4HUCA

Crystal structure of ldtmt2, a l,d-transpeptidase from mycobacterium tuberculosis: domain b and c
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
261
structure length
261
Chain Sequence
MAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of LdtMt2, an L,D-transpeptidase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords PROBABLE CONSERVED LIPOPROTEIN LPPS
total genus 70
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4hucA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hucA01
4JMNA 1ZATA 4GSQA 4XVOA 5DCCA 5K69A 4HU2A 3U1QA 3VYPA 3TURA 1Y7MA 5DU7A 4GSRA 2MTZA 3U1PA 3TX4A 5DUJA 4K73A 4A52A 5DZPA 4QRAA 3ZGPA 4Z7AA 4ZFQA 3VYOA 4JMXA 4LPQA 5E5LA 4A1JA 5DC2A 3ZQDA 5E51A 4LZHA 3ZG4A 5DZJA 5DVPA 3VAEA 3VYNA 4QR7A 4QRBA 5D7HA 4QTFA 4GSUA 5E1IA 4HUCA 4A1IA 5E1GA 5LBGA 4A1KA 5LB1A 2HKLA
chains in the Genus database with same CATH superfamily
1CN4A 2FWLB 3FRPG 4X6FA 1XMWA 4RCAA 4Y16A 3EYOB 3CVHL 3FUIA 4WUUD 5DRWB 1PEWA 1QATA 4AIEA 1D5MB 1F4XL 2O26U 3HNSL 4FYSA 2HRGA 4ZX3A 3IWUA 5D2NE 1VLXA 4LPCA 1T04A 3VRJB 3QZLA 4FQJL 5ADPL 4DK3A 4KY2A 4FFYA 1AP2B 3CFMA 3LZFL 1NFDF 1TYEB 1KCSH 1UZGA 4CVZB 1YPZB 3QRGH 4XB3A 4X4ME 3RBGA 1IBGH 4OVVA 5F7HA 1WZKA 2DYPB 2MCAA 3VA6A 5GISL 4J23A 3CZUB 43CAA 4BKTC 2G3NA 2WN2A 3QUMA 4LAJH 1HHHA 1WZAA 4ODBD 4D3CL 5HYFA 1XMEB 4GUPA 1OM3L 4O02A 1UTDA 2X89D 5KAQG 4PG2A 1MCKA 5DHVA 1OSZB 3V79C 3KR3L 4GP4B 1FNAA 5MHSD 1WF5A 2UXGA 3MRMB 4IGBC 4R96B 5I76B 4YE4H 1DP0A 2IJ0C 3M07A 4FQXD 4QAMB 2RGSA 4UOQA 5FYKU 1HH9B 1OPGH 4PBWD 4V11A 1W8NA 1DFBL 3T2NH 3VYPA 1WBYA 2M8XA 2HYMA 1TETH 1JPSL 2WUCL 2ZKWA 4J1UA 4QGYA 3JYCA 4JANA 4BYHA 5I18L 3GXMA 3IETB 4GT0A 3D0VA 4XP6H 3TBBA 5KTEL 1XR8B 4C83A 4IRSA 2VLLA 1JGVH 5I8OH 3EF4A 1BJ1J 1WC7B 4YDKL 4UINH 