4HUCA

Crystal structure of ldtmt2, a l,d-transpeptidase from mycobacterium tuberculosis: domain b and c
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
261
structure length
261
Chain Sequence
MAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of LdtMt2, an L,D-transpeptidase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords PROBABLE CONSERVED LIPOPROTEIN LPPS
total genus 70
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4hucA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hucA01
5DU7A 3ZG4A 3TX4A 4A1IA 4QTFA 1Y7MA 4A1KA 4QRBA 5E5LA 4ZFQA 3TURA 4GSQA 5DUJA 4GSUA 5E1IA 5E51A 4K73A 3VAEA 5DZPA 4A52A 5DVPA 3U1QA 3VYPA 4HU2A 4XVOA 5LB1A 4A1JA 3VYNA 5LBGA 3U1PA 4LPQA 5D7HA 4Z7AA 5E1GA 4LZHA 4JMXA 4QRAA 4HUCA 1ZATA 2HKLA 3ZGPA 5K69A 4GSRA 5DZJA 3VYOA 5DC2A 4JMNA 3ZQDA 4QR7A 2MTZA 5DCCA
chains in the Genus database with same CATH superfamily
1G7PA 1MJJB 1LK3H 4JQVC 1EEZA 1JHTA 1BD2D 2QFPA 1JYXA 4YFLI 3V8CA 5BS0D 5EEWA 4CSSA 2E7DA 5K59F 4AQEA 4IU3B 2XRAL 1JZJA 1XGZA 3VXNA 1YPZA 3A67L 1MF2H 1QRKA 1F2QA 2DMCA 1BM7A 1T1ZB 3FU8A 1KB5B 3GRBA 2NTFB 4YE4L 3UPRA 4TQ8A 1F3RB 1E8XA 3MRHB 3HN3A 3TF7C 2UVEA 2GK0B 4BCXA 4N5EC 3ELQA 2B20A 3FRUB 4XNXH 5E1HB 3A4DA 2X4NB 4TTDC 1DQDH 5TF1H 3VD2A 1U2HA 3QRBA 1S7WB 3V52H 4ZUSA 3GLZA 4P48A 3ARDB 2AVFA 4KU1A 4WHYG 5PAZA 2Y6SD 4EBQL 2CXKA 5AKVA 2JMRA 3BDYH 2L8AA 4IM8A 2OMVB 4U1HB 3VJ6B 1W72L 1RZGA 2R69A 3TWCH 1MCOH 4LU5L 4U1NA 3CX5K 1J1XH 4FL4C 4N0FB 3HAEB 4GT0A 4EJ1C 2G9KA 1B6DA 3L13A 4OLWL 1UZ6E 4L1BA 4JRXD 4Z7UE 2VL5B 1FZOB 4JMXA 3VFNA 1IAMA 4AIXA 4BSVA 2DDQH 1QLFB 4KMLB 4B9PA 1I9JH 1PTZA 1K72A 3L3GB 4GFTB 1FE8L 4XNYH 1MCWM 1NAMH 3IFNH 2PPEA 1BVKA 3EFDH 1B4RA 1FL6A 5C0CB 5HGDA 3H8NA 3RVVC 1UM6H 4ACPA 3BKMH 4PGDB 2UY6A 1CD1B 4FYRA 2FSEB 2VDQH 3CZNA 4Y4FC 2AEOA 2EINB 2Y5TB 2E7CA 2YBRB 4XOBA 4WWKC 4JHWH 4UBDD 4LLQB 3G6JA 3QFJA 5AD0A 4R2GD 3WEOA 5I73B 1CK0L 1G7IB 4HK0B 3SPVB 4HV8A 5KN5A 1XIWD 4UMGA 4Z7OB 3GBNH 1KENH 1UJ3B 15C8L 3O3EB 2O61A 5EV7A 3CDZB 5GGSY 3LMJL 1AFVH 3QIBD 3N2JA 1GGUA 3U48A 4BFRA 5AOLA 2VC2H 1TNNA 3TNMA 3CFCH 5ITFA 3BP6A 2QVTA 2YRBA 1J5DA 2O5YL 3ECWA 3C5ZB 4J8QA 4QHMA 3D85A 4OD3L 4YHOL 5D55A 2PYED 2WBJD 5LG1A 5DEGB 2QSCH 1KEGL 3C60B 4BYHA 5I8CA 1XF5A 3EO0B 2VXTL 4MNQD 4I1RA 4TVSa 3WFBH 4K3HA 1C7SA 2I25N 4K2UL 2E47A 2R1YB 1S6NA 3KYKL 5E6SB 4L0PB 4QXTB 4KNTA 2A9ML 4P2QE 4ELKB 1JPFB 2BNQA 2X4UB 4GUPA 5E8DH 5IQ7H 5F1SA 5EN3A 4GKSA 5E99L 4LBEB 2O5XH 1FP5A 2D2OA 5JORA 2P5EE 1V3KA 4X4YA 3PJSA 1RUAL 4OT1L 2D7NA 3NFPA 1SY6L 2B8OT 3QULA 1T4WA 4LCWA 1YRKA 1QR1A 5EO9B 2WC7A 3GLAA 4CAGA 1GYCA 1FO0A 2OTUA 1EJFA 1YNTB 2NY3B 2WLMA 4I2XA 3N1PC 1IL1B 4DP8X 2EVGA 2EVHA 1CGUA 4FNUA 4ZS7H 4UQBA 4P2OB 1ZLSL 1FZJB 4J2XA 1IM9A 4WY7L 1DUZB 2DQTH 2O6CA 3DXAE 3LZFH 3FO2B 3T0AA 5B8CB 4F91B 4QRTB 3I6KB 3F7PC 1FUNA 4YS4A 4E9RA 4X2UA 1D5ZA 2K4AA 2MWCA 2ENYA 3OX8A 2F1AA 3EFFB 4JFZH 3SJVA 3L3DB 3QJUB 5EBLB 3QCVL 1KLFA 2AJUH 2FO4B 3ARQA 3DX1A 5CZKA 3TYGL 3UBXA 2HYMA 3GMMA 3Q6GL 4JFEE 5D1XE 3GB7B 1T20A 1GY1A 3D0LB 5K9KA 3L5XL 4FA7B 4M1CC 4D0DA 4FYSA 4K71C 1I8MB 4HIXH 2EEAA 4G5ZH 3M45A 3WS3B 3VG9C 5D7JA 2WZPD 5F0JB 3CVIL 4QHPA 1GCFA 2ICEC 4G6JL 3SKUD 1E8YA 4LCWE 2BW5A 4ZO6A 5FGBC 4UDUB 2NX5B 1E43A 3GSQA 2ZF9A 4BFIB 1FV1A 5EU6B 3HC2A 1H0DA 1DJIA 3MLZH 4HEMA 2A9MH 4G7QB 3VXSA 4HH9B 1MCCA 2B59A 2FJHA 4PP2A 3T4YA 2WXFA 5GSRA 4DP0X 1L0XA 4B41A 3TA3D 4XXDB 5IB5A 2CKBL 1XF1A 4PWJA 5C07A 3B2DC 2ADIA 4JFXB 1ZWIA 1IFHH 3DBXB 5GS1B 1G4RA 3FB5A 4OJFH 2NNCA 1VERA 4RFOL 1XGTB 2X89A 2VR4A 3DJZA 3AJ7A 5FW7A 3EOYG 3MRQA 3T9WA 5CGYC 3APFA 1IGYA 2V3DA 3R8QA 3VCLA 1RL1A 5E2UL 1BFVL 5D71H 1OT2A 4FFWD 1JCKA 4J3OC 3VU2A 2AEQL 4JPVL 3Q8FA 4L8BB 5J1SC 1HHHB 2VSMB 3P11L 1ZLEA 1NM4A 2BM3A 4JR9L 3EGXA 2O1AA 1JHLL 2ZXWB 4AEEA 4X5WA 4TF4A 1FPTH 3WNKA 5CGYD 2L7JA 1RZPA 1X5LA 4OCXL 2J6EL 4N0UE 3S4SB 4X6CE 3SE9L 3T2QA 2EIDA 4QGTA 2NR6D 1KXQA 2UWEB 1I1YA 4PWEA 1GPOL 5FO8A 4KY1L 1ICTA 5SWSD 4WNQB 1ORQA 3ZDXE 4KKLD 4MZRA 1COBA 3DVGA 4WDIB 2Y7LA 4M6OL 1MXDA 1MJUH 9CGTA 4NP4L 4RAVB 1SUHA 4S0TD 4XT1C 4NO5A 4M6NL 4LHUD 3AUWB 4PAZA 1CD8A 4K94L 2XQ0A 5FM4A 3N5AA 3SDXA 3QPXL 4KUCD 5TQ0L 4F7PB 1ONQB 5ABAA 4FXGA 3HCVB 1NCIA 4GLRH 2O6DA 1BREA 3B8YA 5IG7A 4Y4FA 2YMTA 1LNUA 3ALXA 3K71A 4XCYB 1AQMA 1MFAL 1OGPA 5DO2C 5EBGA 1YG9A 4LCUB 2HLAA 4OJCA 3KGRA 4N2EA 4TUUA 2AJYH 4MQSB 1QRND 5IR1A 1BPLB 4OFDA 3RKPA 1MI5A 1IC1A 4LDOB 3TASA 3WMSA 5JR1L 3F6IA 3B5GA 1LDPH 5J3HD 4AEHL 1N3NA 2DV6A 4JVPA 1C08B 5EOCH 2VAJA 1A6WH 1MFBH 3BKML 5F1IB 1KYFA 4QRSA 2B0SL 5AZ2L 1SHMA 4WZ9A 4ECNA 1CFSB 4R6UA 1TTAA 1BMWA 1I1CA 2KQNA 3FQWA 3V0WH 4P5MB 2UXVA 3VXPB 1OD7A 2Y06H 1TYRA 4JPKH 1FRGH 1CFBA 5HGDB 3CH1B 1F4XH 4U0RB 4K7FB 4PEEA 2YBRA 2AJXH 3GC3A 4JPKL 4MA1C 3KLKA 3Q1EA 3S34L 3MLUL 3TH3T 3QEGL 4DZBB 1BLIA 3ULUL 1NGWA 3RWEA 4BZ1L 3NIGF 2CKBA 5JA8B 2X6BA 3FCGA 3CCHA 4ZMTA 3E1F1 2N7AA 3ZKMC 5FCUH 2JK5B 1MVUB 2Q86B 2Z0UA 2BRRL 4XP4L 4YDKL 1GRWA 4UQEA 2X7LA 2HT2D 2WYZA 1IBBA 4GEIA 3WY2A 1I8AA 3WNJA 2F54A 2WQUA 2Z92A 4A38A 3C8DA 1J5OL 1UTDA 5A43C 5AYQA 3E6HA 3O0RH 3RURA 