4HU2A

Crystal structure of ldtmt2, a l,d-transpeptidase from mycobacterium tuberculosis: domain a and b
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
194
structure length
194
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE CONSERVED LIPOPROTEIN LPPS
publication title Structure of LdtMt2, an L,D-transpeptidase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 44
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hu2A02
2.60.40.3780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hu2A01
4GSRA 5DZPA 3TURA 3U1QA 4HU2A 5LB1A 4K73A 4JMNA 4XVOA 5DCCA 3VYNA 5DVPA 4ZFQA 5LBGA 5E1IA 3VYOA 5E1GA 4QRBA 5E51A 4QR7A 4Z7AA 3VYPA 3U1PA 3TX4A 5DZJA 5DUJA 5DU7A 5D7HA 5DC2A 4JMXA 4GSQA 4GSUA 3VAEA 4QRAA 4QTFA 5K69A 5E5LA 4HUCA
chains in the Genus database with same CATH superfamily
4NPYA 2AP2A 3G6JA 2ADFH 4LHUB 5KSAB 2N1KA 3HOGA 4ZOAA 3MR9B 1J1PL 4KKNA 4Q6YA 4JQIL 4F1ZA 1I8IA 4OLUH 5L2KA 5CU9A 1PLBA 1IGJA 5FKAA 2Z91B 3GJEB 1A6UH 1P9MC 3PGDA 3PUUA 1JZ5A 3HN5A 2IPUG 1TQBC 1I8KB 2YD1A 4L5FL 4XPAL 5AW4B 5BO1H 3VW3H 4Q4EA 4B9ZA 2AJXL 1ZVYA 1CTOA 2ZXGA 3L2MA 1EFXA 5CF3A 1B9KA 1DO5A 4CC4C 1PSKL 2B1AL 4Q6IA 3U9UB 2E7HA 4M8QB 5EUKB 5JUEL 1LO2H 1S78D 2K9FB 3Q05A 2JNZA 4IIQB 2WPGA 4L23A 2WLZA 4LL4A 2W60B 2A74C 4O58L 5CNHA 3G7TA 4B95C 3B9VA 4XP9L 4AYEC 3E38A 1D6EB 1FNGA 1MPAL 2YEQA 3QJXA 3UTTB 2UWEE 1HWHB 2FR4A 2WTRA 4UILH 1IKNA 3U30C 5KYYB 5KYNA 5KUKA 3BXNB 3HMXH 3QH3A 3V0VA 4O51B 4HDIA 4Y2OB 1UA7A 1S5IH 5I8CA 1DLHB 1BBDH 5D1QC 4HCGA 5FA4A 5HHXL 3GF8A 3DO3A 3AS3A 3QUKA 3L3DB 2FT7A 5DWUH 4B5EA 1NCWL 1H19A 1ZHNB 1EA9C 3T65A 4K07A 3WENA 1KOAA 4X99A 3B9KC 3M1BB 4Y4HD 4WFHE 3NEXA 4S2SA 3QWNA 3SBWA 4BZ1H 1A0QL 1TQSA 3KYMB 1CUOA 1TVBA 3CHRA 4DVRL 4JVWA 3A3YB 4UM9B 2F1EA 4OKVB 1KLFA 4ZMYA 2BERA 1DUYB 4WV1A 2ED9A 4F20A 4MD0B 2B1OA 4KK6C 2NY0B 4AMXA 4WLCA 1U58B 2E86A 3DGGA 3MVSA 3WFZA 2IFFL 4CMHC 4RSVA 4GSXA 3ZVVA 5L2KD 3PFQA 1N6UA 3TN0B 1CGVA 4N9GA 4BZYA 3BT2H 4I18B 4O4YL 4B5ZA 4NQCD 1KNOA 4J4PA 4ZS7L 4DFIA 2IBBA 5K9JH 1JXKA 2AF2A 2E9BA 3U0PA 5LGYA 2HLAB 4W9EC 2CRMA 1EFXD 5C09E 3H3KA 5GS1A 1LVEA 1WRFA 1GZQB 1XD1A 4Y5XC 3S8FB 2CXGA 4PJIA 3LRSA 1GGCL 4K8RD 3TIDB 4MJID 3CN0A 3EGXA 3DPBA 4X5WA 4L0PB 5ESVA 3X3FL 1M7IB 5FYLE 2VZ3A 2YZ1A 3WUZA 5E6RB 4GI9A 4I13B 2HKHL 2HFGH 2VDMB 2V8MA 2XV3A 1IAOA 4NQQA 1QFOA 3CSBA 3L17A 3VG0H 2BY1A 5FDYA 4JX0A 3RDTA 1C16B 5DS2A 1X5FA 2BIMA 4TLUA 3DURB 4KK8D 3NPSC 4V33A 3QJQB 5HPMA 4HJJL 5BXFB 1HAUA 1IGFH 4O9HL 4WO4B 2VXSH 4P2RE 2ADJB 4R26H 2R1WA 3BD5A 4N5UA 3HE7C 1HL5A 2ILLA 1JHTA 4KKLC 4EZJA 3LV3A 1HAWA 2J1XA 3FSZA 5DRWB 4NUGH 3RL2A 1ECYA 1X5YA 3NABL 1UT1A 1CLOH 2XOTA 2WCSA 1B4JL 1JTTA 1RUQH 2N59A 5EU6A 2C9SA 5HBBA 5KJRH 1K6QL 3TT3H 1M7DB 2GUOA 1T1WA 1PQZB 2A73B 1W8OA 3D4CA 5TGBB 2IDFA 2P28B 2XJLA 4LO9A 2R39A 5EPMB 4J2XA 1KGWA 3L08A 1ZDSA 5CO1A 1PLGH 2A74B 2A83B 2PPDA 1O7VA 1X9UA 3CLFL 2PF6A 4PJFE 4KJPC 2JJTA 1LGVA 4H5SB 1WYJA 3ULUE 2L3BA 2C9RA 3T0BA 2Z3FA 5D7LA 4MBRA 3U30B 5D1ZC 3ZMEA 3HBZA 3D6GA 4J4PD 3PWPA 4XO5A 4D7PA 4M4RA 4A55A 4Z3FA 4FQ2L 4MD5A 1Z3GH 1UADC 3RJDA 3VACA 1TETH 3MRGA 1VENA 1RZKC 3X1BA 1MCJA 3BLPX 1KFGA 2AEPL 4IIZA 4HIPA 4P04A 1DANT 2VLRE 3BFWA 2YXMA 2UY6A 2E59A 3ZGHA 4ZFOA 1NAKH 1RERA 5G4NA 1B3IA 3MUHL 4FNSA 3IYLW 2NT0A 3DJ9A 1JK8B 2WXJA 1XGQA 4AYMC 1F42A 1JGUH 4FNUA 5EO0B 3RDTD 4L3EA 1DQJB 1F4WL 3RGVC 5I0ZA 4G9FA 3PU7A 1A64A 3TX4A 4LSTH 3VA2C 1XR9B 4Y9BA 4Y1TA 1E4XH 2J5LC 3NA9L 1UZ8B 1NIEA 2EXYD 2OYMA 4HZAA 3T2OA 3VRLF 1SBSL 2VW6A 5I1LA 4ZDHA 1IEAA 3DX7B 5FGCB 1HSAB 2WVSA 4TSCL 4OLEA 1NC2A 4R8WH 1IAIH 2RH0A 1RZ7L 2QSTA 1M2OA 2VDKB 5HGAB 5E4OA 4Y5XB 3Q2LA 4OGYH 2YZ8A 3KYOA 3CDGB 4XO9A 4DQOL 3IGLA 1NGZA 1KIUA 2ZSVB 2IV8A 1ZCRA 5CP3A 5E8EA 2ADIB 3OWEA 4XGZB 3GRBA 6CGTA 4GBXD 1E9OA 4GG6F 2MMXA 4X50A 2CALA 3ZIMA 4DGIL 3APDA 3AZUA 2X9ZA 4CNIB 5JQIB 4FQIH 3WAKA 4N20A 1XIWA 2YAQA 1A65A 1P5UC 5AYUL 1TTGA 1AP2B 3HPJB 4Q9RL 5ACLA 4QNPE 4Z76B 5AWNL 1C5BL 4AIEA 1SDAB 2IBZY 3AG1B 3HE7B 1J5OL 1F1GA 2Y5TB 4AG4H 3ISWA 4GEJA 3WIFB 1YNKL 2I7SA 4JFDB 5DHVH 5FKPA 3IAQA 4UUJB 2VMEA 1FZOA 2AEQL 2YMXH 3V5DA 4MXQD 1CDUA 3PRZA 2BP3A 2Y5EA 3VI3F 4EKXA 4UOZA 1ZK9A 3UL4A 4OTXH 2OMVB 4GEIA 1TUPA 1ZV9A 2QZ5A 4GOSA 4JFZL 3P11H 3WJMA 1PZ3A 4L3ED 4ISVA 5F7FA 1BYOA 4NQCE 2DYSB 3QUYD 2BNQA 1M3IA 4JHUA 4Z7OF 4FYSA 3UIZA 3WMPA 4I48B 1HCFX 1T0MB 1S7XA 1YNTA 2BY2A 3NJNA 4A67A 4PN6A 4Z7WB 5JOEA 3U6RB 1D9KB 5D1ZB 1J8HA 5DJDA 2NLJB 1LYQA 1AXTH 3LKPB 2ENJA 4OFKA 4XN5A 3ATDA 4MJIE 4P23A 4BKLB 5GGRY 4G7VH 3F58L 2H2PD 4NQVA 5LAXB 5JNYA 2X10A 2V5MA 4B97A 1KT2A 5FUZL 3VXQB 3IFPB 3Q5OA 4F9PA 4KI5C 1J1PH 5DJYA 3VXSB 2ITCB 4YDVA 1JF1A 5HYSB 2DWSA 5T3XD 3N91A 1K5NB 3VFUB 2X4NB 2F1BA 2AC0A 1MY7A 2FH6A 5I24A 2G4GA 3PHOA 3MQIA 1FA4A 4PJ8C 4LSUH 2WZPA 1CL7L 2IQAA 3MNWB 5K33A 4XPAH 2FZ3B 4OF8A 3SGEI 4FAAB 3RGVB 5FHBL 1LEIA 4Y5YA 4ZO9A 2E76C 3CN2A 2TSBA 5E6IA 4HCIA 3T8XA 2YKLH 1S4IA 3SGJC 4BKSC 3RKDD 3DBXB 2IV9A 1CLCA 1QQDA 4GQZA 4JRYB 4X6DA 5JQ6L 3BKCL 3C6EA 3OMIB 4CSZA 1KYOK 2QGDA 1CFVL 3RKPA 2ZD0A 4M9PA 5LGJB 5F3BB 4O58H 1IZJA 2GB2A 3H7LA 3US0A 