1X7QB 3LRHA 3MRNB 4K5NA 3RWHA 3SDDA 5L8JB 1FYTD 5IG7B 4BH7B 4DGWC 2W65A 3D50A 4HD5A 4AI7A 5DZJA 5AB0A 4WJ5A 3MA9L 3L5WB 4H20H 4MB1A 2IF7A 5DUMH 3LJ3A 2DRUA 2OL3H 1FE8H 3NCJL 4DTGL 3GJEB 2QPFA 3GIZH 3HG4A 4CN6A 2J5LB 5I1EL 1JUFA 1IC0A 2QADB 5C07B 3KLHC 3ASNB 3FQ1A 1CL7L 3HRZA 3QUKB 4L8DB 1RZIA 1LD9B 4U1LB 4S2SA 2OX5B 2VOTA 2J4WH 4KZEH 4HK0B 1A1NB 4NDMA 3VE0A 2HFFB 3F3HA 1QFWH 4Z7UE 2VZTA 3P11H 2VO5A 4R96A 5F96L 5IIEA 2KPNA 3BGAA 3ARDA 3V9CA 5ID1B 2WOBA 3P30H 3QWOA 2CDFA 5EU3B 5GGVH 5E24E 4FQXD 1BD2A 1EERB 2W81C 5IOKA 1TMCB 2ZXCA 4XO8A 3KLHD 1LO4H 1S8DB 4FG2A 5L6YH 2EDWA 2A0LC 5HDWA 1MCWW 5DRNA 4JY5H 1MZZA 5LLIC 2ERJB 3CFUA 4FCAA 4Y4KA 4Y19B 2GSGA 3SO3C 2ITDB 3VSQA 3BT2L 1QSEB 1TVHB 5MERB 4YPGA 1IGTB 3LS5L 4PWGA 2AGJH 4WSKA 1FBIH 5GRWA 4NKOB 1WBXA 4J28A 5LQBH 4P5MA 1AO7E 1G9MH 1ZMYA 2FH6A 2PLTA 2VMJA 1E9PA 2XXFA 2J1ZA 1C5CH 1S7QB 3BSHA 1UHVA 2MQGA 3OBAA 3PL6D 3MOBH 4K3HA 4W93A 2H32B 3NZ8B 4OT1L 5EFIA 3TBYB 1D5BA 1U3HB 1ZS2A 3WJMA 1OO2A 2FD6H 5MI0C 2OK0L 4A6YL 3D3VD 3E80A 4GBXA 5L4MA 3IMVA 3ML8A 2W0KA 4QYAA 2OCJA 3EYSL 3M1BB 3O9WD 1IEHA 5EU4B 1U58B 1WHOA 2OFQA 4L3EB 4A55A 3C8KB 3CVHH 1IJNA 1P53A 4H8WC 5FW6A 4AXWA 4KI5C 3AU1A 1IKOP 1XCTB 3MBEB 5AAWC 2H2PC 3WKMH 4DESA 4MXWL 5IHHA 3H9SE 4PRPB 1A5FH 2KC0A 1HH9B 1E5CA 5EN3A 1FF5A 4XOEA 5AVUB 2DQFB 3QJZA 2Z6FA 35C8L 1AGFA 1TZGL 5LWYL 3B9KB 3ILPA 4ANWA 3I74A 3G5YA 2HSIA 4S1QL 4UTAA 2AEWA 3IAGC 1V8HA 5H35A 5IW6B 1HHKA 5AZUA 2BHZA 1JPSH 4JRXE 4G8GB 5K9KB 1XDTT 1IV8A 1ZVHA 3KPQA 3VFPA 1R19A 3L95B 4WWOA 1G9NH 2HXAA 3DV4A 1BGXH 5MENB 1O9ZA 4HJJL 3O4LB 2H1PH 5IFJA 1N7MH 1RZ8B 3CSTA 1QQDB 1YMMD 1FN4B 4UQBA 1FL5A 3ZQ9A 3VM5A 1X7TA 3PF2A 5E6YA 4GQPH 5F1NB 1NEZG 4OM1H 1I9RL 1UH2A 3MBXH 2YKLL 4YSPA 5GXBB 1MRCL 1TOXA 1E40A 3QS3A 3T04D 5E1IA 4F9PA 1IGCH 2VSMB 1H8OA 2ZX8A 5D5MF 2NXZC 4PJDB 4UOQA 3MRBB 2Y3AA 2VR3A 1O6SB 2EUZA 5IQ9B 3TURA 4P2QA 1U91B 3PHAA 3MAWA 4MB5A 5F7EH 4H1LH 2B08A 1AACA 3P0VH 4XMUA 4DEPC 5HHXH 1DLFL 4Z7UB 