4HUCA

Crystal structure of ldtmt2, a l,d-transpeptidase from mycobacterium tuberculosis: domain b and c
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
261
structure length
261
Chain Sequence
b'MAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE CONSERVED LIPOPROTEIN LPPS
publication title Structure of LdtMt2, an L,D-transpeptidase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 70
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4hucA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hucA01
4GSQA 5DVPA 5E5LA 1Y7MA 5DUJA 5E1IA 5DZPA 5DCCA 4LZHA 5LBGA 3U1PA 2HKLA 4GSUA 3TX4A 3ZGPA 4JMNA 5E51A 3ZG4A 4JMXA 3TURA 4QR7A 5DU7A 3VYOA 4HU2A 5DZJA 3ZQDA 4QTFA 4A1IA 4LPQA 5DC2A 5E1GA 4A1JA 1ZATA 5K69A 3VAEA 3VYPA 4ZFQA 4QRAA 5D7HA 4A1KA 3U1QA 4GSRA 4HUCA 4K73A 4Z7AA 5LB1A 4XVOA 4A52A 3VYNA 2MTZA 4QRBA
chains in the Genus database with same CATH superfamily
2AJVH 1Z3GH 5ANHA 4FAAB 1MFVA 2VDOL 1CU4L 3UTSA 4ZQTA 2VR5A 2UY6B 4E41A 3MRQA 4UM9B 1QR1B 2ZPKL 4I8DA 1AZVA 2YQ3A 2ZCKH 4BBWA 5IEHA 2ZCLH 4NN5C 4LCUA 4LGRB 4Y2DC 4KK5C 4WFED 4U2ZA 5F1KC 1G1OA 5IMMA 1D9KB 1V05A 1ZDSA 2QLYA 2YA0A 4JRWA 3UGXA 4L4TE 4AVJA 5ILTH 5IJKA 3WIHA 3NUKA 3P30H 4FKKA 3QBTB 2E5EA 5DYOB 4LDCA 4NN6B 4P4KD 3ULVE 5DJ6B 2W0FA 5F8QC 4NRZA 3U6XS 1IQWH 4PGCB 3VCLB 1JTTA 4QHKI 4AQEA 1W91A 2GI0A 4LQ1A 5GQBA 1HOEA 1I3VA 2EEBA 5CZVH 2C34A 1P6AB 4PRIE 3SE9H 3U9WA 2XDHA 4GT7A 3M07A 4HLZH 3RVXC 1UVQA 3FUMA 3HN3A 2NW2B 4GAJH 4KDTA 3ZMEA 1U8MA 3DX7A 1UENA 4Q6YA 2QJDA 4LASH 2L7UA 3LN4B 2OMYB 5IWLA 2Z31A 5D7JC 4U0QB 5EO1B 4P2QE 3G5XA 5E2UH 3E0GA 3JTSB 4N8VA 3DX2A 3LKSB 2H47C 4G6ML 1NSNL 1OAYL 1OSPL 4L4TA 2O6PA 5ECJE 4D9LL 3UACA 3Q6GL 4RQQA 5DJDB 4OCNC 2H32A 4RDQF 1EANA 1CI3M 1BQKA 2HWZL 3BSZH 1ADWA 2BWIA 4F9LA 2ARJA 1ZLUK 3Q8EA 4WV1A 3FUIA 2W59A 1SF5A 1ZSDA 4PRIA 5F9AC 2B7DT 4HHAA 2NZ9C 3CVHB 3VXNB 1QSFD 3EYSH 4XBGB 2E75C 2BC4B 1EXHA 3BDYL 3OC5A 3QDJB 1LVEA 5CWSA 4IRJD 4P2OC 1JGDA 3NPSC 4ZS7H 4KZCA 5C9JA 4HJSA 4M7KH 2CO6B 5HHOE 3Q7JA 1WT5C 1I7TB 4P2QA 1T22B 1CL7I 4PGEB 3IJSB 1M2VB 3EDKA 2BRRL 3KS0J 4BGDA 1H0DB 3PYCA 2APVA 3BZEA 4LARL 2EYTB 2HMIC 2AJZB 3O4LB 4X6CB 1XF5B 4PRBB 3K6NA 2Z0UA 2ZXWB 5HVHB 4NQCD 5DEFA 1PD0A 1MSPA 4XTRC 5FYJE 4N9GB 4HUKB 4GRLA 1FORH 1O0VA 2BHFA 1KACB 1A6UH 2A9BA 2NNFA 1RIVH 1AVAA 4J5VA 2VDNB 2EDLA 4MBRA 5HJGA 25C8L 5EIIA 4HFWA 5IB4B 1RLBA 3B3IA 5BO0D 3OR6B 3T2NH 2HT4D 5HHOA 3TEXA 2WLJA 1BCIA 2P5WA 3IF1A 2P1YA 3UG3A 2ADYA 2ZUQB 1FAIL 2VQ1B 1UG9A 3DA0A 3Q1SL 4EI0A 4Y1AE 4ENED 2VR4A 1WBZA 5ICXA 1WUZA 3I6LD 1IFHH 2O6EA 5CILH 1IBDA 1CGVA 1DQLH 4NYLB 3MLUH 1O7VA 2P49B 3DOIA 5D5MB 5HYSA 1Z32X 3ZPDA 1FH5H 3VGGA 3IAGC 3V6OE 3TWYA 1GVIA 1M05B 3EYQD 3GO1H 2VUOA 4UT9L 2IBGA 2WXRA 4FFYA 5KSUA 5KBKA 4Q9CA 5LNGA 4M7LT 3ZRSA 1MLCA 2Z7YA 1MHCB 1UM6H 4KTDH 3HNVL 1OW0C 4FQQB 4D9RD 2Y5TA 1HOCA 1OL0A 3S3CB 3FQNA 3OHMB 4X4YA 4NNXB 4XVOA 1FCGA 3RGVB 2VDRH 5E4OA 1N0LA 4LOFA 4XP5H 4MMYB 5DLMH 4L4TD 4Y1AA 1MI5B 4IMLA 4PJAF 5EU6E 1MCNA 3ARPA 4PP1D 2QADB 4JCWA 5E2JA 1DVFB 3WGUB 4Z7WF 3PXLA 3CFJB 5CINH 2IDQA 2JXMB 4MCZA 5JQIB 1HINL 4KY2A 1IGIL 4NJAH 5INCB 1O7DC 5MENB 1T7XA 3V6OA 2AXFB 2E56A 4YXLH 5FOBB 4JRFA 2Q8BL 2C4XA 3OMAB 5EULV 3CSTA 3V4PL 3IT8D 4MMXA 1GPOH 3OPZH 2Y36L 3U6XA 4X80L 4QRBA 3HUJB 1AGDB 1FNGA 2HJFB 3QUKA 1UH3A 3PE9A 5JW3H 4JFEE 3T0ED 2BP8B 3F04A 5FM5M 1ZLWH 4MXQD 1IB5A 4JRLA 4NLHA 3X14A 5HDBF 2J72A 3B34A 5B8CB 5DJYA 3FQUB 1HHHA 2HN7A 5EU6A 9PCYA 3DSNB 4LKCA 1HJCA 3VAEA 4GRLD 1PLCA 3FO9A 4JR9L 3NJIA 4BFOA 1ZS8A 4F91B 1Z9OA 4AG4L 4XX1G 2A0LC 1LO0L 4OCLC 2B4CL 1M7DA 3HI6H 4KVNH 4URTB 3SDAD 3GS7A 3JWNC 2A2QT 2ITDA 3HE7B 1JJUA 4FFZL 1KTJA 2YSSB 4HH9B 5JYLA 1EEZA 1J1XH 4ABQA 4DVRL 1ODUA 2NX5B 1HCFX 5GGSY 1AACA 5HYJB 2YWZA 3CSFA 4HGWB 2P5WD 2DY2A 4RWYL 4JFEA 2EYSA 4HCRL 4Q7DA 3HB3C 1IIIA 2WKLA 2EABA 1AZNA 1I1AD 3ZL4L 3EYOB 3INOA 4P3DA 5C97A 3B2MA 5T1LA 4TL4A 3MUZ1 5LJYH 1CDHA 3OB8A 4XPHH 5GZOA 2GY5A 4IBUA 4ENZA 1TVBB 4YFLF 5JLZA 1U3YA 3ZUCA 3D3VB 3FYIB 4TLUA 3X1EA 1D7BA 5GS0H 4U6YA 3ZUNC 4R26H 3ZE2E 4Y9FA 2NDFA 4OM0L 4XN1A 5BW7A 1NMBH 2DB8A 3MJ9L 5CJOL 2ARJQ 1KXHA 4AGPA 1EO7A 2X4UB 2YUZA 5C0IB 4CADA 3D85B 2CCWA 1DEDA 4JG1H 4NO5A 2G75B 3AFLA 3UAAA 4LLDB 3WE6B 2YAPA 1AOZA 2IH3B 2DLFH 4E2OA 2PF6A 5A2AA 1E4XI 5CP7A 1NCNA 5EH1A 3BWSA 1A8JH 4UQIM 3C6LA 4N8UA 5FLVA 2WXQA 5CJQL 1FGNL 1P5UB 3NGBB 3PGDB 4ZD3L 1XAUA 3R4DA 3I3EA 1IT9H 2CDGB 3L2MA 1B4JH 1DQML 5GRUL 1K8IB 1ANUA 1LP9B 2CR6A 2VABA 4GBXD 3TURA 4D2NA 1KEML 3GSNL 1DBJH 2DQHL 3CIQA 3KWWB 4UOW0 4JRYB 3I74A 5DVMA 4A6YA 3DX6B 2YQBA 2UWEE 3U82B 4F7KA 5KAQF 4N22A 3QR1A 1ZT4B 3MRDB 5E4EB 2GUOA 3FB8A 3KPSB 5DUBB 2HFTA 2W0PA 4PBWD 3BT0A 3K2KA 3KDMB 2XA3A 2QKIC 3S6CA 1GYCA 5IBLD 1XR8A 2VMEA 1SJVA 3QVAA 1Z5LB 2X12A 4UILL 3BPOB 1GC1C 4HS8H 4ZO7A 3I9GH 1QWUA 4KKRA 4NZRL 2B15A 4PBVC 4R96A 4XO4A 1XH1A 1G9MC 3RAJH 3SEPA 5J6SA 3ZMRA 1URLA 1BG9A 4ZFQA 5BRZD 1UATA 2Y1YA 3AADB 1RJYB 2X6CA 3WN5A 3R0MA 1ZLWK 4WLCA 3BQUA 3WJJA 4ZPVA 3O4OC 3C87A 1KBGH 4PGDA 4A68A 2W5PA 4B6ZA 1T1WB 4HOZA 2CM5A 1DBAL 3GJFH 2UWEA 2WAQA 4WO4A 4XB7A 