4BUQA 1ORSA 2ADYA 2FZ3A 3RDJA 3RWIA 1ICTA 2DLGA 3M17A 2V5MA 1H6EA 5MEPA 4MYWB 1G7QA 3QCVL 3PG2A 4HHAA 5LB1A 2FX8L 4JPVL 5DHMC 4EKJA 1ML0A 4MMYB 4F2MA 2HTLD 5FYJL 5FUZH 3SGKA 3LZFH 2D0HA 3AXLB 2JTYA 4X99A 2C7UA 3P9WB 1GYWA 1U95A 3CC5B 3B43A 1KIPA 2OLDA 3BZEA 4KZDL 4P48A 3KL3A 2OXGB 1TEFA 2P5WD 3MV8D 4FKEA 4HXAH 3RX5A 2JJWA 2OMVB 2P46B 3CFKA 1J0KA 1CE6B 5I1CL 5FK9A 4RDQF 1F2XK 1HWHB 1T1YA 4UOW1 1BVKB 1IBYA 1U21A 2VWEE 4FFWC 4AYGA 2F2HA 1SEQH 4PJGA 4X0NA 1JUFA 4LDOB 2UZPA 1DJZA 3EGSB 3FTVA 3LEYH 2FDBP 1TNNA 3QORC 2C9QA 2EYSB 5F1OB 1R6VA 2KS0A 4A7SA 5L7XH 1S3RA 3V5HB 1U8OB 2XHNA 3V4LA 1JJUA 2D2CC 2N1KA 2ITFA 2E86A 2JCCE 3IJHB 3QORA 1FP5A 2FLMA 2C9RA 2O30A 1G7MA 3CPUA 4DZ8B 3GXUB 4MBRA 4AE1A 5LKNA 4A7UA 1PEZA 4NQDB 4UOJA 3VWJA 4FTVB 1CGYA 5GHWL 2F19H 4N2LA 2DWEB 4JQIL 4FD0A 4AYBA 3RVTC 2HRHA 3S5ZA 5HHOD 2NY5L 2QADC 4PB9L 1YEIL 4N0CC 5LVEA 4U3CA 3T4YB 3MV9A 2UWEE 1KBPA 3IFOA 3RPIB 2YK1H 1G7JA 2XG5A 2VN4A 4TQEH 1J1XL 1P7QD 4NQEB 4OGXL 1SVZA 5BVJB 3U7YL 3I2CL 3KPRB 2ZSWB 2M26A 4P59L 4A67A 4LOFA 1AY1H 1RUQL 2AJXH 3PWLA 2QQNL 1CBVL 1FN4B 5LXGH 2CLZA 5KSUA 4QRPD 3D9AL 1E28B 1NGYA 5LCVH 4BFKA 3V6ZB 3MBWA 3D87B 1O0VA 3BJLA 3BZFA 1BZ9A 3QPKA 4QCIB 5FGRA 5D96C 4EDWL 2AEWA 3OLGA 2UXFA 1WA2X 1MCNA 5GGTL 3WXWH 2CBOA 4PJCE 3EOBA 3HC2A 5D6CB 1OCZB 3ETTA 4PAZA 4YVNA 3E80A 2YAFA 2VL5A 4P3CL 1R19A 1P6WA 1EFXD 3RY6A 1OF2A 2VRKA 4RESB 4LPQA 2QLYA 3BD3A 1MY7A 3QIBD 3C5ZC 4U1GB 4ZUSB 5DZJA 5KYWA 3P9LA 5EU6A 1JZ4A 5D2NB 2XWTB 1OOAA 4LARL 4Z7UA 3REVB 5IQLA 2XZQL 1GY2A 2JJSC 1CF8L 2N7AA 4I2XA 1QFWM 1J0YA 2GJ6D 1KTCA 4D2NA 3CFJB 3F5WB 1NAKL 4URKA 4MA1C 4O02H 3PWPE 1G6RA 2Z8WC 5GGSB 2EKSA 3ARRA 5L2JA 15C8L 5F96H 1Z0NA 1E30A 1IIKA 3IJSA 3MYJA 1DQDH 1X5IA 2A9CA 1N6VA 3CFIC 2FGZA 4WGVB 5AWNH 2CUHA 2VDNL 5D9SA 