5TH2A 5E7FA 1AKJB 2FBRA 1AZBA 4QHNB 5CD5D 3MBWB 1MCBA 3QZOA 3RZWA 5IOPB 2NT0A 4DOHE 3TVMD 3QIWA 1NPNA 1MCFA 2K7PA 2FNBA 1JDAA 2Y07L 1AZZC 3MV7E 5IV2B 4TVUA 3ZE2F 2OXHB 3L08A 4PWHA 5BZWB 1WS8A 2BSSB 4XBGA 1XH3B 4PU2A 4MVBC 4HCFA 3VXRB 3IAQA 4FJ6A 1AZNA 4ODUA 5IEHA 5L2KD 1I1AC 1DBML 3GRWH 2AP2A 5INCB 3ULVC 5BJTA 4Z7UA 4Q4IA 3LKQB 4NZUL 1DSFH 3KL0A 4QRPA 4C56D 5FC9A 4CDGC 5EU3B 1MFCL 2MCAA 3SQOL 2CH8A 3U4KA 1BJ1J 4NERA 2V3FA 5LAPA 1Q9LA 2VM3A 4K5MA 4TS6A 5GISH 3MYZA 4W9FC 3ARSA 4P9HH 1L7TH 3SHSA 5DTFA 1OGSA 3BWAB 3TONA 3SKNA 2G5RA 4XP9L 1BOGA 5JPNA 5CGBA 3D9AL 2AJXL 4GMTL 4CMMB 2X9YA 5KVFE 2Z8SA 2DIAA 1Z66A 5CEYA 5DMIH 2YBGA 1UXWB 3LHPL 1S3KH 3LKSA 4OKVB 1OP3H 1JGEB 4I9WD 1RZQA 1WT5C 2LOEA 3HZVA 2RFXA 4APXA 4LPCA 3FF7A 5E6ID 1A6TA 3T3PB 4X9HA 3QA3A 3T77B 1ANUA 4K2UH 5ICYB 1KPRA 1QEWB 4P0DA 4DKDC 1L0QA 5GRVL 4BD4A 3TBYB 2WZ5A 4B0MB 1D9KD 2F1EA 4HPOH 5E6ZA 1NFDB 4L8SA 4E0RA 1U8HB 4UTAA 2BY0A 5L6YH 4CVZA 1J0IA 3BGMB 1HZHH 3BT2H 3LKPB 4M7ZC 4PPTA 3RL2B 4Q9RL 1Q0XL 3DOHA 3VMNA 1CYWA 1XX9C 2VDLB 3GSOA 4KHTL 3VFPA 1MJJA 2GYSA 4HWNA 1QACA 4HGWB 4R5VA 2SODB 4UI2A 2XWEA 4U1IA 5F6IC 1FORL 1KPUA 5E00A 5ENWB 2DD8H 2VQ1B 3VXNB 4HIHB 1H6TA 2DQMA 1DJSA 3IKCA 4KQ4H 4PVNA 4F92B 1UWGH 4FQLH 5CCJA 4NXSA 4P99A 5F7MC 1XGPB 2NZ9C 5IM7B 3VI3A 4Y7MA 3FRUA 4N2GA 1NGYB 3FO9A 4MDJB 4B3VA 2HFGL 3RNKB 1FFQA 1J48A 1JGUH 5GISL 2LR4A 3K4ZA 4LLVB 4EF3A 5IJKA 4JM4H 5EF1A 5AZUA 5SV4A 5IT2L 4UV7L 2PP7A 1KGCD 3MZGB 2WBJC 1E4KC 2BP8A 3SBQA 1NPJA 3SZ6A 4ZFGL 3IDUA 4YHKH 3ZJAA 1KTRL 3ZVVA 1TOXA 2C7UB 2HJLB 3MTXA 3HAEA 2EIEA 4XMUA 4MS6A 2C3VA 3O3AB 5IVXF 3V5KB 1WZ1H 5IBTL 2VUYA 3IRCA 2IALB 4GIPD 3GIZL 4TLSA 1J1PH 4N86A 1SHXA 3JQOB 5FHAL 3L2MA 1DBAH 2E6QA 1T03H 4MCYA 1AD0A 1OF0A 1X5AA 2HFTA 3EOBA 3MRBA 3N44F 4FADA 4ZFOA 1HINL 1AQKL 1P7KB 1T5KA 4ICWA 4IS6B 3TA3B 3IMRA 5F96H 5L2JB 4I0KA 2JQMA 5DMKB 1RJYB 5LVEA 4DK6A 1N0XL 4NSKA 3JWDC 4WTZA 4WWKD 3QJZA 1P2CB 1EZSA 1M7XA 1TQVA 2BFVH 3VI3E 3Q2LA 4PV9A 4MYWB 4CVXA 1KWGA 1O6SA 3WYRA 3US0A 1MRFL 3L5WA 5DRZB 4PJGF 5B4MD 1FFRA 2GI0A 4JCMA 4CN4A 3KLHC 3FZUD 1A9BA 1C16B 1U8QA 1WCQA 2RALA 3BVUA 3EJYD 2QQKH 4YLQT 2DI7A 1CJYA 3VWJB 4XCEB 3EF4A 4H8WH 5HHOE 1FE8H 2A77L 4XNYL 5JO5A 1MLBB 1QVOA 3B7SA 2UWEE 1AOZA 1NMAL 5CJQH 3VI3F 3CPLB 2CPCA 2XKNB 4LVHC 3B43A 1UXLA 1BZQK 3MR9B 3U9UA 5C0NC 4GKZA 4CILA 3ZYIA 4JPVH 5I74C 3GJFB 4GAFB 4PRHE 5DK2B 2PWGA 4NZ8A 1K8IA 3KYMB 2A73A 1CF8L 4BSWB 4O5LH 5ICXB 2WQ8A 1NBZA 4HGKC 3NFNB 4JPWL 1YEHL 4FTVB 1JZDC 3CUPB 4KBPA 4WO4C 1KB5H 2QSTA 5E1AB 3ZRSA 4I1PA 2VDRB 5I0ZA 1NH6A 4PJXE 1XBDA 3N04A 3RIAF 1C1EL 3ARGD 5D7KD 4A7SA 4MA3B 1OSYA 2X4OA 2JKJA 1ZSDA 3FNKA 5I6XC 2ZOTA 3PJSB 2BX5A 2K8QA 1X6NA 4KJPC 5K1VA 4NQEE 5E0FA 4ZFZA 5CUSL 5DUMH 1P5VB 5B8CC 3KVQA 4U31A 2XV3A 5MI0C 1H3PH 2BS8A 5IQLA 2O6EA 3MGOA 1J05B 2A4CA 4U6YB 4G5AA 4X80H 5AG9A 4S11A 1VPOH 1ZHNB 3P4OB 4EDWH 5E2WL 3AU0A 5HYJA 2I60L 2GBUA 1FZJA 1FVEA 4BFFA 3CCHB 4WGVB 3R0MA 4L9LB 4LFHG 3CG8A 2XKSA 3GMPB 5GSVB 5KAQG 1AZUA 5JYMA 3HZKB 4RGOL 1YN6A 2WUBH 3CMOH 3D39B 4LOFA 5KW9L 1E6OH 2DMGA 3MDJA 3QI9D 4PG2A 1UH4A 3RFZB 5J6GA 2ZUXA 1FORH 5E1GA 4ZW8A 2DWEA 2ADJB 3VM5A 4JFYA 1CLOH 1OM3L 1KTKE 4HIIA 1AKJA 5DEJA 1IRAY 1INQB 5HPMA 3AQZA 1FHNA 4H0HB 4F24A 3L6FB 3QIUB 3UACA 3V7AE 5E94A 1IEHA 4J27A 2NY5H 5CD5C 1RUMH 2YJQA 4ISVA 2HJFB 1XL6A 2B1HL 1DQLL 4U1KB 4Z7OE 1ILUA 3L8QA 2XPGA 3BESR 4IRJD 3BP4B 2DQTL 3LZFL 5JYLA 4XGZA 1TJIH 4F80A 5E7BA 1JXKA 3A67H 4XN7A 1QI4A 2YGOA 3T0EA 1EZUA 3RDTC 3WFCL 1IQWH 2OR7A 3KYNA 2VC2L 1IGTB 4E2OA 5LB1A 1ZK5A 3WDHA 3V5DB 4RMQA 5AOKA 4D9RD 4XI5D 4HFUH 4J4PD 5I1DA 3I85A 1R5WA 3ZT7A 3DRTA 2ENSA 5DJ8A 4AGPA 1UA6H 1MCIA 3NUKA 4PBVC 4P05A 3MAWA 2BVYA 2OZ4L 4MTMA 1JK8B 1G1YA 3L95A 1TJHL 4L05A 4PH8A 1H15B 1OPGL 1ZT7B 5F7NC 5C0EB 3TBTB 2NY6B 4TQHA 3AB0B 5DK3A 2R2HB 3UAEA 4MCNA 1OQXA 5D8JL 5T3XL 2PTVA 2VMDA 3UO1H 3TEZA 3W0WD 1OPGH 1ZS8A 1II4E 1JSYA 2H2SC 4P5SA 4W6WB 4NQUA 3VJ6A 5HVWA 3A4AA 1GS6X 4YK4B 2FD6H 4LLYB 3X17A 4AENB 3V4VA 4UT9A 3FSWA 3NSCA 3FHQA 5DJZB 2JJSA 1RLBA 3L4TA 3L3HB 3I2CL 1BF2A 3OPZL 4XTRC 4IBUA 1MHHB 3CDCA 1DQKA 3QQ9C 4JKMA 4KQ4L 4YXKH 5L4MA 4A67A 3QZPA 4Y4HD 3T0EE 1ETZB 2WOBA 3OJVC 4P2RA 4WI2A 1LTXA 2R4SL 1FNSH 3ECBB 3TP4A 1QFWI 3C5ZD 1UB5B 4XOAA 3BQUC 1TEYA 4Z3TA 2BIOA 3DURB 3L2LA 3MLSL 2D7TL 5IREA 2D8KA 1AG0A 5DJ6B 1E50A 3FTWA 3MHZA 4HCGA 3LHAA 3S35H 3BSHA 4RAVA 3BGFC 1BA9A 5FYJH 1EFXA 2NNAB 3IFPA 4ZZFA 1N6UA 1PX8A 4PLJC 5HSFA 4OIIH 4N0CC 3B7RL 4K94C 3RGVD 1IQDA 5F9OH 2DQIL 1YEHH 3NJXA 2DY2A 4M8QB 4UQAA 1KELH 3VXMD 1NCCH 3L3IB 3PCYA 2NXZD 1Y07A 4JM2C 5EOQH 3UC0L 2WZAA 4YBLC 4GBXB 3ZG4A 1K4DB 4GG6E 4MD0B 3CVIH 1CU4H 4N0YL 5HHXL 3GHEH 5JXED 2J73A 1P4UA 1YHPA 4Y4KA 2O6FA 4XNQA 3TZVB 1FG9C 4XMZA 4WWID 4AEFA 3X12B 1WEJH 2E7BA 3GKWL 5EIIG 4AYEC 4WKZB 4PGZA 4HZLB 4Q4EA 3Q1SH 3RVXD 1AI1L 5A2CA 3MLRH 3L7EB 1CYGA 3GSUA 4MQ7A 5D1ZC 4MCYB 2NUPB 3KG5A 4QHKI 1LDPL 4F57H 4GKSB 3RJOA 1MRDH 4WI0B 4BELD 2RH0A 1MCQA 3UTPE 2GHWB 4ALAC 4DT2A 1S7RA 4N24A 1SF5A 4U1SA 3VH8B 1B3JA 2C7FA 2Q7YB 1F3JB 3HKZA 4HJIA 4TLTA 2P80A 4PB0H 1IGFL 2OTUB 2F7QA 