1KF9B 1IQWH 1MPAH 3DJTA 2NXZC 2BVOB 4JO2L 2R9HD 4KVCL 1NM9A 4X4YA 5IV2A 1KJVA 2FJFB 2VLRB 3MLZH 43C9A 1R5WB 4X7SL 2C7FA 5B38A 1FWXA 4YK4C 5HHXH 3S35X 2PP7A 2VL5B 2YRPA 4AIXA 1P5UB 1ZIBA 1IC0A 1RSYA 1Z9NA 1PKQA 2ZNWA 3EH3B 3O45B 2XZCL 4OZHF 4TV3A 3VE0A 2JQMA 3GHBH 5LGKA 1UWGL 3DVNB 3EZ8A 2F8VA 3ZT6A 4F7MA 4P23D 3ML9A 2XN2A 1SVCP 1A0QH 2F68X 1CG9B 4ZT1A 2BXZA 5TQ0L 4DVRH 4WRLA 2IDTA 3ROOA 2ROXA 3L4VA 1KCUL 5EMYA 5I8KL 4F37K 5AEAA 2YRLA 3V5KB 3A4AA 3KL0A 2IFFH 3H0TA 1KTDA 4FC3E 1OEZW 3G6AA 2KUTA 1O7SA 3EOTL 4O4YH 4WJKB 2YUVA 5ETUB 4X42A 2MCG1 3BRDA 5CMAA 1HNFA 3BFOA 4ZS7H 4GSDH 2XT1B 3AAZB 4LOEA 5D93C 5KVMC 1BVNP 1H0DA 1ZVSB 3U0WL 5E6ID 4FLOA 4ZMLA 4ZUUA 4LLVA 4MXVF 2NYYC 4Q58C 1A6ZB 4TS6A 1XF3B 4LSVH 3O4LB 4YGVB 2YJQA 5A6IA 1GGCH 4HT1L 1UC6A 4Y7MA 2ATKA 4X7TA 3WSQL 4YHLL 1T21A 3IJYA 1S5HA 1E9QB 2MEJB 2HKHH 4QHKJ 2X1OA 2IOIA 2NUTA 4G43A 1UXMA 5BVPH 4E36A 1GYWA 1BMWA 4LSSL 2IDUA 3WIHL 4X4ZA 2WOYA 5ERWB 3QT2A 3ZKMD 5ADPH 1L6PA 3V55A 5FM5M 4PJ8B 1E4KA 2AK4A 4OLVL 4WFED 1R6VA 1E67A 4FNLL 5TE7H 4GAYA 3GSNB 3QQ9D 4RZKA 2PCYA 4S1RH 5HHMB 2XACC 4ICWA 3ESMA 4DESA 4PS3A 5DZOA 1K6QH 1BJ8A 3FQRB 2W0FA 3MNMA 4N3TA 5INCB 4GQQA 4AGOA 1B4TA 3ZKSD 4GQRA 1SPDA 3WKML 3IWVA 1EAPA 5LCVL 5IVZB 3UPCA 3L95A 3QJRB 3CLFH 2BO0A 4NKIH 4UU9A 1RZIA 4DEUA 3BUYB 1G7HA 1SJVA 2HVBA 2WIIB 4OFYD 2NXZB 4FEMA 2CXKA 3FUFA 5FB8A 3CE1A 1OANA 3QFDA 1UOWA 3QQXA 5T5FH 3QFGA 3ZHDA 1BG1A 4XXDA 1E3ZA 4FQ2H 2CH8A 2IMNA 2OTUB 4D0BA 4U1GB 4LBAA 5GZND 5IM7B 5IMKA 2R2EB 5LG6A 5F88A 2AEPH 1DQVA 5DQDH 5GSVB 4PTTA 5DR5L 5J6GB 4NQDB 2HVJB 1OO2A 4URTB 2YPKB 3AY4A 1WFOA 1J1OL 3IDXH 3GSVA 2FECI 2FSEB 3KLHC 1URIA 4J3OH 2H9GB 3WFHA 5MHSE 2ATAA 5KANG 3B1UA 3U9PL 1XCXA 1J0KA 3VFVB 1DQQB 2FNBA 1SBSH 1U8LA 4XRCA 3O3AB 3QG6B 4GFXA 3D3VD 4TM9A 1VSCA 3AXLA 3N5AA 3QXDB 5E8OA 3QUZD 2K4AA 3EJZD 3MRHB 5CBEB 3PAVA 1RI8A 1DBAL 1RZ7H 4APQD 1QSFD 4X6CE 2DQEL 4DPAX 1DBBH 3FUHA 3P0YL 3FN0L 2CHXA 2KPWA 3KLDA 5JHBA 1P4BL 4BFOA 5B8CC 3FHQA 4XP5L 4XMLL 1JRHL 3TYFB 5JR1L 3MBWA 2FJHB 1OSPL 2GTWA 5T3ZD 2IDQA 1S7SB 1PLAA 4G6JL 5DUMH 2UXFA 3F7PC 3E6HB 3HZYB 1LXMA 1BFTA 3FZUC 1U6AL 1P2CB 4AJVA 2D2CC 4Z7VB 3RWHB 3MBEA 3SYQA 2AEQH 4HWBL 2A6JB 4JPSA 4HC1L 5FM4A 3BI9X 3JWNE 2WZ0A 3DDFA 1Q94B 2Z0BA 4A63A 3E6FA 4X9YA 4IKLA 1QX1A 3PDOA 4JFZH 4KDTA 2A4EA 3GXUB 5AYQA 2B2XL 5KZCB 2IAMB 1CT8B 2FEEI 3ILPA 4GO9A 1ZV2A 1CLZL 1HHKB 2OL3L 4QOKD 5FYJD 4A2GA 4AEIL 1VFAA 4FQPA 1QI5A 1WWBX 3MLVL 4P5TB 1T7WA 3CLEL 2RALA 1IGIH 3O0RH 4IS6B 4PJ9A 3OR7A 2N7BA 1BYPA 2N0KA 3EYSH 1I3RB 3MU3A 5JW4R 3LIZH 1AI1L 1UZ6E 2GT9A 4G6FD 1AC0A 1JF6A 5LLIC 1TU2A 4LARL 3OKOA 3PPEA 4QI3A 1FAKT 4Z23A 3RJOA 2CBQA 4GG6A 2J1ZA 4BQCA 1M2VA 1RY7B 2MFNA 4P0DA 4PBWD 1TJXA 5DC0A 3FMGL 1E5CA 1XVSA 1VJSA 2BSCA 3X3GL 4F7TB 5E24E 4LCYA 1G9MC 1LNUA 5J6HA 4WFEE 1HJBC 4LHUG 3HC3L 5M7QA 2ICWI 4JRXA 5DWPA 3FB6A 2I07A 3NCCB 1SLWA 1KDJA 3DYPA 4U2ZA 5GJTL 3IKKA 5PCYA 5BV7L 3W9DB 2BCKA 3VXMA 1T03L 5JQ6H 2GITB 3BKCH 3MCKB 1AXIB 3H3PL 5IWLC 2D7PA 2N3JA 5CFAA 5FUCE 4XZ4A 3VI3A 3WJLA 2C9PA 3CG8A 1CFSB 1S7VA 2AHIA 3OKMA 4FZ8L 4HKBA 4MLIA 1IBBA 1Q1JL 2O4EA 3FBKA 4JJ5A 3RWCA 3VQMA 4XPTH 3LHPL 3BUPA 4MB1A 3CMOL 3NOIA 4HMEA 3TBTA 5IJDC 1IZKA 4KZDH 4KVCH 1NMAL 3OKLA 1GOGA 5B8CB 5IF0A 2BDNL 5FS5A 3VXRA 4A7UA 5IB5B 5CCGE 1TMCB 3FU9A 3ZQ9A 5F7HA 3F64A 1A9EB 3LB6C 4GKNB 3S3PA 4KKZA 5TQ0H 3B2MA 4QRUA 2XWBA 1KJ2L 2BNRD 1KCUH 4KXBA 1TCRB 1M9SA 4IRJA 2AI0L 4OGAD 4N1EA 2Y3NA 4V1DB 5DC4B 4RAVA 1ZIAA 4N24A 1U8HB 1CS6A 1LP9B 3VD0A 5SWQA 3FH7A 4ERSL 3EOTH 3VH8A 4XI5C 4HG4K 3NA4A 2W92A 2EE9A 2IG2H 4Z7NE 3TCTA 4JRXD 3AGWA 4QHLB 4XVSL 5TH2A 1KYOJ 1QBLL 1ZJAA 2OSWA 4PJXB 2AQ2A 3D3VE 5I5JA 4GXUM 2XTJD 5F9JA 2YEZA 4S1DC 5DK2B 5HDOA 3VXMD 2CBMA 1OCZB 2NUPB 1QSFE 1R5VA 1I3VA 2H0PA 2WN3A 4X0NA 3DETD 3WSQH 4CBZA 3CGTA 4WK2B 4HGWB 3BEVB 3W9EA 3SCMC 2ZYRA 4N1HB 5GJSL 4AQAB 3CC5B 2Q3ZA 1JZ4A 3O3BB 2EDDA 5DJ6B 1XMWA 4BFKA 4LSSH 4GFTB 4P2YA 3WIHH 1S7WA 4YWGL 1MSPA 4E41A 4IHOA 1CIUA 3MRRB 3GMOB 4KBPA 4KKPA 1LQBC 5T3ZE 1NBQA 1P7QB 4OLVH 3ZUNC 4BXSV 2C3WA 1YEIH 3L5XH 3R1GH 5KYWA 4OZHA 3AROA 4ODBD 1XT5A 1C12B 1VADA 1UA6H 4CVZB 1KYUA 1KBPA 1QP1A 2BMKB 3CFDB 4IW4C 3FBQA 4UTCA 5F8QC 2B1HH 1L5GB 2ZIDA 3VSTA 4XVTL 1MVUB 3Q8AA 2O5YH 3I02A 5ANMA 3EBIA 2JCWA 1Q4NX 5CIPA 1MCBA 1N10A 4PIRF 3MZTA 2A6KA 2OYLA 4G80A 3UABA 3MI6A 3P4LA 4K7PX 3WKMH 1FN4B 4N2BA 5JORA 3MYJA 5LCVH 2B7DT 1G7MA 3ARGC 4EIUA 3BUQA 2ED6A 1FAIL 4NZUH 2D3VA 4URKA 1ZWIB 4QOKE 5FYJE 1DZBA 1F3RB 4G8FA 4NDMB 2PO6C 4PGCA 5DDHA 1WAAE 3LZNA 1AMXA 4DCQA 4U6VL 4OI7A 5GS0D 2HA1A 3W38A 4HGKC 3TPKA 4UM8B 5E8NA 4ZFQA 1UUSA 3BAWA 4RCAA 4AOFA 3QZLA 1NGXA 5BUGA 2R1YB 2EXWD 2UZXA 4DFHA 1U3HC 2MOVA 1S9VB 2R7EB 2YA1A 4LT7A 3SGDI 4WHYG 2CJUL 3OG6B 2OXHB 2P3YA 5CJQL 1D6VL 4FFWC 4DQAA 4WW2C 3WUWA 1C5DB 3B7UX 2V2TA 1J1OH 3CQPA 4XE0A 4OUUA 1ORSA 2IGTA 2VLJB 3BW9B 3I3DA 4RBPK 5IG7A 1L9NA 2A0LD 4RMRA 5E9AA 4FNPA 3ZDZE 4JB9L 2DZEA 3VGAC 4K7PL 2VM3A 4PG2C 5ICUA 3U9PH 3U2JA 3PL6D 3BWUF 1SLVA 3L3OC 4E9RA 2HSIA 5DA0B 5DRZB 2AV7A 5FLVA 5IBLD 1OPGL 4OCXL 4PRHE 4JQVA 3S34L 5G4OA 5HYQB 3BZ4B 3RB5A 