4HU2A

Crystal structure of ldtmt2, a l,d-transpeptidase from mycobacterium tuberculosis: domain a and b
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
194
structure length
194
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of LdtMt2, an L,D-transpeptidase from Mycobacterium tuberculosis.
pubmed doi rcsb
molecule keywords PROBABLE CONSERVED LIPOPROTEIN LPPS
molecule tags Unknown function
source organism Mycobacterium tuberculosis
total genus 44
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hu2A02
2.60.40.3780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hu2A01
4JMNA 5E51A 5K69A 5DUJA 5LBGA 4QRBA 3TX4A 5D7HA 5LB1A 4XVOA 5DZPA 3U1QA 4HUCA 5DC2A 4QRAA 5E5LA 5DVPA 4ZFQA 4QTFA 4GSUA 3VYNA 4K73A 4QR7A 5E1GA 4JMXA 3VYOA 5DCCA 4HU2A 3U1PA 4GSQA 5DZJA 5DU7A 3VAEA 4GSRA 5E1IA 3VYPA 4Z7AA 3TURA
chains in the Genus database with same CATH superfamily
2V2WB 1I3VA 5AOLA 4OI9A 3QYMA 3ZDXE 5J7CC 4LCWE 2L3BA 2ERJB 1EHLL 1XT5A 3GSWA 4ANXA 4PRHE 1ZSDB 4YN3A 1CGYA 1E8YA 2OMUB 1K9TA 4NQCD 5FGSA 1E50A 3B9AA 5AVVB 2KZ1B 2XTLA 4O5LH 4GLRI 1UXLA 2MNJB 5HJDA 2YRZA 1B0RB 3EYOB 3PL6D 1KLGA 4J4PD 3KZ8A 4XN9A 1RU9H 4EUPB 3WSQL 1A66A 5E4OA 2O6DA 2G0KA 3BZDA 4M62L 5GGTL 4N5UA 3MCKB 4EUPH 1J0HA 3ARRA 3P30L 3I84A 4R9HA 1TMQA 2APTA 2IH8A 2OL3B 1NSNH 3W81A 4QNPE 3CQQA 4PJHB 3UBXA 1D5RA 1HKLH 2GIMA 2OL3H 4O02A 2WXMA 4HJJH 4DN3H 2BY0A 4ZSOE 1MCSA 1Q0EA 4KV5E 2AQSA 2HLEB 3DBXB 3KDMB 4HUNB 4G83A 3NA9L 5C0AA 3HN8A 5LN8A 2XA3A 4WTXA 1H15B 2WGNB 4FQXB 1D9KA 2APXA 1IAIL 1D5ZA 4HIJA 3IDMA 4DUVA 1XIWD 3B8YA 1HH6A 3VWKB 1VEOA 1XGZA 2C9QA 5ENWB 2ZX6A 1S5IL 1CD1A 3GINA 1M6UA 4WEBL 5E9DA 2Z93A 4A55A 1BLIA 4UV7H 1U9KA 2MRYA 1ZANH 2VWEC 2VZSA 3ILQD 4MMXB 3WMQA 2AJYH 3A22A 4K07A 5HI3D 1K2DA 4UAOC 2X88A 4KX8A 4WI3A 5D6DC 1ETJA 3GIVB 4B7LA 1NFDA 2CO7B 3FZUD 2JELL 3MOBL 2YAPA 3MUJA 1IAKB 2WSPA 5EFIB 2PYEE 4GPVA 3UYPA 4BK5C 1EEYA 5F7KC 3MJGX 3CSYA 3E80A 3DURB 3NRQA 1QWNA 3AJ7A 4HS3A 1LO4L 1YEKH 5HHQA 4HFUH 4AJWA 2XXGA 5HHOD 4L3ED 2GG1A 3I6LE 4G6FD 4K3HA 3UC2A 1CBVL 1RXLA 3MGTA 4OF6A 2GAZA 3EOAB 5HGDB 3KJ6H 3IKCB 1RZJC 2NY0B 5D1XE 4BV1A 2BNRD 4YXHH 3FUIA 4KJPC 3ZK0A 4ILDA 2CIKB 3ZL4L 1NCIA 1A25A 1LLAA 3KYKH 5IROD 1UT1A 5BOZG 3ARYA 4TVPD 1RD6A 2CJSA 5GGSB 4KOBA 5I9QB 1DVYA 2HVJB 3WLBB 2OJ1A 2ITCA 4P4KB 4NNYB 4YFDB 4X98A 1UACL 5F97E 5JUEH 1JPFA 4XZUA 4G70B 5DJAA 2DM7A 1KUMA 2ED6A 2PN5A 2VLJD 3QA3A 1X5XA 4MYPA 4WCYH 3QIBD 4MQ7B 2UY6B 2PCXA 1FLRL 4V1DE 4QRTA 1MCIA 3FT2B 2B9AA 2NX5B 5IEHB 3G5VB 2HRHA 3SDAD 4YDIH 4U4IA 1ACZA 3V6OE 2X4RA 2OX5B 2R69A 4X6DF 3SDXF 3V0AC 5I6KA 1NGYB 3WJLC 3TVMA 4XGZB 2Y36H 3BGMB 3CFDB 4GO9A 2CKBB 4WJG3 2WW8A 3JSSA 4TL4A 3BCDA 4WFFE 3V4PL 3FAWA 1NGPH 2CKBH 3WDIA 4JBSA 4LRNL 3WL9A 3NJVA 5IUSA 3IDJA 4U7KA 5GSVB 5EEZA 3C2AL 3NP4A 2V7HB 3ATDA 1T20B 4N2AA 1I1RA 5FW8A 3C8KB 3G6DL 3NJFA 3P73B 4GG6B 5B38A 1S3KH 5IK3A 5FYJL 4QHUA 2C9RA 4A68A 3L5JA 5CLWA 4Y19A 1UJTA 1ZJBA 3QUML 1W72A 3AQYA 1U8HB 1WK0A 4GXVH 3GEWB 1HFUA 3DGDA 3VGGA 2BMKA 1EH9A 1XSIA 2ZKXA 1WFOA 4A2HA 4Y4KC 2I60H 2Q7YB 4NPKA 1GW6A 1WQVT 4JRXE 2W60B 1LYQA 1ZSHA 3HA0A 4LF3B 2CALA 2ILLA 3AG2B 4YSEA 3GMMB 2DJSA 5IP4A 1NC4A 3CDZB 4TV3A 4U1HA 1IGCH 1OGAB 5BS0D 4LBAA 4XTRD 3ZUNC 4AW4A 3DYOA 2F5AL 2X38A 4P5TA 4L29A 1RUQL 4PJAA 4JANA 2AEQH 4HZLB 4NGHL 2XWXA 3I9GL 3L4WA 1Y07A 3OKEB 2D9QB 2A4ZA 2CDGA 5C0IA 2P3YA 3LH9A 4YLBA 4NP4H 1KCLA 1G7LB 3INUL 3ESOA 4POZC 3CZEA 3P40A 4IIQC 3GTVA 3QXTA 4JAMA 3A23A 1A8JH 1YYLH 4F7EB 3QCUL 5G4MA 1LEKA 4AVHA 3ZT5A 4PVBA 4H1LB 4RFOH 2DTSA 4FNTA 1MNUL 2VN5A 4I18A 4PW9A 4WO4C 2CUAA 4PBWD 4L18A 2V37A 1I7TB 3B2UD 1SMAA 2OYMA 5HYSG 2VQ4A 4H1LH 3T4YA 1DR9A 5JOPE 4UIMB 3GI8H 2EVHA 1MOEA 5IMKB 2XG5B 4PRDA 1A1NB 3OZKA 1A4JB 1K4DB 1OSYA 2ZUVA 3UTSB 3PNRB 1L9SA 4X50A 3GXUB 2P24A 3VM5A 3E7JA 5B8CA 3RWHA 1UKQA 2YEZA 4X4YB 2R2EA 5ABAA 4LXFA 3FTZA 3SPJA 5KZCD 1X5KA 2QGBA 2YGQA 2NSQA 4HCFA 5CR1A 2BRRL 4H88H 4KK8D 2F19L 4DPBX 4QXWA 5GRVL 5DA0B 3OJDA 1OSZA 2EUWA 1KCRH 4FHJA 3UYOD 2XKNA 5ITBH 5BMFL 3RB7A 1QHQA 3UZEC 2NQDA 1AFVL 3QULA 3H42H 3FRPB 1RZKH 2NNCA 2FATH 3BD5A 3FU5A 1BREA 1PZDA 2GJZB 5DQ9B 1CFNA 4G1EA 3D25A 1E3FA 4TVSa 4JCLA 3IFPA 1M1XB 4P99A 5C9JA 5FO8B 2IGTA 4IM8A 4Z18A 2WXLA 4IRZA 4PHZA 3DIDA 5EZLA 1TIUA 4M00A 5FO7A 3L1EA 4BWUA 4ANUA 7PCYA 2IQ9L 3C87A 1B0GA 2XPGA 4P4RA 3GXMA 4MMYA 3G6JB 1OALA 4KROB 5KW9L 3BIKB 1UH4A 1SVCP 4P46C 1KIUA 2DN7A 2F58H 2PXYD 3CC1A 4E0RA 4MAYA 3BUBA 2Z7WA 1HILA 2B1HH 2R4SH 2XN9A 1JTOA 3EBIA 3PAZA 3CVCA 4HIIB 4Q9RH 3VVWA 4J6IA 2K8QA 3MACL 4U1NA 4WU7A 4XMLH 2FJHA 5GZNA 3V0JA 1JMXA 4NEHB 5TF1L 3W3BA 3KPNB 3LZLA 2ZKHH 5E2TH 3TBTA 5GQBA 4YK4B 3KH3A 3S48A 4B5EA 1I8MA 3S3SA 3RDJA 1P2CA 2PCPB 5F7MC 3P11L 4NKQB 3KEHA 4TSBH 2GJ6D 5K59E 4S1DC 2OMYA 3CX2A 1G7HA 1DBKL 4WI7A 2C9VA 3ES6A 2UWEA 4L4VB 4OFKA 4JZJB 2NXZC 4WWKD 4ZDHA 1AZCA 4JFDD 3ZE0B 2BX5A 3RVUD 4KHXL 2BDNL 1KEGH 2QMJA 1XDTT 2ZSWB 5ECJE 1JZEA 3W39B 3K6IA 3W37A 3ZY7A 3TIEB 3LXAA 1VFBB 3CHXA 1XGRA 3AXIA 5I1DA 3ZDYB 2DI7A 3FU9A 2JKLA 3VXTB 1T7YA 3CVHB 4I5BB 1OP5H 4ZW5A 5GJTL 4QI3A 5GPRA 5SWSE 3RWJB 1LE5B 