2HX8A 4GO8A 1T80A 1AFVL 3UJIL 3UAJD 3KEDA 2GTQA 3BEWA 3ZW3A 4YFDB 1W0VB 1PX4A 3CWGA 1OGAD 3FC8A 3R06A 2YC1A 2NY2C 5EPMA 3JTSB 3ZKND 3UOAB 3W37A 1Q9WA 1A7PL 4TKWA 2Q8AH 3X11A 2F74A 3P9LA 5IFAL 2EH7L 5C0CE 4A2EA 1PX3A 1S7SA 2BRRH 1A2YA 4XP4H 4OF3A 5B38G 4X6FA 1T6VN 4QRUA 3WN6A 3DSNA 2ZTBA 2ZOOA 5T5NF 4RGND 3MNVA 3MRLA 3HEIB 4L4TB 5FA4A 1VZIA 4N1CA 3TM6A 2D3JA 1A4KA 4ZYKB 2V7NB 3WLWD 5HHXH 4MMZB 2R4RH 3RPIB 2YUWA 2V17H 1DVFC 4Y88A 1KB9J 2HRPH 3US9A 3TFBA 4HKBB 3GS0A 4Z7WF 3DX6A 2J44A 1A1MA 2LV4A 4M43H 3QCTH 1T1XB 4NPYA 4X5RA 2WUCL 5HI5D 5INCA 4ZFQA 5LCVA 4HS8H 3OJ2C 3AMKA 4MASA 3GS4A 3IF1A 2PTTA 2Z8RA 1A7NH 4FQPA 2G3XA 5HVFB 1TR7A 3U1QA 3ASNB 1G9ML 2ESVD 3IXTB 3HUJE 1SEBA 1T2XA 2XTJD 3P3RA 2CBOA 1DFBH 4HC1L 3TJEL 5FXCH 1J8RA 4FJZA 2ZWSA 5HGAB 1KB9K 1BP3B 2CCVA 5IHWA 5IBLC 1RUML 4QO1B 1J8HB 1BOGB 2F53A 3MJ7A 5FYJE 3OZLA 4XHJC 2B15A 3EIFA 4DGIL 4OR1A 4JGMA 1B0GB 5TDOA 2UYLA 3EDEA 4ODXB 1MREL 1M7DB 2B1AL 2APXA 1YNKH 2OI9B 5IVZB 3S5LG 2DWEB 4JM0A 3WU1A 3C5SB 1EMTL 5M7QA 2OK0H 4HWBA 5GJSH 4EN3C 5J9PB 4X6BA 4LVNC 4V33A 3W3BA 5EN2B 1E3FA 4W9IC 3VD9A 1HHHA 2Q8BH 2GSMB 3CFUA 5ERWB 1NICA 3EFOA 4K15A 4ONHA 4S0HA 5ITBL 2BP3A 4ISVB 1N68A 4OCWH 3LYRA 4PJIE 4OVUA 1OK0A 2H9GB 3BGMA 4N68A 3VQ1C 3EJQA 5KJRH 4HUUA 4KRLB 3LN5B 2D7QA 5GZOA 1USQA 1WZLA 4KPHH 5I1EL 3FT4A 3Q48A 2J8UA 3LNHA 3WFBL 2EZ0D 4OD2B 1WK0A 4B5ZA 1SHSA 2WLIB 1SF3A 2IDUA 3CQFA 3RI5F 5ES4B 4CJ1A 2M2DA 1QASA 3K6SA 4NJ9H 4M6MH 3HC3H 4JVUA 4QRQA 4Z7IA 4LQFL 4JFFB 4FMFA 5DZJA 1OO2A 3B9KB 4XCCL 3RIFK 2R56L 4A7GA 2J5LC 3HR5B 3C6LD 3QDME 3QISA 3S0PA 3VD0A 3H2PA 3OG6B 4UBDC 1FCGA 2V9QA 1EHLL 2CHXA 1NGYA 3F85A 5I71B 1DJYA 3QUMA 1GMEA 1LEKA 3BJLA 4Z8FH 4B9JA 1HSAB 1FAIL 4DQOH 1KJVB 4F8LA 5EF3A 2QHRH 1OSZA 4FQHB 1XF2B 4R2GB 1NOFA 3I2CH 1D7FA 1T22A 3FCSA 3S37H 2YLHA 5GGQL 3VTAA 4QYOA 1CDJA 4J5VA 2H45A 3VRLE 4PD4J 3N06B 3THML 5KSUA 2NXYC 3DUUB 3MRNB 2XNAA 3ROOA 4F27A 3SPIA 3V5KA 1CD9B 3KGUA 4UV7H 4CDHA 1QHQA 3QQNA 3IFLH 2DQIH 1G0YR 1DLFH 5E6UB 1YY8B 1FO0L 2OR9L 3ALWA 1F97A 1GPOH 4RMTA 4QRSB 4PJEB 2ZNWA 5E8NB 1CBVH 2C8NA 3HFFA 2Q8AL 5C3LD 2CO6A 5DJ2A 1BW8A 3P73B 5FYJL 3QEGH 2WLNA 2OZNA 4OGZA 4PTTA 3SBWA 1QZ1A 5CCHE 2P8PB 3CFKA 5E9AA 2XWCA 2Y36L 2D3VA 5E8EA 4KUCF 1WAAA 4HUNB 1OGTA 2KKQA 3BZDA 4A2MA 1UFGA 3SY0B 4UQ3A 1HWHB 5DHXB 4DEPC 4LHJB 1NBCA 1ZSHA 3GXDA 4GRLC 4R5XA 1HI6B 3P77A 4Z7VF 3KEHA 5FHAH 3ULVH 4JAMA 1TCRB 4AQOA 2AERT 2XVBA 4YHPB 3F12B 3ESNA 5EO0B 3HBGA 4FYQA 2H8PA 4CW1A 1NDMB 1KTDB 5DVLA 5E03A 3MJGX 5BZXA 3KPSA 1CGXA 4B97A 1PAZA 2XN0A 4BFOA 1QX1A 5JZ7C 3QIBB 3ZQWA 2EDKA 4FQXC 4NPKA 3BVVA 4HKJB 4EDXB 4MKTA 2VDQL 2ZUVA 2ADGB 1YEJH 4YXHH 5HYQB 3ARFD 4XCNA 2BIQA 1JV2B 3OB8A 4ZO7A 5HYJD 3VGEA 4PI2A 4OQTH 4KX7A 1CXLA 3OAZK 2EO7A 2N01B 4ODWB 1H3XA 3GZPA 2HT4C 4UUJB 3KWVA 4MWFA 5GRVK 5ID1B 2DQGL 2VDQB 3WDIA 3U25A 3UJJL 4IHOA 4DUWA 4HZLA 2BJMH 5DVPA 2PF6A 5C0JA 2QV2A 4XBGB 1FFNB 5C08D 1WFMA 2KLSA 5K9QG 5DZVA 2NNFA 2WCGA 4MD5A 3ECVA 4WFFD 2ZIDA 1ZJBA 2JCCB 4D9RE 1A66A 4G8GB 1P84K 3FT3B 4Z7VE 4KRPC 4TULH 3MUGA 1D5IH 4MXWL 5HPOA 5F7YC 4PIRF 3FXIC 1TTBA 43CAB 4KI5D 5DJXA 3ZE0F 2YGQA 5I15H 5C0GB 1QUNA 1NMBL 4FHKA 2ICCA 2OL3L 5D6DA 3WHXA 4YC2B 1YUHA 4YGVB 2NY4D 2YPKB 4JM2B 2UXGA 1BVOA 3UYPB 1U41A 4PGCA 5DJCA 2P24A 4WUKL 1QD0A 3BH8B 4K3DH 1A1NB 4JDVB 1NLDL 3BD3A 4CNIB 5F7WC 3T2PA 2Q7NA 3RUGB 1IC4H 3SJVD 4LRIC 1AGBA 2M83A 3C2AL 1MDTA 4HISA 4L4VD 1RH8A 3MI6A 4L8CB 3DX8A 3L48A 3B2UC 3H3BC 1KNOA 3HG2A 4IW4C 3ZTJG 4WTXA 1MFMA 2YMOA 3O4LD 4RGOH 2IPUG 4WENB 2JKIS 3ZKXC 3L6FA 1AGFA 1SFHA 3QIUA 1QBML 3PQYD 1QQDA 1KN4H 2G3ZA 2VABA 1XGRA 4FMKA 4B53A 4UT6L 4HHGA 3SCMA 4N1HB 3TBYA 3OKMB 1D6EB 3MREA 5T3ZE 1XSIA 4MAYA 3H2QA 2AKRA 1LE9A 3D0VB 3ABKB 2AQSA 4FQJL 4MJIE 3VFWB 2V5SA 3WXVL 3R0NA 3ZMRA 2I07A 4G6AD 1X4YA 4Y9FA 5BQDA 4G80A 4NO2A 2PO6B 1KLUB 2G4GA 2OXGA 3EDJA 2ROYA 3UGUA 4U1IB 1YMMD 4MQXD 1TYJA 4PVBA 4XPAH 4ICXA 2NXYB 5MI0B 4C4KT 1A0QH 2XTLA 4FZEL 1NOAA 3TTYA 4KH2A 1FIGL 1GW6A 1FGVL 5AZEL 2PXYD 2OPCA 4ERSL 2X1QA 3D7PA 1IU1A 2C26A 2JXMA 3HLKA 5I1DB 4R2GC 3JWOL 4I0PB 3UJIH 4DKAA 5I28A 3NFSH 2ZPKH 1EEUA 2DKUA 3HFMH 1CDHA 3Q6FA 5J56B 1UT1A 3BPCA 1IE5A 5DDHA 3TJPA 1S3KL 2PCFB 2KT6A 4X8GA 3MUJA 3Q5YA 2VLLA 5KVGL 3VFSA 2X9ZA 1G9HA 2W95A 1A6UL 2Z93A 4L29B 3T6VA 1U8NB 4PREB 1SLXA 3NJKA 3AQDA 3HG0A 2BNQE 1M7DA 2F7IA 4TRPH 3G7TA 1C1EH 3ABLB 2VDKB 2Y23A 5DD3L 5DZLA 3S5YA 1MHPL 3G6JF 1AR1B 4K7PH 2BOLA 2YRPA 4APQD 4I13B 4BXSV 1ZY9A 5F97E 3UGEA 1RU9H 2Q3ZA 3GI8H 3PHOA 1ETZA 1DFXA 2X6CA 1WEJL 2Y24A 3GKWH 4KJQC 2LLLA 3UP6A 4BGDA 2Y6SC 1CWVA 3QUYA 4NZRH 4GFXA 3UXFA 2BSEA 3KJ6L 2O72A 1A4JA 3HG1A 2IFFL 3WEXB 1RMFH 2CHNA 5TK4A 5F1KC 3H6JA 5H4YA 3CK0H 1JGVH 2CA4A 3VAEA 4P59H 2OJ1A 3QUKA 1WBZA 4D7PA 1TZGL 5T1MA 4D8PB 2A0LC 1XBRA 1F5WA 2JKXA 1KG0B 1XR9A 1BWMA 3MUY1 1NCTA 1H0DB 4NUGL 5EZPA 4ZDHA 1I31A 1MFBL 1QHOA 4FFZA 2YEQA 4QT5A 4JS7A 4OJFL 1BQLH 2VXUL 2BERA 5B1CA 4OLUL 2CDFB 4R97C 4N20A 4NZUH 5IHUL 4PFEA 3QAZC 3BFWA 2DAVA 2JCCE 2C9RA 2H2PC 3NGBB 4NNXA 1HESA 1P1VA 2VH5L 3FL7A 3VDAA 3L1GA 1IX2A 3OR7A 3G5XA 1XIWA 3G08A 1R9FA 2N1TE 