1NTDA 1F90H 4YFEA 4YC2B 1LL1A 4WHYG 5C0BE 5KVFL 1JXGA 3V4VH 4JFED 3DURA 3MXWL 2ENSA 2F58L 3EIFA 5CGBA 3PDOB 4J8RB 3B5GA 3D2UB 2WPGA 3A3YB 2V5TA 2MJWA 5L8JB 4JKWA 1CFQB 3ZTJG 2DQMA 4RZCB 1KIPA 5EC1A 5F9WB 2KZKA 3OKDA 4ONFL 4Z7QF 3O3EB 1E5BA 2IXQB 4G59C 4IK6A 4WEEA 4M3HA 3LRSB 3LXCA 2VW7A 5C08B 4PJ7F 1LLAA 3LKOA 3N1FC 3GXUB 4AJYV 3U2SA 2P8LA 4OT1L 3HW7A 4XC1H 5KUMA 4JUTA 5C0BA 1F1DA 4MA8H 2I25N 2ZWSA 5HDOA 1U8NB 2ICEC 5C71A 3FF8A 4J1UB 4LHUG 3V4PB 5I30H 2GFBA 1F6FB 1CIUA 4JX0A 4JO4L 4OM1H 3SHSA 1I4FB 3HBPA 1INEH 3L2LA 3QUYD 5JW4N 2R2BA 3DX9A 4ZO9A 4XMTA 3F6JA 2G4GA 4N0CD 2RQEA 1UJ3C 3VACA 4JKPH 5JPMB 1EXUB 1JGLH 3U4KA 1OGAE 3BOVA 2H26A 4H25A 2FHBA 1B0RB 4GFXA 1E28A 2R8SL 3ASWA 3OKMB 3ZBMA 2VLRE 4JGJA 4PJBE 1VFBB 1ORQB 1BHGA 2GCYA 4BZ2A 2JIXB 1TFHA 1H15B 4NENA 3ROLA 4YHIA 3V4UL 1CYWA 5I76A 5CAYB 1E27B 4KH2A 1UUSA 3VFRB 1MFDL 5IVZB 4YE4L 2ZSVA 3E2HC 3R7RA 3WMQA 3L5XL 3O3AB 2AQNA 2XVLA 2VAAA 2QV2A 3MOBH 3Q2LA 4AYSA 2D3NA 3FL7A 3X13B 2F7QA 3DROB 3LXUX 1I85A 4GI9A 5KSAA 1G7PA 5DUPL 4WCYH 3APNA 2VMJA 1HZLA 1CYGA 2BLFA 3WAKA 1OGAA 1DYZA 2OULB 2XN0A 4Q6IC 5F72S 3HHRB 1E90A 4LNRA 1A6VH 2AV7A 1U8LB 1CD1A 3WIFA 1PNDA 2VLRA 3BC9A 4PJBA 2N7BA 4K15A 4KTEH 1WFTA 2QPEB 3BUIA 3CV5A 4R4BB 5E70A 3KR3L 4ODXA 2NNRA 4UQ3B 3EUDA 1X5JA 4IBVA 5GHWH 5FA3A 2G3NA 4F5CE 3ZDYF 3QCTH 2Z93A 1G1CA 1XGTA 3PGCA 2UVEA 2ZTBA 3AY2A 3GJFK 3CHXA 2G60H 5M94B 1WZ1L 2E4FA 3W3BA 3MUGA 4RMTA 5G2NA 2HTLD 1KNOA 2JV6A 5IBTL 4NQUA 1ADQH 3BW9A 3OF6A 4NUGH 1QSEE 5IVXB 3BN3B 3IB4A 3V79C 4A7QA 1TO4A 3IGLA 4PJEF 4DZBA 4QXUL 5JXAL 1OTTC 2Z4QA 5BXFB 1GXEA 5JPNC 3D09A 1AS6A 1RCYA 5AENA 1M2OA 4WWNA 3V6FA 4MNQB 4KGLA 2CGYA 2BSRB 3EH2A 1DLFH 2PYED 3EZJB 1PKOA 4KK6C 3TVMD 2I9LB 5FGCE 1JERA 3QI9A 3UP6A 3RY6C 4ZQKA 1JZ2A 1P4IL 1JPTH 4DP9X 4F5CA 1D2OA 4FS0A 1TTRA 3DBXA 3P4MB 2KH2B 3OQRA 1I1YB 1FN4A 2HJKA 3GRWA 4UYPA 4JHAH 3DSFH 4NKIL 1AYOA 4PS7A 1EDYA 1KT2A 2J6EH 1VACB 4CDHA 1QSEA 1V3JA 4YHKH 1ITCA 1KPVA 3MFGB 3BAJA 2XN9E 4UQEA 2FQGA 2XNAB 2AXGB 2X4OB 3ARBB 3STLA 1G6RL 4WTZG 3UZQB 2NDGA 1HEZB 1WFJA 2IH1A 1HHKB 4JM4L 4X6FA 4XAWH 1CBJA 3Q6FB 4LPVA 4LSRL 3JV6A 4PJ9B 1Z9NA 4PJIE 1R47A 4HJGB 4QTHA 4Z3JA 2ZICA 3CFKB 5ALCH 3V5HB 3RB5A 4JFWA 3MGOA 3R19A 3A5VA 3H3BC 1C7TA 2Y1AA 2NQ3A 3QZBA 4BWUA 3ZYJA 5IJDC 3RP1A 4ADIA 1XB8A 4C56B 2NYKA 4GSUA 2NY6D 3E1ZA 4UWQB 4LXFA 1B3IA 3RB7A 1MNUL 2M2DA 2EVHA 1BWWA 2OQJB 3RWDA 3T0AA 3I9IA 2OTPA 3I6GA 3AMKA 2ZX5A 1IC1A 1BQHG 3M1BB 3U1QA 1FL5A 2XN9A 1S7TB 3L81A 4N0UE 2IADA 5IJKC 3MKGA 4GRWH 4HHGA 1MHPH 1ZSHA 1YEGH 4CJ1A 4RISL 2PO6A 3AREB 2A1WH 2V33A 4P07A 5C70A 3R06B 1WZKA 3TBTB 3N43F 4RNRA 1ZE3C 2AXWA 3HE6B 4HJJH 3CSGA 3V0WH 2DWDB 3NFPB 2GBAA 4PJIA 4N2IA 3FB6B 1QPXA 4M3JA 5C0JB 3AB0B 3ZGPA 2W60B 4GOSA 4JZJA 1RIUH 2V2XB 3MRFB 4UV4L 5E8EA 2KQNA 3KXFE 4KDTC 2A9NH 4LBEB 4Q2ZB 4OQTA 1OQOA 3FSVA 1HNYA 4GJTB 3HG1B 3US9A 4G6KH 5I66B 3NAAH 3B9KC 1XSIA 5IWLC 2Z31C 3CFIC 4BZ1A 3LIZH 5ACLA 3LEYH 4H1LG 4GI6A 1UZ8A 1T4KA 2B9AA 2WB7A 1MHHB 1IILE 1RU9L 3SKMA 3VFOA 4G9FB 4G6FB 2XFXA 5FB8A 1LO5B 4XN9A 1JHLH 2QVMA 1MWAB 4F9PA 4B0MM 3NTCL 3FU0A 2CGRL 4N0UA 4Z78A 3SBRA 2DQIH 4KOBA 3BKCH 2LE9A 2VWEE 3ULVC 4UOW1 4WFGE 2NUPA 2C3VB 4FOMA 3T1FB 3EOAB 4F9LC 2AJXL 4WV1C 5D93B 4FG6D 4B97A 5EF2A 2QR0B 5FA4A 1OQXA 2UZXA 5DMKB 4TF4A 3RVVC 2YD5A 4U31A 1HSBA 1DJSA 4LIQE 4UT6H 3KXFA 4XNUH 1RZJL 3MRIA 1P1VA 3DDGA 1UM5H 4LHQB 5GGQL 1BF2A 1UHVA 4LOUD 4XBPA 3C6SA 3RL2A 3UYPA 4F7PA 1JVKA 5T5NG 3LRHA 1UOLA 1GGUA 1YNTF 3QQDA 2X1QA 3LNEA 1KENL 4JFSA 1ML0A 2BXYA 2CHXA 3DPBB 4JS7A 4CU8A 3BKJH 3ZHDA 2A5UA 1D5MA 3QZOA 4HEPA 4JPWH 1MELA 2WNGA 1XDTT 2X4TA 2E27H 1DLHA 3GMRB 4U6HB 1SXAA 4M6NL 4OLZH 5DVKA 5F7UA 1MFEH 1SXNA 1H3WM 4L3EE 1E7UA 4YDLC 4Z7NF 4GRLC 3EO0B 4X5WA 3FAXA 5KBMA 4HSCX 1FG2B 2AZAA 3MLZH 5C3LD 2CKBH 4HXAH 2VR8A 3DYOA 3O6LL 3KPOB 4I85A 4V1DE 1GW6A 4IRSA 1HXMB 4Y19E 5IW6B 1M53A 1LO3L 1JZFA 5IF0A 1E2WA 4QHNA 4P57A 3VXME 5ICZA 1SY6A 5D1XD 3SGEI 1IGTA 2OMZA 4PIBA 4KKPA 5D72H 2GAZB 4Z3TA 2UZYB 3EYVB 1MHEA 5DZLA 5GSRB 5DTFA 1JPEA 2FUQA 3DUSB 2XN9D 5D96B 2WBJD 2H6PA 3RWEA 2N56A 3P0GB 4N5UA 1HT6A 1E4KA 4E9XA 5TPWL 4PN6A 2OMTA 2PO6D 5D1ZI 5DI8A 2Z8VC 2Q0ZX 2YK1H 2DQGL 3QXTA 3LEVL 5DS8A 4QI3A 4L3EA 2FYYB 2OCFD 3T65A 4AWJC 4MJID 1PFOA 5CP3H 5KYXA 3GSOA 4Y4HA 4IOIA 5DMGD 1WG3A 2R69L 3ZE1E 3VXQB 4PJHB 1WWWX 2XV3A 4AVHA 2G3MA 2Q76B 4NT6B 4WI8A 2YZ1A 4JHWL 2AHIA 4V1DA 4CVZB 1AQDB 4Y19A 2HT3C 1SLVA 5C7XL 3VFWA 2X4SB 4EDWH 4POZC 2F1AA 1P7KB 2XWBB 3LKNA 5J4MA 5LWYL 4HK0A 3VXMA 1THAA 2APBA 4HKZB 4I9WE 1KN2H 4DQOL 5J1AB 1A1OB 1YZZA 2R0LL 1DR9A 4RSVA 1BXXA 1Q0YL 4TMPA 3DOSB 3MREA 3VMPA 3Q05A 1QFWH 3CDFA 4UU9B 1BZ7B 3HZYB 4TUKL 5IB2B 1G9NC 2QFRA 1KTDA 2AJYH 1E67A 3K91A 3QO1A 2A4ZA 4PJAE 3BFOA 5E6IB 1FBIL 4ZUUA 1WFUA 4J6IA 4Y5YB 2AQ3A 4OZFB 2YBGA 2AQQA 1BAGA 1J5OH 3ENEA 4Z77A 4G8GD 2RCSH 1YUHA 1DVUA 4JPIB 5G5DA 3V6OC 1Q8MA 4IIQA 3AY4C 5A7BA 1R33A 3GKWH 1GKEA 2C1OA 3KXFD 4MMXC 1S9YB 4N2AA 5C6WH 5MEQA 4MB1A 3LPWA 2CKNA 4PJCF 1BMGA 4P0DA 1S7QA 2DLTA 3MBXH 1LO2L 5DK2B 1J9QA 4UQCA 2EUXA 1A66A 3A4FA 3ZHKA 2K78A 1FNSH 3MKKA 