4MMXB 4PJDE 2JQMA 1MCPH 5GGVH 1QRNE 3LH2L 3STZA 1J8HB 2VLJB 1OTTD 4PM1A 3OKLB 4QGTA 4FERA 3SE4C 2JE8A 4LSVL 4W68A 4AXWA 4XPGH 1YNKH 4PI0A 2WLLA 1JXJA 2LT9A 2XY2A 2XG4B 4GXFA 3D85D 3WJLC 2KZBA 1DE4B 1HH6B 4IYKA 5FYLE 2FIRT 4AEFA 1SRDA 1TZOA 4F7CA 3TBYB 1L3WA 3CPLA 5B21A 4JPWL 3HVNA 3HG1D 3MRHB 4ZAKC 3K4AA 4XNQA 3UTSB 1FIEA 2DMKA 1MAMH 1JHKL 1BCIA 2DEYX 3RVWC 1MIEL 5AUMB 4DGUA 1GGUA 4IBWA 2HLFD 4B7LA 4PSPA 4I3SL 3S3SA 1MEXH 4DVBB 3PIQA 5A6LA 2NYYC 1NGWA 2FH8A 3FN3A 1OPGL 2BVQB 3OJDA 3C6LB 4C4UA 3OB0H 4O2FA 1F4AA 1OD7A 5D1ZD 5LLIC 4LL4A 2E27L 1JGLH 1QFPA 4IOSA 5AW4B 4PJ5B 1CICB 3KR3H 1KBGH 1RY7B 4A1IA 1G9HA 4ZFGH 2WQVA 5T3ZL 1PZCA 4YDKH 3S3BB 5I8OL 1SLWA 3UGXA 2GJRA 3ARFC 1JZGA 3BVTA 1FJ1A 1MI5A 2WY3B 4LO9A 2QDWA 4G6ML 4LNRA 1JPSH 1YRKA 3OJMB 3RHWK 3WLWC 1T80A 4XN8A 2R15A 4QTHB 3ZGIA 2QR0A 2AITA 5I75C 4OZIA 1WAEA 4AITA 3ZKQD 1NJ9A 3SDDA 3KYNB 1PF3A 2V0AA 4YE4L 5CCHE 2Y69B 2FT6A 3LDBC 2GW5A 3K7UA 1AS6A 3MLZH 4L8CA 3B37A 4GI6A 2TSAA 2OQJA 2VDQH 3FQ1A 1DJIA 4P4RB 2AFNA 1RSYA 4PBVC 3L54A 3SN6N 2VAAA 2AI0L 4NUGL 2NCEA 2PCXA 2FHCA 2VDNB 4Y19A 3WNKA 1N64L 1IQWL 1NMAH 1RK0B 1AMXA 4CMMB 4G8AC 4PJBE 1I53A 1A5FL 4PCSA 4F80A 5IHHA 4IHOB 1IBDA 2BK8A 4E9XA 4UOW0 2OSWA 4AWJC 1YECL 2A73B 2HVBA 3WFEH 3QIUD 3QNZB 1XL4A 4HJJH 4E9VA 2WTOA 2ZWLT 1JE6A 1HWWA 4A1KA 1I1AC 3MYZA 2FB4L 1E2VA 2CO7B 2Z93A 5JHLL 1FIGL 5DZ9A 2YEZB 1A5FH 1UENA 3QCVH 2ESVE 4HBCL 2V2TB 2VSCA 5DLMH 2BZCA 1GH7A 3N1QC 5DVMA 5EV7A 3H3PH 4GXVL 2ZUSA 3QDGA 4HD5A 1B0RA 4DZBB 3D4ZA 4KROB 4GRWB 4P2QB 5I1JH 4ATTA 3G6AA 2V5SA 2R1YA 4PG9B 4F57L 4IOFD 1A7RL 3T65A 1DSFL 4HCRH 5E8DL 4CAGA 3PE9A 1NKOA 5I1HH 3WIFB 1XGQA 4HCGA 3RVVC 5DO2C 1PLGH 3F6LA 3FTGA 3RI5F 4DESA 3OKKA 1CDIA 4U1KA 3MBXH 5IBUG 4JS7A 4UV7H 5LNDA 4JKPL 3WFHB 1TKWB 4JHUA 1TITA 