5A2KH 2RTTA 4LFHG 5JZ7C 3VH8G 2QVIA 1IGFH 1NLDH 3STZA 5HYJD 1KEGH 2B3IA 1PZ5B 3QWRA 2B4CC 4DKTA 3K8KA 5C07E 1SJHA 3L3JB 1TTFA 3TZVA 1B9KA 3BUYB 5FA3B 3ZIMA 4UBDD 4Z1PA 1UA6L 1RUKH 2NPLX 1MHPL 3CFQA 4O2EA 3W56A 5HD8C 2AQPA 4EMZA 4WNQA 4PGEB 4XMKL 3WTSA 5C86A 3HNVH 4QYOB 2FL5B 5E51A 2YR3A 1I8IB 1NCNA 3D2UD 3GSOA 2Z34A 5FO7A 1PGRB 3TLRA 4F37K 4PSRA 2MWCA 2XWZA 4NI6A 5LBVA 2NY6D 3NSCA 3QQDA 3C5SB 3JWOC 5C0IA 3LHAA 2Z31C 2IV8A 5LNEA 4FLSA 3QJHB 4RNRA 5FM4A 5AZEL 3TPUA 4MMXB 1UJ3C 4EUPG 2CK0H 5DJ6B 2NCEA 1Q90A 5AKVA 3V5KA 4ODHH 1QPKA 1JPGA 4XVJH 4RGNB 3QQ9C 4TNFA 1KIPB 1LYQA 2VDRH 4P23D 1P69B 3SE8H 1MH5A 4WI0A 1IT9H 4MDIB 2JIXD 3ROLA 4D9LH 3D18B 4O2CB 1UASA 5K39B 4AYSA 2CRYA 2J25A 3FS9A 1SPDA 1WUZA 2YMOA 4LPCA 4XPFH 3LIUA 3IMBA 4JL2A 8PAZA 4A6YA 1T3FA 2OW7A 4OCSL 5FGBC 5J89A 3RZCD 1JDAA 2GBAA 5LJYH 2V8MA 2EO9A 1J9SA 1CXLA 2HVKB 4QXGH 3JWNH 3QJTB 4MMZB 4IOIA 4Y7OC 2VLMD 2XN2A 4K15A 3BKYL 1PLGH 2E9JA 3IVKA 3L2NA 4GLRI 4Y4FD 2X6UA 5IB2B 3B7YA 1DQVA 1S9YB 5LAPA 3P0YL 1T0NA 4ZTPH 3SYAA 1RLBA 4QLWA 2R2HA 3P9LA 1BVLB 4Z7WA 3OZ9H 5L2KE 2NZ9D 3GTNA 3PWNB 2FSDA 3GEFA 3NGBB 4LVNB 4GSDL 1IGIL 1WD8A 2QBWA 1JGEA 4EN2A 5C09E 4CVZB 1IBHA 2R23A 2BVTA 4YEEA 5TQ0L 3HE6B 3OMIB 4KVCH 1T1WB 4PJHE 3TESA 4JFFD 1GCYA 3TN0A 1JZHA 2FWUA 3QHFL 2RQEA 3QCTH 1N8ZB 2HG0A 3Q8CA 1TTBA 4KXBA 4L23A 4OLZH 1JYNA 4JDZB 5HGDA 4FZEH 2L0DA 2HH0L 3SQOL 3GDCA 4WFED 3NJIA 1FNGA 3T09A 1JPFB 2C9VA 2E6JA 2EACA 1F4XL 4M9PA 1OGTB 1QX1A 4OFVA 4LHQB 1OKEA 1OW0A 2XJKA 2Y5EA 1DVFC 5CZKA 2XCMC 3ABZA 1IVTA 1A4KB 3BAXA 4PCSA 5E5UB 5IJVA 3NH7L 1TNNA 3DOSA 5D7SH 2X4OB 3KNBA 4C56A 5AB2A 5I1JH 3BWAA 3TA3B 4TOYH 3KWTA 1KLUA 3TT3H 3C5XA 1GKOA 4GMSH 4X0KA 4ZMYA 5F1KC 3ZR5A 1IAIH 2ZWSA 3QDGE 4MS6A 5LGHL 4KK6D 2A6KA 4TRPH 5CJ8A 1Z9MA 3HZ3A 2EO1A 3IWVA 4GKZA 5HGHA 3ZE0E 4PV8B 3DKHA 3QI9A 4IU2B 1HEHC 2P80D 2V7NB 3WTTA 4I5BA 1GGIL 1KNOA 3IJYA 1AFVL 3U36B 5B3JE 4JRXA 1PAZA 2Z31A 5F1IB 4UT7L 1XBDA 4JGUA 5IESH 1RMFL 4JFVA 4X4KA 