4HF5H 1O7DE 4K7PL 1I8KB 3CVHH 3PPEA 1A14L 3GSRB 1BLNA 2BS8A 3VU2A 1HHIA 2N1KA 3QEHB 4G8EB 3BVUA 2J2ZB 4KH9A 3H9HA 3TJPA 5FYLD 5CEZE 4BA0A 3RWEA 5BW7C 2X9WA 3TT3L 1FYTB 1ND0B 2FVNA 3C6EA 5DS8A 2Y24A 4NOBA 2NTFA 5IVNA 4K94L 5E23A 3PWLB 4Q6IA 5KANI 1NBQA 5KEZA 5TH2B 4I48B 1TYEB 3KPOB 2QEJA 3LH2H 3RY6A 4X5WA 4GSDL 2Q76A 2PTTB 4O5LL 3DUHA 2AABH 3TS8A 1F00I 2APWA 1J5OL 4X5XA 1GL4B 2JKTM 1SHSA 4XBPA 2HG5A 4E41E 2DQDH 4DAGH 2N56A 2NW2B 5E99H 2FSEA 3ARFA 3MI6A 1UC6A 1C5DB 2XWCA 4I0PD 1AXSB 5AFAA 1HHHB 5A2AA 3U7AA 4LAQH 4R96A 2XN2A 4GBXD 4XH2A 1LDPH 1HKLL 4X99A 4ACTA 2OL3L 4HK3N 4HJJL 2GC7C 4L3EB 1Z9SA 2B59A 4TYUA 4DN3L 4FTVE 5HYQB 1ZLDA 4M48H 4O00A 1T3FB 1XSJA 2IAMB 3ARBD 1USQA 4ZUVB 1VIWA 1PYWB 3PHQA 3TF4A 2JCCF 3U4BH 1V3LA 4OT1H 3ARPA 1O7VA 2P43B 5AOIA 5I6LA 4NKDA 2ZXEB 2FO4A 2PETA 1DQDH 5D2NB 1B90A 1BYPA 3K8MA 4F80A 3L9YA 3Q44A 2ARJA 3MRPA 2VKWA 5KBKA 1CFVL 1QNZL 3EG9A 3L7EB 3BKMH 4LCWA 3UAEA 2JI1A 3Q2WA 4YHPA 2EVJA 4HGWA 4UV7L 1ZANL 4TVPH 2JIXD 1FFTB 2AJYL 5AUMA 2N59A 3GJFK 1D5BB 4TLTA 3RURA 1S9YA 2CCLA 2LU3A 3K8KA 3WN6A 1WWBX 4N5EC 1T5WB 3SKOA 5FKPB 5GSRA 5JXEC 4WI5A 4JPIA 4YUEH 4CN1A 3ULUH 1I53A 1IARB 4G9FB 1PX3A 5DD6A 3BYTA 2CK2A 1E4KA 5ERWA 2CDFB 4XX1E 1P5VA 3GWJA 4P9ML 1DQQA 2X12A 3SDAB 5JIDA 4KQ3H 2AQPA 4HFUL 2X4OA 1ZVSB 4N2FA 5HHPA 2WVTA 3HC4H 1PZUB 1OQXA 2CAKA 4UNUA 5LCVH 2GT9B 4JLRA 1SMOA 4LGPB 3BO8A 3IGKA 1RURH 4XC1L 5EUOA 4DHLA 3KJ6L 5HD8D 3VI4B 4JFPB 2EC9U 2VR7A 5IQNA 4P57A 1AXTL 4GO6B 1Q72L 4N0CC 1FG2B 3QC6X 3QIUB 1OGTA 4R8WL 1Z5LA 4DUWA 4G43A 1Y0LA 5I19H 1FE8H 3QRBA 1DJSA 4P5KA 1R3KB 2APFA 3VXRD 4TUJB 5DQDL 4UQDA 3M7OA 4C56E 2O6EA 4QT5B 3PWVB 4E9YA 3KPQA 3ASNB 4MDRA 3IAPA 1NJ9B 4R5VA 1GY1A 3VFTB 3CPLA 4OAWB 5JUEL 3V9CA 4IOSA 4M7ZC 1OQOA 2G5BB 1IV8A 4WCYL 1QO3A 2EUVA 1TYJA 4I87A 1B6UA 2YPLD 1J1XH 1FDLH 4BHUA 3L3HB 4IDLA 1YHPA 4G6ML 3QB7C 2PYEA 4PCYA 4B7IA 4G42B 4J1UB 5DJ6A 1HI6B 2BNQE 2DWEB 2B2XH 3IFOB 3M1BA 2V3EA 4AQEB 4QWWC 5IZ7A 2Y36L 4BZ1H 3CCHB 4J2QA 1T21B 5HVFB 1EAJA 1ZGLB 4X8GA 5JW5B 3L4TA 3PAUA 3QWRD 1NGPL 2CKBL 3QUZC 4N2KA 1EO8H 5L4JA 1QFWH 1SXNA 3DVFA 3N43F 4E36A 1F6FB 4WJKB 1M7XA 2H6UA 3RL2B 3A67H 2NYKA 2P80A 3ARTA 1EDQA 3K81A 2YJQA 2HJFB 2E3VA 2P1YA 3VMOA 4GXVL 3RZCC 1FL5B 1TLMA 2ICWA 1B9KA 4RNRA 2DEWX 3DJTA 3GSQB 2A0LC 4P2OA 1SRDA 1VB9A 4PJFE 2Z34A 3GUFA 4UAOB 3SPGA 5DMKB 2WZ6A 1AP2B 3DX3A 2ZUUA 4FG6D 3HG2A 3U0PB 1KN4L 1FNGA 3P77A 3B56A 5C07D 5DGQA 2V33A 1IGCL 3KLDA 1TVHB 5D6CB 1G9HA 1OLZA 2E9BA 3B2DC 3QORC 1W6LA 1KPRA 3N91A 1J12A 2R2BA 3HZVA 2HT2D 3U0TB 5BNXD 4ZUTA 3T71A 5EC2B 3L9RA 1MFBH 5E4AA 4DEWA 1A8ZA 2PO6D 3GBDA 3GSNA 4JPVH 1MW1A 5IQOA 3IF1B 5C0BE 4P5RA 4Y5YC 3N0PB 4NO3B 1RZJH 4XO8A 3DX9A 4G7YH 5E6IC 4DCQA 4AEFA 4K73A 4ZMQA 2UZXA 4QLWA 1QA9A 5ACZB 4C54A 3V5HA 3LX9A 3MRQB 2CBMA 4X6BB 4ZZKA 1TTUA 1AGFA 2QJDA 1IL1A 4QJ5B 1EBAA 2BVOB 5EBGA 3W82A 2QPFA 1VADA 4HV8A 4XCYA 5EULV 2EC9T 4I3RH 4IIZA 3WFHA 4RFOL 4U7MA 1I8LC 2C3HA 3DUUB 3MRIA 5CUSH 4WI9A 4EI5C 3CHRA 3SE6A 6TAAA 1KIPB 4L8DA 1CFTB 4Q7DA 1L0YA 3PQYE 4B3VA 4KI5D 4XWOC 5C8JB 1ASPA 3TZVD 1P7KB 1IAMA 1KELH 3NIGF 2PWEA 4GW5B 1E65A 3ZKXC 1HSBA 4NS0A 4L8SA 2YK1H 5BQDA 1CYWA 4M6NH 1OP3H 3RWCB 2F5BH 1GH7A 3RGVD 3GSUB 4AK1A 5E1AA 3RJDA 3TFKC 2QQNH 2X4UA 3SKNA 4UF7C 4AOFA 4W4OA 3JXAA 2XTJE 3UG3A 1WAAE 4YSSA 1G87A 2GUYA 3BKYL 4PP1D 1J9CT 3IMUA 3CHPA 2VXQH 3MBED 3QS2A 1JPGA 4JO5A 1D5MB 1FWXA 4LPVA 2FJFA 4FQ1H 1TQBC 5SX5H 5JNYA 4NKIH 1MJ8H 5IB1A 1JF6A 3K8LA 2HLFD 2VIRA 4MD0A 4Y5VA 2FATL 2UZIH 2CA3A 1BGXH 2X1OA 3GB7A 4LT7A 1NMAH 2TAAA 5D7JA 5DK2B 2LE9A 3O6FC 3OAZK 4H13C 4P04A 1ASQA 2R23A 5E4IA 2EYSB 1NCDH 4X9YA 3ZTCC 4LVHB 3VXQA 4HJEA 4BA8A 3BH8A 5JHAA 3DX1A 3X1GA 3EFOA 4QYOA 5F1SA 3OJ2C 1S9XB 1BQLH 4DGWC 1UUNA 4P3CL 1MHHA 4Y4KB 4OZIB 3RFZC 2BSED 3HNTH 3SD5A 2QLVB 2H2PC 2FO8A 2ZOTA 4GI8A 1CK0H 2HKFH 4G7SB 4IJ3B 2F58L 2A6DB 1XGPB 2R0ZH 2FQDA 3R06B 1KT2A 2W0PA 4Q9RL 4XMLL 5EU6E 5KVEE 1UVQB 3SY0A 1F6AA 4PN6A 4D9QE 2Z9TA 2ZKHL 5E2TL 4AL8H 3OKKA 5CIPB 5DRNB 2R83A 4D8OA 5IB5A 2XV3A 4YDJA 5C3LD 1DJGA 4TSBL 5CIPH 4JKPH 1YG9A 2FAUA 3O3AB 3DX7A 3OX8B 4IIQB 2WBJD 1WLHA 2VLLB 3PIQB 3GHBL 4PBXA 3VQLA 4P8QA 3Q9QA 4G7VH 4BWTA 4DKEH 1EEZB 1FNEA 2K70A 5BRZE 2CLVA 2XYCA 3MLTB 4WFGD 4EIZC 2WBXA 2VLRD 1AQHA 3U46B 3EAKA 5E5UB 4WO4B 5LBSH 3IJSB 4F3FB 3VUAA 3PV6B 4ZXBA 1R34A 1UWEL 5KG9A 4PREA 3HPJB 3P3YA 4WU5A 2D03L 1LO0H 1JZ2A 1PIGA 1U93A 2KDYA 3FQUA 2WLNA 3FN3A 3VGDA 2AKRB 4FERA 4A2MA 4JZOA 4TUKH 4NM4H 4UIKH 4HF5L 4LSVL 5DR5L 3WHE0 4X7TB 4ONOA 4Y2DC 3OM3B 2QKIA 3ARBB 5E2JA 1M7DA 1UCTA 2F53E 2X0WA 2V7NA 2DBJA 2PP9A 5HI4C 2D3JA 4ZPVA 2KUTA 3UTOA 4FMKA 4K8RD 5F7DA 4D3CH 4NQUA 1N2RA 1E40A 2KI6A 5DURD 4XZ4A 4D9RE 1ET8A 3KJ4C 3ATFA 5BO1H 1A0QH 1TZGH 4GW4B 3VRIA 2DWXA 2AABL 4KTDH 1TTCA 3HRZC 2KLTA 3OJMB 4FNSA 3NCMA 3OKOA 1Y6KR 5EN2A 1NICA 3L4ZA 3H9SE 2DQDL 3BUPA 4DAGL 3AREC 5E99L 2EADA 1KC5L 4O9HH 3JWNE 1T2XA 1NWOA 5DJDB 1N5AA 3NQKA 4Y9GA 2Z35A 1QRNA 1RPQA 3P9MA 3HIZA 5C6TH 4LAQL 5C0FA 2VMFA 5I1IH 3GXTA 3QNXA 4MFHA 1KPUA 1OHZA 2AEWA 4WV1C 4ZMXA 4YOKA 4U6TA 2OMXB 4P46B 1N26A 4HAFA 4PJ9A 1EZVX 5EIIB 