1GKOA 3IT8D 5EF1A 3S96B 4BDVB 1YMMA 5DTFB 4Z78A 4NCC1 1MREL 2VJ0A 2DQEH 2JKLA 4GW5A 3UIYA 3WG7B 3P0YH 2XETA 1O6SB 3G5VA 4B9YA 3T0DA 2F2HA 2PUQT 2FGZA 2HRLA 4RA0C 1P4BH 5EU4A 3SCMB 3R7QA 4JGUA 2P7TB 1IGYA 3QUML 2CKNA 4YHZL 2LABA 2B15A 4XP5H 5F7AA 1G6RL 4JFEE 4WEBL 3RY4A 2H5UA 1OGAD 5JR1H 2E4FA 2BHUA 1DVUA 1IM9B 3KPSB 3U2SA 1OSPH 5IQ9A 2DMBA 4LLWA 5J1TC 4H8QA 2OBGA 2AXWA 1HE7A 1QLRB 1U3YA 3WFEL 3ECBB 4I77L 1BW8A 3QJHA 3C9NB 3OXSA 1MAKA 4Y4FD 5F6HJ 25C8H 2VZUA 3LRGA 1FZKB 3PF2A 5EOCL 4P4KA 4HWBH 2KZWA 3Q9QA 2XHNA 1U8OA 4HC1H 1JG9A 1NJ9A 5HY9A 4OM1H 5CR8A 5A2JH 5L8LB 1NMBL 2HFFB 3ET9F 4FP8L 2P5WA 3UJJH 1HYRC 1QSED 2B2XH 1OXYA 3PWVB 4L4VB 4XX1E 3JT0A 5SX5H 1ZT4B 4HUVB 5C0NC 3ARGB 1ACZA 2X4RB 3NK3A 1CLZH 3VFWB 1U95A 1X7SA 1PG7X 2XTJE 3FQUA 3X2QB 1WC7A 1K8IB 2PO6B 3MLVH 3ULVL 2DLGA 2HX8A 2ZXDA 3CLEH 1QTYT 2NNCA 1CDBA 3P2TA 3S4SA 1CGUA 1I1AB 3GPSA 1JWMB 1Z9MA 1CF1A 4GRMB 1U3HB 1AI1H 4DZ8A 1WWAX 4W9HC 3IGAA 3L3GB 3OZLA 5GIRA 3B9EA 2A4CA 4LARH 4C4BA 2JTDA 2ZWKA 4OZGF 1JNHB 5BRZA 5EIIB 4K9JA 2DWXA 2Z1KA 4FI8A 1AOZA 2CKBA 1HXYB 2YSSB 4WW2B 4X4KA 3FMGH 4HISA 1JXFA 1EJ8A 1HHIB 3FO1A 3IFLL 5EU7C 4PRPA 3HC3H 1V27A 3U83A 1A4BA 4Q9QL 3CSTA 3REVB 4XCFL 1DO6A 1OHQA 1R19A 2CO6B 3UC2A 5J13C 1HILA 2VZSA 4JDEA 4NSKB 1ZAGA 5GJTH 2F53B 5BV7H 5FDWB 3H85A 4QXVA 3EYOA 3L3OB 4L48A 1T03H 2J55A 3FTVA 2NCMA 3QS3A 3H3PH 3TIEB 3UH8A 3T0XA 1JZ2A 2JV6A 3GTNA 3MJ9A 4KKBD 1TZHB 1O6TA 4ODUB 3H9SE 1W9XA 5GHWL 1QRND 1Y0LA 4FZ8H 1G94A 2XICA 3KJ6L 4Z3TA 3G5XA 1U33A 2K1MA 5E0QA 4KTEL 4EEEA 4LK4A 2P5WD 3HRPA 4HIJB 4Z7UB 1BDYA 3ZZLA 3MBXL 3FOLB 3E3QE 4Y2DA 2WQSA 3LKOA 4HS3B 5GGQL 1BF5A 3K81A 4FFYH 4K15A 3NCJH 2YXWA 3F6JA 1W6LA 4TVPL 4AKOA 5C0IA 3BGAA 1N8OE 2VIRB 5KG9A 3ALWA 4JFFD 4H40A 3ILQD 4XMUA 1QBBA 2F8IA 3PXLA 2AABL 3UACA 1MFDH 2F0CA 3V6ZB 5I18L 4N3UA 1AGEA 1JPSL 1KJ2H 4K5OA 3T09A 3TCLB 3B1TA 3JZ7A 4KNSA 2AI0H 3UAJD 1HSBB 3NSXA 2X3BA 3ZYJA 2PTTB 3QIWB 5E6SB 4RRPM 4ERSH 3ZKNC 1UGKA 4LPCA 1BLNB 5MEND 3MXVL 3VXOB 3QWOA 1GKEA 1I85A 4KQ4L 5F3HA 1ZS8A 1GC1H 2ICES 4POYA 1BPVA 3S3DB 4XVSH 3CFTA 1QBLH 5DYOB 3CMGA 3RX8A 3MTXA 3D8MA 5DS8A 1UOKA 4N2IA 5G5DB 2BIQA 3KW8A 3ZO0A 2Q20A 4Z5RB 4HP5A 5LQBL 4JFEB 1R1CA 3V4LA 1T6BX 4CSSA 4N2KA 3FRPB 5AAWC 4WU7B 5GJSH 4WO0A 4XTRC 4FG6C 4LVEA 4TUJB 5GGUA 2OM5A 2JCCF 3A4DA 3QISA 4CN6A 4QTIL 4BQBA 2QSVA 3TFKD 1NZRA 1OGAE 3E1F1 1BMZA 3BP6A 4ZX6A 3MJ8B 5AALA 3GSRA 5B4MC 5F96L 2JKRM 3V0WH 2NTFB 4ZO7A 4DO6A 3FTZA 2ROYA 2Y06L 4LRNL 2R56L 2BW4A 3MACL 4RGND 5J13B 2YD4A 2E8YA 4D9LL 5DMGC 1F5WA 1RU9H 1Y18B 4KXAA 3UPRB 4A2EA 4QF1A 4HIHB 2ZXBA 1BECA 1E8XA 2ZAIA 4Q14A 4JHZA 3IXAB 5DVPA 3U48A 2X4UB 4FLSA 5AVVB 5C71A 5T33L 4HG4J 5K9OB 3TS8A 3L7EA 4PRAA 1QSEE 4CW1A 2C9QA 1KTJA 1HKLL 2DM7A 3KPRB 3NSYA 1T5XB 3BWSA 5CJXC 4P06A 2VR4A 2ARWA 4ELMB 2ED8A 3DMMC 3IETB 4PHXA 4P2OA 2CO7A 3MLTB 4NUJB 4ES9A 4LLDA 5SV4A 1UACL 1KTKE 5DVNA 3B8SA 5DHYA 5J7CC 4RGOL 3D85B 5TDNA 4L0ZA 3KYNB 4IRZH 3QDAA 1RPKA 3EYUH 1FL6A 3GSUB 4UQ3A 4I5BB 2GG1A 5CJQH 3W11C 4OUOA 4NHCL 1QATA 3BZFB 3ISRA 1LEGB 3KDPB 2WVVA 3MA7B 5AVRB 4Q97A 1MXGA 4KDVA 4XXCA 3MLXH 3FRUB 3R0MA 2R69H 3BOVA 4XPBH 3WYRA 5TE4L 4OLZL 2ARJB 4JB9H 4DKEL 2NY6D 4G83A 3CPLA 5JIPA 1XGTA 1X5IA 2FAUA 4LNRB 3POCA 3H9SB 4WI0A 3JV5A 5E95B 3VFRA 1F8TL 1OF2B 5C0FA 1A3LL 3BH4A 3MRCB 3T0AA 4OCXH 3EDDA 4KOCA 1DUZA 4FOMA 4UT6A 3FB5A 4U1KB 2D7OA 4HK0B 3MO1A 3STZA 5IESL 3MV7B 3FXIC 2WXOA 3IDIA 1QRNE 4XC3L 5J57B 4AYFA 2VWEE 3SOBH 1E7UA 5E94B 1OP4A 3EOAB 3L1EA 4X6EB 4O5LL 2AMUA 1YUHA 2YOCA 3MCYA 1AAJA 5E9DB 4DGYL 3MRIA 5E1HB 1G9EA 4KK5C 3T3MF 3QUMH 4JAMA 4YHZH 2C9VA 3NJIA 5KBNC 1G6RH 4WEBH 1TQVA 5B7EA 1ANUA 2XTSA 2DWDB 4P2OD 3A47A 3U7AA 5C0CD 1ACCA 2APFA 1KXVA 3A21A 3D33A 2BNUA 3WFEH 3QRGL 6TAAA 4KKAC 4QRPB 4I77H 5GRZA 5ISZD 5IFAH 5L88L 1EAJA 4N2CA 2YPLA 1JTOA 3CX2A 5I30L 1L6XA 1E8YA 1XGRA 5EOCH 2B4CL 3HBPA 2ZOOA 3PNRB 4WENB 2ZYHA 1KPRB 1E8ZA 2WWOA 2XG4B 1OB1B 1PMYA 1NGYA 3MLRL 4JFOA 4OFIA 4JE4B 4U0RC 5MENE 3IDUA 4LOFA 3P4NB 3QP3A 4JVUA 3SO3C 2BSRB 3P30L 4FQXC 3HE6D 3D18A 1U92A 5CHNA 3WS3B 3ZTJG 1WIOA 2W65B 3ESNA 1IM3B 3ULVH 1RFDL 2HLFC 4H88L 1T83C 4ODXA 5C97A 1L9QA 2CM5A 2AQRA 3QDGD 1JCKA 4D0DB 3NPZB 3ZRCC 1CI5A 3OLEA 4HJGA 3QYMA 1IJNA 3CFBA 3RIFK 2FX9L 1FO0A 5CCHE 1DEEB 3M17A 2IANB 1D5XB 5DJ0B 1EWHA 4LKCB 5EC1B 3WN5A 1QHQA 4PVLA 1TLKA 4JDVA 1PZSA 2X3CA 3C2SA 3HBGA 1MCWW 3RI5K 3CFCL 3TVMC 2IMMA 2HJLA 5SWZB 1CGXA 1OGTB 2DL9A 4RGNE 5AL8A 4G6ML 2IPKA 5JHDD 2R51A 4OSUL 5HDBE 1Y07A 5DEJA 4RA3A 3SJVA 1EXGA 4LSQL 4P4RA 1NINA 1T3FA 3K5RA 4J23A 2PYFB 3KLLA 5GHWH 3QQ4B 4HJ1A 2PLTA 3CVDA 1KFAH 3X13B 2QGBA 4EE2A 4PJBF 3KJ6H 3C6LA 1VFBB 2AANA 1RZ8B 3CVHA 4KTEH 2NW3A 4MQXC 2R4SH 3PHAA 1VLXA 2WWKT 1A6TB 3MCLH 4BRVA 1UWFA 3V0AC 5BS0B 4M3KB 5GGQH 5K1NA 3AREC 5CJBA 1NC4A 4Y4KD 5IJVB 2DQFA 3RVWC 2RB8A 3RFZC 1GW6A 4EI5C 1UFGA 4DN3L 3DDGA 3P0VL 2JSFA 2GJ6D 4X9HA 2DMGA 2ZCKL 1Z66A 5F7EL 2AABH 4N86A 4OZGA 2CDEA 1TXKA 2L8AA 4YUEL 2CA3A 5I18H 1JPSH 4Y16C 4YSUA 3TZVC 3GO1L 2F54A 1UM4L 4U1LB 1KXHA 3WXVL 2LW3A 1S7RA 3P9LA 4PR5A 2FGWH 4Y9GA 2Y07L 2G9HA 2ESVB 1VERA 