2BDNH 4BUGA 4B9CA 2WYTA 2WZ0A 4XGZB 2EJ1A 4J7RA 4P23A 3VFGL 3WFEL 1F3DJ 4PJAA 4AH2B 1JS4A 4I3GA 3B56A 4C4UA 4DW2H 1BECA 2BS71 2OSLB 3CZLA 3HN8A 2DBLH 3X11B 4X8XA 3MJ6A 3JWNG 4QYOA 3EJQA 1BYPA 4B5EA 4QRTA 4L8BA 4JDZB 4OKDA 5EU5B 1X5YA 5AW8B 3S9DB 3N0AA 4QRSA 2GEEA 3S5LG 3SE8L 1PIGA 3K72A 4IRSD 4HQQL 4IOSA 3S98A 4AVIA 5CIPB 1CB4A 4PVBA 5T3ZH 2CLRB 2E6QA 1KTLB 3K1DA 5ES4B 3L7EA 1ZK9A 3LMJL 4TLTA 2AVFA 5E1QA 1Z9SB 2FSDA 4HKXB 4FC3E 1VDGA 2EDTA 1J9CT 2D7PA 4PRNA 3S36X 3LZFL 1RD6A 1S2EA 3RL1B 1NAMH 1T21B 3II2A 2FX8L 1O6VA 1BFVH 1PZSA 3MRCA 4ABWA 4HWBL 1J11A 2TRYA 2QDVA 4GQPH 1P5VA 5GZOC 3SDCB 4WHTB 2WSDA 4XZ4A 1X5MA 5IQMA 2YRBA 4HGKC 4MD0B 3I75B 2IV9A 1AGBA 3NJFA 5BW7C 1IKNA 1FFPA 3UOAB 2AJSH 3GSRB 5IKCA 1F86A 3QUMA 2J71A 2K9UA 4OCXL 5CUSH 5C7ZA 5E9DB 3OX8B 2NY0D 4RCAA 3UL4A 2I26N 2VLKD 2WB1A 2DQCH 2HSIA 3JWOH 5E1AB 1AZZC 1INDH 1CXLA 1U8IA 1HH9B 2X1WL 4OCYH 1KCLA 2AABH 1FWXA 3SDXF 2GIYA 1MW1A 3LB6C 1N59A 4I3RL 3S37X 5I1CH 3C6LC 1CTOA 1RJZA 1B6UA 1C8QA 5LDSA 5EN3A 4BK4A 5ECGA 4KNUA 3ETBF 1S46A 1IIKA 3V0JA 2V2TB 1GGYA 5BQ7A 1WD9A 4YXKH 5I5RA 4PJ6A 5E8PB 5IQ9A 3ARDB 3W0WE 1U9KA 2FATH 4M1DH 3VM7A 1I3GH 2AZUA 4AQ8A 3KPMA 3S5YA 1NFAA 3G6AB 3UBXA 4DJMA 5KVGE 1BREA 3NDZE 5KJ4A 4NQSA 3O3DB 4I9WD 1IJNA 1BEXA 3P9MB 5I26A 3HNSL 1CQYA 2YEZB 1A9BA 2D0HA 1FJ1B 3LQAH 1LEKB 3TIEA 5INDB 4MWFA 4XAKD 1FUNA 4EXKA 5KBPA 1GY2A 1MCRA 4FYQA 2MQGA 1PY4A 4P4RB 4TSCH 4QF1B 4BK5A 4ZXBA 5EPMB 1KLFB 1MIEH 1RIHL 5E2TL 1R3LA 4ZOEA 2FD6H 3IDIB 5KYNA 2FE0A 4YFDB 3BQUC 3W0WA 3WJJC 5FDYA 4JFQB 3AWFA 4DO5A 5AVXB 4OZ4A 4IOSD 1S6NA 4NM4H 1MAML 1T5WA 5IVOA 3QULA 3PAVA 1PQZB 4WO4C 2XV0A 5T5FL 1BPLB 4NZ8A 5H37A 5JQ6H 2Y6SC 5F3HB 1AYRA 1KCRL 4GSXA 5EOTB 2KUTA 2H1PL 3FCBA 5I28A 5CEYA 1FVEB 2D4FA 4C59B 4R7NB 3DX1A 5I5JA 3AGVA 1H3TA 2YUXA 3ZT7A 1V54B 3PS6A 2HVBA 1E2ZA 1NGWA 2OR7A 4EVNA 1HQRA 1MVFA 3K4AA 3V0EA 1M6OA 2X05A 1F6AB 4BQ8A 4GUQA 4K55A 4YN3A 2BS9A 1OIOA 3BGAA 5CGMA 3BDBA 1T0MA 1UACL 2ORBL 2Q6WA 1GZPA 4M02A 1IAIM 5KVMC 3ZDWA 1QLRB 3AS2A 5DZVA 3VG9C 4P5TA 2YZ8A 1IJ9A 4FA7B 4GW4A 4QHKJ 2NXZB 3VI3F 1OCWH 5JO5A 1OF2B 5CU5A 3CDGB 1VFAA 3EJYD 1KLUA 3BVWA 3DIDA 4FULA 1QNIA 3QFDA 4FQXB 3GPSA 3OAUL 4V2CB 5JW4Q 2UUDH 1TYRA 1VKXB 4U6XB 3MACH 3DBSA 5CZXC 2Q7NA 3ZX1A 5I1JL 4G1MB 5EMYA 3TTSA 4NKOA 3CFDA 1H3VA 1IGYB 3FN0L 4HG4J 3VG0H 1X5IA 4J27A 2V37A 2AMUA 2WQWA 2X42A 1NIFA 1EBPA 1V10A 2P8PA 5ISZD 1YEEL 2VN4A 4NQEB 4JN1L 4L23A 5L0QB 2RJMA 2UZIL 1TNNA 2A3TA 4M7JL 4YDJA 1LILA 4OF0A 2FZ3B 5C0FB 2VL4A 4PJ8A 3WKQA 5ETUA 4AYFA 3GS4A 3TV3L 3ALPA 4DK5A 1PEZA 3RJDA 3S35L 4AVKA 5HHXL 2V9UA 4JFVA 4WHYH 4JFXB 3MI6A 2X5PA 4O58H 5L8LB 4R7DA 2DICA 4PRHE 3O2DH 2J21A 2FUTA 5IFAL 1COBA 2QSVA 1FO0A 3MLSH 2Z8WC 4CVUA 2W0LA 1EO5A 5C0DA 1KJ2A 5AYUL 4M48H 35C8L 1V3MA 2YPLD 3T09A 1YEJL 4NN7C 2CJUH 4E9YA 5KSAC 1I85C 4ODVL 4PRPE 2QHLA 3UTPE 3ZTJH 1CLVA 3HVNA 1ONQA 1YEDA 3ZIYA 1U8KB 1Y7VA 1TJHL 1VLXA 3U7YH 5KVDL 4FJZA 2BNQE 2CNZA 4FZ8L 4JQIA 3QT2A 3W0WD 3K74B 3W9DB 3VFPA 2A73B 5CGYC 4G8FB 2PTTA 1JZ5A 4P3CH 1E8ZA 4W6YB 2WO2B 2WLIB 1DQQB 1MFAH 2BNUB 4XO9A 1ITBB 2A99A 4UQ2B 4JJ5A 2JTYA 5D7LD 4UQBA 2ICCA 4FQJL 3NMEA 4N6RB 3GMPA 2D7TL 4OCRL 3QJQB 2BSSB 3BISA 4BKLB 4JDVA 4PRHA 1CT8B 3PHOA 4M7LL 4OFQA 3K2UL 2YLKA 3BGFB 4ZYKA 4A39A 3ZDYE 4FRWA 4TQEL 2X2YA 2E74C 1KPUA 2ITEA 3FRUA 3GSVA 3EDFA 2YAFA 1M71B 1ORSA 2WQSA 5ABAA 4PRPA 5LQBH 3CFQA 3APDA 6TAAA 3C9NB 3KL3A 1O9VA 2H2PC 5D4QA 3GJEB 3D39B 4CSTA 2BNQA 4PJEE 2F74A 3WXWL 1K6QL 1FZOA 3ABZA 2I32A 2BZDA 3ZE0B 2OMUA 2R0ZH 5H8DA 1S7RB 5C0CB 3MRGB 2NUTB 3BZFA 3LIUA 1A7OH 2E0PA 4GY4A 1TVHA 4GAYB 4A04A 4NGHL 2F5BH 4JB9H 5IREA 3QI9C 1USQA 2AGJH 5IR1B 5C07E 2NSMA 5EDXA 3FHEA 3IMWA 1FP5A 1GJIA 4MAUH 4EDXB 1JFHA 3PUCA 3WAJA 1I3UA 4AQAA 5K9QI 1SXSA 1MQKH 4PMFA 2EEAA 1S7WA 2ESVE 3CQQA 1AGEA 3BP4A 3D48R 5GS3A 5AWNH 2R27A 3L4XA 1XXDC 3DV4A 1K5WA 4J3OC 3IDMB 4PJEA 1R3IH 2OV0A 1PZUB 3QDGD 3RG1C 4LB8A 4PB9L 2DYRB 1PZDA 3ASNB 4LPQA 4MS8D 4R3SB 5DJZA 4YHNA 3DOHA 5EA0L 1BQSA 3TEUA 3DI2B 4C83A 1XFPA 3N40P 4MLIA 5ADPH 4JZOA 3O9WC 2I5YL 3QXVA 4MDIB 3SJVE 3U46A 1H3PH 1U2YA 3BZ4B 5DRZB 3I6KA 4DZ8B 5C07A 2X09A 2P5EB 1A6WH 3HZ3A 5I1DA 4K2UL 5D71L 3MRRB 4JPKH 1SNRA 4OB5L 4ISVA 3RVWD 4ODTL 4X7CC 3ZTDC 4BD4A 2ZUWA 3KGTA 4JL1A 5JW4R 4K71C 5DT1L 2VL5B 2ESVA 4M29A 4XNQA 4MKTA 4UBDC 2WUCH 4BXVA 3H2WA 2GKIA 4MDJB 3TO2B 2R23A 3QEGH 4HIQA 5I17A 1JNNL 1KCUH 2FGZA 2AEOA 2PO6C 4UDUB 2OLDA 5D1ZA 2DMBA 2Y06H 1AD0B 1WFMA 2AEQL 1TQSA 4DGWC 2QQKL 1ZTXL 2ATKA 3MLVH 4DTGH 3HA0A 5FHBH 3VUAA 3CFEB 3EUUA 4PD4K 4OUUB 3DXAB 3GNML 4JZJC 2WANA 2XZAH 3SJVA 3VRIA 5JYMA 3MJGX 1TZOA 1BZQK 4EI5A 4TUJA 4DGUA 1FLRH 1O6SB 3MLYL 1XF2A 2BSTA 2XIIA 2F54E 5J3HD 5MEPA 1RK0A 4ANWA 5DHVA 2CHDA 1XCTB 3P11H 2VDQH 4ODWB 1N5YH 1NFDB 3NSJA 4FNQA 1GGIL 2G2RB 2WN2A 5E8DL 1U3HD 3QORB 5BVJB 3TA3D 2HG5A 4F9PC 4AC2A 4WU5A 3MRLA 1R3HB 4XOBA 3H2PA 5T3XE 4RX4D 4KAQL 4TVPD 1WFNA 1QKZH 5B21A 3KBHE 3N9GH 3OD3A 4W70A 3S37H 1Q9LB 4ZDHA 1UD3A 1MCKA 3U79A 4GAGL 1GHFH 5D1QB 4CMHC 2DYPD 2FNWA 2IAMA 2L3BA 5I74B 1J1PL 5IJVA 5FYLE 2Z6FA 2OM5A 3AXIA 5JORB 4Z95L 