4I89A 5E9DA 4WJKB 1G0DA 1OP4A 3AXLA 4P46B 4WO4A 3HFML 3ETSA 2ZUXA 3BZEB 3OJ2C 1SNRA 4Z0BH 2OKMA 5ACLA 3ZRSA 3VI4B 1KGCD 3PRZA 3NFNA 4K3JL 5G4OA 1GGBL 5E5MB 3RLSA 1T21A 4LLWA 1TTBA 3JT0A 5K9QI 3BWSA 3HN8A 2EDLA 5HYJD 1S7XA 3NGBC 4HJ0C 1Q4NX 4KZCA 4P5MB 2E7LC 1MREL 2O61A 4QCIA 4AEHH 1D2PA 2YD2A 1WITA 3ZHLA 3V5HA 2WK2A 3C9NB 1M71B 2X2YA 3NP3A 1T0MA 2PETA 4YDVB 5IVZB 2NPLX 5C3IA 1I7UA 4PLOB 2VL5B 2VJXA 2JKRM 4N3TA 1T20B 2JKNA 3LQZB 3QUYB 4XPFL 5D7KD 3HMWH 3LN4B 3OKEB 6FABH 3VI3E 4CNIA 5D2NA 4ZMTA 5E6IB 2O1AA 1IEAA 4YO0A 5EBMA 2LR4A 2YD8A 4HH8A 4ZUUB 1SPDA 3KLHC 2CO6B 2A1WL 3UPRB 1R3JB 5K5YA 4GNKB 5C09D 2HWZL 2WZPA 4B50A 2IADA 5FXCH 5DTFA 1U6AL 4QAWA 1XDTT 1A8JH 2GTZB 1W72B 3IFLH 4HG4J 3WTWA 3FB8A 5CKGA 1DSWA 4ORGA 3WS3A 1TCRB 4OD3H 2Y4SA 1RZJL 2FUTA 3WN5C 2EDHA 4MDJA 4X5XB 1RULL 2ESVD 3FTSA 3VFVA 1J8HA 2VLJA 5DS1A 2YJQA 3QEQE 1HL9A 5I9QB 1ITCA 3UGUA 1A3QA 4HKXB 4OQTA 1FNGB 1BJ1H 3CVIH 3V5KA 4Z3TA 2OAAA 3MRLB 4OLXL 3SPVA 3VXME 3M1OA 4XC3H 5D72H 2Z0BA 4R0LA 1QR4A 2VL4A 4LP4A 4KUCF 4AVJA 4XMKH 3L3GA 1KJ2A 4NKDB 5IUSA 3NTCL 4N90E 1BMWA 4AV4A 2XV0A 3UBXB 3EBGA 1FYTE 4U1LB 1ZLSH 4FEIA 3WDHA 4JFUA 4PJHB 3BKYH 4K5OA 4ZI8A 4F37F 4LCCB 4LSTH 3GMMA 2G2RA 1KCRH 1LO4H 1I8IB 1XD0A 1MDAA 3MRIB 4MDIB 2AJ3B 1BA9A 3VD1A 1RZGB 3NCEB 1A3LH 1CFQB 3UTPE 3B83A 3CQFA 2QHRH 2FQDA 3OJDB 4MNGE 5LAXA 4QY8B 1JVLA 3QI9C 4GAFB 4GXUM 4JG1L 5K1JA 3QYMA 3DX1A 4N2AA 1ET7A 1YQ2A 4XPTH 4WJ5A 1ADQH 4XBPA 3ME0A 3SKJL 1U3JA 3AITA 4PJ5A 2NQ3A 1QI4A 1J1XH 4MJ6A 4QMEA 2GFBB 2K8QA 4F9LC 5B38G 3A22A 5BVPL 4M5YH 2AJXL 2FWOA 4K55A 2Y06L 3IGLA 5E51A 4GW4A 2DTMH 3ROLA 3TBYA 1R24A 4RZCA 3I3EA 4PVBA 3T6WA 2EH7H 4WHTA 1UD5A 3FFDB 5EU7E 4MCYA 1NJ9B 5FYKD 3SDDB 1CURA 5T3ZH 3Q5OA 5EPMA 4X9FA 1PL3A 4JAMA 5KVDL 4Q9RL 2Q1EA 3HW7A 4N85A 