2ZUWA 1T6WA 4MNGE 3U4BL 1SVBA 1DDHB 2W1NA 3DMMA 5DJ8B 2R1XB 4R3SB 4OZFA 4AYDC 2AHIA 5I16B 2XSKA 1D5XA 4NQDD 4QPEA 5ACMA 1KLFB 2UYLB 5ESQA 4LASH 1E9OB 5I28A 4HBCH 1I9IL 2OXHA 4PJAF 2D2CC 4WW1A 5CJ5A 2P5EA 4TVPL 3WY2A 5EEXA 3HI5H 3FTXA 2OS7A 3QJFA 2XRAL 4KGLA 4NC1C 4YUEL 2VN4A 3U30C 2NXZB 1N70A 2YR3A 1YEEH 3D5OF 1GGIH 4XMPH 1P1VA 4RVBA 2P26A 5TK4A 2BIPA 5D2LB 3KPMB 5JYLA 3QDJE 3GJEB 3UBXG 2J56A 2PCFB 4APQC 5HYFA 2I32A 3O3DA 4IOFD 1U58A 3HC4L 3AU1B 5TQ0L 1ZLVK 1S9WB 2VZTA 4QHNB 5KYXB 2VLKD 4Y2OA 2O5XL 2E4FA 3OMIB 1RIUH 4LHUG 3QUXA 4YLQT 2X4NB 1CFMA 1MSPA 2ITDB 1MCPH 2LVCA 2DM4A 3G5WA 3V5DB 4NSKA 5I8KH 2IQAA 5I19L 1FE8L 1QR1A 4QAWA 5ADPL 5E6RB 3UTTE 3BVWA 3CIQA 3Q6FB 3ECVA 5TJWK 3QEUA 4UU9B 3K4ZA 4ABWA 1FAKT 5CFHA 2ZPKH 4RGNE 3UIZA 4M7LH 3WBDA 5C0DB 5I0ZA 4K5LA 2PP8A 1P9MC 2HFGH 4HG4J 4DGVL 4FG4A 3T4AA 2DQ6A 3DSFL 1WAPA 4H5SA 3D09A 1LXMA 3BUYB 3TYFB 2FH6A 2H47C 4MDIB 2DQFA 4M8VA 2W94A 4JREB 1PBYA 3KBPA 1M6OA 4YDNA 1IEHA 5DJ0A 4M56A 5AAPA 3WOVA 3H0TA 4A7TA 1MAJA 4Q6KA 5MEOB 1PD0A 4OKVB 1AQMA 1E8WA 1YEDA 3BE1L 3ZO9A 3B9KC 1WAEA 4BZ1L 1VESA 4MS8D 5E1IA 2OKMA 35C8H 3IXAA 5JPMC 1N59A 3QRGH 2ZUQB 4WUKH 1L9QA 2OMVB 5KJ4A 3Q2VA 1HNFA 5GGUB 5J1AA 4X6EA 3G5YB 1JV5A 1H8NA 3OAUH 4PTUA 3LKRA 1TF4A 5EEUA 2Q86A 2W91A 4APXB 1SFHA 3A67L 4LNVA 3US9A 3L7FA 1OT2A 3GK8H 2CU9A 4ICWA 4C56A 1AZNA 1QUPA 1RZIB 3ZZQA 3Q6GH 2WB1A 3OB8A 1XF4B 2KT6A 4U6VH 3FUJA 3HAEA 4ODXB 3ZT6A 5L0QC 3ZKMD 2ZNXA 1OLLA 3ARGC 3REWB 3ZR5A 4WTZG 4JY4B 1M71B 4EXPX 3CXFA 1SDYA 3FUFA 3O6ML 2NYYC 5C0ND 2G2NA 3UGUA 1TKWA 2ENQA 3DSNA 1HCYA 2XBZA 4M3KB 4OLYH 4WLCA 3H2PA 5F1IA 3S5LA 3PGFL 2UWEF 1KPVB 2VRAA 1BX2B 4KI1A 5HYJD 2XWBA 2ZG2A 3MV8E 4OGZA 3PXHA 3TZVB 4HSQA 4UBDD 3VYOA 1SLUA 4OGAC 5H37H 3WE6B 1E8ZA 1FZMA 3QI9C 4AENB 2MHAB 4YDZA 1FGVH 4NN6C 1WBYB 3MFGB 5DS2A 3DPBA 2F74A 3OLGA 4BH8B 4TNGA 1MFBL 4OJCA 1SPDA 2AJSH 5FW6A 5HHNB 1DBML 1JGEB 2G5RA 3S8WA 3FT4A 3DTXA 3OKLA 1JHTB 2RB8A 3W5NA 4ZW8A 5B38G 4JO4H 3U1QA 4GG6E 2P8LB 4AM0B 4G7YL 5AL0A 1JV2A 2Y5EA 3MBEB 2N0MA 3GTTA 3NH7H 4KKCD 2Z7ZA 1BM7A 4MNQE 1JERA 3T3ME 4BSJA 1A4KB 3DX6B 1JGLH 3D3VD 5C0JA 2R4RH 4I3RL 1W16A 4N6RA 5E2VH 2C1PB 3U6XS 4IS6B 2BCKB 5MENE 2Z0UA 4Y4HA 3N1QC 2EDRA 4M7ZB 1URIA 4PJFA 1MFNA 4HPYL 4JFYA 2AXFA 1S4IA 5TK2A 5DO2C 3WNLA 1KELL 1EGJA 3LPWA 5FV2A 4QRRA 5BUGA 3S88H 2J8UF 1OGAE 2VZUA 3U36B 3X1BA 3VWJD 1FNAA 5CBEA 5J89A 4HEME 4ZMVA 2ZP8A 1MVUB 4B9FA 2HCZX 2XJKA 2GBVA 2DMKA 4H8PA 4FJYA 3R19A 2E46A 5KWYC 4WHCA 3O3EA 3UERA 2OV0A 1YZZA 2LR4A 1WT5A 2CLRB 1U8LA 4NT6A 4U7SA 4BFRA 4PJ8A 3KLHC 3UCRA 4JFXB 3O11B 3SBWC 4IKLA 5IIEB 1U3NA 1MHCA 1FIEA 1J0YA 1MNNA 1IM3B 4I1RA 2DIAA 4A37A 4XNYL 5C0BA 1CE1H 2ADJA 1NUDA 3L4YA 3HPLB 3MLSH 1IBZA 4FKHA 1MJ8L 1YNTB 3FO0L 5ABDE 1YMMA 4HMDA 1NC2B 1O5PA 5FCUH 3LEXB 3U4EB 2UZIL 2W65B 1BGXL 4BCZA 1LWHA 1UG9A 2MOGA 3RWGB 1H8SA 1JWSA 4OJEH 5L2KD 5HDQH 1LNUB 5T5FH 3SE4A 3ZDXF 1J87A 4UQ3A 3IDIA 1MCNA 5DD0H 1T1YA 3DETD 2EDDA 3ZKSD 1KJ2B 4JX0A 1J0KA 1P6AB 5EPMA 1GS8A 5A2JH 2VLRB 4EI6A 4UT9H 3UTSE 1WZ1H 2FH8A 4GEIA 4D0BA 1KJ2H 4OIBA 1IFHL 1ZPLA 1UUSA 2J55A 3OJVC 3VFWB 3UO1H 3JUYA 1RJYB 2R0ZL 1MFCL 3NIFB 1F3JA 4YHKL 1KBGH 2HUHA 3DRTA 5GGVY 3S3CB 1NOAA 3N40P 4XHJC 1RIVL 4PJDE 3UAJA 1EUUA 1C7SA 2WUBL 3MOAH 3QORB 4U0RC 2E74C 1VERA 1E7VA 4JFOA 5DEFB 4AL8L 2C1OB 1GTFA 4PM1A 3U7WH 5F0LB 4EO5A 4MB4A 3AUVA 4XAKD 3PREA 3U48A 5K93A 3W57A 3SJVE 5AAWA 1ZTXE 2NUPB 4UQ9A 1AHKA 4FD0A 3VX0A 1X9RA 5FYLL 3V6FA 4XE0A 4Y5YB 4KV5F 5DURB 2F54D 4K8RH 4I2XB 3NCWA 4FNRA 2IDFA 3LXCA 5DSCB 3F83A 5K9JL 4N2EA 4A6YA 2X1QA 1CLOL 1TOXA 3EF7A 1Q1JH 4G7VL 3UGXA 4HCRL 5E6SB 3E2HC 4DKEL 2ATPA 1T1WA 3LN4B 2D3VA 2IPTH 5DUPH 4FZ8H 2K6ZA 3G7TA 3MRKB 2V0AA 1TO5A 5FHAH 3IVKB 1KY6A 4EI5B 2OLDA 4PGEB 1J1OH 3VX1A 1OD7A 3GGWA 3K2UL 1BMZA 1AIFA 3O2VH 5LWYH 1LO0L 3CUPB 3GSVB 2OR7A 4MKMA 2Y5TB 5JOEA 3LVTA 3PYCA 3ZKXB 1F4YH 1A6AB 3QJHB 4UIKL 2EJ1A 3CXHK 4GAYB 3VMPA 4NO0A 1UB5A 3T2QA 5D4IA 4W6WB 2FWOA 3QUYC 1V7MH 1K8DA 3HW7A 4OUUB 2DB8A 4NIYE 3CU1A 3VFGL 5AVQB 1IFGA 4DP1X 5FR3A 4FZEH 1A5FH 4ISVB 1EO5A 2NR6C 1V05A 3NA4A 3HN3A 3KBEA 3LKQA 4LBEB 4AUJA 5HVHC 2WQRA 1F97A 1E28B 3QNZA 4OGXH 5I30H 2MWCA 4PWFA 8FABA 4IEFB 1OSPL 3PP3H 1HWHB 4WIQA 4L4VE 1SEBA 4FA7B 5B1BB 1SYSB 2XT1B 4OGQC 4KTDL 5GGRB 1TQBB 3PABA 3ZE0E 3FQNB 4TQ8A 4AVIA 4MA3B 5B4MD 1UOLA 1KWGA 3QXDA 3MLYH 3ECBB 1LK2A 1URLA 4TM9A 4P06A 5KYYA 1BVLB 2X41A 4LLDB 4KWUA 4IU3A 5EBMA 4DIXA 3MUZ1 3O6FB 1VACA 5IY5B 5MEQA 4ELKA 3LDBC 3ZDYE 1D6EA 4ZOCA 5A2BA 1DLHB 2VAJA 3S8GB 1PNCA 3L5WA 1YPZB 5TTRA 4O4YH 2NUTB 2WXRA 3EXLA 3LPPA 3RFZB 3V4VB 3HG0A 1A9BB 3IS1X 3POHA 3SZ6A 2VLKB 4X2UA 2OTUB 4PGZA 2XBTA 4XN5A 3V4VH 3L54A 4LLWA 3T0DA 2AK4D 3VW3H 4L3CB 3RNQB 2WTRB 1XD1A 4GAFB 3TV3H 2XZCH 1I3GL 1FYTE 3VCLA 3CFBA 4JHWH 3M46A 4LASL 5EORL 4DTGL 1CO1A 4YHZH 4HBCL 3V2AR 3QS3A 5EZJB 4ZODA 4AX3A 3SD2A 4ONFH 4F7TA 1UCBL 3MROB 3NEXA 4M43H 4XMZA 2Z92A 4G82A 4A7VA 3A6CH 4AT6B 5FUOH 5E8PB 4F57H 2UVEA 4BGLA 4J3VA 3QO1A 1YEEL 4LIQH 1GGIL 4XMPL 3H9SA 2WLHA 4WWPA 1BYNA 1QASA 1GGCH 1KJVA 3RILA 1CPUA 25C8H 2IPUK 1ONQB 4R4ND 1TJGH 3VXME 1FO0B 