1EFXB 3REVA 1UXWB 3UP1A 1QI5A 4WJG3 5TQ0L 2AJVL 1Z3GL 3FH8A 4Z3EA 1TJXA 2G30A 1YEKL 3HS0A 2A6KA 2F54A 3UJTH 2BM3A 3ARGA 3PWPE 1I53A 4P06A 4PI0A 2ZCKL 4JFYA 3ECWA 1ACXA 2ZCLL 2VQ4A 5EUKA 3VVVA 3P77A 1L6PA 3OKLB 3V52H 1YEWA 2OI9B 2QFPA 5EORH 1YMME 2DH2A 2FYVA 2YXVA 4S2SA 3WOVA 2B1HH 5ILTL 2VWEC 2WOBA 3P30L 1MW2A 5EIIG 2GJZA 4PSPA 2EXYD 1R0AH 2ERJB 3ZZQA 5L2KB 3DDFA 2P4AB 1IQWL 3OJMB 1MF2H 1FHNA 3FFCB 4MVBC 5CZVL 2DEYX 3W2DH 1K8DA 3JTBA 4XVSH 5IOPA 2Y3AA 1FV1B 2XXMB 1S5IH 2VLJE 1IM3B 3B7UX 4ETQB 3TCTA 2H3NB 2JCCB 1ECZA 1UXSA 1F2XK 1VFUA 4GAJL 4FMVA 1QR1A 1T89A 2PXYB 4FQLH 4OZHB 4H1LH 1J05B 3PWPA 5B1JA 1MZYA 3H3PH 1YNTA 4LASL 3SCMB 3KPLA 2RFXA 3IN2A 4DP6X 3C60B 2K45A 2WWNA 4MMZA 4X0KB 1L9TA 2FJHB 5EU7E 3WUWB 4XBMA 5CU9A 1D9KA 4H0IA 3P2DA 1YMMA 1E4KC 2EDXA 4OBSA 3DVIA 1HFUA 1Q72H 3VQMA 4N2KA 3IDUA 4NHCH 4WUUB 1JHTB 5DYOA 2IF7A 4JREB 1L9RA 3RGBA 3ZYIA 1SF3A 3BIKB 2RH0A 4R2GC 5HHNB 4Y4HC 2Y25A 3TBVA 4PGCA 3BSZL 3VCLA 2WVVB 1I7UB 3PAZA 4XE5B 5I1AB 5FFOA 3DTUB 5C6PB 4BWTA 2VZ3A 2VLJA 4HHWA 5I8CB 2AAVA 2NOYA 3EYSL 2P7TB 4TQHA 2MSPA 2NCEA 1RUKH 3LN4A 4ZS7L 4QAMB 4JGUA 4WDIB 2ZX8A 3PHQB 3ILQD 3NA4A 2A74A 3JTSA 3CX5K 4N2BA 1NIBA 3LKSA 3RHWK 3SYCA 4LAQL 3OZ9L 2XHNA 2IANB 1J12A 1IEHA 4NO2A 2WYZA 4WWKD 1RHHA 4IIQC 5F7DB 3GBMH 3KW8A 4GP5B 4F37K 1Z9LA 4N8CH 4AQ1B 1RIVL 3FMGH 5C8JB 4UUJB 1A7BA 2F54D 1C8PA 4PGBB 4PJCE 3IVKB 3H9SB 3GBEA 4XBGA 3LNIA 5FXCH 1RZKC 3TH2T 4PYHA 3HR5A 1A3RH 4JW3A 2EDYA 3BAEH 3DUHA 3HI1A 3WCYA 4CSPA 3T2NL 4QJ4B 2A9CA 1NZRA 2CO6A 3EYUH 3HAEA 1FL6B 4MA1C 2WO4A 5JHAA 3U9PH 3FU3A 1L0QA 4P23C 4PGEA 3IJSA 1RLWA 1GZQB 4IOFC 3D1MC 2E9JA 1H0DA 1X4YA 2I07A 2RQ8A 4M56A 5IQ7H 2NY2C 2AJZA 3V7AE 5CZRA 4YAQB 1IFHL 5CILL 1XF5A 2GSIA 4PRBA 4YBQD 3RWIB 1DQLL 4LBAA 3MLUL 4QHUB 4X7TA 5IB3A 1EDQA 4DGIH 1FH5L 1KB5B 3FJTA 4N9GA 3FT3B 5FYLD 1RJCA 3WFHB 4FTVB 4IJTA 2IBBA 2B08A 4ODUB 4QOKD 3IJHB 1BXAA 2F8IA 4PJHF 1YY9D 2W1NA 5J11C 1URZA 4FA8A 4Z3GA 5CJXA 1IQDB 3SKNB 1UM6L 1U3ZA 3D69B 4L05A 4PJCA 1HU8A 1PAMA 3GKZA 2VJ0A 3KS0H 3PWPD 2P26A 1MFNA 1IC7H 1AP2B 3OR6A 4NN5B 3HOGA 4WW2B 2RR3A 4KKNA 4Y2DB 4GKSB 2WXFA 3IJYB 1JZHA 4PGZA 5C2UB 1HESA 4XP5L 5DLML 1MI5E 1IGJB 3ZKMD 4NYLA 5CINL 1HQ4A 4ANUA 2P9RA 3GTVA 4LSQL 1PAZA 4NJAL 5AVYB 4Y4FA 3UTTD 1UWXH 4RFNC 2A6IB 3ZXAC 5MENE 1IKNC 4M1GH 1BYNA 4WNJA 1M05A 4GG6F 2PR4H 3H42H 3MROA 4YXLL 2CA4A 4J3UA 4APQA 3EJYC 4S1RL 1GPOL 3OPZL 3TYGL 4AYBA 4QO1A 2MTAA 1DL7H 5DVNA 2XKSA 2IMMA 4YLBA 4DUWA 2JQZA 4MQXC 5D7JB 3SDXE 2BMKB 5JW3L 4WNQB 4NNXA 1NC4B 4M43H 3QCUL 2GTWB 1X5GA 4YBLC 1VZIA 5DJXA 4PY8I 3RGVA 3SKUD 4HU8A 3QPQD 2NW3A 2X4QA 1MI5A 2HLFD 4ZX6A 4XCCL 3BCFA 1WS7A 1DVFA 3NJNA 3CN2A 3SYQA 4PWFA 4XE0A 2A9MH 4LQFL 4E0RA 3QUXB 4J3SA 4AQ8C 3QFJE 2XVGA 3ZYZA 5MENA 5CMAB 5A6IA 4N9OB 3HZKB 1A21A 4XCNB 2AXFA 2Z65C 5FOBA 1NGYA 2RACA 3TCLA 4JLRB 3HI6L 5CCHE 4OSUL 3CHPA 3QJFA 4W9KC 5D6CA 1KB9J 3EDEA 4PCSA 2WXMA 5IG7A 4FQIH 3NPSB 2HJFA 3GB7A 3SDXA 2X4NB 1U2CA 5I23A 4MSWA 4B96A 3KL5A 1KLGA 3NSCA 1DVTA 3F65A 1L9QA 4Y89A 4PV9A 4ZFGL 1I7RB 1ZGLP 4CSZA 3CIAA 3FQUA 4BK5C 4ZXBC 3DSNA 2FJUB 1ECYA 3L3JB 4WTWA 5AD0B 5DA0B 2ZOTA 1T2XA 3LVTA 3LPFA 3GMOB 4XPHL 2GB2A 1J8RA 3AW5A 3D3VE 2BCKA 4K3JH 3QFJA 3SOBL 4NI6A 2Y4SA 4R26L 1SM3H 4R0LA 1A25A 1E43A 3KBFA 2NTFB 3IK2A 5DGQA 1T1XB 3CLFH 4ELDA 1VGKA 3UJIH 2F08A 4NDMA 4JG1L 2DEWX 1BVOA 3VB9A 1Q0EA 1V7NH 4I18A 3WJLA 3WTTA 2DLFL 4OH2A 2ZOKB 4PBXA 1KSRA 2V3FA 3R8QA 3GSWB 3OHXB 1QQDA 1EHLH 4BSVB 1AO7D 5E03A 5DQ9B 4MYWB 5DFAA 5GIRB 4UIMB 5GRZA 3WG7B 1UD6A 2L4OA 5AZEH 1IT9L 1B4JL 3DVFA 5LNDA 1LP9E 1N0XH 1ROCA 2BIHA 3FQTB 2GK2A 4YDIH 4JZNB 4P5TC 2HFGH 1DBJL 1E30A 1GJUA 1W8NA 1ZA3B 2CO7B 3D3VA 3KNBA 3QK0A 4JRYE 4KHXH 5D7EA 5HGAA 1BOGB 3VI3E 5I2IB 3BUYB 3LQZB 3UEQA 3S8FB 3GEFA 3ILDA 2X4UA 5L4JA 1GC1H 2XUWA 1UWXK 2H45A 4QJ5B 4HIHA 3EJSA 5ESVA 2MCAA 1E4HA 4IGBA 4J28A 4MJ6B 1C16A 3N1MC 4IU2B 4RMRA 4XNMB 3NZ8A 1P5UA 4HS8L 1DBMH 3RAJL 4PLJC 5BUGA 1AY1L 3HZVA 5TDOA 1ETZA 4NWUH 1LP9A 2CXGA 2ZXAA 4JFFD 1HHIB 1MPAH 4PJ8C 2QGDA 3KWWA 4JRYA 1XB6A 1RUQH 4MS8C 4B7IA 1H3GA 3VI3A 1C1EH 1MRCL 1KBGL 4G70B 4O00A 4Y7MA 5E94A 3QYCA 4DGVL 1F90L 5I75C 1A6ZB 2R4SH 4W9ZA 3V4VL 4M5ZH 5DUBA 2EIMB 5HTSA 1U8QA 4JY5L 1JOIA 3KDMA 4XWOC 4DKDC 5HI5C 4TVPH 2YD1A 2HKLA 1NJ9B 3VXSD 1DBKH 3CCHA 4OKVB 4U7SA 4N2DA 4Y0GA 1EH9A 4LSSH 2G9HB 4F24A 4JFPB 1OK0A 1PZBA 3W5MA 3IWUA 1FZMB 2QPSA 5C09B 4GXUN 4OJAA 4EIGB 1RJYA 1S5HB 1TO5A 1TOXA 2AK4E 4AKQA 4W9IC 2PYFB 3P69A 3OMNB 2B0SL 5DWPA 1M7XA 4F57H 1T7ZA 3AG2B 1WZAA 5PCYA 3D0LA 5GGTL 3ERXA 4A67A 3RPIA 5B39A 1L5GA 3VXUD 4JUSA 2GYSA 2AQ1A 3UEZA 1EMTH 3S5LB 1B88A 4DAGH 4XC1L 3L3KA 3GZKA 2VO8A 4MA8L 5A2JH 1F4HA 3VFVA 3FQYA 3DHMA 3V0DA 3U9UA 3HB3B 4BH7B 5EU4B 5I30L 4P2RD 2GSGB 4OM1L 1X44A 1M7IA 3HG2A 3L16A 5I0DA 1PX3A 2QKSA 5H35B 3DK0A 1CN4A 5DXWA 3RJOA 3F6IA 1B0GB 4JEGB 3C5SB 5A1AA 4RZCA 2FH6A 4FNLH 2BVYA 3EBIA 1Q0XH 3GHPA 4JKPL 4XZUB 3V0HA 4B0MB 1G84A 1JGLL 3EZ8A 2AK4A 3JV4B 3CTTA 3JQOB 5J12C 4UYQA 5EZJB 3TONA 2OMNA 4A2MA 3HG0A 4TSBH 3TN0B 4YHZL 1AFVH 1OOWA 2APTA 2QLVB 3N1GC 2K8QA 1UTDA 4Z7OF 1NPUA 