5ACZB 5EEWA 4ANUA 1O9VA 1I8UA 3ATEA 4AQEB 4DP8X 2WMPB 4HKXB 5FGSA 3SE8L 3MXVH 4YSPA 4KQ4H 1LE9B 2ZG3A 3HHMA 3VTTA 4FG2A 4NUPA 1QEXA 2HH0H 5CWSA 4ONHB 3SO3B 4PWGA 4FQXB 4XMKH 4DW2H 2VERN 1DVFB 2DF3A 5LQBH 1U8NA 5E99L 4X5PA 5JDSB 1I8LA 4H1LB 1W15A 4KK9D 3OGCA 1SY6L 1MVFA 4IRSC 4CVXB 2HTLD 1ZHLA 2XVKA 1SOXA 3FU7A 3QEQD 4O02A 4WW1A 3MROB 4R84A 2ZCZA 1JV2A 7TAAA 1XR8A 2ZOWA 1XB8A 3G5WA 3D39B 4NQUA 1XF5B 4PG9B 3WGUB 1CU4H 1RJLA 1G9NL 4XWGL 1DYZA 1MI5A 5C0CE 4XNUL 1HHGA 5F93C 3DGCR 4AXWB 2Y06H 4ODWB 5T5NG 3GIVA 2A7BA 2P24A 3V79C 1T0PB 3TVMB 3L3KA 5ISZE 1H3PH 1USQA 1JDAA 3MACH 3O3EA 3UROR 1UQSA 3BH8A 4DVBA 4GRLA 3RL1A 3BAEL 1BSIA 2BP0B 4KQ3L 1U93B 3RY6C 1CFNA 3JWNG 2WP3T 5T33H 3KGRA 2DWEB 2J4WL 5F1IA 4L8CB 1E42A 4JEGB 2A6IB 2AJ3A 2SODB 1GH7A 4MAUL 4CGTA 3LN5A 1ZA6B 4NPKA 1HKLH 1ZK5A 2DEYX 4J3XA 3TF4A 4KV5F 3AVEA 4JGMA 3MUUA 1PZ5A 3IMUA 3FFCA 1B90A 5FYKH 4P5KA 1NBCA 3NJXA 3EJJX 4NBYB 5F89A 4LLMB 2QQNL 1MN4A 1UACH 2CK0L 3GI8L 1FH2A 3KPOB 2WNKA 2QDWA 4PJHF 5HI5D 4RLDA 1KYAA 3QDGE 4XNBA 4X9GA 4HQQL 2VDML 4QWWC 3X17A 1DP0A 4M1DH 3ZDYB 5A6LA 3Q06A 4EI5B 5H94A 2JCCA 4XBMA 3CX5J 2EEFA 1B9ZA 2APWA 2WD0A 4NHCH 3JXAA 3LPWA 2BP8B 2NR6C 2WSDA 4NQTA 4OGQC 4Y16B 3DOHA 4F5CE 2AW2A 5DI8A 2FSDA 5HDBB 3BO8B 3VSQA 1VEOA 4LU5H 3QIBB 4WNQA 1XH3B 2DMCA 1QMUA 3PJSB 4EI6A 4QY8A 1DDHB 1UA3A 4OLZH 4DKEH 4PRNB 3RIAK 2QL1A 3QNZB 3SD5A 1FHGA 3GINA 1MI5D 4N9OB 1WO2A 3RDJA 4D8PA 1F8TH 3VMNA 5JHDE 1A3LH 4XH2B 5JXEA 3K4AA 3RNQB 1AD0B 1FGVH 2VC2L 4L8SC 4BFEA 1EQWA 1MHHA 2GIMA 3PGCA 5IESH 5AOMA 4CSPA 4XC3H 2EC9T 3T04D 3D5OF 2YAPA 4NOFA 1UXSA 4RAUB 3VWJA 1T66D 3BMVA 4GQ9H 1A4JB 4O5LH 5I76A 4IRSB 5DYFA 1N6QL 4DGYH 1U8IB 2KHAA 5C0BE 1ETB1 1IBZA 2PP8A 3KNBA 4NS0A 4ETQA 4JY4A 2X6VA 4GKZA 3GUTA 1U4FA 2BLFA 1RURL 3MV01 2H26A 4G7YL 4NXKA 1XL6A 2Y7LA 3FFCD 4KJQD 4X98A 3WTXA 3ALPA 3FONA 4YFLI 3A6BL 1CGSH 1UH3A 3CTTA 4JO1H 4Q4IA 3S0PA 3UP1A 2C4FU 4P9HC 2GJ6E 5B22A 3WEMA 1GJIA 2IC2A 2V9RA 4HCRL 2ICWJ 3GZOA 4J6RL 3F7KA 4UDTB 4YHYB 3WU1A 1U4EA 2IALA 2EYRB 3LX9A 3QG7L 3NZSA 2MOQA 4FADA 5INDB 4E5XA 2VL4A 4HD5A 1VDGA 5F9OL 3DX6A 1TZGL 3BIAX 2N01B 2UX7A 3MLRH 4I2XB 4ZRGA 5IW6A 3TO2A 2C8NA 3UP6A 4LMQI 2E7CA 5A7EA 4N5EC 1N8ZA 1LO4L 2CDGB 2DQDL 3P30H 4G2AA 5I71B 1TQCC 2ENSA 3BWAB 3BQUB 2E7LA 5E1GA 1RFDH 2ITDA 2ZXWB 4GRWH 2VDKL 3MYZA 3T8VA 1NOAA 3LKRB 4NRXA 5F21B 2I25N 1FE8L 2MQCA 5AVTB 3IVKB 4N8CL 3IE9A 1FV1A 3C5SA 4PJ6A 5J5EA 4IOSA 3KWVA 1BREA 2GEEA 4IKJA 3GB7B 4JY6A 3DUSB 4U1NA 3OR6A 1ZGLA 3QEQE 4AW7A 1ND0B 4AMWA 4ODHH 2FX9H 1DQDH 4XMPH 2HKFH 2XZZA 4YBQD 3RVTD 2FE0A 1XGUB 2AEIT 3QJZA 3VU1A 4JANB 1I1FB 1QZNA 5I5RA 1ASOA 5C8JA 4WNSA 1WK0A 3RA7L 4Y19D 1C08B 4MZIA 5EIIG 1AHWC 2P43B 2C4XA 2UUDK 4PRDA 1QI3A 5K5YA 4AVJA 4NKMA 4L8SB 1NBZB 5B1JC 5D8JL 2XN1A 4HAKA 4QYOB 5AZ2L 4CSTA 1T4KA 4EDXB 2RCSL 4ZAKC 2VQUA 4M8UA 1Q9OA 3NAAH 3QJVB 1BVKA 2DQTH 2XKSA 4M1CD 4W4OC 4LCVA 2DS4A 1J8SA 2Z31C 3FH8A 5IQNA 1LWRA 5DHVA 5I5MA 4D94A 1OOAA 4I3GA 2BRRL 4HEME 4K9EC 5DC2A 2GBUA 2EDKA 4ZOBA 2FIKB 4BGLA 1S78C 4U1SA 5GPRA 1RZKL 5K9KA 2XG5A 3ZL1A 4IU3B 5L9DL 1ZLDA 4DN3H 3P0VH 3QZWA 1ET5A 1D5IH 3LPFA 2PTVA 2ZCKH 4B9CA 5F7EH 3NSCA 5J11C 4YGAB 2L7UA 2YBRA 4W9KC 2X70A 2X4QA 1UKQA 3JWDC 4IOSD 4HX1A 3HC4H 3GO1H 1EJOH 4J12A 2YQ2A 1UM4H 4DH2A 4JG0L 4KFZC 4FQHB 3DXAD 3WXVH 2QPFA 5C0GA 1MRFL 2X88A 5DUPL 2Y07H 5DEGB 4S0HA 3POHA 2R23A 4JO5A 4L29B 2UZIL 4TPRL 1SHXA 3SE8H 3OLGA 2JJSA 1OCRB 3QO1A 2YPVA 4QRAA 4NIYE 5IEKA 4ZFFA 1NDGB 5DHDA 2ICEC 4Y4HC 2I9TA 2D0HA 3JT2A 1TQCB 4U1MB 4MRBA 2OX5B 3QJFB 1KBGL 5J12C 5C0BB 3T0EA 1UJ3A 2G3XA 1JZ8A 2Q9OA 1WEJL 3BZEB 3TV3L 1SY6H 2Y1YA 4PJBA 2DD8L 3G5YA 1WWWX 2V7HB 2VLLA 5IHZA 1ICTA 2JKXA 4J8QA 43CAA 2DQIL 3CIQA 3T2LA 5C9KA 1R3KB 5DSCB 1GMEA 1UGNA 2QFRA 1Q9WA 5CBAB 5I6PA 1YEGL 1DJSA 4HUCA 4OI9A 3FRPG 2K4WA 5EBLB 5BW7A 4XWGH 1N12A 3BAIA 4XNUH 1ZT1B 3FTUA 1TZIA 3K4DA 4Q6IC 1THAA 4AJYV 2DQCL 2O5XL 3I6KB 5AVUB 2GIYA 9PCYA 4K8RC 3ZQWA 3B2VL 4PB0L 4W6XB 5KSBF 4ZG1A 1HH6A 4AZ8A 1OE3A 3O8XA 1D5BA 3Q2NA 1AHWB 1OKEA 2FWLB 2HJFB 3MLUL 2ZUUA 4EVNA 4BFGA 3R0NA 4JFVA 2BOCA 3BAEH 5C07D 2P9RA 4KRNA 2QHRL 4POZC 4TQIA 2KT6A 4KQ3H 4L05A 1R3HB 3L81A 3WE6B 5ID0A 4MJ6A 1IKNC 4NLHA 4KK8C 1C9SA 3GMPB 3GRWL 4MAUH 4FERA 3SPGA 3UGUA 3UAAA 2EE2A 1II4E 3IF1B 4A7GF 2VYRE 2EYSB 2NXYD 4XMWA 4G3YH 4ZAKB 3ABZA 1TKWB 1OTSC 3KPNB 3AITA 3MUGB 1BFVL 3WNMA 1U2YA 3KGUA 5FO8A 3N50A 4M5SA 5D7KD 1IRAY 2Z31B 1ZT7A 1YMHA 1GMIA 4TSAL 5AW9B 1SUJA 2QQNH 1I1YA 2WXPA 3GI8H 3L2LA 2N56A 3SBWC 1FFQA 5IY5B 1KCRL 1X9LA 3T0ED 4ZNEA 3K3QA 3NCMA 4PJ5A 4WV1C 4HQQH 2VDMH 1U8KB 4FLQA 1AZVA 3EZJB 1TJMA 4L3CA 3NZ8A 1JMXA 1UVQB 1FYTB 3K8LA 4MAZA 5J11B 1NIBA 1TO4A 1XFPA 4P46A 1DQKA 3EJQA 4J4PC 1J7VR 1WFJA 3S2AA 1V10A 1BM3L 1SHWA 3GSNL 4Y19E 4RX4A 5GS1C 2YFOA 1CTNA 1L7IL 4OAWA 5D7JA 2ENYA 3A6CL 4P5MB 5D1XD 4YSAA 3G04A 2XPGB 2XZAH 1IBDA 4R7DB 2ICEB 1JWSA 3I3EA 2FO1A 4JFUA 3N40P 4QHNA 4OCRH 5CLZA 5J12B 4NPYB 3D52A 1G7PB 2HVKB 3OM3B 3P40A 1FQ9C 4LIQH 4PLJD 5CJOH 3RDTC 1GOFA 1MCCA 3HW7A 3MV9A 1I9JL 3O0LA 5JHMA 3VUAA 4KOBA 3B2UD 3TEZA 1BWMA 3TPUB 1BCIA 4WHYH 