1QSFE 4DGIH 2VISB 1XGUA 1QTYT 3SE3A 5H4YA 3RY5A 1FO0H 1RIUL 4JFFE 1HSAA 1MQ8A 4YQXH 5T5NF 3US1A 4ZZFA 1MCPL 1JN6B 4XNQB 2R1YA 4FXKC 4DK5A 4MNGA 1FFQA 4GRLD 1T66D 2FX7L 2V2WA 1TJHH 1JTPA 3HNSL 1H5BC 1I85C 3OHMB 2RACA 4Y2DB 2DWYA 5BUPA 3ELQA 4JJHA 4LLUB 1EHKB 3ORJA 1DSYA 4N8VA 1ZSDA 3QQDB 2ZPKL 5JZ7D 3RTQD 4RMTA 3OZLA 4Z7NB 4ENED 3C6SA 3MJ7B 3VXOB 4GMSH 3ULUE 2CH8A 2J1ZA 3TO2B 4AZ8A 3KJ4B 4NRZB 1B0RA 3EYOA 3PG2A 2J25A 2OSXA 2DMHA 2PPEA 2DH2A 4HKXB 4BQBA 4EUPA 4Q58C 3EF4A 3WNMA 2ALWA 1TUPA 5BQ7B 1OT1A 3MCKA 1UWYA 5GZOC 3PNWA 1MEXH 2OL3A 3FAXA 1T0MB 3QDJA 4CUCA 4DKFH 1QZNA 4PJCE 5HGAA 4PJHA 5F1NA 5J3HC 35C8L 5DTFA 2JKIS 1NKGA 3UXFA 3GYRA 4WUKL 1QEXA 4Z3JA 2OI9C 2YAEA 3QQ4A 4WV1B 5CM1A 3DBXA 1HCZA 3ZVVA 4X5LA 1TZ8A 3QUYD 1H15A 2CCWA 3DRQB 4FQXA 3RIFK 3OAUL 2RGSA 4HJGA 4LVOC 4PRAB 3D30A 1FIGH 3N44F 2V5MA 1WZAA 1E5BA 2R59A 3CWGA 3R4RA 2GSGB 3LH8A 5EB9A 1UM6H 2DQCH 1OVZA 4U1MB 3GK8L 4LL1A 4LVNC 3TT1H 5ENWA 5FGCB 2EILB 3Q6GL 3TP4A 2V6HA 4MMXA 4U6VL 4B95C 4NAJA 4V33A 3O41A 5BPPA 4LDEB 3VD2A 3D3VB 5IBUG 4EVNB 5LXGL 3BVNB 2G9HB 2VM9A 3VFMB 5EFIA 3T0AA 1N3NB 4OLYL 4PS7A 4M6OH 4KFZC 4GKZB 4EI0A 4XVJH 5G55A 3U30B 5HYSB 3EDFA 2YXWA 2R15A 1ZPUA 2ED8A 1YEGL 2WMPB 5J1SC 4OCNC 2X6MA 5IR1B 1Q8MA 1JXFA 1AD9B 3FTWA 5E6UB 3I3DA 3J8F7 4M7JH 1EEQA 1NUNB 2MMXA 3VWJB 1FGVL 4APQB 3EOAA 2Y69B 5HGDA 3IKCA 5C0GB 4NN5C 3RDTC 3A0OA 2EZ0C 2WKOA 2WO3B 1V7NH 3HKFA 3L3JA 4JO4L 2XV0A 4NC2B 5GGSA 4PCKA 1UA6H 3OC5A 1PX8A 1HC1A 4YDKH 2VZOA 3IJ9A 1JNJA 1I1AD 3E1F1 3WLBA 3NH7L 2W38A 4R0LB 1YY9D 4P4KA 2BXZA 2IEPA 4NNYA 4FI6A 3BKCH 4PU2A 5MI0C 1F5WA 2AQ1A 5EEVA 5AYUH 3L5IA 1KY7A 5MHSD 5KANG 2VWEE 5E2VL 2XJLA 2X6UA 2UY6A 4J3OF 3UH8A 4N90D 3J2PA 1XGTB 2DQUH 2NX5A 5IEHA 1ZXQA 3G5VA 4HPOH 5K59F 4XCFL 5DVLA 3NCYP 2NY5C 3GJFB 4N2DA 2DKUA 2OX5A 5DLMH 2Q9OA 1HL5A 1PFCA 4KK9D 4UOW0 2WVVA 1CFSB 3GJFH 4XGZA 5DYOB 5AVSB 3OXSB 4P3WA 2CKBA 5GS0C 3II1A 5I66B 4AKQA 3B9KB 2Z91B 3S36H 2J1XA 3Q2CA 4X7EC 3SYCA 4FFTA 3WFBL 1MRDH 4F9PA 2NY3D 3NAAH 4HDIB 1TQWA 5GSVA 1TNNA 4AEIL 4LQFH 1T20A 3NACH 1U8IA 4GG6A 2NT1A 1UD6A 2RH0A 3MLSL 4E9RA 2DM2A 4ZUSB 5CEZH 5FCUL 4KO7A 3D1MC 1DSWA 2I25N 5DMYA 1U8HA 4MNQA 1UASA 3APCA 4X6DB 4W4NA 4GW1A 1J0JA 3SDXB 1NPUA 5HDQL 1LILA 5FFGA 4EDWH 2PABA 3BVVA 2Q7YA 3DI2B 2Z4QB 5L0QB 5DUBB 3VYPA 5DD0L 2XNAB 2BPBA 5E5MB 3H85A 4LF3A 4PLKD 3KDPB 2W59A 4UT9L 3EO9H 3GMMA 3L1FA 1HZHL 2QDWA 4J27A 1R3LB 4ZS6D 1OGAA 1WGVA 4KX9A 4JN1H 2FEDD 4JFHD 1ILUA 2RR3A 3GBMH 3X11B 2MQ3A 4HEMA 3FB6B 3TYGH 1C1EH 2A77L 3BPNC 5IJBC 1XB8A 3Q1SH 3QAQA 4FKKA 2WINB 1T22B 1BZQK 2YGNA 5DRZA 3QI9B 4HZLA 5IFHH 2WK2A 5I1JH 3BUIA 3MOAL 4NN6B 2EDOA 2LU5A 1QTPA 4BK8A 2OXGB 4K7FB 3U7WL 3T65B 5C0RH 1G7LA 5BZDB 2D2OA 3HVDA 2YA1A 2D9CA 1QW8A 3MCYA 4TUOB 5IF0B 4NP9A 1Q38A 3FQ2A 4K8RL 3UX9B 4F7EA 2XUWA 2O6PA 2AQRA 1JD7A 4RETB 4W93A 4H1LA 4J6RL 3GMRB 4AIZB 1G7JB 1OF2A 3TWCH 1I7TA 1BVNP 1WIPA 2FLRT 2XV6B 3VU1A 1FF5A 2IPTL 4FZ8L 5DUPL 2IADA 4UOJA 3P2BA 5FHAL 2ATKA 4KUCF 3B4NA 4X6CE 4E9VA 4H8WL 4UIMA 5TDOB 1J1OL 3T0ED 5IMKA 1E27A 3I3BA 3ILPB 2XG5A 1A1NA 5CGYD 3ILDA 4KTYA 1A4JA 1K4DA 3TEXA 3UTSA 1JRHH 1QI5A 4X4YA 3SCMC 1QZ1A 1F4YL 4HX1B 3LQMA 3F00A 4Z7QE 5IMLA 3IB4A 1UATA 3QE5A 5BZWB 4GG8B 5I5IA 3FFCB 3P4NB 1HKFA 5T3XE 1JP5A 1NCBH 5SX4I 4BELD 2BOLA 4FZEL 1I8UA 1JF1B 1BD2B 1WZKA 4OF3A 3U0WL 2WNXA 1VSCA 2ADFH 3WEXA 3F2LA 1C16B 1EHXA 4OFQA 4HKZB 5ACLA 1PZ3A 3EDJA 4XX5A 2HMIC 1IVTA 5E9AA 4KVCH 4JQVA 1FNFA 1JNNH 3FRPA 3WIFB 4BSWB 5C08D 2A99A 4PLOB 4S0HA 2GJZA 5DQ9A 5SWZE 1ZLWH 3MLYL 1M1XA 5IBTL 5FO8A 1S7RB 5AZ2H 1G5AA 1YN7B 5D71H 4YWGH 2NYZA 1SBSH 3LIZH 1A65A 3QDGE 4HS8L 1CN4A 3OSVA 4FQIH 3WKPA 1FUNA 3QJXA 4NNXB 3PDDA 4PY7B 5IMOB 2IH3B 3G6JA 5CHNB 5AALA 1MF2H 3BT2L 3BIKA 1QBLH 4UT6H 3CN3A 4O4YL 9CGTA 2CO2A 2HSIA 1RUAH 2D0HA 4NZTL 3E9TA 1I9JH 3T08A 3EJYC 3WE1A 4NFBA 2Q10A 5KVFH 3VW3L 1I1FB 3IJHB 1CT8B 2NW3B 1MPAL 4HZ1A 1IM9B 1DJHA 5C97A 3EJZD 4JHWL 1E8XA 4MCZB 5DC9B 4ZMYA 4U0RB 4YHZL 3JZYA 1BFSA 3FMGL 4L4VA 5AVYB 1O9WA 3E6FB 3WFZA 4N3UA 3G5ZB 4O51B 3X14B 3A6CL 3APMA 3MR9B 3QEQB 3MRLB 4F57L 4ORZC 1JPSH 4KFMA 2AV1A 2RD0A 1VRSA 1JNLL 4G80B 5JIHA 2ZSWA 1WCBB 4NNPH 2HT4D 1GZPA 4TQIA 1QFWI 4ODUB 2HT3D 2H3XC 4OZGE 3TIEA 3E2HB 2NNFA 4PGDB 1VFBA 3QZLA 2VERA 2AITA 2K6WA 3IDNB 4QRQB 4XP6L 5IGXH 4C47A 1WITA 3Q48A 4GQQA 5A16B 4FG0A 5ELIA 1TJGL 1A7PH 1AYRA 1X5LA 4AKPA 4DGIL 2LTQB 3CVHA 4KRNA 4X8JB 4I5BA 3OAZH 1DFXA 3KXFB 1FO0L 3V8CA 1LE5A 4PJFF 5C0AD 3RWJA 5IBLD 5F7HA 4OZFG 4IJTA 1I8KA 2WY3B 4PBVC 2WYHA 5DA4A 4F33B 4YQXL 4ADIA 1D9KD 3GSRA 3JV6B 4MBRA 1X44A 3QEHA 4G8EA 1TJHL 2F8IA 5FA3B 1ZT1B 1BEXA 2V9RA 3BW9B 3QUYB 4FFWD 1DEEB 4ZOEA 1FYTA 4WHDA 3KH4A 5E9DD 3U82B 4XPTL 1OAJA 4W9LC 3KHOA 5DQJB 5IVZA 4XVSH 2BIIA 4A2EA 5TH2A 4I48A 5FDYA 1OPGL 3P2DA 1TZAA 2J6EH 4GMSL 1GYWA 4UDTB 4DGUA 1SUHA 4KDTC 4YHML 2F7OA 5LUMA 4M1CD 4OCRL 5J9PB 1D7BA 1RZQA 3JT0A 2KQMA 2ZXBA 1E9PB 3VRJB 4EZKA 3I02B 2NW2A 4PD4K 1KGWA 2OPCA 3UCQA 1C5DA 5B8CC 5TE6H 2J20A 1AXSA 4I4WB 1BVNT 4ZFOB 3FSAA 1BVKB 4M6MH 4WKXA 4DKFL 1U95B 1UWXK 5KBDA 3LDBB 3B9EA 4ZQKA 4B96A 4ETQA 3LNHA 1DVSA 