3VXSA 2FE0A 5EEVA 1U8HB 3CLEH 1QSEA 1SDDA 4L9DA 4F5CE 4MCZB 2QMJA 2Y3AA 3BZ4B 5E1HB 3U4EA 3C6LA 3TTYA 2M1KA 1VJSA 1AZNA 2X6CA 4YSPA 1DBJH 4IRSD 5LGJB 3CFTA 1OE3A 2QQLH 3VFGL 4QHPA 4LRIA 3DIDA 4CMMA 1U8PA 3SQBA 1T66D 4X6DA 1YEJH 1CICA 3WN5B 4WTZG 1T4KB 3OZ9H 1V55B 4LCIL 4YWGH 3L17A 4NUJA 3LEYL 2XTJE 5B4MD 4BA8A 1FNEA 4NDMA 4BWTA 2WTRA 3D52A 2CO7A 5D1ZI 4WK4B 2H4EA 1AOHA 4TVPL 5J4MA 1YEHH 3Q13A 3OM3B 1M7IA 4K3EL 1UT2A 1LK3H 1X9LA 2I7SA 3QCUH 3P3UA 4JRXD 3ECQA 1ETJA 1KPUB 3KYNA 4XMWA 1MOEA 2FK9A 3T8VA 1N5AA 4QHUA 5I75B 1EERB 1EXHA 3DIVA 3ROOA 1B2WL 1MVFA 1OF0A 5ANHA 2CDGB 2AHIA 3TN0C 1P4IH 3QJFA 4WW2C 4D7PA 5IOPB 5IFAH 4NSKB 4MJ2A 4P49A 4U1KB 4Y5YB 3L9BA 3NT0A 3E0GA 5EOCH 5ERWB 3RIKA 1K6QH 4FS0A 5D7JB 3E9TA 4YHYB 4ZMLA 1NAMH 4J4PC 3QZWA 3DDFA 3MXVH 2K3HA 4NKQB 4ZFOL 4JK0D 4W9HC 5C07D 5ESAA 1HSBA 3MOBL 3MLWH 4B5ZA 3FSWA 3NJLA 4QIRA 1ZTMA 4Q4IA 1RJYB 4XN1A 5F97E 5C0BB 3QA3B 3GSVA 3SQRA 2MRYA 1CGVA 2IGLA 4M6ML 5EFIB 3DTDA 5DWPA 1WWCA 5F0LB 1T21B 3WNMA 1NDTA 4B9KC 5F3BA 3O2DH 3QCTL 1GJUA 2DBLL 1SHXA 3H56A 3AAZB 3UAFA 1FDLH 4GRLD 1UYWH 4F91B 4RWYH 3K91A 3NZHH 1Y7VA 1P0SE 4TQIA 4FQCH 2Z92B 4CDGC 4BFEA 5IEKB 4LKXA 3VNYA 3B2UD 3ARGC 2Q2EB 4C54A 3MTRA 3RVUD 5L6YL 2CMRL 1TJHH 3RPBA 4R84A 2X9ZA 4PMFA 3ULUF 4D0CA 4XVTL 5J3HC 4D9LL 3D2TA 4HXBH 4NWUH 1BFVH 3HG0A 4FXKB 4Y89A 1UOLA 5DWUL 1FVEA 2NNAB 4EUPG 2O72A 5M94B 3AG4B 4BM7A 4P46A 2NY4D 3CHQA 2BP5M 3FT2A 1XF3B 4YSTA 3RYMA 4RX4D 3CHPA 4J3VA 3UPRA 3MNWB 4MJID 3UEZA 1NANI 3ZHNA 3LSOA 1UM4H 2VW4A 4NN6B 4GRWH 4LOEA 5E6SB 1DEEA 1I9RL 1AYRA 4LHJB 4FN0A 3HTLX 3HNVH 2B7DT 4XMKL 2WSPA 3WCYA 2NX5E 2WLZA 4OLVL 4OI8A 4F8OA 3L3KB 3HVDA 3HJEA 5HD8D 4PJFB 3P4OB 5AW6B 1UZ6F 5TDNB 1FHNA 4NQXB 4YSUA 2A6IA 1GRWA 1EMTH 3V4PB 1AD0B 2VXQL 4J7RA 5D1XC 5KG9B 4PSRA 