1I8IB 2E7BA 3VRIB 4MJ2A 5I15L 4LRIA 2C4FT 1IGJB 5FKAB 1PGRB 3LH9A 1OTUD 1K3ZA 1FFOA 4FLRA 3TU6A 4LFHG 2PYEA 4OCMC 2EXYC 1RURH 3OJVC 1PVHA 3E1ZA 4G7YH 1RK1A 3HS8A 4D9RD 5ITFA 2FEDD 5A6MA 1H5BA 3LHAA 4PJHA 4JR9H 3A6BH 3IDJA 1OCWL 1ZLSH 1JDDA 3VWKA 4OIIL 4PS4H 2XV2A 2JB6A 4AIZB 2EP6A 3L9RA 2J73A 4HCRH 2DM2A 4PGBB 1TMQA 2WZAA 3O9WA 2AQ1A 4Z6AT 1BQHA 1S9XA 4F58L 3DXAE 3HJ0A 4GNKB 1UWYA 2Y24A 1I75A 3EOYG 2TRHA 1NUNB 1XDTT 1FNGB 2DB8A 2JJTC 1RZQA 2ZUXA 4XAKE 1XEUA 1TZGH 5F9OH 1DSYA 2WTRB 4UTAH 1DTUA 1MCHA 1RP8A 2AITA 1F1DA 3QBTB 3QH3B 3V0VB 4HDIB 1LO4H 1KTLB 4UT7L 4UYPA 3SBPA 3DX3A 2DQDH 4MYPA 4RX4D 3S5LA 1NCAL 5I8CB 1WBXB 1PY9A 2UXGA 2K7PA 2IO5A 4R7NA 4O2CA 2VDKH 2X6UA 3T65B 4OD1L 4WTZA 1FE8H 5KN5A 4X99B 4LVNB 4N8CH 3DX4A 4MXQC 3L4TA 2WK2A 2QVKA 5GXBB 4QCIA 4S10A 5I1AA 1KLFB 4WUUE 2KDYA 2G4EA 1EZVX 4YHOH 3QNXA 3RP1A 3MV8A 3DGGB 1J9RA 1N4XH 3GDCA 1DEDA 2JH2A 1EHAA 4HUWA 2X1PA 1MRCL 3ZDXE 3SKNA 3KEHA 2PYED 1MH5B 1KNOB 5FECA 3ZOAA 3U0PB 1KJMA 1G7JA 3DIVA 4NOBA 4NZTL 4Y8DC 5DQ9A 4QRSB 4ZW8A 1GRWA 4JPWL 1R3IH 4GO6B 2LU7A 4AVKA 4JFPA 4AGNA 2CHNA 4PJIB 2G3MA 3H9ZA 2CJSA 3D0LA 5C07E 4YS4A 3EGXB 5ESVB 3DPBB 2NY1D 4HUXA 1LWJA 1BOGB 5IHUL 3C60D 5D8JH 2WANA 1SF5A 4P2QE 3UXFA 1IAOB 5FXCH 5AZ2H 3SZKC 4N1CA 5C3LD 1REIA 2RCSH 3SDDA 3TO4A 5M95B 2G60L 2A77H 3GDBA 4TTDD 4DO4A 1XIWC 1MWAA 4YDLC 3KEDA 3FQ1A 4KO5A 5D7KE 4AM0Q 3DUUA 2R1WB 2XA8L 3RKDC 2BRRH 5IVOA 5KS9F 4TLKA 4HH8A 4JHVA 1A7PL 3RL2B 1KUMA 4QIRA 1RZKH 2V6HA 2ZWSA 2C1OA 2FYYA 1SVZA 3CDZA 5EU6B 4JHAL 4L5FE 1BF2A 3QK0A 4LESA 2Q5BA 2YARA 4J3OD 1DJZA 5IK3A 1SHMA 3GTTA 4JG0H 3DIFA 4HGMA 1SJEA 5DUPH 1XGPA 5J4MA 1O6VA 4K71C 4UANA 2UZIH 4TPRH 2MNUA 5D7LB 4OJYA 4QKTA 4G8GA 3LIZA 3DX0A 3PWPB 3N41B 3RG1C 1T4WA 1RIHH 4M4RB 5D1XE 2EINB 3LVTA 2GCYA 4P8QA 4IOFD 3V4VB 1RZGA 1OQXA 4P23C 3ULUH 4MD5B 3SDAD 2FB4L 1RZJC 3K0WA 4ODVL 3SYPA 3T3PE 1KBGH 2EH8L 2YKKA 3SN6N 1AO7A 1LDSA 4KJWD 3OD3A 4F9PC 4NQXA 5FOBA 4ZS6C 4ZFOB 4LBEB 2UY6B 4YQXL 3GSQA 1Z7JA 1XGQB 4GW4A 3NCWA 5HJGA 3SDDD 3TO4D 2Y25A 4BXVA 3OKEB 5HHOA 1MLBA 2WTOA 2Y2YA 4GXVH 5DMIH 4G9FB 4Y5YC 4P57A 4H1LG 4LGPB 4PMFA 2C3XA 2P5ED 4I1RA 2EUZA 2G2NA 5FEBA 5E6IC 3SDXF 2EE6A 1KENH 3O11A 4KFMA 2DQCH 4XN9A 4K3EL 4ZDHB 1IEAB 3B2VH 2A3TA 5IVXE 1NC2B 4DKFL 3FUIA 4PWKA 2P44B 3EDFA 1V3LA 1ZVHA 4I87A 4F24A 4YIQA 1A22B 3O2WL 3KYOB 1DQIA 3BH9B 3FNKA 4KNTA 1NGZB 1KIUB 1P6FA 2DEWX 4TQHA 5E8EB 3FTWA 3LNIA 2YJLA 3GRWH 3QPQC 2I85A 1XCTA 3NIDF 4AT6A 4WFGD 1BQSA 4MAYA 5DZ9A 3IS0X 2AZUA 4YPJA 1MF2L 5E7FA 2APXA 1BFVH 3MRMA 3Q8FA 4JCLA 2IH3B 3A4FA 2NNRA 1XIWB 3QQ9C 3H56A 3L5HA 4WUUB 3UADA 2AXFA 5CZVL 3L7FB 5J3HD 3CXFA 3ZTDC 4TSAH 3FUKA 2HX7A 5GISH 4JE0A 3VQLA 3PAYA 4XNXL 1WVZA 2W0LA 2UVFA 4F8OA 1VEMA 4NO0A 2DMKA 1PW3A 4L37A 4XPHH 5FKPB 3V4PB 3JTSA 1FZOB 3V5DB 2FECL 2LAAA 2O72A 4R5XA 4MS8C 4NI3A 5C0AE 2IDSA 3P4MA 2G0LA 1JGDA 3WJMB 5ACMA 3Q6FA 5D7IF 4GSRA 1FLRL 4ISVB 1G9ML 1I9RL 3OBAA 4FHBD 3AT9A 2P80D 2BNQB 4UNUA 2HYMA 4OF6A 5EC2B 3GSNH 4K71B 3SOTA 3BAYA 1S7XB 1YNTB 3C5ZA 1L7IH 5KSBA 4P2QB 3A6CH 2HT4D 1J8HB 3GSWA 1MRDL 5DJDB 2FUQA 3QSKB 2AVGA 2JELL 4BKTC 2DIBA 4HV8B 4K23L 4PJGF 1H3TA 4QPEA 2X12A 4XNZC 5D6DA 5AW6B 3VXUA 5JNYB 1KT2B 4IBZA 5DLML 4WEMB 1CD0A 3LXBA 1F11B 5DJYB 3JV4B 2X5PA 4N0FA 5DGQA 5I6NA 4FYQA 4A7GA 3OPZL 3D2UB 3GS7A 5I15H 3WY4A 4NQEA 3PHOB 4IJ3C 4HIEA 1E4KC 4MTMA 1TJHL 5E9NA 5I16B 5JPMA 4CU7A 5FOJA 4MDIA 1LEIB 3DSNA 3GRGA 5I5IA 3QHZH 4ECNA 3I50H 2BOLA 5CN3A 1OCWH 3NK4A 1ZLUK 3T8XB 3SD2A 3TM6A 3UAEA 4OIIH 1PKOA 1QWNA 1UD6A 2XCMC 1QQDB 3JTTA 1GY1A 4X6DB 4BFIA 2K6YA 1CK0L 1ADQA 2RBLA 1UENA 1FC1A 5KJ7E 2OZ4A 1R5IA 4OJCA 4AE1A 3PWUA 1EBPA 4XHQA 1X4YA 3X12A 2UZPA 2XKNA 4N6RB 2IOMA 2AV1B 4EF3A 5AL0A 1PFOA 3CDCA 3QDJD 4EN3D 2WY3B 3ZE0F 5IV2B 4GMSL 4N0RA 4WGVB 5T1LD 2V9QA 3S7GA 4UT7H 3PP3K 5B38B 3PWLA 2CD0A 1F4AA 1SLXA 2BFVL 5AOKA 2N7SA 3NDYE 2FX8H 2ZWYA 1FG2B 2DI9A 3ESVF 5IEKB 1PKQB 4F7CA 1S3KH 1BVZA 4OD1H 4XN8A 3VE0B 1JPGA 5I26A 4F7MB 1JS4A 1DJHA 3VXUD 3ROOB 3CSYB 5MP6L 3K80A 1HOCA 3WLWC 1EHXA 1NFDE 3AY4C 4M6OL 2VLKD 2IDCA 4MJ4A 1H6FA 3DOSA 3BZDA 3VGDA 4FKEA 4ANXA 1PNDA 1XSJA 2P5EE 1ED3B 4OV6F 2WQAA 4RBPH 1ML0A 4RMTA 3ZT5A 1MY5A 4R4NC 1OAQL 4RGMC 1BLIA 5A2CA 1PPIA 1C1EL 4CC0A 2PN5A 1QPPA 4HSCX 3MRBB 3LEXA 3Q44A 3F7LA 5IP4A 1ETZB 1BVOA 3GPEA 1HXMA 3ZTJH 3BHBA 3CXDH 3OVUB 4X7TB 1JZIA 1T21B 1S5HB 3IJYB 1VFMA 1BQUA 4XNZB 2GFBB 5I1GL 1HCVA 1SXNA 4F33A 2NUTB 5AOIA 2O61B 3PAUA 3G08A 4XN1A 4WFGE 4HOZA 5DHMC 2G60H 3L1FA 4XOBA 5CKAA 1HIML 1PX3A 2R59A 2OTPA 4A7TA 5SV3A 5I19L 4IJ3B 3BX7C 5IR1A 2AK4B 2XA8H 5HI3C 3RWDA 3CK0L 5C0AB 2L04A 3V10A 4GAYB 2R0KL 1A7PH 4P49A 1XCQA 1EPFA 5A3IC 3KGSA 2Y1ZA 3MBEC 2EXTA 3IU3B 1NBVH 4JHAH 4O00A 3HMWH 4LEOB 1A7RH 2W0FB 1IFGA 1QHOA 2G9KA 4KDTC 4H44C 2F7IA 2J1YA 2NYZA 2DQJL 1J8RA 4Y9FA 1EAPB 4LOUC 4GXUN 3L95B 4LCCA 4UU9B 3CH8A 1RZIB 1G7HB 4X4XA 5I28A 2NNXA 2IPTL 4FHJA 2OCJA 1PEZA 2DV6A 2EYTA 5GGVL 5FB8B 5JHLL 1QSVA 3V0FA 3ZL4L 4QRBA 3QFDB 4MA7L 2Y5QA 4PJ9C 4PJDF 2IH1B 4XXDB 3J8F7 2FO8A 4JY5L 1UKSA 2CJTA 2FB4H 2ZUYA 3OC8A 4PV1C 4PWJA 5EZJA 4AGLA 4D0BB 5CEZL 