4FJZA 1CFVL 4LIQE 4XOBA 4POUB 5CGBA 3N42F 4MKTA 3WNKA 3EYVA 4R4FL 5I66B 2YOCA 4LP4A 1FFNA 5FUCC 1B88A 4OZGB 4DK5A 1Z5HA 3RX5A 1HXMB 1WUNT 3QUHA 1JL8A 3N0PB 5J1AA 3VXQB 2D7NA 3QEQA 1KIRB 3ARWA 3L3IB 2FK9A 4XP1H 4YBHA 4AT6B 5FWRA 5G55A 4ZAKB 3TU6A 2XVBA 2RQ8A 4P2RD 1X6LA 2VN4A 3AM8A 3FU3A 3PWPE 4NO0D 3QH3B 3BLBA 4U1NB 2VDML 1SF5A 2VH5H 4F8NA 5FEBA 2R27A 3WTXA 4MAYB 4LCWD 4WO0A 3MX0B 5C0DA 2XXGA 3ASOB 2HLAA 3V6BR 3MFFA 3HB3C 3B7RL 1GJWA 3KG5A 1RHHB 4GRLA 2AK4E 1M1XB 4Z3GA 2IGLA 3IJ9A 5HGBB 2LFGA 4FFTA 1XIWB 2NY0D 3WXWL 4R2GB 5JXAL 4H0GA 3RDTD 3Q06A 5GGVY 1MJUH 1Z5LA 3I75A 1BAGA 4BZ2L 1CDCA 2F0CA 4LDCA 1TMQA 1A6VL 2JKRM 3QBTB 5L88L 5JIDA 2X4QB 4K9JA 1EHLL 1TCMA 1VFMA 4OZGF 3RLSA 4RGOH 3RNQB 2GAZB 3HB3B 3C09C 2J20A 2ICWJ 1YO4A 2NY4B 1U33A 1VFUA 2QPSA 2XZCL 2XKUA 1MIEH 4Z95L 3HHSA 3R1GL 3G9AB 3VTTA 4DP2X 2IH3B 2FECL 4WIQA 3PWVA 1GRWA 1Q0YL 3DIVA 4BIKA 2IG2L 3KS0H 4BGDA 1AP2B 1G7MA 3EJYD 5CFHA 1U91A 5TE4L 2R0WL 2R83A 4XBGB 3W57A 3QIWD 4X5WB 4Y2NA 1K2DB 1OSZB 2IVFC 1CK0L 1ZLSL 3MJ7A 5B1KA 1XH2A 4HQQL 2JCCE 4UINL 1X5KA 1KGYE 1T6BX 4H8WL 2Z7ZA 5EZIL 2N56A 3H0TB 5E6UB 3TGXA 4GSUA 3RWFA 1U8LA 3NIFF 5I71C 5I74B 3SDCD 4DJMA 1ADQL 2DKUA 4XN7A 2BJMH 1C8QA 1MWAH 2VYRE 1VGKB 2B3RA 1SYSB 4L1SA 4A68A 1CDJA 4AUJA 4E42A 5I30L 2R2EB 5INDB 2BFGA 1SVZA 2NX5B 5I8CB 4ZK8A 1MHEB 2R4RL 5AVYB 3U2SA 1J12A 3KWWA 3QUYD 2LAAA 3LEVH 5K9OA 5I0DA 4HETA 5I1DA 3EAKA 5E0QA 2R0KL 4FLHA 3WDHA 5CKGA 3BWSA 1PCSA 5AW5B 3C12A 5E56A 4MJ4A 2YQGA 3MA7A 3OGOE 2AANA 4HWEH 3BVXA 3BZDA 1TEYA 3APCA 3X2QB 2HJKA 1QO3A 5CZVH 4D3CH 1VPOH 4HF5L 1LVEA 1XF2B 2Q1EA 4AIZA 1T5KA 1R3HA 1M2VB 4ZUUB 3HG3A 3VGGA 2Q6WA 3FF8A 3BP4A 4OUUB 4XBPB 5T5FH 3FHAA 2BC4B 2FGWL 5KSBA 4G8EB 2ZAHA 2PW2A 4RAHA 3VRLE 5FUCE 2FEDD 1WG3A 2BMKB 1DQLL 1LP9E 1JCVA 2CO4A 2UXTA 4QT5B 1FE8L 4EZKA 1BFVL 3TPKA 3QEHA 1G94A 4UT9H 1GYUA 1CE6A 1HL5A 2R15A 2H6PB 5FW7A 2J6WA 2ZF8A 1VEPA 1P4IH 2R1YB 3PWPB 1QA9A 1FDLH 5SV3A 4KPHL 1KGXA 2X89A 1MFEL 5JHLL