2G4EA 1PF3A 3UC0H 3OZKA 5TQ2H 1W8EA 1PY0A 2VOTA 2GT9B 2CBTA 5IHZB 1JUFB 2OK0H 2WBWB 3I2CH 3V4PA 3RPBA 3MJ8B 4QTIH 1SLXA 4J3OG 4XNAA 3CXHJ 3MOBL 4XVJH 5B7MA 1CFSB 5DD5H 4IJ3C 3O0RH 4GQQA 4E9SA 3OSKA 3ZTNH 1A6TA 4GKNB 4WCYL 3D4YA 2MEJB 1YDPA 1WIPA 3GI9L 3NIGF 5E1HB 5CF3A 2WP3T 3CPLA 4Q9QH 1RPKA 1EXUA 5FFGA 5C9KA 1BVLB 3K71B 4HIEA 3KPPB 1LWHA 1TZHA 2AQPA 2EO7A 4LSDA 5D2LB 3VX0A 3SPHA 3ZQ9A 1MCIA 1B0RA 2Y7QA 1IC5L 2IOOA 3A24A 3P54A 4GYBA 4Y9CA 4ZUSB 1A6VL 4R8WH 3OKMA 1S7VA 1G7LA 1ORQA 1IBGH 2JIXA 4BFKA 1H15A 4KTEL 1NQBA 2J56A 4P46D 1WIUA 4P8QA 5EFIA 4ZBJA 4F2MB 5GHWL 1A5FH 3EGXA 5ADOL 3REWA 4XPTH 3QCTL 4EN3D 3O3AA 5DRNA 4FFZA 1A65A 3JBG7 4WJ5B 2WP3O 2EIEA 1I3RA 3DROA 1ADQL 3DGCR 4F7EA 4NUGL 5K39B 1QG3A 4ZG1A 1BAFH 3VM5A 4AL8C 4P48A 5JHBA 2F53D 4HCRA 4Q52A 4HSQA 5D1ZC 4TTGA 8CGTA 2BY1A 3TWCL 4EZJA 3VI4B 4B9FA 4UF7C 5IM7A 5TGBB 3EKCA 2OJEB 2HKAA 4MNQE 4J6RH 4YSPA 1QO3A 4EI5C 1DLFL 3PABB 3FTVA 4UQ3A 3H54A 2OAAA 4CNIA 3GK8H 3AS1A 4KUCF 2YC1B 3PWUB 1BF8A 3MJ9A 4I0PA 1AGCA 2CHWA 4UDTB 2EE3A 4X4KA 2WTRB 3DSFL 5FO7B 4EOWH 2J6EL 5I0WA 1SOKA 1U21A 3FKUS 5A40E 4QLRA 3OWEA 5H2BB 1NCHA 3DI3B 1LO4H 4YHKL 1G94A 2LT9A 3HCVA 3JWDC 4M9OA 4LLYA 3U7WH 2AK4D 2LABA 4NUMA 4BE5A 1DQDH 5DSCB 1NA8A 3RY4A 5BXFA 3RIFK 1WQVT 2WWOA 1IBYA 4YDNA 2QBWA 3CBJB 2IAMC 5F7MC 4XAWL 4MNQA 1FYTE 2BSRA 2O72A 4R90H 1PD6A 4MQTB 4MNGB 3GSNA 1S7SA 3FONA 3GUFA 5J9PA 4YOKA 5F88A 5ALCL 2I9LA 3HS0C 2PKDA 4Q9RH 4PCTA 2Y5QA 4HEPG 1YUKB 3ARGC 4JQVA 3F83A 3WIHH 4A7VA 4GS7C 1QUNA 4FCAA 5FUCE 5DMJB 2KKQA 5ESQB 4AEEA 4HWEH 3LSOB 4OQ1A 1QLFA 1KCSH 1UJ3B 1QW8A 3P4OB 1T1ZA 2W9LA 3IKCA 4CW1B 1MIMH 1JP5A 5CLXA 3VXRE 1EAPB 1MHPL 4QUOA 1YEGL 3QHZH 4YBQC 3TGXA 4CUCA 1VFMA 3QNXB 5C0NC 2A1WL 2PR9A 1UJTA 4NHUB 3LDBC 32C2B 4KFMA 4ONHB 1TXKA 4HJJL 3ROOB 1FYTA 3IGFA 4LMQI 1EZUA 5FHAH 4XXDB 4HJGA 1JDCA 3IDYB 2R7EB 2NY4C 1T80A 1RIUL 4LLUB 1T89C 1FNEA 3E2HB 5TTRA 3X3FH 3Q5TA 2ZP9A 5B1JC 3C5JB 3DX8B 4G6KL 5HD8D 3RWCB 3F5WB 1E3FA 3Q8BA 4ZFFA 3WTSA 4MMZC 5E00B 3CE1A 1ZT1B 3QCVH 1D9KC 3QWNA 2EO9A 4G9FE 4M7ZB 2AKRB 4GQRA 4MD4B 3QIUA 1JHLL 1B9KA 3I50H 2J1YA 3M1BA 4AC4A 3R7QA 3MCYA 4F20A 2FT6A 2ZXGA 3VXRA 5JOFB 3BKCL 2EZ0C 1DQVA 3UADA 3R06A 1MCBA 3TBTA 3EOYG 4MTMA 5HGHA 4Q97A 3EFFA 2DWDA 2XWRA 1A0QH 3GEWB 3NFPA 3WLBA 5KJRL 1K3ZA 5A16B 5C0JA 4JFOB 5FF6B 2V2XA 1E65A 3MRFA 3EO9H 4HWZB 4UT6L 4XNUL 3BWAA 4NXSA 1JYWA 4I0PD 1OTSD 4HZLA 1UM5L 3T1WA 1EVUA 3L7FA 1PMYA 1UWYA 2COVD 1XSOA 5FV2A 1BD2D 3KYMB 4JVPA 5TK2A 2A74C 5EU7C 3GFUA 3BKJL 4G9FA 3DMMD 1IL1A 4DFHA 1PFCA 2QSCH 4JPWL 4OIAA 1SPDA 3DRQB 3BZDA 5G4MA 3NEOA 1Y6MR 3QXDA 2E27L 4N2HA 5JPNB 4OLZL 4GIOA 3U4BH 2XXGA 2XBTA 3QH3A 3UPRB 1MFEL 4CA4A 4PJFB 1HHJA 4Z0XA 3T1FA 3GBNL 4OLVH 3QUHA 3OXRA 3VFUB 3U1SH 1M4KA 5EEWA 1JZGA 3VD2A 2CKBL 3QQ9C 4HXAL 3LKPA 5HHME 2XQYG 3K8KA 1F0LA 1QSFB 3GRBA 3FB7B 1N8ZB 4U1LB 4FERA 1YY8B 4IQHA 4WFHE 1FF5A 4IRJB 4IKLA 4P49A 5ANMB 4ADJA 4CVXB 2EDKA 4MXVF 5D72L 4K4KA 4NO0A 3GUTA 1N5AB 3DPBA 3MBED 1YN6A 3O45A 5FYJH 2OMXA 4LDLB 3QG6A 1A22B 2DMGA 3M17B 3OKEB 4O5LH 1XH3B 3WNOA 4JO2H 3FCUB 3MX0A 5IW3A 4U6HA 1GSKA 1KBPA 2HFEB 3BUBA 3SY0A 1SMDA 4NQCB 1BIIA 2YK1L 2X0WA 1EUUA 4G6JH 3RYMA 4WEUD 1KGJA 1FG2A 4HMDA 4JBSA 3TCXA 5CD3A 4ZO6A 2XWTB 4X9HA 1D5XA 4PJHE 3BT2H 3KJ6H 1A4JB 5CJXC 1F4WL 1FCCA 2FQEA 1IV8A 2WO3B 3MRQB 1D5BB 1NEZB 1HXMA 5IW6A 1FZKA 2H0JA 5D2NE 4EDWL 2G2PA 4L9LA 5HYEA 4LCUB 2VXSH 3LS5L 1P4LB 1KN2L 2XZQH 2GAZA 3V4LA 4XCYA 2UZYA 5E7FA 2WXIA 3EYVA 2ZUQC 4ORZC 5DRWA 1GYVA 1QFWL 3ECQA 1R6VA 3RKDC 2VKWA 3TFKD 4KX7A 2W0FB 4NRZB 4P9HH 2XTLA 4GKLA 2MWCA 4Y4FC 4AQEB 1J5OL 3IRPX 2I69A 5HPOA 1MJUH 3QIWD 1XV8A 2RCSL 4GG6E 2DWEA 4KXCA 4PJHA 3FPXA 1UVQB 3GKWL 4APQC 3LY6A 4I9XA 3AXHA 2VDMH 1AQDA 5D2NA 1WD8A 4QRUA 2RBLA 5SX4I 2XWBA 3CZEA 2Z31B 1NCDH 2PN5A 4XOAA 3H9YA 3ZHFA 1H5BA 3JZYA 3MBXL 2F5AH 4X7DC 4JVUA 5J1AA 2GJRA 3G5XB 2EIJB 1PG7H 5D6DA 4N8VB 4S1QL 3VRLF 3UERA 1FNSL 3L45A 1ZIBA 2BDNL 3RGVC 4UTAH 4J8QA 4RAHA 2LLGA 3N42B 1BZ7A 3HZYA 4L4TB 4NBZB 1IARB 4UTBL 5IB2A 1BZDA 5GRWA 1DVFC 1MNNA 3WTUA 2H32B 2MH4A 3N40F 4IBSA 4DW2L 3MCKA 4OZFA 1YN7A 3HC4L 2ARJB 3TJEH 3UPCA 4EXPX 3ILPA 4PRIB 4NPYB 1PW3A 4HHAB 4YDKH 1J5DA 4KI5F 4GG6A 3OG6B 5FEBA 4PWIA 1MCWM 1Q1JH 2CD0A 4D0DA 4A37A 3RRQA 1S9YA 3LV3A 2OTUA 2QT6A 1J48A 1G6RA 4LOVA 3EOTL 4HD9A 5T3ZL 5CWSB 1JGDB 5C9JB 4A66A 2COQA 5L4MA 3C5ZD 3NP4A 4NO0D 5DK2A 4MS6A 3EJZC 3T0EB 1NCOA 3B2UC 3ZDZF 3LX9A 3MN8A 4H8PA 3BZEB 5A2BA 2J8UF 4BSWA 3CSBA 5T1MA 1NAML 3F58H 1BFVL 4AH2A 3OMZA 5DEFB 4RRPA 2W38A 1KCBA 2PWGA 4N5ED 4YDLB 2OSLA 4RAUB 4GRLB 4HETA 4FHKA 4GH7B 5DUMH 3BKYH 3SB3A 4NP4H 4X9FA 4R0LC 1VFOA 4JDZA 2G0LA 5EU5A 1R1CA 2WSPA 3GXDA 2AJSL 4I87A 4I77H 4JHZA 3SDAB 2K7QA 5E9DE 3B3IB 1UZ6F 2E76C 2CLRA 4I18C 5E2VH 2DQCL 3WJLC 5E51A 2A9DA 3JWOL 3IMBA 4WI5A 3N06B 1F3DH 2P5WB 4L1LA 1HWHB 4OCYL 2NSXA 2AABL 4GAFB 4PM1A 5SWZD 4HVBA 5I1CL 5ICXB 2F8XC 4TQPA 3L4TA 3T08A 5J57B 3NCJH 1U30A 4A6YH 5HYSB 1LHZA 1V8HA 4G71B 1A9EA 3DNKA 3QGVA 5I19H 4YPGA 2MNJB 2YD8A 4YXKL 1XD1A 3K80A 1LQBC 4Q4EA 1U58A 3JYCA 4CAGA 4KZDH 2HFFA 1USZA 1H6UA 