3IPFA 4KFZC 4QHUB 1R24A 3OR6B 5FK9B 1NBZB 2FIKA 2QVMA 5F7DB 3QDMB 2NY1D 4FMVA 1IFGA 1KCBA 3KBHE 3K8MA 3VG0H 3HE6A 1CGSL 4RMRA 4WI0A 2YPLD 3HB3D 3U6XA 5DT1L 1JZGA 1HU8A 1I7ZB 4PJ5B 1ZV9A 2OM5A 4TSBH 1JPEA 2CBQA 2BSCA 4UIKH 5FWRA 1ET7A 2Y6TE 1V10A 2QTEA 5F6IB 1IM3B 1PF3A 4R0LC 2XQBH 3TCXA 4R9HA 4IQHA 2IPKB 4IRJB 1MHEB 4XN5A 4H20H 1JUFA 2IF7A 4AMKH 4XPHH 3U0WH 3O4OC 2FL5B 4HOZA 3MOQA 1PEWA 2CO1A 2ZCKH 5CCKL 2BHUA 1XWVA 4Y16D 3K2KA 3QNYB 1T4KB 2R4SH 2OX5B 4NNYB 2ESVA 1GS7A 5BRZB 5I5IA 2VMEA 4YVUA 1DZ0A 2EC9T 3FB6B 4Z7NB 1C8PA 2W80C 1NMCC 3P1VA 4FEMA 2DICA 4W9EC 3SD2A 1N5YH 2GJPA 2E9GA 5EOCL 4G8EB 4L4VE 4L4JA 3QS2A 4U6HB 2DQJH 4FLHA 1DJXA 4LSRL 4N2IA 4DVRL 2BHYA 1SOXA 2QMJA 3CN3A 5KSBA 3CSYB 4KXDA 5TQ2H 3CN4A 3KXFB 1EZVX 3RU8L 1RZJH 1WBXA 3BUIA 2MKWA 3M1CA 5T5FA 4UOZA 5A6LA 4KQ0A 4FG0A 2QKIC 1FVCA 4NCC2 1NFIB 4KY1H 5A6MA 1RAMA 2EC9U 4TOYH 1ACYL 3PHSA 4LCYA 4PG2C 1NUGA 3ESMA 4K8RL 1PZ5A 3OQ3B 3ULUH 2AC0A 4B95C 8PAZA 2EIZA 1OGAE 2FJSA 4JRFA 4TNEA 5CIPB 3G5ZB 1KCRL 4UQ2A 1P7HL 4Y1AD 1H5BC 1JXDA 5FDWB 3ZIMA 1OZTG 4LDLB 4L5FH 2VN4A 3TO4B 4AI7A 3V0EA 4NRYB 4WW1B 4OH2A 3FUDA 2OSLB 5AB9A 5DHVA 1FZMA 1I1AB 3QRFM 4X6DF 3GT6A 3MRDB 4NN7B 4PJ7B 2WLJA 1SHWA 4GXUN 4YGVA 5J11C 3QDJA 2KLRA 2X4TA 3MTRA 4MJIB 3NJJA 4OCNC 5DJCB 4BDVB 2VLKD 1CICA 4BA8A 4GPVA 3STBA 2CIIB 2CO4A 3QJQB 2EDOA 3QQDA 4JG0H 4MJ6B 4JX0A 1MKFA 5C0DB 3BWSA 3MSPA 5C08B 4F58H 1F4AA 3QPKA 1J88A 4Y8AA 3UBGA 4R7NB 1BLNA 1Z2KA 4IOSD 3WNLA 2R27A 4HC1H 3NZ8A 4MNGB 1JWSB 4NC0B 5ERWA 3TJEH 3UEQA 2AEPH 3ILPB 4LAQH 4G9DB 3NPSC 5JQIB 2ZICA 4DH2A 3UTSA 3APCA 2VXSH 1JGIA 4HCRH 3O9WA 5D7JC 3VE0B 3GBLA 4ALAL 1T6BX 2DMHA 5J57B 1L4IA 2XBTA 5CLZA 3UTTA 2F8XC 4DF9A 4WQOA 1T89C 2BVQA 4PJEE 4WFHE 1Y1UA 2AMGA 5KYYA 2IDSA 1OALA 4Y9BA 1S5HA 2BOCA 3PYCA 1TO5A 4W1TA 2J8UF 4NO0B 2QADC 3BE1L 5I1IH 3OZKA 4PW4A 2AV1A 2EXWD 4UDTA 1GC1H 2R8SL 2X1XR 3E6FB 2Q76A 4HZ1A 4XMPH 1FYHB 5EBMA 1G0XA 3K6OA 4JE0A 3LRGA 2PPAA 3VX0A 1EANA 3PIQA 4YIQA 2W38A 1P4LA 4DW2L 6TAAA 1BXXA 1NDGB 1SJHA 1T22B 2VNCA 2CQVA 2ZOUA 2CDGB 3NZUA 4RGNC 2CGRH 5G4NA 1BAFL 2XFGB 2P1YA 5C9JA 3H7BA 5IW1B 3VGFA 5CZVH 2WLLB 5T1LA 3WO4B 4WW2A 1E7UA 1BHGA 3ROLA 4DKFH 1MFVA 3REVB 2CK2A 3PP3K 5ICZB 2NQDA 4LEOA 4LP4A 4OZHA 3VFMA 1BOYA 4NQCD 1YY8A 2XUWA 5KVDE 4MQ7B 1BG1A 4AEHH 1P5UC 3HRPA 1WFIA 4G7RB 1U8MB 4ANVA 4IRSC 4U6XB 5C6PB 3OQRA 4WEBL 4F7CB 1DUYB 1UADC 2B7DT 2IOMA 4FG6D 4NXKA 1YJDH 3S3PA 2UUDK 2FSEA 5FUCE 4KROB 4R84A 3MGAA 1TU2B 3MRPA 1XF4A 1YDPA 4LOVA 5FYJU 1MFCH 3UFIA 3LIZA 2W60A 1R5VA 3L7FA 2W9EH 3IGLA 2P42B 4G7YL 4RNRB 1VRSA 5ENWA 5HJGA 4OIAA 4P4KD 4RBPH 5EUKB 4ODSH 4EIGB 1WD8A 2XWBA 4JR9H 2RTTA 4D0BB 3F12A 3CDZA 3FTSA 4UV4L 3RWCB 2PWHA 3QFJE 3DTUB 1FLTX 3JSSA 1DEEA 4GLRI 4AM0B 3TF4A 1P5UB 4AJ0A 4KVCH 3FS9A 5CHNB 5JHBA 3V0DA 3P9LB 3BDYL 4P07A 2IAMB 3HBZA 4ES8A 1R19A 4R4ND 4PJ5E 1OW0C 3PP4L 1VFAA 1PGRB 4CADB 4U3HA 4A6YH 4Z23A 2V8LA 1WZ1L 1O9WA 2R2EA 2BSTA 3BP5B 5IBTH 1C12B 4K7PL 5DHVH 1HZLA 4PW3A 1EFQA 3FTYA 4R90H 1TTCA 4NRXA 1PDKA 4R4NC 4B9KC 5ALBH 1JZ5A 4NUPA 3MGTA 3O3AA 4PJCE 1QFWM 2OJEA 1EDHA 3V4PB 2DYSB 3RTLA 5EOCJ 5IFHL 5IWLC 2JI1A 2AI0H 3G3LA 4L4VA 2BNQB 2NYZA 4GRMB 4OAWB 1U8KB 3H9SB 5FFGA 4FA6A 2GABA 5JPMB 2X38A 4U3SA 1ADQL 2QLVB 1RJYA 4IGBD 2H26A 1UZ8B 1CGTA 3QIUD 5DVOA 1U9KA 2OMXB 1LEGA 4GAGH 2YPVL 5DJDB 5FO9A 2IWFA 4XPHL 1ET5A 1YYCA 2G2NA 1D2PA 3U0WL 3UJTL 4I88A 4FFVC 1NMCB 4DTGH 5AB1A 5I76A 2DM3A 4OQTL 3WHXB 4OU3A 4YDVA 5KVFL 1AD9B 5IMKB 3TIDB 5GGRB 1E27B 1AXIB 1X9QA 2ZXEB 3LXAA 4G43B 2ARWA 4MBOA 4N5UA 5K1JA 2CSPA 5B8CA 1EGJL 4PJIF 1YMMA 3CFTA 4X7EC 3RUGA 3G9VA 4KV5F 4ZUTB 3CFBB 3HHSA 2A1WL 5T1DL 1Z6JT 1HN1A 3O2WL 1D2OA 2P8MA 3GEWB 1RI8A 4P3DA 3FQ1A 3ILDA 1JI2A 4GBXC 3QEQE 5CJOH 3B9KD 3RVUD 2HG5A 2C4FT 2MNUA 4HFUL 4WI5A 4D0CA 3MR9A 5C0CD 1ZIBA 2CMRL 1WZAA 3GB7A 4AG4L 4LSUH 4C83A 1AGDB 4WV1A 2YGNA 4YPJA 1XGRB 4GIOA 3OKOB 2XWJA 3HI6H 2A9CA 3FO0L 4JG1H 4NHCL 4YPGA 3L4CA 1Y6MR 4LSUL 2ZWLT 3MJ8B 4JO4L 1YYLL 3C75A 4BM7A 5ANMB 4LE8A 3J07A 5IEKB 5GQBA 2XN9D 3TLRA 5E5MB 3QJVB 2Q9OA 3JYBA 2YQGA 3RUGE 1NGZB 4XN8A 1QFOA 2Y1ZA 4E36A 2OJZL 4B9GA 2AFNA 4HLZH 1A3QA 5EWIL 1ZSDB 4G11A 1SXCA 4PRPE 1JWUA 4G8FB 2BVTA 5FWQA 5GJTL 3ZTCC 1TENA 5AVWB 3IJEA 5BMFL 3MLXL 4DVBB 1UD2A 4H25B 2NXZC 4WFHD 5C7ZA 3QCUH 5J13C 4M56A 4PJHE 2M1KA 2XC8A 1G6RA 1NC4B 3EFDL 4YLBA 1JPGA 3HN8A 3VB8A 3N85L 1PSKH 3V8OA 5DCCA 2VW4A 3GGWA 5DQJA 3RNQB 5HYJB 3T2LA 4BE5A 3T71A 3B6SA 2ICES 3VA2C 1QTSA 1KIQA 5DJYB 1XGTA 1G1CA 1HOEA 4MNQE 1BIIA 3FU7A 4IKLA 4YSEA 1S5IL 2EDMA 1QW9A 2J56A 1UHVA 3OJMB 5B7EA 3SB3A 1QBLL 1S7VB 2NDGA 4ZMNA 5I8OH 4I3RL 3WXWL 4TQEL 1A7QL 4R7NA 5KSUB 2X1PA 2X4RA 2WP3O 3LZNA 1A02N 4KFMA 5IB2B 4PJAF 4AYBA 1QKZH 2YWYA 3BIKB 5K9JH 2AK4A 4HD5A 1RZKC 1H3WM 4WJKB 5DD3H 3P2BA 2G9HB 4YSRA 1A4JB 3HG1B 3L5JA 4TUKH 5DHMC 2MTAA 1YLBB 2NY4B 3BP4A 3QC6X 4PJFA 4X6CA 3IDXH 3ECQA 3CV5A 2B5IB 4EVNB 1J8SA 4LSVH 4AE0A 3WKPA 3AS1A 3R7RA 3NCFB 4AIZB 4OZIB 3D48R 4LNRB 2VDNB 4NO5B 3AREA 1P4IH 2X28A 1ES0A 1AY1H 1QYGH 4LKCA 1R5WB 1KTDA 2HKHL 4XP1L 1IBGH 1UUSA 2K9UA 4AH2B 3EO9L 1W16A 