4DKDC 3BP4A 5IMKB 2G3NA 5F88B 1E5YA 1ZA3A 2W0KA 4ODSL 4OGAC 3HZKB 4KTDL 4YQXH 1I3UA 1EX0A 1X5GA 5J1AB 3LZFL 3QCVL 4PTTB 5C08A 1G1CA 3V5HA 5KYXA 1E65A 4WWID 4IBUA 3P0GB 1JXGA 1PZCA 2ZCLL 3V95A 4ONGL 3GSVB 5FV1L 3L5IA 3EDKA 3AQXA 1P4IL 1OK0A 5LBVA 3PQYD 4GT0A 5IHWA 5KS9A 1BPLB 2HAZA 2XWCA 3FUMA 1X5HA 2Y9RT 3WFHB 1I3GL 2NMSA 4DT2A 1LQSR 2VO8A 1U8LB 4K3EH 2Q3XA 4XRCB 4UOQA 1AR1B 4RGMB 1FBIL 4GT7A 1AIZA 1H8OA 3MGOB 3AXLB 3WJLC 2DQMA 4ZZKA 1F90L 4H0IA 5T1MB 1OQOA 4HZLA 3QZOA 4L8BA 1KC5H 4HJ0C 3ATBA 3HFMH 4FX5A 3O2WH 2XRAL 3SDCA 4ZMWA 3RGBA 2BC4A 2BRQA 4ZQTA 4UF7C 5ADOL 4FFYA 2EDFA 4O2EB 3B6SA 4BWTA 5EF0A 3GBNL 4FG4A 3OKDA 3QDJE 2NW2B 1N59B 3O2DA 4PS8A 4BSWA 1MF2H 5BUPA 3MBWB 1BD2A 3KH3A 3QNYB 2GTWB 2YBGA 4MNQA 4MMZB 3ZJAA 4GAAA 4KJYA 3MJGX 4XNXH 3VTMA 4J28A 3FO9A 2GY7B 2ISDA 2HFEA 2YD8A 5B21A 4IRJC 2VLKE 2CBOA 3MBEB 2LLGA 1PS3A 3AUVA 1B0RA 1FUNA 1X6NA 1WGVA 1GS7A 2ZOLA 2YEVB 3E6FB 3NN8A 4B0MM 3FQTB 1TO5A 3ILDA 1FLRH 3SDXA 1G9MH 1I9RH 3CWGA 3JWNH 1RMFL 3VFNA 1UWEL 4R97C 3ILPB 5GS0C 4AIOA 5CN2A 4KKCD 1VFAB 3CFIC 4G8IA 3O6KH 5H2BB 1YY9C 2H0FA 4PRID 4ZSOE 2WGXA 3LH2H 1NIFA 4PJ9B 1OE1A 5T1KB 4PLKD 2LFEA 3WHXA 5CGBA 1F41A 3L4UA 4B9GA 3W1ZA 5D2NA 1U8MA 3DVIA 1QLFA 3EOBA 3IDMA 4Y1AA 3EF7A 2GT9B 5DLMH 2XI9A 3SE9L 1QLEB 5DRXA 2WLKA 4GG6B 3KL5A 3OPZH 3MUJA 3FCSA 3HKFA 2QR0A 4AY0A 1INDH 3ARBA 2DRUA 2AS5M 4XO8A 3S88L 3ZX1A 3DX2A 3EJPA 4OJFL 1KJ3L 1TJHH 2D4FA 4JM2D 4LCYB 5J6HB 1Q38A 3MAWA 3NZUA 4J3UA 3FB6B 5E08L 1NTDA 1MCPL 2HUHA 1ZSHA 4RVBA 4MNQD 8CGTA 1AD9A 1MHCA 4H4NA 1AACA 2ZP8A 4KHTH 1J5IA 1FVCA 2V3EA 5JZ7D 4ZPTB 1I8AA 4MDJA 1I7RB 5E00A 5FGRA 4NUQA 5FW6A 1X44A 2WINB 3IK2A 3VI3B 4CGUB 4E9TA 1OCCB 1T7YA 1BZDA 1S7VB 1F18A 1JPTL 1MFAH 32C2A 3HI6H 3HS9A 3KXFE 4FF9A 4X0KA 3K6IA 3OKMB 4Z95L 1MFNA 1YEEL 4LSRL 2GSGB 5D7IA 5I23A 3RWCB 3D48R 4HHAA 2W95A 2VQ1A 4WNJA 4IMKA 4K5LA 3TBTB 5IREA 1BX2A 1EEZA 1MCQA 4PCTA 4WHCA 2AK1L 4QHMA 4GMSH 5IF0B 1MJ8L 4DERA 4M43L 3VI4E 3VXRB 4B50A 3QZNA 5CAYB 2UX6A 4DSYA 5HHQB 3ABMB 3QO0A 2BFVH 3VD4A 3WJJA 4XNAA 5D2LE 4PJGA 4XP6L 1TEGA 3VFMA 5K9QG 3GLZA 3LNFA 3LZQA 1Z32X 2R69A 3FHEA 4XP1L 3GI9L 4UTBA 2LGNA 2R0LL 2XWBB 4LAQH 4M6OH 3U7WL 5AKRA 4IEFA 4IRJB 1KBVA 5J9PA 2ICWA 4NN7C 3HFFA 5SWQB 3EDEA 1JTPA 4GAJL 3PQYE 5F97E 3VH8B 1IILE 1QW8A 2L0DA 1QVOA 3KWWA 1OAQH 1WUNT 4R97B 4JQVC 3AADB 4R2GD 4Z0XA 3MUZ1 3CXHK 1X7QA 3DX1A 1YECH 3GZQA 5I6OA 1SDDA 4TL4A 4IBLT 5C0EA 3HTLX 2D0GA 5IFJB 1R5VB 4Z7OE 1ZDQA 3HA0A 5CR1A 1OL0A 3LCYA 3WKNA 1F0LA 2QADD 4PBDA 1KGCD 1A8ZA 4H26A 4PRBA 3W9EB 3DK0A 3CU1A 1IGCL 5I1GH 1SMOA 1BJ1J 2H6PA 5F7WC 2DLEA 1LO5A 2G5BB 5AW5B 1S7WB 3UTZA 4HOWA 4E41B 4IHOB 3SE4A 5AVZB 2X0WA 3N0AA 3WBDA 3PNWA 4KUZL 2NZ9C 1YAIA 3LEYL 5KYWB 1NDMA 2R0KH 4PJ7F 3N04A 1HEZA 2AKRA 1G84A 3V52L 4GH7B 4L2YA 1J05A 4P4KC 1AZBA 4ZXBA 2ICCA 3I02B 5ANMB 4MNGA 3W2DL 3HG1E 1WZMA 1QFWL 5CIPB 3WEBA 2A6KB 4KZ0A 2J8UE 2AFNA 4G80B 3RTQA 1S9WA 4YDNA 1CBVL 4UOJA 5FUOH 4L1LA 4L9LA 1G7MB 2NY3D 3EJTA 2JI2A 3CZSA 3HRZA 3T4AA 1AZRA 3RHWF 3II3A 5JHLH 1KY6A 2UV3A 3FL7A 2WBJD 4PGCB 5DDHB 1XZWA 3LRHA 4MA7H 4PRIE 4DCQB 5TK4A 4B9KC 5ICYA 5E8NB 1KN4L 1AZUA 4JY5H 1XF2A 1NGXB 5CEZH 3ZL2A 2UZXB 4A37A 3O81A 2VW4A 5B7MA 1T1ZA 4ZX3A 3C8KA 4ODSH 5DVKA 3UTPD 4KTDH 1E28A 1EV2E 1NFIA 3CZKA 3LZFH 4OCWL 4B9PA 4XNYL 3WUWB 2ZCLH 2R4RH 4P3DB 1VCAA 2V2TB 1T1YB 5BZDA 3KCPA 2OA9A 4ONGH 4OUUB 1ORSB 4F8NA 2WVUA 1P4IH 4NN7B 4Q0XH 3S36X 1ZGLM 1D5ZA 2NY4D 3AWEA 4QRRA 1KXQA 1UD3A 2Z6FA 3BSHA 4YR6B 2ZXQA 1BVLA 2JVUA 5ALCL 3BEWA 5B1KA 2KYIA 2AV7B 1H6EA 4Q2ZA 4KWUA 1IAIM 3W3BA 4C56A 3ARRA 4PVNA 4YHIA 4IOIA 1A4KA 2L4OA 4HS8H 2F19L 1J0IA 3B9DA 3L4YA 1YMMB 3IGKA 3V7AG 3E80A 4TF4A 4OVUA 2JK5A 3NJGA 2WLNA 4GW5B 3QC5X 5L7XL 1OF0A 3G5VB 1OZTG 3QI9B 1B4RA 1J12A 5EU4B 3N3EA 3C6SB 3ULVD 2EDJA 1IGYB 2DYPA 2VB5A 2NSQA 1AANA 2VDRB 3NJHA 4Y2DC 3E0GA 4FYRA 2XN9A 5F0MB 4WJG3 4MQ7A 4QO1A 1ZANL 4PJDA 3QUXD 4UQ9A 1B0IA 3U2SB 4F8TA 5IQ9B 4JFYA 4FXTA 4JN2A 4LLWB 2O1AA 4TTGA 4MJHA 4BZ2H 2YD3A 1L7TH 3UFIA 4X8XA 2OCFD 3LKSA 5EZIH 1J1XL 3QJHB 1BFSA 3ARDA 3OXSB 1MFCL 2X0UA 3QFJA 2A9ML 1NGQL 2ZP0T 4OZFA 2VISA 3MRLA 2Q6WA 3TA3D 1AGCA 4P4KB 2CLVA 1JMZA 1U8OB 4RIRB 1NJ9B 3ULAB 5HY9B 2R15A 2GK0A 1CICA 1N0XL 1WDAA 2W5PA 4YMPA 1I85C 3LKQB 4FXLA 5CFHA 2VR5A 4Z7OB 1RMFH 1E4WL 1UFUA 3U1PA 2X4TA 3TLRA 4EXPX 2OL3B 4P9ML 4JCMA 4N6QA 1U95B 5DEFA 3IWUA 2Z7YA 1E3XA 3FQUB 1WC7B 3QRLA 4MJ5B 4QRTA 4GAFB 3RPKA 1HINL 35C8L 3KR3L 3CJJA 1VIWA 3IU4H 3OMZA 3S4SB 2H1LM 2DN7A 4ONFH 1KGCE 2PXYD 4DZ8B 4XWOC 2XPZA 1W0VA 3NH7L 2GUYA 5GIRB 4BYHA 1HX0A 4AEHL 4XBGA 3A5VA 3W37A 1XH2A 5FAAA 2I32A 5BRZB 4IJTA 3RPIB 1A7NL 4IGBD 3S88H 4OJFH 2DYPD 1KJ3H 1OD9A 5DU7A 5DURB 5DUJA 5DQJB 4GSUA 2J25A 2BOBA 3CU7A 1TQTA 3BLBA 3FO1B 4G11A 4PRPB 4XVJL 3HG1B 5LXVA 3U4EB 2VKWA 4I0PA 1MCPH 4JDEB 2VMJA 3M86A 5KYUB 1JGEA 3RZCB 5SWSE 5E4EC 1SMDA 4PJEF 1JYWA 3ROLA 3BPNC 4F2ME 1IC4L 5F1NA 4YXLL 3QR1A 4DF9A 2VGLM 5CD5D 1WFTA 2JB5L 2QVIA 1OOWA 1HYSD 1GGUA 1Y0LB 2EDEA 4Z95H 1KBBA 1OT2A 1YEEH 3ES6A 3KPMA 1N0LA 2LV4A 2XWEA 3G5XB 3GJFA 3JYCA 4N0UE 2F61A 3MLSL 2MQ3A 3UTSA 