1WCBA 2FH8A 3AQXA 4ZMVA 2FATL 5KSUB 4M1DL 1ASOA 2FCBA 1I3GL 4KXDA 1MLCB 2FBRA 5EG6C 5B7FA 3RUGF 4OY9A 1IO4C 2YUWA 5E9DA 4DPBX 3OX8A 4GUOA 2Y5TB 4N1CA 3QZWA 4FNPA 5IMKA 3FQNB 4X4YB 1ILUA 3ZT6A 5D7SH 4YO0B 3D07A 5AW2B 4AEHH 4IGBC 3BZ5A 4HDIA 3GLAA 2VMFA 4KITB 1RK1A 4Y1AB 3OKOB 3X17A 3GIVA 2DPKA 3ME0A 2J88H 1P5UC 3NGBC 5KTEH 4YHYB 2KC0A 4MCZB 4AYEC 3FTUA 2V2TA 4GBXB 4KKCC 4TSCL 3IPFA 2PW1A 4ZUVA 3MV9D 3V95A 4H2AA 2FD6L 3ARDA 1XGRA 4N28A 1W15A 1ULVA 3QPKA 2BW5A 4KO7A 3KD4A 4NM4L 3L1EA 4A2HA 2XA8H 1OP3H 4AV5A 2ARWA 2G3ZA 3QUKB 5I71C 5JQ6L 4KO9A 2BNRE 3O8XA 3W11C 1CF1A 3DJ9A 5C0RH 3IDJA 1BIHA 4M9PA 1UWEH 4LL4A 3BKMH 1E5CA 5DJYB 4UMSA 2HAZA 2HN7B 3TZVD 5D8JH 1PBYA 4Y16D 5HI4D 3SE6A 2MQCA 2P80D 4LCWD 3FRPG 3FCSA 4FFVD 4BZYA 2ICWA 4K7PH 4PG9A 1BXVA 3FO9B 2BOCA 1F8TH 4P4RA 1ZS8B 1KLFA 4XRCB 4HJIA 1KXQE 4EUPH 4RGOH 3KWUA 3OJ2C 1ESOA 3U4AA 4G83A 1ES0A 2Z91A 3LAFA 1ZLSH 3PNWB 2MCPH 1KYUA 2YXFA 1EEZB 5D7IB 3EGDA 5L7XH 1EJOH 3DJSA 1WGOA 3KLKA 5ALBL 1FNAA 3D8MA 3K5RA 3N04A 3MACL 1R75A 4XP9H 1YQ2A 2BNRA 2X0UA 2R69A 4JFEB 1K4DA 1JNLH 5CO1A 1CJYA 4HF5L 4MJ2A 3CVIH 4D8OA 1S7UA 1UFUA 3F7LA 4P3DB 1FH2A 4WHDA 4RGNE 1AR1D 3GTTA 2XPGA 5JLZB 5EOCJ 1D7CA 1IVTA 2Q9OA 4JHUA 2JKNA 4I2XB 3SKOA 1KXQA 4U6YB 5DZ9A 4XP6H 3FUHA 4I0KA 4ZMLA 4PCKA 1GJWA 1EVTC 4KVCH 4CADB 3M1OA 4YPJA 1G7IA 4NO5B 4BUHA 3IMUA 4Z7OE 1T0NB 4FQXA 3IDXH 4LMQE 3FSWA 4O58L 1DFXA 4U6XA 1VKXA 3O2DL 2JB6A 4CKQA 4G1MA 1VRSA 2XG4A 3MLSL 5CP7B 3QXWA 1JF1A 3EJPA 3C6LB 5EC2A 3VVWA 3ZLQC 4OZIF 2AV1A 2CJUL 2EP6A 5F6HJ 4ZK8A 2M26A 3TPKA 2VABB 4ANKA 3TL5A 1U4EA 1PYWB 1SRDA 4QLWA 5AW5B 4K94L 3U7YL 4J3WA 4PFEA 4DGYH 4MCYB 2FZ3A 4KX9A 3I02A 4X4XA 3ZE2B 5HPMB 3LN5B 2CPUA 4P3CL 2DI7A 1MFAL 3WJMA 2JJSA 1WDAA 5AOIA 4OFYA 4NM8H 5AZ2H 4AK1A 2DLIA 2GUOB 3FB8B 3QWRA 5I9QC 2CGZA 3BO8B 5DEJA 5T33H 5I0YA 2B4CC 2VSKB 1XR8B 2JH2A 1F4YL 3MCG1 4M1CC 3M6DA 3QEUA 5HHPB 1RV6X 3MRMA 5DDHB 3G3LA 4R96B 1BJ8A 2V0AA 3HHMA 1OP3K 1J1OL 1D6VH 4KMTH 4LL9A 3BP5A 1OAZL 3D39E 4O02H 3WN5B 4DETA 4GW5A 3ECVA 1YNKH 3G5YB 4QDGA 1QBLH 2BP3A 5FUOH 3W9DA 3BQUB 1KGCE 4ZPVB 4A2DA 2V5RA 4NAJA 1I7ZA 4HWBA 2UWEB 2VR7A 2R0ZL 5C0CE 1DQQA 1Q4NX 4WO4B 5EZIL 4KK9D 4PS8A 4UQ2A 5HXMA 3BE1H 5GJSH 2FJFA 4ZW5A 2F5BL 5JIKA 4JB9L 2R56H 3DURB 4BKLA 2VNCA 3JYBA 2AGJL 1CL7H 4FQ2H 3RZCD 3CMOH 5C0EB 3RDTA 2VC2L 2BSEA 4I0PC 2ATAA 1T20A 4MAUL 3WKYA 3BEWB 2GJ6D 3ML9A 2WLZA 3AITA 4K3DH 4WTQA 1MQKL 3C6EA 3M46A 3UG5A 1KIPB 2VKXA 3OKDB 5AWNL 4U6VH 3H2QA 1WE5A 4XOCA 2XV6B 1BF5A 3GJEA 3D39A 4WFFE 4X4ME 3LRKA 1UEYA 1LJMA 5K9KA 4DWHA 2EVJA 1BV8A 1R3IL 1MDTA 1UURA 5JMRA 4H8HA 1A3ZA 2X6UA 4LEXL 5D2LF 3LKOB 1S7RA 5C0CA 3X2QB 2NUTA 1KTCA 5HJDA 3U2SB 2NYYD 2LGNA 3T71A 5ADPL 5C0BB 2PYEB 5C3TA 1H3PL 3TVMB 5HDQH 4B7LA 2B1AL 2ADJB 4FLQA 2P5EE 3KLLA 2GFBB 1A6WL 4K7PY 4F7MB 3SQOH 5IB1B 1I8AA 4JQVC 4JPKL 2YOCA 4HYTB 4RIRB 3S4SA 1EUTA 2R2BB 3HBZA 5CXPA 3D87B 4DPAX 4B9PA 4PY8J 4MJ4A 2WUCL 5MEOB 2JLPA 2W88A 3RPKA 4X4MA 1ZHNA 2H26B 1LEGB 3QEGL 4MNHA 1E28B 1KCUL 4FNSA 4N25A 4K8RD 5FK9A 4FHBD 2Y06L 2PW2B 5EZOH 3L8QA 2GCYB 4OFYD 2VDKB 3KH4A 1CDBA 1YECH 3MLVL 4LK4A 4NENB 4DTGL 2WWMC 3QWRD 4YHIB 3ROLB 5FHBL 4BZ1H 5I76B 4CJ0A 2AJ3A 3JVFC 2XZAL 3BZ4A 4KXZI 2RGSA 3VNYA 3K4ZA 2JB5H 5DFVC 3VWJA 5L9DH 3DETD 2B39A 4D7PA 1Y1DA 2P5EA 1FLRL 2HUHA 4JM2F 2VAAB 1XCQA 5IIEA 2DL2A 2NY6B 3UZVA 5FUCC 4NN7B 3NCBB 2VDQL 3K81A 5IFJA 1G7PB 4MA7H 4HG4K 1N5YL 2IDTA 5GRJL 2OKMA 1AGFB 2YD6A 3BVTA 3QIUC 2EIDA 3E8UH 4UV7L 4MDJA 2XY2A 5IROA 4GP4B 4HBCH 1Y18B 3MQIA 3T0WA 4LNRB 1QKZL 3N9GL 1CD1B 3WIFB 1AD0A 4PJBB 4L5FL 5D1QE 4Q89A 2NY1D 4K3GA 1SHSA 4LCYA 3TEWA 1HILB 3HI5H 4OUUA 3ARSA 2WZPA 5FA3B 1B6DA 3LNHA 3DVNA 2E7BA 4N2MA 1U95A 4OJFH 2Z93B 1XGTB 3PGCB 4MRBA 1Z1WA 2FT7A 3EDDA 4BH8A 3W38A 2X1XR 3T3PF 3UJTL 1KNOB 3KJ4C 2JJVA 3ESPA 3NSDA 4NC2B 2G2RA 2WGXA 3QORA 3LRMA 5BVJA 4PJDF 3V52L 3WMPA 5EORL 2Z4QB 3D08A 4JRXA 4N90E 4X6EA 3TTYA 1J8HE 4JO1H 2B1HL 2PCXA 4DNLA 4NUPA 3W81A 3MMEA 1UXMA 2F2HA 1Q9LA 1R0AL 5D1QA 3QE5A 5D93C 5L2KE 2HKHH 2OW7A 3LKRA 1A2YA 1MF2L 3B8YA 5G55A 5AKRA 5JORA 4XPAH 3W2DL 4XVSL 1T7VA 3TESA 3KE0A 5LAXA 4ZQKB 3HBQA 1RVFH 1S5IL 4TULH 1SYSA 1B4TA 3L3IB 3MZTA 4OLXL 1FN4B 2BH0A 3LS4H 4QRPD 5AB9A 2LR4A 3WHXA 2Y2TA 1ETA1 1F58H 2XYBA 3H3PL 1OF0A 1ZVSA 3IGKA 1QSEB 1KPVB 5BMFL 1A3QA 2DLGA 3UYOD 2APSA 4N4YB 4KJPC 1F4XH 1WUNT 1NDTA 3VD5A 5MP6L 2VN3A 1Q72L 1J8HA 3IPEA 4NHCL 4WUUE 3E8VA 2XG5A 4GRMA 4X6FB 1G5GA 5KG9B 1EK3A 3JV6B 2GJJA 2Y22A 5L2KA 4QTHB 4FE9A 4HAKA 4FXGA 4ORGA 3MV8A 3QS2A 3MGOB 4ZMQA 5HDRA 1IM3A 4XH2B 2VM3A 4WQOA 4A63A 1DVXA 4HT1H 4L9LC 4LESA 5D1XB 1YYLH 2ODHA 2WINB 3TNNA 5IHLB 2E6PA 3GTNA 4ACPA 4K71B 1J05A 1TTCA 1EDHA 2E9WA 5CKAA 3RWDB 1RUKL 3SCMA 3NSXA 3I6GB 1PCSA 4I1PA 3MV7E 4L3AA 4QKXB 1RPUA 2VC2B 1LMKA 2XN9B 2WBJB 3NQIA 2IADB 1ET7A 3M88A 3QPXH 4DP7X 4OFDA 2PO6B 3NFSH 4WUUA 3S8GB 4RNRB 1DUYA 3BIKA 2ZAIA 2V5YA 4PJFF 4KMQA 2F1BA 4IEFB 4E9VA 3GBML 1RZKH 2WZPD 1KTKE 4G7RB 4JZJB 1FDLH 5E8EB 2D3LA 1EHKB 1SN5A 1ETB1 1N64H 4N8CL 1HYSD 5BJTA 5D2NC 2Y7SA 3O6FD 3V8CA 1F2QA 2RTTA 1H5BC 2JF1A 1CMOA 3N50A 4CGUB 