4FN0A 4POYA 1GXEA 5J1AB 1SBBA 4IEFB 1ZDSA 3BAXA 2QZQA 1H8SA 1QW8A 2FX9L 1FWXA 2WCPA 4IDJL 3D3VB 1NLBH 1U3HA 5KSAC 3A6BH 5JW4M 5FO7A 5IMLB 3LNEA 1C5CH 3EZJB 3MNMA 3TFKC 4CU7A 1OIOA 5L9DL 2WXRA 2AS5M 2JLPA 2CALA 5BXFA 3SE3C 2PPDA 4RQQB 4ZT1A 5HHOB 4HFWA 3RX9A 1N4XH 4RDQF 3WTXA 4NO0D 1HIML 1TKWA 3S37X 4DWHA 3LEXB 3WXWH 2FWLB 1HHKA 1KEMH 2JELH 2CUMA 3BKCH 3BVNA 1EBPA 1NEPA 1EEYA 3NA9H 4FXKA 4N26A 4P5MA 3VXPA 1I7ZA 1U33A 5KYUA 3CH1A 4KKCD 4JQXC 4DCQB 2I5YH 3IMBA 2IXQA 1L7IL 5L4IA 2ZOKA 4L4TD 2YN3A 2Z1PA 4RVBA 1M1XB 1UCBH 3QUXA 4GW1A 4RNRA 3BZEA 5CU9A 1DQQA 4CBPA 3QORA 2R7EA 4IU3A 5EUKA 2YKLH 3DWTA 4P5TC 4DPBX 2J5LB 4AGMA 2P5WB 3B3IB 5DZPA 3ARGA 3S35X 1BECA 2XWRA 3L3IA 4NP9A 5E95B 5L8JB 2XLLA 2JV6A 1U4FA 1ND0A 4ZQTA 2E86A 3U4BH 1R5IB 2FEEL 2A2QT 5TH2B 3C8KB 4XNUL 2XN9E 3RL1A 4NZFA 3U82B 3MBXL 2HG0A 3L3OC 2ZUYA 3NTCL 4PJHA 5D7LB 1IKFL 4ACTA 1CB4A 2KLTA 2D0HA 4N9OB 2PLTA 1GYUA 2BHZA 1FN4A 4WO4D 3SE4A 1LO0L 3V6ZB 3MO1A 4ABQA 4U1NB 1LEIB 1S9WA 4KKCC 4PHZA 3FTXA 4ZOBA 1X5YA 4DGIH 3REWB 3V4PA 4A1JA 1A8ZA 5A2JH 3N41F 2C1PA 3O6MH 3D50A 5KUKA 5FIEA 5KVGE 4UINH 3ZDYB 2QQNH 4GKLA 3RQ3A 4GXVL 4I0PC 3B2UD 5I5JA 2XETA 5CGMA 2OR9H 1KB5L 1CD1A 1AO7D 2B77A 1F6FB 2IGFH 2WNWA 3LVEA 3V6FB 4U7SA 1LEGB 3ZU8A 2DLIA 4PWIA 4HF5L 2XTJB 3IDMA 4R26L 1F6AB 3DGDA 2X87A 4ELMB 4L3CB 3CXFA 3TOPA 1E8ZA 2X53A 1UJ3A 4HIPA 4KK8C 2I32A 5BZZA 4L5FL 1FGNL 2ZYRA 4G43A 1O5DT 3UADA 2YEZA 3GTTA 3D5OF 1HXKA 1RJZA 4PRHA 4AYGA 2FECI 5E2WH 3E8UH 4K8RH 1HX0A 4PV8A 4F20A 4C59B 2VXQH 3W9DA 5F21B 2HA1A 5DRNB 4DEPB 4NWTL 3GMLA 3DSFL 2NOYA 1JWSA 3Q2NA 3LKNA 1R1CA 3FQXA 2BY3A 5EZLA 3KYKH 4IGBB 5DEGA 3UTSB 4M3HA 2V9TA 3WKYA 2Z31B 1UA3A 3MNVB 2QT6A 2EEXA 5F88A 1K2DA 2Z91A 4FC3E 4POZC 5LXGH 2YA1A 2IH9A 2GUOA 3VW3L 4TL5A 1QRNA 3W5MA 3NIFB 5GRUH 4CGUB 4YUEH 5ELIA 2GB2A 4RZCA 5BUGA 2FGWH 3RWDB 3ARWA 3MKGA 4TVPH 4WTZG 4PJCA 5D71L 4OI9A 1PEZA 4C4KO 2MCPH 2DBJA 2D9CA 1PZ3A 1Q94B 2WINB 3NABL 4HHAA 3FUEA 2DL2A 3BFOA 5C09D 1KXVA 3PWUB 2FEDD 3RP1A 1R3HB 3E6FA 4QWWC 3G04B 1A0QL 2ARJQ 2CDFA 5IVXB 5EO1A 3QQ4B 3I9GH 4F5CE 3QG7L 1L9SA 1RP9A 1YNKL 3EW3B 3E3QE 4ZAKC 1YMHB 1BZ7A 3GM0A 2APWA 3N44B 4Y5YB 4AZ8B 4NNXB 3O6FD 3FB8A 5D2LF 3KDMB 3DRQB 2XVKA 4KO5A 3FO2A 4NNPH 1KDIA 3QUMH 3IMVA 5HI4D 4JLRB 3IBEA 4LSSH 5IHBA 2E9BA 3HE6C 3O41B 2BNRE 4GAYB 4O2EA 1MJ7L 5TGBA 3FTUA 2Y22A 3GXUB 2X4SA 1Q90A 2W9DL 3PXJA 1GZHC 4C56B 1X9LA 3DIDA 1OCWL 4F7MA 4XNAA 3EUUA 5EFIB 3DECA 1LO3L 2OCJA 2XIDA 3DHJA 4HJ1A 4HSQA 1HL8A 4HWBL 4KZDL 3QH3B 4Q9BA 1NC4D 2ZKHL 3OAYH 3QCTL 2MPAH 2BWQA 2BP5M 4P5TB 3W81A 1IEAB 4P2RE 1AQHA 3QQ3A 1MEXH 2OCFD 3FQNB 5AAPA 4AMKL 3EHBD 2BC4A 3WIFA 1EEZB 1DJWA 1JHTB 1PD6A 1A65A 4OZIA 3AROA 4UILL 2V5TA 1C5CL 5HDBB 4G1EB 4K8RD 3F58H 2NCEA 1S9YB 3DARA 3TEWA 2CA3A 2XICA 1JUFB 2CXGA 2L7UA 3BKJL 2X42A 1Z9SB 3OMZA 5I30H 4Y7OC 5IB4A 1UOWA 5ALCH 2I9LB 5I19H 3U9PH 4JRXE 1LL1A 2DTMH 1NCAL 3QYCA 3FFDA 2P8LB 1QI3A 5D7IA 4M8RA 1OCOB 3DNKA 2XIIA 3LNDA 2V2XA 1SJXA 5DUPL 2RBLA 2E8ZA 1KJVA 3TO4D 1FH2A 2G2RB 4KMTH 3FOMA 3U9UB 4LSQH 1JRHH 3PHQB 1U3HB 1JGLH 3KPPB 4IRZA 2HVBA 4FZ8H 5EZOH 5G4OA 2FX8L 4ZS6D 4GRWE 1L5GA 1NGQH 5DQ9B 4JANA 3KPOB 4NKOB 1OTSD 3VD7A 1BZ8A 2GCYB 3UCQA 2EDLA 2WQRA 4GRMA 2B4CH 4HG4J 1P7QB 3PABB 4XNXL 4XOCA 3MUZ1 4FXKB 5JPMA 4L0YA 1DQTA 4UNTA 4NQDD 3FOLA 1SEQL 2DW5A 3PGCA 3MLRL 2EE6A 5GS0C 4KJYA 3IFOB 4G3YL 1T0NB 3QJFA 2AJYL 1Q9KA 3U79A 2HRHA 3CHOA 5IJBC 1WFUA 5I26A 4DOHB 1RZ8B 2ZKHH 1U3ZA 4F7TB 2Y07H 4YWGL 1HVXA 2RR3A 3RVTD 1ZHNA 3OXRB 2R23B 4PS3A 3LH8A 4GG6B 4KXCA 1OAYL 3LZQA 5EIIB 3MNWB 3EXLA 1BGXL 2XA8L 3GLEA 3RWHA 3RWFA 2H8PB 4Y2DB 3IDNB 5FGCE 3K71B 2ZG3A 3O4OB 1LE5A 3FH5A 4PJFF 1RJLB 2AEWA 4G9FB 3S9DB 4JJ5A 2DLFH 1O7SA 2L0DA 2NY5L 4JFYB 3ZZ1A 4AVJA 1YEEL 4K3JH 5K5YA 4D0CB 3CZKA 4LARH 1LP9A 4ATTA 4P5RA 2IMMA 1V7MH 2G75A 2FQDA 4F8NA 3IDJA 4L37B 4JZNA 4YPGB 2YOCA 1BAWA 4OCXH 2WQSA 4LHUB 3SQBB 1AVAA 3ISYA 1K8DB 3AS2A 4O2CA 3EDKA 4YNYB 4O58H 3IS0X 1E9PA 2QSQA 3ZYOA 3FU9A 3KPMB 1N6VA 4JG1L 4NHCH 1CT8B 1DVSA 4HUVB 5GGVY 3GMNB 3PAYA 1CVSC 1NIFA 1T0OA 3CH8A 1S46A 1GIGL 2VMJA 4Q8BA 1JWUB 4G8FA 3WE6A 3ZHLA 2WXPA 3EO1B 35C8L 3HE7B 4M03A 1SM3H 1OCWH 4A04A 3F00A 1NCBL 3CDGA 2WXMA 2YA0A 1UQSB 5ADPL 4F15C 1F6AA 4XMWA 1IJNA 4V1DB 2APVA 4XRCA 1G6RL 2N7BA 3LXCA 4U6VH 1IL1A 3MLTB 1T5WB 3ZTDC 2DEYX 3FQ2A 3B6SB 1U95A 2ZJSH 1KTLB 1NOLA 1E0OB 1DUZA 5A7EA 4R8WL 1X3DA 5IESL 4PJXB 3AWFA 1A3ZA 4NS0A 3K6DA 1TQWA 1WO2A 1YY9C 1BBJA 2CCLA 2FH8A 2WTPA 1HL9A 3LPPA 3E6HB 3NEEA 1E6OL 1T1WB 5GGQH 1GY2A 2WWKT 4PTUA 1CDCA 2BVPA 1KLFB 2FO4A 5FYLL 4TNWK 3BWZA 3IM1A 4JFOB 4HUMB 5H35A 3GMMB 2QTVA 3LX9A 5KUMA 1N2RA 2PETA 4HJGA 2CO7A 3FW6A 4U4IA 4J3OG 4G8IB 1CVRA 1G1KA 2VRKA 3NJVA 1MAKA 4UT9L 3U7WL 1PSKL 4NFBA 1ZK9A 1JTOA 1F3DJ 3I75B 1IAII 4X5XB 5HYJE 2ZXBA 3VACA 5K9OB 5I66B 3DURA 5BZWA 4PJBB 5CSGA 3GSNH 4HWEL 4KXAA 3MRPB 3RVWC 3S5LA 1P53A 4Z7QF 3STLB 1YPZF 3GK8L 5GGVL 1QAWA 2XTJC 4A2DA 4D94A 2DI9A 2TSBA 5F7EL 5T1DH 1LILA 2F5BH 4H8HA 2Y5QA 3OB0H 1ES0B 3NIDF 2NY1B 4ZW7A 3RVTC 1H6UA 4JNXA 4KVNH 4YHOH 4OZGF 1U58A 4GRLA 2VXQA 3JWDL 4NQVB 4XP5L 