3APNA 4XMXA 5D1ZI 1OPOA 3LNDA 1PSKL 1J9TA 1JGUL 1J8RA 2IAMA 1B4JH 4GKLA 2L7EA 4JFFA 4ZUVA 3AGWA 1PYWA 3D0VA 4QKXB 1X5AA 4RSYA 4LLYB 2OTWB 4G8FB 1FIGL 3FRUB 3ECUA 5F9AC 5ICZA 5M94B 3TTSA 3U6XA 2Y7LA 1U6AH 2DQCL 3VA2C 5D7SL 3TT1L 4B9YA 2P9RA 3L7EA 5DRXB 5KTEL 3DARA 4JM4L 2IWGA 3Q2LA 1A6TB 3UJIH 2AI0L 4F5CE 1TSRA 1TQTA 4BUQA 5F7UA 5LJYH 1I1AB 4XVUC 3WFEH 4AJ0A 1D5BA 1WAAF 1HOCB 4L4TE 4UMSA 1T5WA 2ZT9C 4YE4H 2R51A 4G9DB 4RESB 5FKPA 5IG7A 3Q5TA 1ANUA 4AITA 4KKNA 4G9FA 2OR8A 4XX1G 4M6OL 5DF0A 5LBVA 5CZXC 1NCGA 2GFBB 1UOKA 2CDFA 4XVJL 2EE3A 5ALBH 3AS2A 1OGSA 1GTNA 2GY7B 2JCCB 3KBFA 5LCVA 3TVMD 1CURA 3V5KB 1QABA 3C9NB 4HH9B 3D07A 1KXQE 4M7JL 4PJCA 2GT9A 1QSVA 3SPHA 4BKLA 3VSQA 5F3HA 4WVRA 1E9QA 3BAIA 4JFPA 5DZJA 2VZ1A 2NY6C 4PJ5E 1V7NL 1SJXA 3OBAA 3QIUA 3BN9D 2XWTB 4MJIB 2XWJB 3BQVA 2NY4D 3FB5B 2EECA 4IGBC 4NQSB 3UPCA 4AV0A 1R3KA 2YXVA 4TUJA 1IMHC 4FXKB 4Y19D 4QT5A 4YDKL 3RWFB 3EJJX 3DIVA 1DBJH 1H5BB 1CG9B 3HBPA 2WYZA 3HAEG 2BP0B 1TTAA 3M45A 1NJ9A 4Y5XC 3DJRA 3D0LB 3E6HB 3QDAA 3BKCL 4KY2A 5INDB 2R2CA 5I5JA 3CZUB 4OAWA 5AYUL 2E6PA 2EQDA 1FHGA 4CU6A 2HX8A 3CK0H 4NC0B 5BZZA 5GS1C 1MJUH 1REIA 3IN0A 3ILEA 3ZHLA 4IKJA 3L3HA 4FNQA 3BKJH 2HFFB 1V5JA 4G42A 1Q9OB 3NYKA 4J1UA 4WI0B 1NC4D 1HI6A 4P5MB 4NZUL 2DWEA 2MNUA 2CR6A 4GY4A 5DLML 2HH0H 5DFAA 4AQEA 3PAVA 5D1QC 3AAZB 5JYMA 2C9UA 4OCXH 3CCHA 1ZE3H 2DZEA 1T21A 4P5TD 3HZYB 7CGTA 1ZGLA 3ET9F 1SJEB 5JW5A 2IV8A 3FW6A 3S36L 3QJQB 1F13A 1Q94A 3H6JA 4LPYA 4PJIF 3GMPB 2OZNA 1ZTMA 3ATAA 4FNUA 4WNQB 3VFPB 5CP3A 4R7DA 1Q9KB 2IF7A 3NACL 1K6QL 3NFNB 3V10A 1KXVC 4LVOB 4P07A 3GSOB 1ZLVH 1EK3A 2HJFA 4X0KB 4XB7A 2Q0ZX 1YQ2A 2E5EA 1OTUC 3LRHA 2AGJH 1KTCA 1L9TA 1FL5A 4L48A 1AGEB 3LIUA 2BC4B 4PJGE 3GSQA 1M9WA 1SMDA 2DDQH 4EDWL 3LB6D 4YDVB 1FNHA 2YKLH 2HTLC 1R5VA 1XB3A 5D6DA 4IBSA 5IJDC 4I0KA 1J8HE 3KLLA 4HUXA 1TETH 5JMRA 5IJVA 4PY8I 1TPXC 4OLZH 3N43B 5DS1A 4BK5A 4XT1C 5KVGH 2JFCA 1WTLA 4OSUL 4TULL 3AADB 5D6CA 2H0PA 2D3LA 3TYGL 1C1EL 5BVJB 1DVXA 1KZYA 3Q1SL 2EDJA 3PHOA 3REVB 4CU7A 3WYRA 5IFHL 4FHBD 3U0TA 2X3CA 1IEAB 2BHUA 3AT9A 3L2LA 5EC2A 3C6LC 3VG9C 2YSSB 4XBMA 2UY7B 2CKNA 1Q9WB 3V6ZB 1ZT7B 1VDGA 4L4JA 3RDTB 2VZVA 4BBWA 2O5ZL 5E2WH 4N25A 4NO3A 1AD0B 1S7WB 2G75B 1OT4A 1VKXA 2B16A 1E0OB 5ACZA 2Q2EB 1SDDB 3CLEH 2BVOA 2GB2A 3IMWA 1JPTH 2UZPA 3TONA 2N1TE 1QUNA 3DUUA 5MI0B 1RZGB 1KIPA 5CGTA 4JM2C 2YPKB 1CFTA 1LMKA 4L1LA 3EH5B 2Z7UA 1C08B 1DQJA 3NRFA 5LO7A 1R0AH 3SOBH 1YJDC 2H1XA 1KBBA 1P7KA 3AM8C 3K6DA 5D8JH 4GW5A 3EHBD 3ZKND 2JK5B 3U9WA 3RWCA 3KHQA 3FYEB 3NIFE 2FECL 4MAYD 3O81A 3GSUA 4WENB 3L48A 4NPYB 4M8QB 1N10A 3SGEI 4J2XA 4KZEH 2XN9D 3ARVA 4J12A 3BIBX 3IDGB 3WJLA 4OBRA 5GZND 1C12B 5HHVL 1SUJA 2XPYA 3IJYA 4FRWA 4FFVD 1NCBL 3LZFH 4PB9H 2VXQA 2CR3A 2FO1A 1UZGA 1I31A 2EXTA 5GS0H 4KXAA 1NMBH 3HG1B 2NXYD 3MXWL 4UT7L 1D5MA 2YC1B 3T1WA 3EYQC 4FEIA 2Y1YA 3GSWB 1D2OA 4KVCL 4I2XE 1G7MB 4P2QB 3QDHA 3C09B 3BEWA 5JHMA 3NIGB 1GCYA 2QPDB 1FQ9C 4G1MA 4FQ2H 4JS7A 3ZGIA 3MN8A 4WHTA 4X9HA 3R7QA 1PLBA 1KLGB 2EYSA 1TZIB 5AZ2L 5D71L 4P5SA 4YWGL 1NANH 2Y0SA 3NSJA 4JY6B 5IOPB 2H26A 1EXHA 1P5UC 1S9XA 3WJMB 1S8DB 2NY1D 1XR8B 1ITBB 1IC5H 4FQIL 4Y4KA 2JMRA 1GS6X 5GHWL 4R83A 3NT0A 5TGBB 1ZK9A 1GA2A 1QBLL 4RGOH 3QG7H 1BJ1H 2A6DA 2D0GA 2A9BA 1IGIL 2CA4A 1XGPA 3DTDA 5D1XC 3VTTA 1HCFX 4O02B 3CJJA 3CX5K 5KVFL 3TEWA 4PGJA 4PV8A 5DUJA 2R9HD 3R06A 4ZFZB 1E6OH 1COBA 3BVDB 3DV6B 3MOQA 4O02H 3ZSSA 5C0AB 1UVQA 1VHPA 1WPCA 3BPNB 4PHXA 4LHUB 1NAMB 5CIPA 4YL9A 5DRNA 1D5ZB 1GYAA 1NGQL 1NAMH 3CSGA 3S4SA 1V10A 3ZGHA 2VDMB 2Z93B 2H8PA 3RL1B 4IIQA 2NY2D 1CQYA 2CUHA 2VDMH 3GBEA 3PIQA 2W80C 1XCQB 3T3PE 1XV8A 4M61A 3LS5L 1JPSL 4M6AA 1HXMB 3ARFD 1EEZA 5LBSA 3MLTA 4Z23A 2GITB 3V6OC 1DANU 1QLFB 1EEYB 4WFHD 3U46A 4CGTA 4WO4A 3IJSA 4RX4A 4F3FA 4R97C 4L8CB 3HLKA 1LP9F 1KYUA 1I3RB 1A7PL 5CCJA 2YWZA 1HINH 4L9LC 5F7WC 1UYWH 3UTZA 2WXHA 3EJRA 3NJIA 1U4FA 5C09B 2JXMB 3IDUA 2ZCHL 1EZVY 2AKRA 3O9WC 4S0SD 2GAZB 3RJQB 2B14A 3O6LL 1KN2H 4X7TA 2UZYB 1G9MC 2R0KH 2YQBA 2YGVA 3RGBA 5ITFB 5BOJA 4NUMA 4JG0H 1IJNA 4LCWD 3VD4A 4EZMA 4PLJC 4FHKA 2BCMA 4LPTA 1JK9B 1EAQA 4XVSL 2QR0A 1JD9A 3W1ZA 3CU7A 4NLHA 2DJMA 2J6EL 1M7UA 4GW4A 1BG1A 4DO5A 2JI2A 1M2OA 2OBGA 5DJAB 1SQMA 4DO6A 2CLZA 3UZEA 2B4CL 3QA3B 1XF2B 4XP1H 3PU7A 3LN5B 1L4IA 4FFZH 5FFLA 3JWNG 1FAIL 2J1KA 4I77H 2HFEB 4PWHA 5HHME 2EKSB 4FP8L 5TE6L 2X0VA 5DJDA 2E0PA 4M6ML 3T3MF 3CAFA 1EANA 3JWDC 4MRCA 2AZUA 4QTHA 1E4WH 1SJVA 2FB4L 4ZFOL 3FNKA 3JWOC 4E9LA 3OD3A 5L88L 5LNEA 3AS0A 2OMXA 4P46A 4U31A 2GK0A 4R90H 5EIIA 4FLSA 3SKJH 4KKRA 1DQMH 1ADWA 1DDHA 5DJ8A 2R1XA 4R3SA 1T7XA 3DNKA 5JIMA 5T1LB 5I16A 2C9PA 4PB0L 3FO1B 3CVIH 4NZRH 2V9TA 3K46A 2RTTA 1M57B 1KLFA 2DPKA 4N8VG 3WHXA 1OEZW 2NY4B 3DGGA 4AMWA 2F7RA 1E9OA 2Q3AA 5B38B 1RK7A 3IETB 2JB5H 4DH2A 1DBAH 2GPZA 3UJIL 4Y19B 1FC2D 3RVVC 4IOSD 2BOBA 2GBUA 2JJTC 3IJ7A 5FGRA 4N1CA 3WIHH 3TWYA 4F2MB 1TTGA 1M7IB 4YE4L 1AE6L 2GJRA 4LEOB 2NTSP 4OIIH 4KK5C 1B3JA 2J57A 2P5WB 2PYED 4GUOA 1WVZA 2QBWA 3P4MA 4S2SA 4XE5B 4UCFA 3POCA 3H56A 3P1VA 2GABA 5D2LA 5EU3B 1ACYH 3AB0B 3KPMA 4BJLA 2HAZA 3AQDA 2UXGA 2PCFA 5EU4B 3FQ4A 