4PEEA 1T4KB 5D6DC 3SKMB 2DI9A 1A3RL 4LVEA 3G6DL 3BAEL 2BHUA 4TTDC 2XFXB 2D0GA 3VRLE 5FB8B 1GOGA 4WDIA 3EYUL 3MV7A 4XB3A 2QDWA 5ACMA 3TBBA 3U9PL 3M8OH 4N0UB 4Z78B 4JRXD 4ETYA 2Q7YB 3AMLA 4G2AA 4HXBL 3IXTB 5IQ7L 4ZTPH 2DQEH 3K8MA 4Y5YC 2AMGA 2NUPB 3HPLB 1TYEB 2D9QB 3J2PA 3PL6A 4CMHB 3UO1H 5L88H 1AZCA 4UQ9A 5FA4B 1R9FA 2WWKT 5F7DA 4FTVE 5DZJA 3KVPA 4KI5E 1HSBB 3KXFB 4LP4A 4KO5A 4K5MA 3MRIB 4OLUH 4UUJA 5ICUA 1FLTX 1NEPA 2ZYIA 4WSGA 4XBPB 4KROC 3A4DA 3C6SB 3UYPB 4F7PB 3F7YA 3IE4A 2DBJA 1QLEH 2GEQA 3L1OH 4PHXA 1IC7L 1XTLA 2DZEA 1D5MB 4DUXA 3ZDZE 1MZZA 1H9VA 1ZKAA 5EHFA 1JD7A 1P6WA 2J8UE 2X4TB 5DQDH 1N10A 1FFOA 2AQ2A 3V6ZA 4RMWA 1FSKB 2HH0H 2WWKO 2FX7H 4YAQA 3F12A 4X5WB 4HS6A 1EXGA 3RWIA 1KOAA 4QHUA 1A6PA 2DM7A 3CHQA 3RY5A 1IC0A 1OCOB 2LVCA 4LPYA 5F3FA 3MV8D 2DJSA 4HGMA 4FTVA 4M1GL 2K4WA 4ODUA 1AXSA 4M6AA 4IRSB 3MLWH 2DEXX 2PR4L 3H42L 4HW6A 4D0BA 4G1EA 1JK8B 5IF0B 1UZ6E 1CR9H 4QHNB 5ICZB 2J2ZA 1PNCA 1IQDA 3GXFA 2OMZB 3D2TA 2BY2A 4P59H 4UM9D 1DL7L 2HKFH 2CRIA 4KRPD 1MHEB 4WW2A 1EEQA 5F89B 1QP1A 4GKSA 5BCAA 4F3FB 2H6PB 4HWUA 4M43L 2EUZA 2J8UA 2ALWA 3IJYA 3ABLB 1W72H 2X2HA 3N42F 4U1JA 1T66D 3GHEH 1G7MB 5DI8B 2OMTB 1H3XA 4MD5B 5CKGA 1MREH 5DS8B 1DJIA 1IGJA 3CFUA 3NJXA 1U41A 4NZDA 4R2GB 1CLZH 5KYXB 3GSOB 4Y4HB 3MXVH 1ZAGA 1U36A 2A9ML 3FTZA 4I1RA 2J25A 2A6IA 4X98B 4YX2H 5DMYA 2XTJE 4NQTA 5HVWA 2GY7B 1MQ8A 3VFWB 1OGPA 1QW9A 4XWGL 3LKNB 4HK0B 3VXMB 1T5KA 2VLKB 5K9QG 2PTUA 1P7QA 2ED9A 4GMTL 2WKGA 5B38A 5LGJA 3GM8A 3HKZA 1M9SA 3D9AL 4FQIL 5HGDA 1TSHA 2C9AA 3ATFA 1IU1A 1EHNA 1THCA 4G72B 1KXVC 2XQYK 1RZJC 1NC4A 3FPYA 3RVUD 4ZUUB 1A1NB 3QO1B 4U4BA 5E5RB 1UWGL 5TE4H 4Y8AA 2X6VA 1NDMA 2H8PB 1A4CA 4E36A 3CDZA 3AVEA 4OGAC 4ZX4A 1JNJA 4P3WA 1E5ZA 1YUHB 2E9GA 1XGYH 1RUPH 2JKWA 4IIQB 3ARDC 3WTXA 4F80A 3QUXA 3R1GH 2EDRA 5GJTH 3RWJA 2C1OB 4K3JL 3LZRA 4AENA 5MEQB 2IQAA 1LE5A 3MLTA 5LUMA 2P45B 3G7TA 3NG5A 3G08A 1GIGH 3VD9A 2YMOA 2BFVH 4UNVA 4P2YA 5I6NA 1GS8A 1S7QB 5IK3A 3CLFL 3K6IA 1QX1A 2QGBA 3O8XC 3UJIL 4TS6A 3FK3A 3QDJD 2V7NB 4KRLB 3W56A 5J6GA 1E9PA 1V7NL 2FJGB 4MA1B 1SVZA 4B9ZA 2OP4H 4P23B 2P52A 3X12B 4AW4A 3MHZA 4PJAB 1VEMA 4PU2A 1PEWA 5F0JB 5JIDA 4S1DC 1EHLL 4Z7WB 2NY2B 3JZ7A 2A6JA 3DWTA 1I7RA 3O4LD 3OLIA 3FU7A 2YGNA 2DQFA 4FZEH 5CD5C 3ILEA 1FGVH 4K5LA 1MCWW 4QRTB 5CNHA 5LKNA 5CFAA 4YDIL 3MRKA 4IDLA 4U3CA 1N6VA 1AOHA 1CLOH 2HFGL 1W6LA 3K72B 3D0VA 4KHXL 3DUUB 5GGRY 2IDFA 5GGSA 5J11B 2BJMH 4IRZH 2P44B 3L7EB 3CBKB 4K9JA 1G5AA 5F9OH 3MFFB 3T0XA 3ZHLA 2H3XC 3HBGA 3VTMA 4BELD 2CDEB 3EJCA 4JANA 3BSZA 2CIIA 1X9LA 3V0VB 3A6OA 1M57B 1EZVX 3PP3H 2ADGA 5HDBB 1MW3A 3MRCB 1T0OA 3OHXA 4K8RH 2EE2A 4L2YA 3KYKH 1P5VB 2DI8A 5DQ9A 4FA6A 1KN4H 1XH2A 4O9HH 1DBML 3EH1A 4M6OH 3SIKA 4QEGA 1NGQH 1J9TA 3CN4A 4YE0A 4XVTH 1AGBB 1WAEA 4RFNB 3V10A 1FAKT 1P84J 2O5YH 1IAII 1MPAL 1FFPB 1RSYA 4JZNA 4MJ5A 1TKWA 1NCWH 4JFZL 3QUMB 3IMTA 5IKCB 1DJZA 1NOFA 2CO7A 1OOAA 3QIBA 1RUQL 2NXZC 1KJ2H 1K4CA 4QWWD 3FT4A 3S48A 5J8OA 1C1EL 2AQRA 2WZ5A 3BUYA 3LQZA 4N2CA 4FQXC 3LZPA 3G5ZA 3PQYE 1FIGH 2OMWA 1U8IB 3BPCA 4BFGA 4L4VE 1NEUA 3D34A 4M5ZL 4ZMAT 1I8MA 1RJZB 1D2PA 4DN4H 4TVPL 1JZ3A 4NO3A 1NFIB 4IU2A 4OZIE 1DBKL 4XPGH 4NB7A 3FB5A 1YQVH 1NGXB 4RGNC 2QADD 1SDYA 4YHPA 5BV7L 5DA4A 2C9XA 5IQ9B 2NMSA 1JRHI 3PJNA 1NLBH 5F2FA 2OYLA 3KPMB 2AI0H 5FYKU 1ZLDA 3UBXB 4F57L 3O11A 2JJSC 4W1TA 4OV5A 3SPVB 5I1EL 5D7IF 5DJAA 4RGMC 1YEIH 3PQYA 5DC9B 1VB9A 1AIFA 5D7KD 5DEZA 1EMTL 1NUDA 3T8XB 1J10A 4DAGL 2Z7WA 4L4VA 1T83A 2QVIA 2NCMA 4URKA 1M6UA 2H0FA 1A4AA 4DKAA 4N2GA 3TIEB 4PUBH 3VB8A 1SJEA 3IU4H 4OZIA 3BIBX 1RI8A 2G9HA 1KGIA 1XB3A 4G7YL 2EDNA 1FVCA 4KKLD 1R3LB 4N2LA 2OJZH 3W0WB 4FNLL 2OCJA 1Q0XL 2FLRT 2YXMA 3DVGA 3H4FA 2KPNA 3ZL1A 4XI5D 2QPFA 2PYFA 4FNUA 2GTZB 4S10A 1SJMA 4GSQA 3QULB 4HIXH 1EZSA 2YMXH 1ZWIB 4GXUM 4TSBL 3IGAA 1UKSA 4QRRD 1HE8A 1LK3H 2CR3A 3ML8A 3UAJA 4KPHH 1KGUA 2YJQA 3UC0L 5TFSH 5CEYB 3BGFC 2E4TA 2NX5D 3RDTC 5I0XA 2DM3A 5HYJD 1KB9K 4M61A 1TT6A 1O6TA 1YAZA 4F58H 2Y7MA 3FZUC 1A02N 2OK0L 1JGEB 3QUZD 1NGWB 4G80B 4EVNB 1D3CA 2GSGA 4QTIL 5AVWB 1FZJB 4PB0H 1OCZB 4P9MH 5TDPA 3O41B 3KLSA 4XVJL 4OVUA 5DD5L 2VH5H 4P5MB 4AZUA 3N44F 3O0RL 1A7NL 4G5AA 5DHEA 3GXMA 1T0MB 1B0GA 2Q6WB 3ZTNL 3C5SA 1GZPB 2H2SD 4MB3A 3INUH 3A21A 2X6BA 1S3KH 3PP3K 1J5IA 4P5TB 2M8XA 4GEJA 4G43B 2JJTA 1DSFH 4EBQH 5LBGA 1KEGH 1DQJA 5D2LE 1JIBA 5JO5B 4CL7A 5JZ7D 5EZJA 3IRCA 1KLUB 3IFOA 2EKJA 1FL3A 3ARFA 3ALWA 3NJLA 4R8WL 5GZND 3SGEH 3TN0A 4PR5A 5LCVH 3VGDA 3GHBH 1IBGL 3WGVB 3A67L 3D85D 1CICA 1RH8A 2EKSB 3CFDB 4UINH 4UOJA 5H94B 3B3BA 1JUFA 5E6RB 2ED7A 2Q3XA 4YGVA 4XPTL 1PVHA 2HX9A 5HVGB 3X1NA 3IM1A 1HK6A 2IPUK 4Z7QB 4YDJB 4GKNA 2Z4TA 1TJIH 3BHBA 1NWOA 3WBDA 1PU0A 1BAFL 4PYGA 3ULUC 3I6SA 4F15C 4PJ8B 2WIIA 1SDAB 3K71A 1F13A 2PWEA 5MERB 4OR1A 4HC1L 2VXTH 4PJ7B 4ZFOL 5D2LA 1VA9A 3VI4E 2PPAA 3CPUA 4GI8A 1DDHA 3D6GA 4R7DB 4E9WA 3VWJC 5I5MA 2W9EH 1P53A 2DWXA 1FO0B 3TF4A 1UD5A 1YVLA 2ZJSH 3BD4A 2WIMA 3L4UA 3LCYA 1ZGLA 2FWUA 2Q2EB 1ONQB 1YEDB 4BKSC 4XO5A 4WJ5A 4AZ8A 3BLKA 1NKGA 1TQBB 2FIKB 2FWLB 4GKZA 5IROC 3VFPB 1LO4L 1T03H 3VW3H 1OM9A 1OT2A 1RZGA 