2VDOL 3EGSB 4AL8H 2D9QB 2APBA 1E4XL 1DEEB 4AM0A 2EEDA 4AYFB 2FO8A 4M93C 4AMWA 1W0WA 2J6EA 4HX1A 5D1ZB 4JGJA 2BIMA 2F8OA 2X88A 3MACL 4XO8A 1K4DA 3G9AB 5T3XE 4JFHD 1WGOA 3FRPB 3H3PL 3KDPB 1ZPLA 5DRWA 1KCSH 1KLGA 4WWKA 2ROXA 3T6XA 2VDLH 4MA7H 3S6CA 5AVXB 4NUJB 1Z1WA 4F33B 4Q9CA 3QORD 3C6SB 4MCZB 2A6JA 5EUOB 1ZHBA 3TPUB 3R7QA 1DP0A 4WUUD 4BZ1A 3DO7A 1H3TA 3UCRA 3U6XS 4L8BA 4R8WH 4IDJH 5HHOA 2DQHH 2EYRA 5BMFH 1PW3A 3QIBC 2PUQT 3GSVB 4Y16B 4YHLL 4JRXB 1I3UA 2F18A 4YE0A 3MRMB 4XVJH 1AKJD 3PPSA 4PI0A 3RPKA 2GTZA 3HZMB 2F0CA 4N8VA 1Z5HA 2GT9B 1NBVH 2YJLA 3B37A 4MNQB 4LVEA 1FRGL 1M1XA 4ALAH 4N22A 4D8PA 1ZA6A 3PUCA 3INUH 4QAMB 1S9YA 1B2WL 5KS9A 3QSKB 2APSA 3BSZA 3UZQA 3MV8B 2PMZA 2EJ1A 3WKQA 4J8RA 1TQTA 2GAZB 2JKLA 4LSTH 2F7PA 2EXWC 5CO1A 3VO0A 1OY3B 3HHSB 3VXME 2KZWA 2J2ZA 2XPYA 4KITB 3PDGA 4PRPB 1WTGT 1WG3A 3DIVA 2V2XB 2DYRB 1G43A 1OE2A 3LPWA 4YSTA 3PWPD 4PY8I 1LQBC 1EVUA 4DUVA 2BNRB 5AFAA 1JIBA 5D7LA 3FFCE 4FCHA 1SVBA 3LH9A 1LHZA 2BP8B 4PJGA 5E9DE 1PVHA 1Z9MA 3KLLA 4HCIA 4BCZA 4QHUA 4X9IA 3GSNA 4BQCA 5GS0D 3ATFA 1C9SA 5MEOA 3EOAB 5I1GL 2HMIC 2VDLL 1TEGA 2Y3NA 5DA0B 1KPVA 3KPOA 3SDCD 1OARH 1QYGL 4ZODA 3GFUA 1JK9B 2ZAIA 2CPUA 5AVZB 5HI4C 4BH7B 3FQ4A 4BE6A 4GNKB 2CR6A 2ICWJ 2JSFA 5ACMA 3QG6B 1JBJA 2CIKA 4BKLB 5C0AE 4BHUA 1E65A 4TUOB 3LEVH 4XBPB 4PJ9D 1J1OH 3MU3A 4BA0A 1G7MA 4L3EE 4R3SB 1TF4A 3LV3B 2K45A 4RRPA 3PJLA 1HQ4A 5C0AB 5D7LE 4R4BA 4IIQA 5AVSB 5F0MB 5TPWH 3L5HA 5F7HA 1RZ8A 4YHYC 3GO1H 3SDDD 1CLVA 3BZ4A 1JF6A 2BZ7A 3R1GH 4KJPD 4X4XA 1ZATA 4YL4A 5E56A 5DR5H 5ESQB 2G5UA 3DVIA 1NAKL 2AXGA 1N6QH 5DA4A 2P52A 4LLDB 1JGUL 3AGVA 2FK9A 3I6GB 5B1BB 3VWJA 4ODXA 3N1QC 1U2CA 3MRJB 1DTUA 2F5AL 4KUZL 4OZGA 3L4VA 3BRDA 1XHHA 3HIZA 1M7UA 4OFIA 4W68A 5CBEA 2V3EA 4N85A 1Z3GH 1IGCH 1YECL 1SVCP 1V05A 2O93L 1J10A 3A6CL 3S88L 5F7UA 4F37K 5CJOL 1FYTB 4MGXA 4UQDA 3NSJA 1I8UA 5AW2B 3STZA 5SV3A 5C0ND 4HPYL 1UM5L 2XQYG 5FOBA 3O6FA 4U1GC 3W9EA 2YXVA 2QPSA 2ZCLL 3ESVF 2A38A 4MB5A 2YA2A 3H9SE 4OF8A 3U6RB 4PBXA 2AJZA 4U1MB 2DB8A 2XCMC 2OFQA 4DP6X 1HHIB 3RWDA 4AYMC 1E9PB 4FNTA 4XC1H 4X8XA 5JXEC 3UTTE 3KVDD 1MWAA 5DFAA 5B22A 4DQAA 4APQA 1KJ2H 1JF5A 5FUZL 1IUZA 1MNUH 4XVTL 2AABH 4WU7A 4QTHA 3HR5A 1XMWA 3VFUA 1ERNA 2FLMA 2EIJB 1YN7A 2Y4SA 3H56A 3L45A 4GSRA 1OLZA 3BAJA 3QEQD 2WMPA 4P9HC 4Y2NA 2BOBA 2YAEA 2VZSA 3GHBH 3Q5TA 4IEFA 3RY5A 2VZ3A 3MC0A 1TJIL 3N6YA 4MCMA 2AJUL 2VLRD 3QYNA 1QBAA 1WRFA 1TPXC 3ZDYE 2Q10A 4XP9H 3EBAA 2OTWA 5SWZE 4AYSA 4X98B 5FX3A 3JT0A 4I3SH 5E70A 3CZUB 2V37A 3PXHA 2DH2A 5I74B 4UTBL 3SN6N 2ENJA 2HXAA 4DKTA 3U30C 4UTCA 2XG4B 3K5SA 4YZFF 3MX0B 1U8OA 2VDRL 2B3RA 2VERN 3OKEB 3VXMA 1G87A 5I1AB 1RZKL 3WN5C 1NGQL 1DLHB 3JWOC 3KYOA 1CCZA 1I8IA 4P23A 4RISH 3CC5B 1UENA 4JCWA 1NFDA 4L8SB 5FO8B 2R0WH 4PJ8D 2LU3A 5F1NB 4ESKA 3C08H 4KKPA 1CR9H 5JHDB 2BVQB 2X3AA 4WDIA 1NQBA 3QZWB 1O9VA 1AZCA 1SDYA 1PNCA 4E41E 4U1LA 4ZPVB 2RHEA 2ZXAA 3H54A 4H8VA 2WKGA 1KPUB 2JI3A 3U0PB 4Z76B 2X2UA 4ZZKA 2Y2WA 3KR3L 1BVNP 4UIMA 1JNHA 3HOGA 5C6WH 1ONQA 1MG2C 4FXGB 4P4KB 3OKDA 4P5KB 3OAZH 4LCIL 4LQFH 3TV8A 3FPXA 1DBBH 3HW7A 4QHKJ 3EGSA 4HPOL 3DDGA 1ED3B 4WEMB 3RDTA 1SZNA 1DSYA 4FJYA 4UNIA 4I18C 2LTQB 5F44A 3SDAC 4JG0L 3VTMA 4M5YH 4W9CC 5C1MB 2A0LD 3TV3L 3ES6A 2RIKA 3IWVA 1D9KC 3QFJD 1FNEA 5DVNA 4PJHB 4P2QA 3TBVB 4LEXL 2AQRA 5J13B 3LNIA 4KH9A 3D52A 2YMXH 3LD8C 4JPQA 3ZLQC 3N1GC 1YAIA 5DYOB 1CC3A 1P4BH 2CBPA 5FYLE 1LO2L 3PWPE 2XQYA 4X7TB 1E6JH 2Z7UA 3W11C 4ZUUA 5BZDA 4GG8A 4QI3A 4B9IA 2YXWA 1FDLH 4KUZH 2PR9A 4E9SA 4H5SA 2N1KA 3W38A 4NP4H 2JCCA 3R8BB 2Z6FA 3E2HC 2H3NB 3PGFH 4KJYB 1GSKA 3HZMA 1T0NA 3T3MF 1UEMA 2R9HC 1AIFA 3TA4D 2VO5A 4B0MM 4R0LA 2H6OA 4U2ZA 3C6LC 1HHGB 1UWXK 3NYKA 1KT2B 4U3XA 1UM5H 2NNAA 3ZZQA 4P06A 2PXYC 2WZPA 1B0WA 2WZ0A 4NFCA 4PR5A 5JLZB 3QYMA 1KTJA 1RULL 1X9RA 3MNWA 5A2LH 3VI4A 3KPRB 3QRGL 4Z78B 2A9NL 1FNGA 4WJG3 1H8NA 3T1FA 4BHUI 1JZEA 2GKIA 4G7VL 1MCPL 1KIRA 2AQ1A 1RJZB 2PR4H 4PRHB 3VGGA 3NRQA 1BZDA 1GOHA 4L23A 2D03L 1ZXKA 2DJMA 3IGKA 2ZCKL 3KPTA 2C9QA 3DOSB 3KBEA 5HHQA 4MHHG 1R3KB 2FHBA 4MBRA 2JH2A 5GRUL 4P57B 4ENZA 1UKTA 4WNSA 3V0HA 4NRXB 3DKHA 1D6EA 3X12A 1IM9D 4A7TA 2X89D 2E4TA 3BWUF 3V4UL 3NFNA 1VJSA 4FTVA 5E1AA 3VXRA 5IEHB 1QSVA 5D5ME 1IZJA 3T8XA 2CK0L 1M7IB 2HT2C 3U36A 4LO9A 4GEJA 4JJOA 4Z7UB 3S2AA 5FFLA 1NFKA 1E5BA 5E6IB 3IGFA 2H32H 2ZUSA 3UC2A 1G7MB 4BWTA 1A6VH 1TVHB 4OD3H 4OLXL 4BFKA 4LMQI 5GS2D 3APNA 1S7QB 2JXMB 5FO9B 1OXYA 4FG4A 5KSAD 4BWWA 2NR6A 4HIXL 4NX0A 4ZD3H 1EHAA 3CZEA 4FKKA 2PCPA 4NT6A 1O5PA 2JKSA 4Q14A 3U30B 3NJLA 4YDVB 1XR8A 1RLWA 4CVWA 4UZGA 4YSSA 4HF5H 2IAND 2VDOH 3MODH 1OL0A 5M95B 3VD1A 4G7SB 1IGJA 3IAPA 5KYNA 1NANH 3EGDA 3VSUA 1AQDA 4WHTB 4XPFL 5C8JA 4NQXA 1ZAGA 3LKSB 1OB1B 4LIQH 1JGEA 3CFBA 3S36H 2VLME 5K59E 5ICXA 1MY5A 3DYMA 4FGMA 3V4VH 4N9GA 3NG5A 2HT4D 2ARJB 2FQFA 3EYOB 4IOFD 4OGXL 1OEZW 5HPMB 5KZCD 4G8GD 1N2RB 4OJYA 1DZBA 3NP4A 3KPSD 5EFIA 3EJZC 5E94B 5GS0H 1QEWA 5DK0A 1OM3H 4FERA 4E9QA 5E08L 3LSOA 1KBBA 4HS8L 3RPBA 3ZDZB 2JNZA 1KN4L 1MOEA 1VLXA 3JWNG 3TO2A 5J3HC 4B9YA 4DGYH 1D9KB 4HUCA 2CDEA 2QBWA 1AOHA 1ADQH 1CDYA 5BS0E 3PDOB 