3AU1A 4JO2H 1S9WA 3NUKA 4QHNA 5KYXA 1G1KA 4B9GA 1F8TH 2BVUA 2FDBP 4PJAB 4AWJC 4JANB 2X4NA 1K4CB 3B34A 1HVXA 4XPFH 4G8IB 1F45A 3D2UB 2CDGB 1DANT 4ANKA 2H0EA 2P80D 3P02A 1H3WM 4BFJA 4OFPA 3WD5H 1ZWIB 2WBWB 3VQ2C 4Q0XH 2XZQH 1C5CH 4OI7A 3Q6FA 1IGJB 2O5YH 3K5SA 3SDCC 1R33A 4RQQB 5B3JE 4NJAL 2FK9A 4WUUE 3NSCA 4AQ8C 4QCIB 4LSSL 4OQ1A 3ZDZE 5BW7A 3DO7B 5EIVA 4PJDF 1VGEH 4JHBA 3QJTB 1NGWB 3KS0H 5I18L 1LEKB 2CE6A 2Y2WA 2BZDA 1BFVL 4P2OD 3TCXA 4OB5H 3CK0L 3OKDB 5FM8A 3KVPA 3BUYA 4I18B 4OCSH 3TYFA 2YOAA 2H7WA 2XZAH 3A6BH 4MDIA 5FOBB 4ZXBC 4XI5C 4NC1E 1RPUA 3BKJL 4PWJA 3C5XA 1K5WA 4Y7MA 2QTVA 5JW3L 3BQUC 4ZUWB 1GZQA 2DLHA 3FT1A 5MEOA 2HH0L 2WWMC 4OKVA 5GIRB 2FX9H 1SVZA 5B7EA 5AVZB 5B8CB 3SE8H 1AACA 1WICA 4MSWB 4WFFD 2FHCA 2R2EB 1T83C 4B9IA 1S7SA 1WIUA 3PWPE 3HKZA 3OXRA 2ZWNA 4PJ5A 5IHUH 2YQGA 3G5YA 3KLKA 4J3OC 2EDQA 5DHVB 2IDUA 4WW2F 4XP5H 1UD4A 1ACXA 5DHVH 1OOWA 4APXA 4PG2C 2R0LL 2H1PH 4MJ4A 2M26A 4PGBB 4X5PA 5PCYA 5AW5B 2AGJL 4ZS7L 3E3QE 2E9JA 4ODXA 2AXGB 4KKLC 4GSXA 4Z0BH 3DTUB 3GDCA 2XN0A 4G1EB 5ADOH 5D7LB 3REWA 3ENEA 3NSFA 4JY4A 1KIQB 3O0LA 1M71A 1QHOA 1KCUH 4HD5A 4YVUA 3VGAC 2YKLL 3K2MC 3ZKQD 4DP4X 5MERA 1JTTA 5EZLB 2QSCH 3PPSA 4NWTL 2VNCA 4S11A 4JGMA 5JXEA 1MREL 5TE7H 1TETL 1KPVA 5H37A 1BX2A 4OLZL 1NCWH 2OSLB 5HSFA 4AZUA 3EHBB 5J11C 4AENA 3QPQD 1O7DC 4B9KC 5GRJH 1WBYA 4WGWB 1XSKA 1HILB 5CF3A 4BH8A 3LNGA 4JFTA 4B3EA 4K7PY 1YVLA 1RAMA 4U1NB 4M4RB 3TA3C 4J39A 1JGEA 1RSFA 1VAHA 4YH6A 4HIPA 5DFVC 1JHTA 3TBTB 2GTZB 2EXYD 2NY6B 2VMJA 2A73B 4M5YL 1WHPA 2P8LA 4U6HA 1H3PH 5E2WL 2VITB 1LM8V 3AY2A 3MRNA 3OQ3B 4AM0A 3HBZA 4N2OA 2NNAB 3HMXL 3ALPA 3OMZA 4IGBB 4HUWA 1C5BH 2BSRB 3N1PC 3CLEL 8CGTA 4OD2B 1NCCH 5D7JD 3STZA 1W0VB 3DX6A 3SDXE 3MPCA 1JPTL 1S78C 4EBQH 2VDNB 4Y5XB 4JRFA 2C1PA 5J6HB 1WG3A 4F7KA 2BCKA 2VDNH 5JOPD 3LKSB 1R0AL 3F7LA 1F4XH 2XWRA 3SOBL 3WEBA 4YZFE 4U3SA 5GS1B 5DMGC 5D8JL 3KWXA 1XGRB 1TQUA 2J8OA 1GSKA 4XCCL 1RFDL 4HJTA 1UGKA 4KTEH 2VQTA 3U36A 4FYQA 1EJ6A 4OD3H 2WXJA 1L6ZA 4AIXA 1JMZA 1MVUA 3M07A 4L3FA 3NTCH 4KZEL 4YO0A 1MAML 5A2KH 4G2AA 3DOSB 1HEJC 3BUTA 1JYXA 4ABQA 2CLRA 4GAGH 4L1HA 4K9JA 2YPVL 4KJQD 3LZFL 1RLWA 1YMHB 2XPZA 2R56H 4JFXA 1A02N 4MQSB 3QUZA 3L8QA 5IIEA 4I89A 4FOMA 2FX8H 1KTLB 1IM3A 4XAWL 3NVQA 3P54A 2EH7H 4JQXC 4H20H 3B43A 3HPLA 1BQRA 1YNTA 5DZLA 1INEH 4C83A 1AR2A 1NC2A 2PR4H 2IFGA 1U30A 1ZHBB 3LEXA 4NZJA 4GP8B 3U4EA 4H1LG 1ZHKB 3ZE2E 1FL6B 5T5FA 2J8UB 3QHFL 4X5XB 4LMQE 4AGNA 5IB4B 2HG5B 1LNUA 2YA0A 1FZOB 3RZCA 1OF0A 3HBQA 3DK0A 3KGRA 1ZK5A 4L9DA 2FSEB 3CDGA 4PP2A 1KJ2A 4G8AC 4XNMB 2HX9A 2J1WA 1R3JB 2Y07H 2EDKA 4RGOL 3QG7L 3VFWA 3KYOB 4R96B 5A3IC 4NRYB 4XH2B 1RJYA 2R27A 1R47A 4YBQD 4FYRA 2XHNA 1TPXB 1Z9SB 3L3IA 4F8LA 4MQXC 4JFQB 3WTXA 1KTKE 2X2HA 2B7DT 1E6OL 3VXUB 4O02L 3CMOL 3BZFB 5AW0B 3QORA 2WIIA 2BLFA 3ABZA 4AQAB 4NKDB 1CE6B 2FO4B 5DEFA 4UANA 2C1OA 2YOCA 4PJCF 1SHMA 5CLTA 2OCCB 3C6LB 4GS7C 1MFMA 2YD0A 3K6SB 3ZDXB 2PTVA 5CEYA 3IFNH 1A9EA 1KBWA 2TSAA 3CTTA 4LCWB 4P3DB 4EN3C 1D7FA 2J12B 4JFZH 4PRHB 3ZO0A 1WTGT 4ZX6A 2TRHA 4TVUA 4AY0A 5E6IA 4I2XA 5AUMB 2VDML 5DSCA 1DL7L 1S9YB 4K9EC 3GZOA 1UD2A 4JPIB 3CBRA 5CXPA 4XMTA 4QGYA 1DZ0A 3MRKA 4ZMPA 1QRND 5DD5L 5LB1A 1I8LA 4U0QB 2AQ2A 3IVKA 4EI5A 1INQB 4PGEA 4BE5A 2Z8RA 3O8XC 1DQQB 5J56B 4FJZA 3IFLL 1KGXA 1FHNA 2BVPB 3NJNA 3S37X 1HINL 1XAUA 1UYWL 3WI9A 4PJ9D 3BXNA 1A6AA 1YJDH 2WWKT 4GAYA 3ASWA 3DMMD 4N8CL 3WTVA 4ZSOB 2E7DA 4P57B 3NN8B 2R0KL 1UA3A 2EP6A 2VR3A 4XCEB 1Y0LB 1Q1PA 4ISVA 4CDHA 4P5KB 4LBEA 1IB5A 3WGVB 3MJ6A 1E28A 2PNDA 3QXUA 2ATAA 1PLGH 5F8RC 4IEFA 2P5ED 3VDAA 2V17H 2EIMB 1UB6B 5IB3A 2EKJA 3WKNA 3ALXA 5GGRA 3ISWA 3FQNA 5AVTB 1T80A 1V3KA 4MA3A 2M2DA 1QPXA 3ECBA 1JXDA 3D08A 4OH2A 1IVLA 5F0MB 1FBIH 5JA8B 1BVLA 2WP3T 2WN3A 3GMQB 4LLDA 4PV1C 5IBUB 3O6FA 1AHMA 3QWQB 5IJKC 5CJ8A 2PYEB 4TTDD 3TX4A 5K9OA 1I1CA 4AQZA 3C8HA 5ES4B 4OV5B 3FFDB 2KYIA 4ZNEE 1AGDB 1DLHA 3EDKA 2BNUB 1E4WL 4WY7H 1P5UB 3FSOA 4XBEH 1YPZA 1I1YA 2NUTA 2R69L 3RFZA 2AEIT 3HZ3A 3QUXD 2P7TA 3QFJB 3V4VA 3MYJB 4HXAH 4R90L 4CADB 3SKJL 1G1OA 2R39A 4X7SH 5IHWA 1DQML 2OTUA 5D1XB 1F4WL 3MRMB 4KKAD 4L3CA 3CVIL 2WTRA 1KB5B 3CDYA 3VJ6B 4N24A 1ES0A 3S3DB 4GMTH 3ASOB 1KB5H 2YFNA 4HJSA 4AVKA 1LVEA 3EGDB 1PFOA 5EZJA 1R19A 4S1SH 1OM9A 3A24A 2WAQA 3ZTDC 4HIEB 1H6EA 3MROA 3WIHL 4DPAX 1LO5B 2F6AA 4AT6A 3HJEA 4FLRA 3MODH 3L9EA 2NY7H 3CN0A 5E8PA 4OZHE 3GI9H 3GPEA 3QIWC 3UDWC 5I1HH 4U1IB 3CIAA 4X80H 4EF3A 4V1DB 3SPCA 4Z77B 3BSZH 4HYTB 1ACYL 1KNOB 1OCOB 4J8QA 4OM1H 5FUZH 4JY5H 1ONQA 1ZIBA 4YSCA 3WTYA 1I7ZB 4JO2L 2JE8A 4Q4EA 1FO0A 3BLKA 4HIQA 2VISA 3WTTA 2BNRE 4G5AA 3KR3H 9PCYA 1F8TL 1FRGH 1MRCH 1A6WH 1FJ1B 2P5PA 4I7ZC 4L9LB 4POUB 1JN6A 3HOGA 3O9WB 2DLIA 4QRFA 4Y2DA 3EJPA 3IE4A 4Q0XL 2KLSA 2CXKA 4C56D 2XZQL 3NZUA 1F3DH 4OJFH 2O5YL 4DCQB 3C60C 4LLUA 3MUGB 2ITEA 1G9MH 1ORSB 2C9SA 3UL4A 3QQDA 3LYRA 2ED9A 3CFTA 4X4KA 1V3JA 3UO8B 3MJ7A 1IFRA 1VADB 3SBPA 3VXOA 4XCYB 2Z64C 4OB5L 4NRZA 5H35B 1A3RH 5LVEA 2XZAL 3S0PA 4HKXA 4BKSC 4U1GC 3HRZA 4L8DB 5BQ7A 1UH3A 4JRXB 4N2IA 3BWUF 4G5ZH 1H9DA 3AREA 1T0MA 2FX9L 5ILTL 4EOWH 1R3IH 1ZT4B 2FBJH 3GTNA 3SE8L 