3FHAA 3U7WL 2PPDA 1O9ZA 2HVJA 4DP2X 4H8QA 1DQDL 4ZW8A 4DQAA 4MJHA 2FBOJ 4JJ5B 2J20A 3GMPB 1I8LA 2VDLB 5I1GH 3HZMA 2EXWD 2VM9A 4LVHC 1RY7B 2DM2A 1CXEA 2VB5A 3O6KH 3PHOB 4JDVB 1ZIAA 4R90L 2YA1A 4MNGE 1TTFA 4LFHD 4ZS6C 5AW6B 2ROYA 4JM2A 1GAFH 2G2NA 4Q9RL 1KPUB 3BWZA 4CGTA 5T3XH 3FRUB 3GSVB 3T3PE 5EBLB 1ORSB 4UDTA 4PRPB 3D2UD 5AKVA 2WCSA 1KIRB 1OAQH 2WTRA 4U33A 4AOFA 1UYWH 1OB1B 3QORC 4HMCA 4FJ6A 2BNQB 4HWEL 4PJDE 1NMAH 1KCSL 3BUTA 1FZOB 1OB0A 3TPUA 4OLWH 5ITFA 4PJXF 1MIML 5DSCA 2WMPA 3BZFB 5J12B 5KZCB 5KVEL 3QHZL 4X7FC 5D1QC 5E2WH 3RGHA 2RAMA 1WK0A 1G43A 2D3JA 3B2VH 5C08D 5BV7B 1NANI 6FABH 3Q43A 4G8IA 1MCPH 1CICD 4IW4C 5ID1A 1EPFA 5E99H 2CUMA 1D7DA 1MJJA 5FHAL 1IFGA 3ZDYB 3R0NA 4OCWH 3FUNA 3ZZLA 4AQAB 3X3FL 1ZV9A 1KCWA 1S7WB 3GJFA 3VFSA 1AGEB 3BP4B 4A2GA 2EVGA 1SHXA 1JVLA 4WFEE 1LDPH 5ESQA 3V4VA 4Z8FH 3FTYA 3QCVL 4PJDA 3KYNA 3P4OA 3ULSA 3BP7B 3RI5K 2DV6A 4QTFA 3PLYA 4N2OA 2EEFA 4YHNB 4DP5X 5F7NC 4C83B 3BVVA 1SGKA 4JZOB 3DRTA 4LGPB 2V2WA 4NHUA 2WXGA 4FXGC 3U46B 3I85A 32C2A 1CGWA 3ZMNA 1X4ZA 5C07B 1A0QL 5I1DB 3CGTA 3Q5OA 5GS0D 1R4XA 1WBXA 4XXDA 5JOPD 3SYAA 2IO5A 3EO9L 4LLUA 5GGTA 5IQLA 3CDCA 1N67A 3C5JA 3KCWA 3LZNA 3EHBD 1WRFA 1BM3H 1UB6A 1ZLEA 2G5RA 3SCMC 4KKZA 1BLNA 4DCQB 2LU4A 5DVLA 5CN3A 1P0SE 1ZT1A 3TC9A 2B2XH 4KKBC 3CXHK 2AKRA 2QSCL 5TE7H 2FEEL 4L0YA 4NCC1 1AS8A 1MRFH 4NNPH 2D0FA 3CVHH 2ATKB 1CI5A 5LNEA 4P4KA 4PJFE 2B3RA 5ENWB 3SJVB 1V7MH 4OLVL 4LZKA 2R9HD 4TUJB 3U1SL 3U1PA 2DQTL 3VDBA 2WYIA 2BSTB 1CD8A 4JM2D 2M1KA 5MEPB 1RK0B 1QSFE 4FLOA 5DHVB 5B4MD 3KPRE 1CTMA 1T04A 3FO2B 3GSQA 3AG1B 3ISWA 4WNSA 1IGML 5ANME 3TEYA 4AIZB 1YC8A 1QBMH 2HG5B 3F64A 4OZFG 3MRLB 4YS4A 3QHFH 2X4PA 5IT2H 8FABA 5DFTA 2WQ8A 4LGSB 4YSCA 3EF4A 4KKQA 4O5LL 1WS8A 4JO2L 2VDNH 3EO1A 4ZDHB 1SXZA 1IX2A 1Z6JT 3PL6C 3Q01A 3TBCA 3DGDA 1YJDH 1HC1A 5AW9B 3N43B 1OWRM 2R4RH 4OD2A 5E5MA 4PV1C 5IJVB 1NBZA 3C09C 4PJFA 3NCYP 4G6JL 4MLSA 2VDPB 3REVB 4AT6A 3SY6A 3VFUA 4J3XA 2GC7C 4HUWA 5D7HA 3KJ6L 1WF5A 3HS0B 2A6KB 2F54B 3FOMA 1KYAA 1QSFA 1GZHA 3FB7A 1N26A 3KPRA 4HCIA 3B9EA 2K3HA 4OW6A 1YY8A 2BP5M 3KH3A 3SKJH 2YGPA 1HXYA 3F7KA 4GS7B 4JFYB 4IRJA 3L3HB 5EUKB 5GPRA 3BMWA 3P77B 2VXSL 5ANMA 3HIZA 1PLGH 4RRPG 2XZQL 3BX7C 2ATPA 4FCHA 2BY0A 3D05A 4N24A 4ZAKA 2GQHA 4S2SB 3HPJA 4FLHA 3I6LE 4O2EA 3L1FA 5I18H 3GMLB 3IDNA 1W9XA 3BVDB 4ZOBA 1CQKA 4ONGH 1J8KA 4P9HL 1OEZW 1N2RA 4KKAD 1ADQA 3LDBB 1K8DB 1A9VA 2OW6A 1C7SA 1UGKA 4KI5C 4A55A 4PJ9D 2XWTA 2X70B 2ALAA 2NY4B 1UXSB 3BSHA 3MUUA 1A4JA 4JO3H 2ZNXA 3ATEA 1D5BA 1NEZA 2VDML 4JHBA 4D9RE 3PWPB 2R2HA 1YNTB 4PTTB 1QAWA 3KPLB 1I1RA 2OMBA 2RFXB 1NCDL 3RA7H 4C56D 4L18A 4WW2C 1OSEA 1GGCL 1P4LA 1WYJA 2F5AL 2PABA 3AUWB 4MMZB 5DHYA 1BBDH 1TETL 2LFGA 1AQMA 2R2EB 2C9SA 4UTAL 1YMMB 1TENA 3NA9H 5I6XC 2E3VA 1CDJA 3ZQXA 3FQXA 2JWYA 4Z7NB 1A7RH 3FTXA 1OAXH 1BEYH 2F19H 3T3MB 3TBVB 4E9QA 3ARED 2J6EA 3UTTB 3QZWG 3TJEL 4LZHA 5JIMA 2HCZX 1WGVA 2VLJB 4QWWC 5E8OA 5C6TH 4F8OA 1Q9KA 4GIPD 3RLSA 1Q1JL 4XCEB 3KGSA 3FH7A 3VGAC 2O5XH 5IMOA 1SXBA 2VITA 5EU3B 2ZOLA 2FR4A 3RTQA 5ESAB 4YR6A 5DC2A 3FU8A 4W9EC 4H8WH 4RMBA 1MOEA 1MFBH 3T0EE 2A74B 2HUEA 2YD3A 1ZPLA 2D7QA 4U3HA 5HI3C 4AMWA 2YPKB 3N85H 2ZCHH 2ZP8A 5E56A 5KSBF 1P2CB 3L4VA 1YHPA 3RHWF 2W07A 4NO2B 2IOIA 1J0JA 3BWUF 3F58L 2X10A 1QRKA 1RHHB 4DEPC 1ZRUA 2IDCA 3NCFB 1IM9D 3QUXC 4M5SA 4AE0A 5DUML 5DURD 1FQ9C 1KBBA 4K7FB 4F37F 2XTJC 4NP4L 1LD9A 4NPYA 4MB4A 1RQ5A 4I77L 5CEXA 3KPRD 3L17A 1XZ0A 1JZDC 1SVCP 3MA7B 1UKTA 3HR5B 4TYUA 2QQLH 5HVFB 2XTSA 3HI1B 4BKTC 5E2VL 3FYEB 1EGJH 3ZK0A 3HAEB 1EZVY 2P5WE 2NQCA 3SN6N 2UXGA 4YHOH 3T0EA 4ZAKD 3G04A 3AACA 4KK8D 1X5FA 4AV4A 2I07B 4JFTA 4WENB 4JMNA 1LGVA 1YLBB 1LM8V 1J87A 3OB0H 2EYRB 4ELMB 2GSIB 3NCJL 4HUXB 4D9LH 1JPGB 4A6YL 3CJJA 4X7TB 1L7IH 5I19L 5IB3B 3C08H 2YKLH 4RAUA 2BSBA 2ZWNA 4KZDL 3HG4A 4HIJA 1QI4A 1AZUA 2RD0A 5HY9B 4FMFA 1AQKH 2CZNA 2YR3A 3ZO9A 2VRKA 4PJCB 3SDAA 2BERA 2IQ9H 4BQBA 5LHDA 3FQ4A 3NJHA 4X99B 5DQJA 4EPSA 3BDYH 2IWKA 3IU3B 4BGLA 2CBPA 2HZHA 5D7SL 5F7LB 4JHVA 2E7DA 2C1PA 4AEHL 4WW1B 2DKUA 4BIKA 1IAOA 3OHXC 4HA1A 3RBGA 2V9TA 4UT6A 1E50A 4LARH 1I1AA 2B9BA 2J88L 1BPVA 5KTEL 1UUNA 1HQ4B 4GQZA 2BS8A 1P7HL 1I9IH 4GPVA 4V33A 2IBZX 4Y4FB 1I82A 2WQXA 1QMUA 3UTZA 4DVBB 4AW7A 3MROB 3QIBC 4X0NA 2YBRA 1LWRA 4AGMA 4U1SA 2FGWH 3WSQH 5JZ7C 4APQB 3NYKA 2Z8SA 4XBEH 2YUVA 3O81A 1QR4A 4QO1B 4D0CB 2XA8L 3RTQD 1ZMYA 2MKLC 2Y6TE 1EHXA 1AHWB 4ZMYA 4OF7A 4S0TD 3QR0A 4YO0A 5F71A 2CKBA 5DJXB 5F7KC 1UWEL 3BKML 2AW2A 2NW3B 3OC8A 2X4QB 5E95B 2CWRA 3OKOA 5EO9B 5J06A 4Y5XA 4TPRL 3O3BA 5D8JL 5T5NF 3WEMA 5E6ID 4K7PL 4LO9A 1MUJA 4E0RB 4GBXA 5BRZE 1F8TL 2ILLA 1T5XB 3IS1X 3TCLB 4RGOL 1NGYB 4AI7A 1AXTH 1QA9B 1G7QA 3L54A 4UAHA 1EZLA 1INQA 1O75A 3QJFB 2FB4H 1ZLSL 1NCTA 5D6CB 5EBWA 5D7IE 3UH8A 3SBQA 1XGZA 3P40A 1VZHA 5IG7B 3WV0A 1JV2A 5L7XL 1EJOL 1KC5H 1T83C 3GB7B 3SDXB 3BAKA 4MQ7A 3W37A 4MSWB 1JNLL 2VDOB 2MMXA 1KLGB 3SGKA 2A77H 4PV9B 2BRQA 2D31A 1TZGH 3AQDA 3CVIL 4WEBH 4NZUH 4ZFZA 3GMNB 4MAYD 2R1XB 5CJ5A 4U1GC 1TUPA 2PPFA 3WIIL 4H13C 4IHOB 3H9HA 1RFDH 3IFNL 1JGVH 1IGIH 1OARH 5TJWK 5BRZA 4XRCA 2BCKB