5T1LD 4AQ1B 1TCMA 1LM8V 3HJEA 3SPJA 3WIFB 1U91B 4HIEB 1RIUH 2H32A 3GWJA 3LZOA 1MUJB 1NCAH 3OF6A 3WD5H 3CXHK 5IY5B 5ILTL 4TYUA 3WG7B 4GO9A 3L9RA 1ZE3H 1QR4A 5DGRA 1U58B 2FDBP 5L0QB 4QT5B 3R4DA 1MCNA 4FFVD 5F9WC 4UOQA 5DWPA 1JPGB 4K9EH 3AWGA 4NQDB 1FYTD 3WTVA 1TMCB 3FQUA 3L1OH 5ADOL 3OMAB 4XPBH 3MJ7B 2J55A 1BXAA 3DXAD 1BQKA 5CN1A 4WWKB 2O30A 2KI6A 4L8SC 1B0GA 1CXFA 4KZ0A 4JY4B 2UYLB 4LPXA 2VN5A 3BMWA 5J12C 4YO0B 1OWRM 1S7VA 2H1PL 3RVWD 4G6ML 4H13C 4EZJA 3KPNA 2GFBA 3CMGA 1G7JB 1KJ3L 4NKQB 5H94B 1GVIA 2UY7A 1NC2D 2V2TA 2F58H 4I48A 1NLDH 2A6KB 2NXYD 4QLWA 1SYSB 5B39B 5I1LB 5JIIA 3QRGH 4Y1SA 1F4YL 3ULUC 2XZQL 4U7KA 3MRCB 3O0RL 4O2FA 1YEDB 2PPFA 4LP8A 3A23A 1J8KA 4JKWA 3D69A 3TN0A 5IQ7L 4UOW0 4GSDH 4JFDD 1UXSB 1G9MC 1T04B 3DMMA 1GGIH 3HPJB 1RIHH 2F61A 1H8OA 3BN9D 1QWHA 1J8HD 2DIBA 4KDTA 5D7LD 3SDYH 3WTTA 2NRDA 1SOQA 3P2DA 5I2IB 3GD1C 2C4FU 4Z7NF 4NQTA 1TLMA 3M8OL 4OD2A 1ZA6B 5IMOB 2WQAA 3HTLX 4TXVB 3NVQA 4K23L 5CP7A 2YRZA 4G1MB 4Z3GA 5IW3A 3BH9A 3G5YA 2EQDA 4DPRA 2Z0BA 1F02I 3IYLW 3LN4A 1G94A 4GQRA 4QMEA 5DFVC 1IILE 1W2KT 1SY6A 3TA3C 4RWYL 2AXFA 1EVTC 1A64A 1WIUA 2NY2D 3JV4B 3ZE1F 1Q72H 4OZ4B 4XP6L 4ZMVA 5JNYB 4K07A 1U3NA 4Y5XB 4HCRL 4ZTPL 1KEML 2HX7A 2HZHA 5F7BA 3LIUA 4OD1H 2PXYA 5J1AA 1WVZA 3H0TB 3C2SA 5MHSE 4ZUSB 3AAZB 2WLKA 2Y36H 2YAPA 1JPSL 1KCVH 5GGTL 3BJ91 5J89A 3MROA 4G8EA 1QR1B 2K4WA 4QYOB 1P1ZB 4MVBD 3IDJB 4L37A 1BBDL 2VE6A 1QSFE 4G42A 1ZT1B 5MEOB 4KTEL 1KIUA 3ZGPA 4YE4H 5JDJA 2R1XB 3K1KC 3OXSB 3B5HA 35C8H 4J3VA 4E42A 2DOCA 2I7OA 3FULA 4FTDA 1SDDB 2DI8A 4O9HH 4OLVH 1TZIB 4X50A 4DCQA 4PGDA 3HZYB 4PMEA 2DM2A 5FYKL 2B1OA 4WW2F 1AY1L 1J11A 4WCYL 4M1GH 5CZXC 2F8VA 4YC2C 3PAUA 5K39B 4C4BA 4LNVA 1AXSB 4PY8J 5FA3A 4YHYB 2E27L 1CFNA 5FYKU 3QORB 5E8OB 4KKRA 3MLTA 4R83A 5FKAB 1S9XA 3SKMB 2XN9A 1QSEA 3OHXB 4W9ZA 4L9LA 4FAAB 4LEEA 3HMXA 4Q6YA 2P5WA 1OOWA 1NGXB 2IWKA 2X4QA 3BAYA 4M5YL 5BS0A 4MMXC 1ZEAL 4QRPD 3WUWA 4N4YB 1BJMA 3FSAA 3GLDA 4DPCX 3KE0A 4RA0C 4HWZA 1KFGA 1HDMB 1YAZA 2QZ5A 4W4OA 1ZVSB 1S7SB 4MXWH 4JGUA 4EN3B 5F9WB 1Z9OA 3IJSB 4JZJB 4PHXA 1MWAH 1WA2X 4HGMA 1Q1JH 3ZO0A 3GEFA 3KJ4B 3GTVA 3ZQDA 1AJ7H 4GP4B 5I8CB 3O6LL 3TCLB 1A6AA 3OHMB 4KRNA 2WKOA 1E67A 2FCBA 2W91A 4DERA 5FF6A 1ZANH 2WVVA 1N5AA 3GSRB 2J43A 2CMRH 4Q89A 1D7DA 3K2UL 1BQHG 5I24A 4UF7C 1CO1A 3QI9C 1OQOA 4ZFFA 1X5JA 4CU6A 3WNMA 4HQQL 3AG3B 4PS4L 5FKPB 3CZFB 2MOVA 4PCTA 5GIRA 2JJUA 3T2OA 5BRZD 4IRZL 3A0OA 4PGBA 1CGVA 1GCYA 2LU7A 3BUDA 4NYLA 3N1FC 2ZCHL 1ZVHA 2BNRD 1QUPA 4LAJH 1IAKB 4LT7A 5KBPA 2ISDA 2CAKA 1KGJA 3E8UL 3MXWL 4NDMB 5L4JA 3WCYA 1PYWA 2Z4QB 3TBTA 2F53B 3ARXA 4HC1A 4YX2H 1P6AB 3DUSB 2WTRA 4FNSA 2DLTA 3ULUE 3QK0A 5EEYA 3I6KA 1ZV2A 4WFGD 4NRZB 3ARED 5E5UB 2A9BA 5LCVL 1BEYL 1A7OH 4BRVA 3US1A 2XG4A 3REVA 1YEGL 4PD4K 4PCKA 1IBFA 3SDXB 3FSOA 3HC0A 5I1KH 5AZEH 2E6PA 4YUEL 1ECYA 5C7XL 2WW8A 4Y16A 5TDNA 5LDUA 3BAIA 1H5BB 2CHDA 4IU2B 5F88B 4ZXBB 1B0RB 4JN2B 5AW9B 1U8MA 4JFTA 3MREB 5KSAB 4MAYB 3PWPB 2BFGA 4J23A 1BQUA 4HJ0C 4HUUB 5B21A 3O3UN 4NO3A 4XWGL 4MNQA 2I9TA 1EXUB 1OCRB 4I3RH 1PD0A 1WAAE 4L1LA 1U8LA 2DLEA 5JXAL 3S34H 1J8HE 2X2IA 2J8OA 1N3NB 1IAOA 1JZ3A 3GDCA 5ESAB 1EJOL 5DD5H 1Z3GL 3PWUA 1D5BA 3KWWA 4X5LA 1QLRA 1GA2A 5IVXA 3HUJB 4RISL 4YSQA 1P5UA 5EH1A 4NC1C 3Q06A 1JZHA 5LGJB 4YBQC 4R7VA 1U8JA 2HFEA 4Y1AA 1Z9PA 1MZYA 3ARDA 1DO6A 4LIQE 1I8LA 4B27A 5LGHL 2AV7A 3L3OA 4U6VL 1U42A 1MRFH 3CFDA 5IBUG 2OJZH 1N7ML 4PJ8C 2H1XA 4XTRD 1G7JA 1O6VA 1HWGB 4WEEA 2UY7B 1VIWA 4P49A 1MJ8L 3T4AB 1XD0A 2VL5A 1X7SA 4WUUE 5FAAA 4XVOA 4RGNE 1JK9A 3O8XA 4XAKE 1E8WA 1BEYH 1C5BH 1GOGA 2B3IA 4IOSA 1A3LH 3DPDA 4X83A 2WZ6A 4DK5A 1WT5A 1P7QD 4TVPL 1TO4A 2FJUB 1FNHA 5KS9E 1TG8A 1Q9OA 4HKZB 4QHNA 3UX9B 4O51A 1WUZA 2H2SD 2E7LC 4F2EA 4AT6B 2ICWA 4ODSL 1W91A 5JUEH 1J5CA 3V6BR 1MWOA 1TJXA 3TURA 4G1EA 3M17B 4FNLH 1NCCL 4ZRGA 2ZOWA 3UTTD 2O61B 1U36A 3WFEH 3BH9B 3G5YB 3T3ME 4LRIA 5BVPH 3A24A 4PB9L 4ODTL 1AHWC 4OIIL 2AXFB 3JV4A 4QNPE 2VDKL 1JN6B 1R33A 4L3EB 4XI5C 4HJ0D 3UG4A 1F56A 4HQQH 4RA3A 1Q9WB 4K0OA 5D7IB 1UB6A 4BWUA 4I18B 4J4PA 3U7AA 3MA9L 5H37G 4Q9QL 1XH0A 3BCDA 2XBZA 3ASWA 2Y1AA 1TJGH 3BUBA 5JHDD 5HYQA 4FXLA 4NKIH 2B14A 4EDWL 2D31A 3VRLF 2VLRE 1ZTXH 5E6IC 1AQKH 1BD2B 2IANA 4Z5RA 3QZNA 2CGRL 2F53E 3NTCH 3DROB 4AJWA 4EUPH 3P3UA 1E4XI 4FQCH 5L2KE 5L6YL 3FH8A 3CDYA 4JW3A 3QJHA 4DGUA 1ITCA 3WJMB 7FABH 2BMKB 5F9AC 1Y0LA 5MEND 2FYYA 1KXVC 4BK5C 5TPWL 4RZKA 4I85A 1ZGLM 3O6ML 2FX9H 4FQ2L 4LARL 4KMQA 4WY7H 2P5EA 3D1MC 1CL7H 4P2RD 2E9IA 3HE7D 2H0EA 4AV0A 3C5XA 3O9WD 5JDSA 1K5WA 2OZ4A 1RUPH 1SQ2N 5DJXB 4TNWF 2C3XA 2Q2EB 1AS7A 1FSKB 2PCPB 5I1HL 1YUKB 1YUHB 1Q72L 1A25A 1RQ5A 2WYHA 3I6LE 3NJGA 5KANG 4QCIB 2XXCB 3EUDA 3OKNA 4GI9A 5F6HI 5A16A 4Y19E 5CINL 3RJDA 1AXTH 3VFRA 3GSOB 1S2EA 1TDQA 4GQPH 4NQXB 1EIBA 4UAOB 5DUPH 5BS0B 1RJLA 3SQRA 4AC2A 1AGBB 3WHE0 2JELL 1G6VK 1ACYH 2QVFB 2BSBA 3BKCL 1GZQB 1WAAF 3NA9L 4JFFD 2GBAA 4RX4A 1BV8A 3RGVA 4HHWA 4TSCH 4HDIA 3QBTB 3FK3A 3OAWA 2VW6A 1XXDC 1LP9B 3NRPA 1VGKA 3RU8H 4BFJA 5AW6B 1R75A 4KTEH 3JTBA 5M94B 1TPXB 4EI6A 2A74B 4HD9A 4NKDB 3L3KB 1MCRA 4XXCA 1E2ZA 3OKMA 5EEXA 