1CICD 3M8OH 2EUVA 1CTMA 4P2OC 3QIUD 2EEAA 3EJYC 4FEIA 4PW4A 4M43H 4PJAE 4Y2DB 3D2TA 1LILA 3LKOB 5F6IC 2ZKXA 4W9GC 3BP7A 3L45A 1DQLH 1EDQA 5IB3A 3UPAA 3ZR5A 5C0IB 4AYSA 2E3VA 4LPTA 1A3QA 2G2RA 3T5WA 4XP1H 1X4XA 1G4MA 3GI9H 5B38G 2ZF8A 2D0FA 2R0LH 1AGEB 1NSNL 2NNFA 3U7WH 5HHNA 4DGVL 1U42A 4OZ4A 4XXCC 2PWDA 1VAHA 1JZHA 2UWEF 3EJUA 4H25A 5LBSA 5KVGL 3QRFM 3E8UH 1BV8A 4GAJH 3HB3D 1ZHBA 1QKZH 1HWWA 3DK2A 1I1CA 1ZS8B 5F3HB 3AC0A 2V33A 3WY2A 1CC3A 1N6VA 3CZEA 3VDBA 5L2JA 1SEQL 2X05A 4GAGH 5JO5A 1QUNA 1K5WA 3OKNA 5DS8B 5KW9L 4Q9CA 4FCHA 1VFOA 4NHUA 5FFLA 3N44F 4LDEB 3VVWA 5MEPA 4L4TA 4DGWC 1XD0A 2P26A 2BHFA 2J1KA 2NY2C 3AS0A 4GI6A 3IFOA 1H8NA 4AI7A 1CE6B 1YLBB 1MIEL 2Q0ZX 5DF0A 5E0FA 5GGUB 2J7LA 1D7BA 5FYKD 3AU1A 3V0IA 2VXQA 5EBMA 1V3KA 3ZY7A 2QVFB 5C7XH 4NZ8A 3RVVD 2W59A 4YSTA 4BH8A 1Y1UA 3UTSD 2J6EL 2G5UA 2C34A 4AYID 4ZMQA 2B3RA 3GSRB 4G9DA 2VM9A 1I7TA 4JPVL 2OMYA 1KXVC 5I1CL 2HT3D 2CIIB 1YUKB 2H32A 4KUZH 1JFQL 4XP4L 5D7HA 1FFPA 2ZICA 1RUKL 3A0OA 1A3RH 2NX5D 3LDBC 3V52H 1KYDA 3K2UL 3QPKA 4M7JL 4QF1B 5M94B 2H1XA 3CHOA 3BPNB 1KBKA 3W2DH 2ZX6A 4GIPD 2ZSWA 1QFWH 2QLVB 1LDPL 1OGPA 3L7EB 1DQML 3X14B 1MWOA 1VGKA 3BWUC 4CW1B 2HWZL 2FRGP 3I9GL 1UTDA 5C92A 3CXHJ 4YL9A 2FTAA 1IKFL 5DO2C 2QELA 4MX7A 1BXVA 2ID5A 3UJIL 1M05B 2WB1A 4ZW3A 1WBYA 2CO7B 4PMEA 4LLDB 3ARFB 2LE9A 5F6IB 4ABUA 1KN4H 4LCWD 1H9DA 5TDNB 1TJIL 4K94L 1O7DE 3RUGE 5T1DL 3PWNA 3M7OA 4UQ3B 2JI3A 4NB7A 1U8JA 4UQEA 1GIGH 1UD5A 3FCTA 4HAGA 4BA0A 4XNYH 5L4JA 2J44A 2WVVB 4TVPE 1IC7L 3WN5C 5SWSB 3CH1A 3CHQA 4U6XA 4FFZL 5MEOA 4PJFF 3BSZH 3ULUF 2XVBA 1AG0A 1FFNB 5BZWA 2NQCA 3CPLB 1G7QA 4IHBA 4YPGA 5LB1A 4X7DC 4WI0B 5ALCH 3QUHA 1P69B 2DKSA 5C0FB 4FTVA 1MCDA 5EEUA 4P9HL 4N0UB 4KK9C 1A1OB 2COQA 2UUDH 3ARVA 3EBGA 1WBZA 1DUZB 4ZUVA 1AE6H 4H8WC 1NLBH 3FB5B 5FYLL 1WJ3A 1NH6A 3MO1B 2F19H 3STZB 1UYWL 3L6FB 2HTLC 5DFAA 4DUXA 3VD2A 3IDIB 1X3DA 4AYFB 1R34A 3C6LC 4JQXA 4NFBA 5L7XH 3HEIB 3MRNA 4GMTL 1MIML 1BQRA 1I7ZA 2NY2B 4LE8A 5AW1B 3MRIB 3ETBF 4JAMB 2BX5A 2R2BA 4LHUA 3ARXA 3H42L 4YHKL 3MR9A 2GBVA 5EUOE 3M46A 1ZANH 4YFLF 5DD3L 1EEYB 2R29L 3HZ3A 1BVNT 3MRPA 1Q9KB 2VDOB 3IS1X 5GZOA 2BNUB 2P49B 2Y1VA 2YR3A 4H1LH 1SZNA 3LNDA 4CKVX 3CFJA 1UXLA 5A16A 5C9JA 4KI1A 3MKGA 1OT4A 2YPLB 3LDBB 1PBYA 1NGQH 5D5ME 3CN1A 3DA0A 2WWMD 1UB5A 2OMWB 3FFDB 3TWCL 1P1ZA 4WDIA 4MGXA 4BFBD 5I73C 1W2KT 3IBOA 4LSPL 3GEWB 1NGYB 5DUBA 2IGLA 5E2UL 3EGSA 1HWGB 4JFOB 5FA3A 5C6TL 4MWFB 5TTRA 1EHLL 4A39A 1BZQK 2BIOA 3PAZA 4NFDA 4HIIA 4NNPL 3HNVL 2EVFA 4P9MH 1D6EA 1JZ3A 3D18B 1U92B 4TULL 5CHNB 1R3LB 4S0SD 2VSMB 1GW0A 4KHXL 3DX8A 4QNPF 7FABL 5HI5C 5ID1B 5KYYA 4WTQA 2FJSA 4UV4L 2XDHA 1I8LC 3KCWA 3BXNA 4XPFL 3ZIYA 1OK8A 1XH1A 3HI1A 4CRPA 3WNJA 3AGVA 4KPHL 4WKXA 3Q1SL 5DVMA 4YLQT 4RDBA 5E7BA 3RWFA 1DLHA 2PR9A 1WQVT 3U46A 4E9VA 4M48H 4FQCH 4PBXA 5CSBA 3NH7H 3L3DA 4JM4L 4HJGB 1D5MA 4OD3H 4W9CC 4WQOA 1ZHNA 2CRIA 2OI9C 3CFBB 1A7NH 3M17B 2VAJA 3MLYL 5F70A 2F7RA 1R3JA 1OAKL 1ZHKA 4OKVA 3CFUA 4LHUD 4UWQB 1DUYA 5KSAD 2EABA 4P59L 3ZDWA 3EAKA 1ERNA 2XBZA 1K85A 1GHFL 3BWZA 2FQDA 4K9EL 3WS6A 3OWRA 1X5AA 2EDMA 1F4YL 5DJXA 2NX5E 5F7YC 3PABA 3TJEL 3MFFA 2DEXX 2IPKB 3C8DA 4GRLC 5DZPA 4JG1H 3FO2A 4LPXA 3SJVB 3QORA 1IC4H 1U41A 2OS7A 1T66C 4YFEA 1T3FB 3K2IA 2F15A 5DT1L 4EIZC 3S3CB 2JB5H 4M7KH 1GZQA 5E51A 3C6LB 3VMPA 3MLSH 5EN2B 3DRTB 1KEML 1MDTA 2NW3B 4NIKB 2ITEA 4W1TA 4FQ1L 4JVPA 4HIXH 4MZRA 4X7CC 1GY2A 4N2MA 1GGBL 3UTTD 1NC4B 2OFQA 3N43F 1MEXL 2OW7A 4LCWE 1PJ9A 2DQFB 4WO4A 2JI1A 3U0TA 4UQ2A 1X5XA 3BIBX 4OZGB 1IQDB 2CDEB 4M93C 1ZTXL 4RFEB 2B39A 4F57L 4BCXA 4DGVH 2F54B 3ESOA 4TSBH 4G6AD 1E4XI 4KKRA 5KVGH 1E9PA 3NCEB 2G9HB 5I73B 2FWOA 1M7DA 1AQKL 1EO8H 4UM9D 1PQZA 4L8DA 4XR8C 3WEXA 2WXLA 2D9QB 3KMDA 1MCOL 4XMVA 1IAII 5DK0A 2V8LA 1A7QL 1NCHA 3DGDA 5EFIB 2NY0D 5F44A 2RJMA 1OWWA 2WQ8A 2A83A 1SEQH 4K8RL 3QZMA 4PJEA 1G0YR 2WCGA 3SBRA 3TN0D 3W0WA 4HEPA 4H5SA 5KW9H 2X9XA 1I1RA 5CEYB 4OBSA 1U8NB 1N3NA 1T6VN 1TT6A 3VH8G 4OQTA 3VWJC 3NIFE 3OGCB 3U9WA 1NL0L 4KROC 1RULL 2JQAA 4NERA 3QA3A 4N28A 1ZHLB 2OSLA 3FU7B 4GRWE 1NA8A 3AB0B 4O02B 1BAFH 2OCCB 1WGOA 5IROA 1JV2B 2OI9B 1PZUB 3PS6A 3SPJA 2J6EH 1XR8B 3SQRA 4JPVH 4FRWA 4HFUL 1JK8A 1RJLB 3AG3B 4JREC 3OB0H 3BFQG 1DQJA 2F7QA 4NC1C 3GIVB 4XP4H 3DSFH 3KHOA 3L3KB 3O3EB 1UQSB 4PP1D 4WO4D 3ZHNA 4QJ5B 5CS7A 3BH8B 3GIZL 4DVBB 2F08A 4GRLB 2KPNA 4MQSB 4XNDA 3MA9H 4NAQA 2UWEA 1CFNB 3UYPA 3FCBA 1E4JA 1HSAA 4OB5L 3T77A 5F1IB 2LQRA 1DQMH 3KG5A 4AC2A 4AE0A 4I3RL 4WWOA 3LN5B 4HA1A 4U3XA 1W72A 5ITBH 3QR2A 3KJ4C 1XGYL 3RBSA 4IBQA 2ZSVA 1IKFH 4JDTL 4UB0L 4CAGA 2E7LC 4CADA 2ADIA 4KNUA 4PJ7E 3FFCB 3OV6A 4KH2A 3RTLA 5IHLB 4P5KB 3HHSA 3IGFA 3NDZE 2V17H 2XWRA 3SKOA 1W91A 2QHLA 1WIUA 4YOKA 1TJIH 4CNIA 2BS8A 5ALBH 2AJZB 3EYFA 5IB1A 2GABA 3U1QA 1AP2A 5T1DH 3QZPA 4JJOA 4RISH 4XCNA 5H94B 1HKFA 2VDLB 4CL7A 2JCCB 2NZ1A 4X5QA 4M1GL 2OMXA 4M93B 5CGMA 4LEXH 1IC7H 2ARJQ 1HCZA 1WT5A 4PD4K 4WNQB 4NM8L 1WE5A 4EI6B 4CVWA 4QY8B 3NVQA 4YC2C 3WGVB 2E27H 4AVIA 1UEYA 4BCYA 2OMVA 4UQAA 5C09A 3R19A 1A8JH 3OXRB 5KBKA 4D8PB 4X4ME 3WUWG 1TF4A 4KK6D 3H6AA 2LFGA 2JJWA 4AMKH 