5SV4A 2ZP9A 5E1AB 4M1GH 3FQTA 2YGPA 2LT9A 1U8JB 3FSVA 5HDLA 3SBQA 1JFHA 4WV1A 1KB9J 4X6CF 1J1PL 4MJIE 5TDNB 5JXAH 1OTSD 1BXAA 3JWOH 4PRAA 1E6JH 2F9BT 1IQWH 1I75A 2H1PL 2FJFB 3U2IA 1QPKA 4OJAA 4LMQI 3HE7C 3DJZA 4MJ5B 4Z7QF 5IB1B 1O9VA 5JDJA 3RJOA 4F7MB 4YHLH 5DC0A 5EDSA 4Y5VB 1JRHI 1MFAL 4Z0BL 3GB7B 1UGNA 2ARWA 3L13A 4Z3HA 2LLNA 5D7JB 5ADOL 4HOZA 4Y4HD 4UM9B 4F2EA 4EVNA 2WZ0A 3BVNA 2G9HA 1EDHA 1KACB 5GJSH 4MA7L 3VFMA 2X42A 1A22B 5DGRA 4GRWE 2QSCL 3EFOB 3KBHE 4GKZA 2XWDA 4QRRD 4IRZL 5HYSA 4LOUC 1EVUA 3MLRH 4TKWA 4F1ZA 2WMPA 1AXIB 1NCWL 2CZNA 1AD9A 2BZCA 2OAAA 1U33A 5JORB 4M1DH 1BAWA 3N44B 1HEZB 5B3NA 1NIDA 5FECA 2N01B 4APQA 1S7XB 2VQUA 3NCFB 4KY1H 5C92A 4V2BA 3J07A 5F96H 5KOMC 4PJ8D 5C0GA 5BRPA 5HPOA 1QSEB 4I9XA 4GXUM 3PRZA 3PWPA 4AV4A 5DC2A 2BO0A 4OKDA 3BFOA 4ZRGA 2WIMA 2EXWC 2JKWA 5F7YC 4P0DA 4AE0A 1JGIA 2QSTA 3KPLA 3PP4L 5C0BD 2JJSC 5CGBA 5L8KB 5LQBH 4K55A 1G7PB 4C4BA 1WV7T 1YMMD 4D7PA 5JHDB 5IQ9B 1C5BL 1IBYA 1HYRC 3CLFH 2NQCA 3IDXH 1ZGLM 1NCCL 3DX7B 4Y1SA 2YKKA 4B9ZA 4YSAA 2JV6A 1R6VA 1WO2A 3BP4A 2FLBT 3X1FA 2IJ0C 4EBQL 3OAYH 5ID1A 4B60A 3SPIA 1BF8A 4UNIA 1P9MA 1EHAA 2VDNL 1RK1B 1XD0A 2XQBH 4NB7A 5KVGE 4PCSA 3WS6C 3LPGA 3W11D 3ZHKA 3GJFA 2XXFA 4ZXBB 1JZ3A 4KTEL 1P84J 3GKWH 1SY6A 1XL6A 1CFSA 3B37A 3LD8C 3NJXA 4AJVA 3QRFM 3BQUB 1MCDA 3BAKA 3ZMNA 3FQUB 3NTCL 3OXSA 4LCUB 4NCDA 4PYGA 3UAJD 5I1GH 5I66A 2BWQA 2CJTA 3B9KA 4JZOB 1JJUA 4KTGA 1IC1A 3TV8A 2XTJD 2AANA 1QWUA 3QEGL 4Z7VE 1WBZB 3X1NA 2WXNA 3KGTA 2WQAA 4OZGF 5JPMA 1OAXH 3H1ZA 4HD9A 5EG6C 1EFXB 2M1KA 2V7NB 4OFDA 4ETYA 2LOEA 2ZUTA 2VE6B 2DYSB 2VC2B 2EH7L 4H20L 1VPOH 2WB7A 2YA2A 5T8IA 5DHEA 4UNVA 5IVOA 1JL8A 1A4CA 1ZOXA 4NHUB 3UZQB 5JIPA 4ZUSA 2PR4L 3ATEA 4J3OH 5HHXH 4UOZA 1N8ZB 1LQBC 1RUMH 4X6DA 4NQQA 1ZS8B 3SDXA 1PAZA 3LTVA 2VKXA 4WHYH 3WJJC 1WISA 2QT6A 3AFLA 3HNVH 5FEBA 4WRLA 5LG1A 5DUBA 4KJWD 5E8NB 3ARGA 4PJ7E 2X9ZA 1ZLSH 5E5MA 2WYIA 3VGAB 2KQNA 2FIRT 4JHAH 1Z0MA 4R5TA 5C0FB 1R3LA 3MRDA 1KPUB 3U9PH 3X11A 2B20A 4NO0D 1HDMB 3FB6A 4Q9QH 4J3XA 3RVTC 2IVFC 3RVXD 1EHNA 3OL2A 1RERA 1KFAL 1PLAA 3QZPA 2WINA 1T22A 1UURA 3QI9A 2BW4A 5J11B 1KCVL 5SWSB 4D9QD 1YEIL 3WTWA 3SODB 1RL1A 5I73C 1DUZB 2OXGA 2GJ6E 4K7FA 1D5XB 4YEEA 3T65A 1NWPA 3NCYS 4JG1L 5BZDA 3TA3B 3EOBB 4NZ8A 3IFNL 2CBQA 1HCVA 1QX1A 4F1SA 4MZIA 2OXHB 4FC3E 3FXIC 4TUOA 4JFDE 5IF0A 2IMMA 4RDBA 1UXWB 2CGRL 3NIGE 3ZSTA 1AOHA 2PCYA 2ZSVB 1GSMA 3PJLA 4G8GE 3QJFB 2YRLA 3GRBA 3CZKA 4P2RB 5JPNC 2FL5B 3WV0A 4NENA 2RBLA 2KBGA 5F6HI 1BMWA 1BFOB 1TT6A 2WXPA 1F58H 3GMRA 3KNBB 4AIZA 4CVXB 1MJ7H 2DLFL 4E41B 2QQKH 3QQ9D 1N5YL 3JVGC 1U8QB 2XI9A 1JZHA 2KDGA 3GXNA 4MMZC 4HP5A 4FLQA 4Q8BA 3RPIB 3RWIA 4KRPC 1CVSC 3ARWA 3FF8A 3O3DB 5D7KD 3FHQA 2EIZA 3L08A 1VGKB 3I6GA 4P49A 4HX1A 4OBSA 1QQDB 4Y2OB 5AOZA 3D4ZA 3RVWC 2PWFA 3TEZA 1Z9PA 1GGBH 2WCGA 4FTVB 4GG8A 1YC8A 3UADA 3FFCA 3P4NA 4LKXB 3TCTA 1VLXA 4H26B 4QTIH 1J5DA 2DV6A 1OCRB 3S4SG 1JF1A 1BD2A 4JPSA 3AACA 3GS4A 1UWFA 4U2ZA 1C16A 2IANE 2J8HA 1PLGL 4R4FH 1GYUA 4HKZA 3SBWA 4KO5A 3AMLA 2AJ3A 2EE6A 3FO9B 4FMVA 4GKSB 5H2BA 3OPZH 1MHPH 4M4PA 4BSWA 3WIFA 4JDTL 1T89C 2CWRA 4MLIA 4FXGC 4AUYA 2KLRA 3LIZA 4H5SB 3BUQA 3HB3D 3LMJL 4PIBA 1FBIL 4X7CC 4ODSH 5I0WA 2W0LA 1UXMA 1TQSA 3GHPA 2XKUA 3UPRB 1W0WB 3LRSB 4UT6A 4NUJB 1IC7L 4NNXA 1YEDB 1TCMA 3P4OB 4GO8A 4XBEL 5CHNA 3V4LA 1F2QA 1R5IB 4JE4B 5EU7E 3RX9A 5DXWA 3NSYA 4X9BA 4B9CA 4N4YB 4X7SL 1I1FA 2CBOA 2A6JB 3IJHA 4ONHB 3VSVA 1PQZB 1CT8A 3VAEA 4R26L 2NW3A 4XP9H 1AO7E 4OF8A 3RX5A 4MCZA 2Q86B 5F3BA 1ETA1 2OFQA 3HI1B 3MNZB 1OAQH 1ECYA 1WUNT 4C55A 2JJUA 4HCGA 2FQEA 1YNLH 4JO1H 4WWOA 4FFYA 1I9RH 1HXKA 1A2YB 4GS7B 2XCMC 4DF9A 1GJWA 5JHLA 1TMCB 3HAEB 4O51A 3G5ZA 3X14A 1C8QA 2YEQA 1IBGH 4EN3B 1D3CA 4QTFA 3QEQA 1E4HA 3MRLA 3HAEH 2UXFA 4XNUL 3TBYB 4X80L 2FNWA 1WCBA 3WGUB 2NDFA 1TKWB 3DSNB 2DICA 4HXBH 1JZ4A 3AU0A 5F1IB 4EQ2A 4OM1L 2FYVA 3QDJD 4Z7AA 4PGDA 3S2CA 1KGJA 4ZK8A 2NNRA 2BNQB 4JY5L 4Q14A 3WUZA 5A16A 4BQ9A 4PJBE 5DRWA 5GXBB 4PJGF 3T09A 1NBYB 3KR3L 4X8JA 2NZIA 5B39G 4A7QA 1FRGL 1A6WL 3KXFA 4ZNCD 3MJ8B 4MXQD 4YHOH 4F33A 4FQXD 1L9OA 3WKMH 2VCOA 3NDYE 4M93C 4ZX4A 3VXRE 3CMGA 3B2PA 4W68A 4RAHA 3U1SH 5FA3A 3U2SA 1FZKB 2O93L 1ZT1A 4K3JL 3BW9A 1CF1A 4N2HA 1DEEA 1FFPA 2VGLM 2HJKA 3CFEA 4OJFL 4NM8H 1CUOA 3KYAA 5FUCC 3UG4A 5ANME 5DQJA 4I1NB 3NGBC 2NR6A 4RGND 2BHZA 3MMEB 5D4JA 1CLCA 4UDTA 1U3JA 3IEAA 3QWOB 2EEXA 1RHHB 1AG6A 1IILE 4OFVA 4DQOH 5I0XA 5AB9A 5J9PA 3RPKA 15C8H 2FLMA 2DLTA 4Y4HB 3V7MA 1E9PA 4BFIB 4PJFB 3ZOAA 2Z31C 3H53A 4MB5A 3H55A 4GAJL 3DROB 4NZFA 1YLBB 2AXFB 3DPDA 5D7IF 4M7KH 4ZFOA 4MQTB 3GFUA 3KPSE 1BVKA 1NDTA 2WZAA 4MCMA 2XDHA 4XPHH 1EGJH 1PAMA 3UOAB 1JUFB 3QXWA 4Z7UE 4HG4K 4M1GL 2NY0D 3GMOA 2QFPA 1RH8A 4ODTH 4F58H 2QGDA 3STLB 5IFJA 5FA4A 1U8LB 1ZRUA 1BAFH 1PGRB 2Q6WB 5ETUB 2ADYA 3VQ1C 3GRGA 3JWOL 3QK0A 5SWQB 3N41F 1BM3L 4G8FA 1MHCB 2WXFA 3FRUA 1IQWL 1ULVA 4W9DC 1Q4NX 2ZAHA 3UEQA 2ADJB 4XO9A 4P4KD 5DRXA 4AIEA 3NEEA 1SM3L 3QFDB 3VI3E 3A21A 4F27A 5DMIH 3K71B 2IGFH 4TSCL 4LFHG 2DQHL 3MHZA 1G7QB 4DKAA 2YIHA 4EJ1C 4N68A 5E8DL 3WY4A 1JWSB 1J0IA 2NX5D 3N06B 3NDZE 5F9JB 3RHWF 5D4QA 