3W2DH 3TXAA 2IBZY 1GL4B 1HCZA 1PZAA 4RH4A 5FYLD 5JHLH 5J6HB 3H3KA 3TX4A 3MRIA 3MUUA 4YGAB 4UT7L 4AVHA 3FFCB 2QGBA 1VF5C 2OBGA 2MPAL 3F7VA 2PO6A 4OGYH 3I9AA 5F7FA 4HIEA 3CU7A 3H2WA 1MSPA 4IBYA 2XYBA 4Y19B 3VM7A 2IVFC 4WWOA 3H55A 3GIVB 1JNHB 3FUMA 3TBBA 3ZRFC 2GSIB 4YHNA 2W81C 1DL7L 2IALA 4HU8A 3ZBMA 5HGHB 4OFQA 3GQFA 3MCKB 3G5WA 3MRHA 1RIVH 3NRFA 3LY6A 4ZFOB 3QFGA 3KLHD 4KRPD 3QAZB 3HI1A 5DQDL 2J5WA 4XRCB 2L4OA 4X99A 1MREH 4OY9A 5B4MC 3RWJA 5I19L 3R19A 1S8DB 4E5XG 3B1TA 4AGNA 3GZQA 3BQUB 4EIUA 5KVFH 1HJBC 2WP3T 4OLEA 2EACA 5HI3C 2GFBB 3LH2L 3SE9H 1FDLL 5H94A 2EDQA 1JGLL 1DVQA 4IBLT 1A6UH 1DJGA 1FSKC 3FUIA 4CGTA 1X5MA 3CGTA 2MKLC 3KHOA 2J1ZA 4R4FL 1ZT4A 1ZA3B 2ESVE 5F3BB 5T3XD 5DHEA 1YEDA 4AUUA 3TT3L 3S4SA 1NKRA 5EOQL 4DN4L 4TV3A 3VE0A 3BVNB 4QTFA 4NZTL 4EZLA 1MZZA 1DJHA 6PCYA 2NY3D 3L5XH 1W8EA 5C0CA 1DQJB 3CFKB 4ODHL 2NW2A 3QORC 5J5EA 3IETA 4KQ3L 1RUQL 3HPLB 4GP5B 2VLKB 4ORZC 4ZAKB 4KTGA 4Z3JA 1Z7JA 1VADA 2XWTA 1G7IA 4HK0A 4TN9A 3QR1A 2GJ6E 3S36L 3SPVA 2KDYA 4S2SB 3S3JA 2V7HA 5I8EB 1PLGL 1SYVA 2OYMA 1SOKA 3O3EA 2BH0A 3I9IA 4CC4A 4YHIB 3ULSB 3RIAK 5JIPA 1T0PB 1F1DA 5LNGA 4YHZL 1IEBA 2WANA 1VGEH 5D96B 4NQEB 2WVSA 1OAXL 2GEEA 3ZKMD 4L18A 1KBWA 4PLNC 5D1QD 1RP8A 2HTLC 1IC5H 4BKSC 5ID0B 1YNLL 2YPVH 4Y2OA 5AW5B 1INEL 5DRWB 4NBXB 4WI9A 1BF8A 4FABL 3AS0A 5EDXA 3DHMA 5BW7C 1DVZA 2LQRA 5EZIL 5CZXD 1TQCC 5I16B 2CO2A 2KS0A 2OR8A 4NUMA 3E0GA 3V0WL 2NX5D 1FVDA 3RWIB 4BFNA 3EH1A 3D87B 4HVBA 2EDRA 2Y7MA 4MHHI 5C0JB 5BVPL 2IGFL 3DIFA 3V6OC 4ELMF 1KBVA 3D39A 3MRBB 4LLAA 4PWFA 3IJ7A 4B3EA 2IV9A 3CPUA 1BBDH 1OP3K 1V7NL 3OC8A 4U6XA 3SGDI 2IO5A 4A7QA 4FI8A 5CJBA 1FFPA 2VDPB 2XZAL 3LPGA 3N40P 3P4LA 4MDIB 5F3FA 4N0UB 5IT2H 4ZUWB 4MX7B 4L4TE 1O6TA 3MUGB 2C4XA 5D4IA 5IWLA 3VGAB 1R17A 2JIXB 2W94A 4ELDA 1KZQA 5C0AD 1HXYB 3HI6L 2IPTL 4BQ6A 1W6LA 3KPRE 2NY0B 4FQQA 3S3SA 3OB0K 2WVUA 2EE3A 1EAQA 4JPIB 1IO4C 5EIQA 2JB5H 3SKMA 3QZBA 3SDDB 3OHXA 2R29L 3EYVB 5FYKH 3V7MA 1TVBB 2EKJA 2W88A 4JEGB 4I2XE 3VRIB 4BUQA 2ZSWB 5ANHA 3OVUB 3MA9H 4Q9QH 1DE4A 4DW2H 1WZKA 4WHTA 3QUYC 1P4IL 4N2MA 4AW7A 3NIFF 1AKPA 1M6UA 5HYFA 1AG6A 5DUBA 1AP2B 4J12A 2H6PA 3DA0A 3HRZC 3Q13A 3V5DA 3FT9A 1I1RA 3HG3A 5IESH 4X5PA 3B56A 4UIKL 3LKNB 2QR0A 2EYSA 1F58H 4J3UA 4YJZL 3K6FA 1HAUA 1QBBA 2XI9A 4BV1A 1VACA 3ULVE 1NL0H 3OMNB 4EN2A 1I9JL 3KYMA 5HVHB 1SXAA 4LGRB 1OOAA 2TRYA 3B2XA 4OGAD 3SDXE 3H4FA 2BSSA 1BGXH 2XA8H 3DROA 3KXFA 4XN2A 1R6VA 1WAPA 3DBSA 2CDEB 4IBTA 2N3JA 4N3TA 2WXKA 5B3JF 3WV0A 1DANU 1RZFL 2FLBT 3TTSA 5KEZA 5D2LB 4ZTPH 2IC2A 4PB0L 5IJCC 4YVNA 1J9RA 4AENA 4KZCA 1UJTA 1ACCA 4CVUA 4XO4A 2H26B 1HIMH 4LDCA 2EXSA 4I89A 4KDWA 4NYLB 2AJ3B 1F86A 1ZVNA 2FZ3A 5GSRB 5BNXD 5F7KC 2XN1A 4WK4B 5E51A 1J05A 3NAAL 2VMFA 4PRDB 5DF0A 4QOKD 8FABB 1YMHA 5GGRA 4OCSH 4U49A 4XMPL 3X1EA 4L8DA 4Y9CA 4CMMA 3MRRA 3FB8B 4UANA 1RK7A 1YNTF 3KDMA 2FLRT 2PPCA 1DQIA 2HJKA 4F9LA 1HL4A 4QRAA 3DSFH 2P5PA 4JY4A 3MRKA 4E41B 2YKKA 2DQFB 4TPRH 1PBYA 4H1LA 2NYYC 4ZOCA 1S7XB 2EUVA 1GZQA 1HKLL 3U2IA 3OLIA 3ZKQD 5DJ0A 3MNDA 4I5BB 3P4NB 1NAMB 5I1GH 1XO8A 2IDQA 4K5LA 1HQRA 4JL2A 1CN4A 1B90A 3MV7D 2K78A 1QFUL 4OZHE 3SOTA 4HJJH 3GBML 3O8XC 4U1KA 4OFYD 3ARDD 4L9LC 4YXHL 3SZKC 2BCKB 5J6HA 4GBXA 3RL2A 4XGZB 4H4NA 5DO2D 3OBAA 2P46B 2BC4B 1BWWA 2I9TB 5DC4B 1F00I 5LNDA 4M9PA 2ZP8A 4X4KA 3TO4C 4KK6D 1GAFH 2WXLA 2FWOA 2VQ1A 2X3CA 3BPNC 4G82A 3BXNA 1OF2A 2GIMA 1I85A 1SNRA 5KOMC 1N5YL 1DR9A 4XCFL 4UM9D 5JIHA 2XRAH 5ILTH 4YFEA 2Q76B 2K9FB 3O2DH 1KIPB 4TLUA 4ZI8A 2K70A 5D72H 5TDPA 2V0AA 3BEVA 2VDNH 1B6UA 3W39B 1FL6B 2UVFA 5G5DA 4FQ1H 5C0EA 2P28B 4EZMA 4MMXB 4X6DA 3FOMB 2Q8BL 1FL5A 1NDGA 3IEAA 2EDWA 3NSXA 3VXRE 1W72B 4XPBL 4JUSA 5FYKE 1KFAH 4M6NH 4KKLC 5KVDH 1OTUC 3MLWH 3NH7H 4HT1H 4QRPE 1VFUA 1NFDE 3OR6A 3DTXB 2XA3A 1CFVL 4Y1AE 4YDIH 4Z7QE 3HMWH 5D8JH 1JYWA 4FD0A 1GC1L 5D4JA 2R8SH 5DUML 5DVMA 2ZXGA 1X5HA 3E1ZA 3DLQR 4NBZB 4PRHD 3WIHA 2C9VA 4W93A 1M05B 3EOBB 1HKFA 1T21B 4A6YB 4L48A 3UGXA 2OZ4H 2EXYD 3UMTA 5DXWA 1JZ6A 3TNMB 3BP6B 1RURL 3BUQA 1QBMH 1WWWX 4PJFB 2ZXQA 3G5VA 3ZHNA 2D2CC 2WSPA 5TJWK 4XE5B 3IU3A 4PJ5D 2JCWA 1VFMA 4PS8A 3MLPA 2VZTA 5CWSB 1R5VB 2W60B 1RZJC 3EH4B 1AS8A 5MEPA 4ONGL 2X44D 1LGVA 3MQIA 4IRJA 1IM3D 1BVNT 1LO4H 1YO4A 2BP0B 3UDWA 2QSVA 1K5NA 3QNFA 4MMZA 5CMAA 5T8IA 1NIAA 2QFRA 3IDNA 3KPRD 4HW6A 1T1XA 4NPYB 4XVJL 5E5RB 5JO5B 5I6NA 2CE6A 5F7AA 4LBEA 1F18A 1KYUA 4PJ9A 2IAMC 1TZ8A 3WFHB 1JOIA 3LKOA 5JW3H 4Y5XC 2HVKB 5JOFB 3ES6B 2EKSB 1J0ZA 3A6OA 2KPWA 3N91A 3S96A 2EH7H 2CJTA 2N7SA 3HE7C 5BQ7A 4E9LA 2ORBH 3QQ9D 1K8IB 3NCYP 2IANB 4Z5RB 5I6XB 1A6AB 5IV2A 3KGSA 4JB9H 5KSBB 3WFDH 3OV6A 4ADIA 4POZD 1IM9B 3WIIH 4A2LA 1EJOH 3K46A 1KCRH 1VFOA 1KBGL 3L7EA 4YSAA 4OLVL 5D96C 1BFSA 3QJTB 1RPQA 3K91A 1HHKB 3UC0H 3BPOC 1MAMH 2FYYB 2AW2A 2JKNA 4JO8A 2MFNA 5T33L 4XXWA 3VGBA 2XZCH 2E75C 3V9FA 4J3OF 1NUFA 1XEDA 4H20L 4H2AA 1NUNB 2PYEE 1F3JA 1KV3A 1OAJA 1PLCA 3MGOB 4XN9A 3WUZA 2BSED 3MV8E 3B2PA 2ZP9A 4V1DA 4F58L 2UZXB 5TE7H 2DQ6A 1BFOA 3CZSA 3VFOA 4KDTC 5B38B 5I5RA 1GHFL 3MJ9L 2Q6WA 1PYWB 2Z4QA 4N2OA 3CXHJ 4RLDA 1Y18B 4JM2D 3VWJC 5AAWA 1CICB 3DC0A