4YHNA 1OAYH 1S9YB 4KRPB 1OARL 4TUUA 1NUGA 1D9KA 3RWIA 4WWKA 1UXSB 1FIEA 2NLJA 3VWJB 3Q13A 3WE1A 3LKPA 1MIMH 5I76B 1KSRA 2NNAA 4NC0B 2AQPA 1GPOL 2D03H 2OJZL 3AQYA 3EYVA 1IT9H 4KROB 3UBGA 4BKLA 5LAXA 3V6OE 4P2RA 3IFPA 3KNBB 4ETQB 3H42H 1TCMA 4JY4B 2OKMA 2ZUSA 4WKZB 4JLRB 4YHKH 4BGDA 3GUTB 4UT9H 2NQ3A 5JW5A 3U4KA 3UTTE 1TOXA 2QQLL 1NPNA 2R29A 4X98B 4AV0A 3FONB 2ZX9A 3MNWA 4JREB 4ZFOL 5AFAA 5EORL 3WDHA 4FXKA 1JE6A 4KMTL 4X6CF 4C4KT 2YRZA 5HJ3B 2BS9A 5I74C 1AG6A 1YN7A 2XN0A 3HNTL 5CU5A 4PJFA 4PJXF 1YEKL 3HE7D 5I1KH 4LSPH 1DJYA 3DX6B 1IBGL 3X1EA 4KKLD 7PCYA 4JHWH 4HXAL 5E2UH 1DANU 2WXIA 4JZNA 4LXFA 5IW6B 3TO2B 2FHBA 3DJSA 2JJSC 3WFBH 5LGJA 4JFDD 4TRPH 3WIIL 1CMOA 4UIKH 1TQWA 2WSKA 3OKKA 1NCCH 1N67A 1N8ZB 5E2JA 3HNVH 2K45A 3KJ4B 5I82A 1QR4A 2VMCA 5BJTA 7FABH 6PAZA 3T0EC 3QEHB 1AGDA 2ITDB 1DDTA 4AGMA 1UJ3C 5T5NF 2DY2A 1YJDH 2HRGA 2VLRA 1YNLH 3WELA 1R5WA 4KJPD 3Q1SH 3FUJA 3J27A 3C2AL 2A6DA 1FV1B 5T3XL 4YAQA 3C5SB 3H53A 1FL5A 5G4MA 3NCFB 1D9KD 1A21A 1RVFL 5D1ZD 4JY6B 1D2OA 3O45A 3OR6B 1XBDA 3P77A 3BP5A 4U1NB 1HI6B 3T3MB 2R0ZL 3FYEB 4EO5A 2XQYA 3HHRB 2AVFA 3MLYH 4HXBH 4AGQA 2F8OA 5BW7C 1Z9PA 3S4SG 1MAJA 3ZU8A 2GBAA 4QTHA 4N0YH 4P59H 4UQDA 1F2QA 3EYQC 3HAEA 3V5KA 4YJZL 3VXSD 1GHFH 2OZNA 1EXHA 3U79A 1UZGA 4YC2B 2WXFA 4A2DA 1F4YH 3O8XC 3NT0A 4BFFA 3LS5H 2X2JA 3PP4H 4RRPA 4PRDB 4PLJC 2DJSA 2JKJA 5IOPA 3RGVD 3AAZA 3MMEA 3ZBMA 5EBGA 5D71H 4NKMB 1KIPA 3JWDH 1ZVSA 5DT1H 1Z0NA 1UZ6F 1LLAA 1MG3C 3VCLA 1H8LA 4OY9A 4KC3B 4KH9A 2DLFH 1T4KB 5AZEH 1CZ8L 1KEGL 3HR6A 1FL3A 3ULUD 1WTGT 1KEMH 2B20A 1Q9OB 4FQ1H 1E9QA 1BVKB 5JW3L 4WGWB 3M45A 1PFCA 4E9XA 1CFTA 3GK8H 2KKQA 3RURA 2WP3O 3L3IA 2NQDA 2HZHA 5GRXG 2WNWA 4KTGA 4LCIH 1AKPA 1RZJL 5ERWA 4ETYA 4G72B 1MNUL 1N64L 2G30A 5K9KB 2XG5B 2VLRD 4X9FA 2XVLA 3QZWB 4U2YA 1AVAA 4A04A 1WUZA 3V7MA 2YBRB 3R7RA 1MCWM 2X70B 1ZTXH 4E0RA 4P46C 5D1QE 4F57H 2V2WA 4HX1B 4FQJH 2X2YA 3VO0A 1W80A 5C0GB 5I74B 4NQCA 2IXQB 2ZAGA 4WI8A 1KCBA 1YEDA 2H8PA 1NKGA 3L9BA 2WLIB 1MFBH 3FQRA 3SQBA 1AQKH 3AS1A 2R23B 5FFOA 3IJHA 1MCOH 2IFGA 5D7JC 1TZ8A 5E2VH 3QO1B 4EZKA 3LQAC 2DAVA 4GS7C 4ZFFB 2DH3A 3FSOA 2I9TB 3MV11 4MJIA 3VGEA 3BUYA 4HWZA 1KLGA 1L9MA 2YRBA 4KUCD 3S9DB 3QCTH 4F7EA 1WZAA 1UJ3B 3VDCA 1XO8A 2VITA 2LAGB 2B0SL 1DCLA 5FGCE 1RULH 2WNGA 5KUMA 4DP2X 4LRIC 1XF4B 5IHZB 4BHUI 5IM7A 5FX3A 1EIBA 3B2PA 3O4LD 1V5JA 4RZCA 3KBEA 2YK1H 4HALA 2UVEA 4LP5A 5GSVA 1NCDH 1H5BC 4F2FA 3UYRH 3RYMA 4Z7NF 4KAQL 1TZIB 2YPKA 5K39B 3VWKC 3V8OA 4KI5D 1IKOP 4W9ZA 3QWRD 2VR7A 2FSEA 1YG9A 2NY1C 1HH6B 4IBVA 4AZ8B 3O8XB 1D5BB 1MJ7L 3O9WC 4EVNB 2H9GA 5LDUA 1TZOA 3GIZH 4PJ8D 3AT0A 1QW9A 1BZ7A 1T2XA 2BSTA 1TJGH 3VFVA 2BOCB 3VD3A 2PNDA 3JV0A 4MA8L 5ID0B 3QG6A 5PAZA 4MJ6B 4OB5H 4TTDC 2OMZA 4AL8H 4JUTA 4OM0L 5HHMD 4DTGH 4JFDE 3F3HA 4I3RH 3E8VA 1EXUA 4H2CA 2KQNA 3SEPA 1B0GB 3M88A 3A23A 5ICZB 3HCVA 1F6FB 1HC1A 1XGYH 3CZFA 4JDTH 4UB0H 2Y4SA 3OPUA 1BJ1H 5HTSA 4ZFGL 5FO8B 3PP3H 3Q8BA 2XWDA 5IHBA 1CDCA 3EXLA 4G1EA 1I1YB 3MLWL 2FHFA 2X6CA 5JIKA 3TYFA 4CKQA 1JZGA 5F7NC 3SE3A 2NXZD 4Z7WE 4PJ5B 1F2XK 3FT4A 3BKYH 2WJ5A 4L3CB 1E30A 3NZ8B 5T8IA 4RMVA 1H3GA 4M1GH 4GP8B 1NANH 1AIFA 4P46B 1IC1A 2CO4A 3PGFH 1LO0L 3TBCA 5E2WL 2BVTA 4RETB 4NM8H 1TQBB 4WZ9A 2A6JA 3VXSE 4JG5A 3I9IA 5JIDA 1JNNL 2R0WL 4NQDD 1WAAF 1J5DA 1JVLA 4OAWB 3B7TA 4JO3L 5D7JB 4EZMA 2G3ZA 5HI4C 4FS0A 3RVXD 1VB9A 3AG2B 2IAMA 4DKAA 2VC2B 1T1XA 3GSOB 3M7FB 4UMGA 1JWSB 3T2NL 4QHNB 4WEEA 6FABL 9CGTA 1KB9J 4GBXA 3QXAB 4WUKH 4OBRA 4P5TA 3SDDC 3GFUA 3TO4C 3MV9B 4JRYE 5IFHH 5BZXA 1GPOH 2MQ0A 1WHPA 4XCEA 4OFPA 4G5ZL 8FABB 3BRFA 4MVBD 4HWEH 2NYYD 3CVIL 2XZQL 4ENED 1FFOB 2I9LA 1OM9A 1KULA 4NAJA 2CUAA 2KMWA 3ZDZF 3V4VH 1ZEAL 3EJSA 3IM1A 1EAOA 1DVSA 1RK1B 2QQLH 5D1QB 5LGHL 1H5BB 1CCZA 4OCYL 4PJHB 1BEYL 3IDJB 2EKSA 3SIKA 1HS6A 3S48A 2WNXA 3VWKB 3L2NA 4J3SA 2YUWA 3B9KB 5LVEA 2JB6B 1WCBA 2X4SA 1MKFA 4NN5C 1XSIA 5EORH 2VW7A 3HLAA 3L9RB 3ZRSA 3S3SA 3WLBA 5IQ7H 2NY1B 2V7NA 4KMTH 3O9WB 1BQHB 1S9XB 5DXWA 4PD4J 4AK1A 4PVBA 5IQLA 3W9DA 3HNTH 4OKDA 4AC4A 3ZE2E 5DFWH 2Q7NA 5JMRA 1OVZA 3QUYA 4CMHB 2GITA 4JZOA 1IBGH 2AJUL 2IBZX 4X5RA 3OTTA 4TNWF 3ZO9A 4HXAH 2N1TE 1F97A 3WIIH 1CFSA 2IADB 3B8YA 4AWJC 3VSVA 3AABA 3UCQA 2MTPA 5I66B 3F04A 3NG5A 3VYNA 1YSOA 5KZCD 2GY5A 1UM5H 2X53A 4I4WA 4YBHA 1QTSA 1BHGA 2IAMD 2VZTA 3GHPA 3SPHA 5BMFL 5KN5B 1RPUA 3UO1L 3SPCA 5H37A 5FW8A 2IWEA 4ORGB 4MCZA 1OY3B 5CP3H 4QCIB 5I1AB 1RVFH 2YGQA 2XV6B 4NO5B 4DNLA 4P5TD 3C5XA 3O4LE 3MV8B 3RAJH 1JOIA 3LQMA 1E2WA 4HUWB 3NPSB 4W6WB 3SKNB 4XE5B 3FQ4A 3GNML 2FJGA 3AWFA 4XXWA 3KDMB 1L0XA 4U1HB 5KSVA 3QHFL 4KI5E 1J9QA 3N0PB 1KJMB 1G7JB 1UOVA 1IL1A 1U8HA 1W16A 4ADIA 2FLRT 3L8QA 5ESAB 1BFOA 4ZODA 2CPUA 4R0LA 2UYLB 3V4PH 4K3HA 4X6CA 1RLBA 3WFCL 3D0LB 1GZPA 3PV6A 4HUXB 3BDYL 1LO3L 2OXGB 4NZFA 4HUNB 5DK2A 1L6ZA 5HHME 1WPCA 1S2EA 4MAYC 3I9AA 3T6WA 1U91A 1CZ8H 3KVQA 1BQLH 3EO9L 3JZYA 4FHKA 5F1KC 2OPCA 3KLQA 5HVFB 4TNFA 5JW3H 1IIKA 1MWAB 1NMCC 4BCZA 3WI9A 3CC5A 1DN0B 4ELKB 5B3JE 1LMIA 3DUUB 3O3BA 5C3IA 3O6LL 1XTMA 3FYIB 4A66A 3NCYS 4NI6A 4FCAA 5HGHA 1MNUH 1N64H 3MRRA 1FNHA 2C1OB 2VN4A 4M6AA 3UZEA