1MUJB 4XN1A 5C07E 4XXCC 2GFBA 1KTBA 1HHGA 3D69B 4P23C 4WW2C 3PQYB 3QIWB 2BFGA 3MC0A 4KRMB 4J3SA 4HH9A 4DVBB 3GS0A 1RQ5A 4M1DL 3T1FA 2ZTBA 3S3PA 1G0YR 2QFRA 2GUOB 4KY1L 4XRCB 2K6YA 3CFNA 1MG3C 5F96L 5EO1B 1ET7A 3NCJH 3UAFA 1TEGA 2XTJB 2LFGA 2XWTA 4MJIA 2XWJA 3NJMA 3CC5B 4XMUA 2H45A 4JFOB 1NZRA 3FB5A 5LQBL 4NQSA 1U3HC 5LDSA 4FXKA 1AVAA 2W9EL 3NSXA 1DVZA 4KITB 5EEYA 1UM4H 2NSMA 1H5BA 1I85A 3B1TA 4JKMA 4X9GA 3IDXL 2BP0A 3M86A 3ZIMA 4YXLH 4MNQD 5INDA 5EF0A 3D0LA 3E6HA 3C60B 3V7AG 1MY5A 1W80A 3DVIA 5D7LE 4R7XA 4YVNA 1FH5H 5F8QC 5CD5C 3QDME 2ODHA 4KI5E 2VDKB 2YD6A 2AERT 2ZOUA 2L7QA 4ZPTB 2B8OT 4YDLB 5IV2B 3A3YB 1DTUA 5H37G 2VDKH 1F3RB 1J05A 2HFFA 2XKSA 3HMWH 4IMLB 2A9NH 1Q9OA 3EJTA 4P5MA 3SQBB 3I2CH 4U1GB 2DL2A 4K23L 5BRQA 1OGAD 3WXWH 1AIFB 1NCOA 3AAZA 3T3PF 3TNNB 2ORBH 5GZOA 3HE6C 3HZYA 2HXAA 2ZJSH 3FB8B 1SJEA 5E08H 2IC2A 1UB5B 4OV6F 2FUTA 3GMPA 1K8DB 4U1JB 1NIBA 2BY3A 1OAXL 4WNQA 3CH1A 1S5HA 5EU6B 3VFPA 1S7UB 1Q9KA 1MCJA 2F15A 1GMEA 1S6NA 4QHKI 1YAZA 3ZR6A 5J57B 4TLKA 5KVEH 3QNZB 2DRUA 5EWIH 1S9VB 5C2UB 2EUXA 4GQPH 2WGXA 3GDBA 8FABB 3GSOA 2VDLB 1CLYL 1LD9B 1ZJAA 2VC2L 5HHXL 2CCVA 3TEYA 2ZNWA 4HJ0D 2VN7A 2XQ0A 3AQZA 3IM1A 2VDLH 1QLEB 4DEPC 1RUML 1AGEA 3HE7B 1ORQB 2BC4A 4DEUA 3WLWC 1L9PA 4J5VA 1QLEH 3HLAB 4E5XB 3HNVL 3BC9A 5E8EB 5ISZE 4LVEA 4YDVA 5KYYB 3Q5YA 4ERSH 3BSHA 3C5ZC 4NI6A 5BRZB 5MEQB 3LEVH 1Q0YH 4JZNA 1ML0A 4PJIB 4ELKB 5KJRH 1P7HL 3DGCR 3TNMA 4Y1AE 3UTSD 1FG9C 4LLQB 2HTKD 4N0UB 3WNPA 4L0YA 1O7SA 2J71A 3MLUH 1K3IA 3U9PL 3QHZH 4GFTB 4QAMB 3WFCH 4Q9QL 4N2GA 5FC9A 5D1QE 3U9UA 1T7WA 1HJCA 4F37F 1CF8H 5BVJA 1EJ8A 1AZVA 3REVA 4WWNA 3T2NH 1QTSA 3VD1A 1IEAA 5H8DA 4Z7VA 2YSSA 2UY7A 4Y0GA 2N0KA 1SN0A 2G60H 1HNGA 3V6ZA 1DN0B 2K78A 2F53B 3RDTA 3CZFB 1AD0A 2J88H 1X5MA 1FGNH 2ZIDA 2C3WA 1TNMA 1DQLL 3HBGA 1SXBA 1BBDH 4ODVH 1SDDA 2YLKA 2E7CA 5A6IA 1AZUA 1OARH 2V5TA 1QKZH 1M2VB 2VR4A 2C4FU 5DEJA 2XA8H 4JR9H 4W1TA 1AAJA 4IU2B 3NSDA 4KX7A 5TFSH 3COOA 3QISA 4PGCB 1RZGA 2X2JA 4LB8A 5CLYA 5D93C 1L5GB 1E5YA 1ICTA 2QQKL 3H9SB 1SOXA 3F6LA 3N1MC 1C08A 4YHNB 3HG5A 1Z9LA 5AWNH 1MCKA 1PPIA 3LNIA 2JK5A 1SEQH 3A4FA 4OLEA 1XGUB 4M8QA 3ZYJA 2IBZX 1BIIB 5JDSB 4NQTA 1SHXA 2X10A 3IDGA 3EH2A 1Z0NA 3L95A 1S2EA 1C12A 1G0XA 2VXVL 3D4CA 3MRJB 4HWBH 5CMAB 5D70L 3THML 1WE5A 5ESVB 1MY7A 3ESNA 4BGDA 3MV7B 1VF5C 2HA1A 1P4IH 1URZA 3HG1A 5TE4L 2G2PA 3BMWA 5CN2A 1CFBA 3MKKA 2YC1A 4ES8A 12E8L 4L4VD 1IKFH 2IG2H 2CHXA 4N8VB 2XIIA 3GIZH 4OUOA 2V5RA 4NX0A 1G7MA 5EO0A 5BV7L 3C6SB 4P2QA 1EEUA 4D2NA 5C70A 4H25B 3UMNA 4AZ8B 3GM8A 4G8GA 3B6SA 4N28A 4Q89A 4JEGB 1TZIA 1OAUH 1OXYA 4LSPH 3T6WA 5KSAC 4IRSC 1XGQB 4P48A 4XN4A 3VACA 4JY6A 5IOPA 2Q8BL 5B3JF 2OM5A 4JQIA 5PAZA 3WJMA 1S8DA 4XC3H 4ELME 1FCGA 1XR8A 1XX9C 3ZDZF 1EA9C 3WUWG 2ZX5A 5JLZA 3PNWB 3GHEH 2WP3O 3DWTA 1CTMA 1Q9LA 3QDJB 4N8PA 5I26A 5TGBA 1WFUA 5F88B 5HGAB 5F1NB 4ESKA 1RMFH 5DTFB 2BVYA 4OFYA 4JHUA 1DVFC 4HEPA 4ZBJA 3HI6H 4ZFZA 3QQ4B 5F1OB 3DV6A 1BZ9A 2QHRH 4NQDE 3ZPDA 4LHUA 1NAMA 4XP9L 3SBRA 4HJGB 1HAWA 1FYTD 2YAOA 2K8MA 4U05A 3D39E 2D8KA 5FAAA 1OAQL 3UTTB 2DI9A 4WI4A 3TPUA 5I73B 3TJHC 1TENA 2IANA 1YNLL 1MFEL 1I9RL 3ULVE 2W9DH 3RL1A 4C57C 2Q8AL 4LCYB 4RGNB 3F6JA 3S35H 1IBGL 1HYSD 3O41B 2OMNA 5CCGE 1XCQA 4MXWH 1GAFH 4UTCA 1HXMA 3L5XH 3RG1C 4KZ0A 1DFBH 3SE9H 5JPNB 1XQ4A 2GITA 1IKNC 4HXBL 4HWZA 5CLXA 2EDEA 1QLFA 1XVSA 3V9FA 5GRXG 2F1AA 3U4KA 4MNHB 4TN9A 5GGVH 4L8CA 1ZEAL 4IBYA 1N6QL 1I3RA 1X7TA 2WO2B 4MHHI 2PLTA 4LOVA 5C7XL 3I85A 4AYGA 5C09A 3QFJE 2IAMD 2DEYX 2JXMA 4MMZB 1OKEA 1UM5H 2C4FT 3IPBA 4JFFD 4KRPB 4YHOL 1FV1B 4FYTA 2UZYA 3SCMA 2A4CA 3QFGA 5D1ZC 2B5IC 5FW7A 1Y7VA 1WHOA 4AMKH 3L3JB 4K15A 1SOSA 3U1SL 2K7QA 5ITFA 1NBZB 1AO7A 1GW0A 4QLRA 2GW5A 3M1OA 1OGPA 5A2FA 4NM8L 3CD4A 3ZLQC 7FABH 1JK9A 2CJUL 2CM6A 5KBNC 5AZEH 1RZFL 1ESOA 1WA2X 3ULUD 1IC4H 1RVFL 3QG6A 1LP9B 1KDIA 4BXVA 4FFZA 4UQCA 4DQOL 4G9FD 4MD4B 1XF2A 4Q97A 1QMUA 3INOA 15C8L 3O6KH 3LN5A 5JA9A 4KQ0A 4W9GC 2O61B 4WTZA 1Q0XH 1KTDB 2HFEA 3MRRB 4YAQA 2WPGA 2EKSA 3IAQA 4M7KL 3FUKA 4GUPB 5LGYA 2FZ3B 4Z3GA 4L5FE 4JGJA 3FN0H 2WVVB 3MZGB 3M17B 1EGJL 3MA9H 3MV8B 4DPRA 2OJEB 3QH3B 4O2EB 4PJBA 4M9OA 1M3JA 4GFXA 1PTZA 3DDGA 5EA0L 3RHWK 2QZQA 3MV01 3QIUD 5INCB 5K1VA 1NCAH 1BAFL 3ZUCA 5DUMH 1MFDL 4YZFF 5T1LA 1PW3A 2KH2B 3II3A 3JTTB 3FO1A 1R9FA 1KCBA 3CVBA 4LCCC 2LAAA 1EX0A 4FLOA 5IEKB 5IHLB 4LL4A 4N2LA 1U8IB 2VO8A 3BLBA 3L1OH 5LAPA 2EE0A 3BWUC 3BVXA 3KCPA 4X8CA 3IETA 1FORL 3TN0C 4TPRL 3LEYH 3GZQA 3WIHA 1H6UA 2KPWA 5DO8A 2IGFL 3OMAB 1J10A 4MNQB 4XB8A 1BQUA 4GB9A 3T3MB 4F2MA 1WFJA 3EFFB 3LRKA 4GW1B 1YNKH 3LRGA 2F7PA 1M7IA 2E7LC 3SEPA 3IGAA 4LEOA 1UHVA 1A7NL 5GRVK 1J9RA 3NEOA 2P5WA 1RZ7H 4HLZG 5C3TA 5HYJE 4QIRA 5MENB 3O45B 5E7BA 3DECA 2AXJA 5EU3A 3W5MA 1EWHA 3S34H 1EAPA 4OFIA 1SOKA 3KPSA 3ZE2F 5EU4A 2MCPL 1BJ1J 4PV9B 3BFQG 3V4UH 3E8UH 3P0GB 3BOVA 5IESH 5C0CE 4Z7UA 4YHYB 4UTAH 2VJ8A 4DPCX 3TL5A 3OHXC 4CMMB 2OR9H 1MI5B 5DRZB 1K4CA 2P8MB 1HE8A 2GIXA 2WO4A 4F20A 2E7BA 3CFIC 4G8IA 3FCBA 3D2UA 4NERA 1WIOA 1ZWIA 2YAMA 3BISA 4M93B 4RMSA 4PR5B 2LHAA 4MVBC 2WZ5A 1IGJA 5GS3A 4RQQA 1JXGA 4QCIA 3DO7A 3TXAA