4XMPL 1JZ2A 3F6IA 2BNRE 4P57B 2DIAA 4KQ4H 4XOAA 3VSQA 3VUAA 1ETB1 3VRLE 1NBYA 5K33A 1IFHL 3IB4A 4QWWC 1Q94A 3IDXL 1R47A 5B1JC 3QFJA 4QEGA 2AMUA 4FQ2H 3V6BR 2A9NL 3DK0A 3VGDA 2YA2A 2FHFA 3LRKA 5JR1L 2EYRB 1BPLB 2AK1L 3RTQA 1OGPA 1OCOB 1D5BB 3OLIA 1Y1UA 3NAAL 5A2FA 2WWMD 1ZK5A 1RJCA 1DQMH 1CFQA 1BGXH 1FCGA 3DHUA 1AGFA 4WEUD 1JGEB 3WJJC 1MCEA 2UY7A 3FS9A 3H9SB 1EJOL 3LNGA 1SFDA 4NQTA 3GRGA 2YEQA 4L1DA 1XX9C 1AGEA 3IDNA 3TCTA 4ZNCD 4JX0A 2KUTA 3VTAA 5FO8A 3FO0L 2FO4B 4MKTA 4B96A 2XA8H 3L3JA 4MNHA 1H3GA 2W1NA 2MOVA 2YXWA 2H26A 2IH1B 4L9LA 4H7VA 3MRDA 3ZHKA 4NKOB 4H88H 5AB1A 2UZXA 1BIIA 5LN4A 3LKRB 5SV3A 2IXQA 2CRZA 1KXVA 3ILQD 3ABGA 4JDTH 5EZIL 2JV6A 1AO7E 4PIBA 5I1EH 5E8EB 3QNXA 1OSEA 1LE5A 1IT9H 4GRMB 2G4EA 1S8DA 1IC0A 5C0AB 5BJTA 1EXUA 4JPWH 4OIIL 1GW0A 4B9FA 3GMMB 1NICA 3GXPA 1ORQB 3Q06A 1WT5A 1HKLH 1CFVL 3RUGF 2AJ3A 4EXKA 4XZ4A 2ZKHL 4JG9A 5H2BB 2B5IB 3GSWB 4HKJA 4WCYL 1ZHLA 4XO5A 4AQEA 3BP5B 1FFOA 3HBPA 3QG6A 4MQ7A 3HI6L 2GB2A 4EN3C 5LAXB 1JK8B 5D72L 1NMCC 4ZX5A 1OD9A 5HGDA 4ZTOL 1KJMB 2CPUA 5F70A 4ZFZB 5MEND 4NKMA 2BIMA 4P2OC 1DJHA 4NT6A 4DHLA 2R51A 2DQUL 3WXVL 1AIFB 3L3OB 4L4VE 2LVEA 3FFCB 1YDPB 1S78D 4NHCL 3N85H 1BQHB 5LUMA 2FBOJ 4RFOH 1HILB 4M7JH 1BBJB 4LVOB 5JA9A 1NEZB 3GINA 1JV5B 3CVHA 1QPKA 3TZVC 2H0EA 3PHSA 1N0LA 3DVGA 4YN3A 2EDNA 5ACZB 2FSDA 3ZN6A 1A1NB 1RIHL 1MG2C 2F6AA 2FB4H 2X4NA 4LEOA 1S5IL 4YIQB 3CFDA 2EIMB 2FT7A 2LTQC 4QHKI 5A2BA 4Q9CA 3RZCD 4Y2DA 5E1QA 3LV3A 3EBHA 3U6XA 1P6AB 4TQ8A 4OCXL 1K9TA 3FTUA 3WFEL 1YJDC 4Z7AA 1ZE3C 5BOPA 1WQVT 2CDGA 3RNKB 1JHLL 2CKBA 3N9GL 3QJFB 4NO0A 4FNRA 3BAIA 2DQHH 4W1TA 4YZWA 3TBVB 1G84A 3PAVA 3TCLB 4MQTB 3LEVL 1ODAA 3WUZA 4KK9C 2J6EH 4BSVB 4YNYA 3V0AC 5IW6B 1QFWL 2XX0A 1H6UA 3N06B 1N2RA 3WKMH 2YRLA 3I3DA 4AYSA 4GAGL 5IHUH 4Z7QF 4PRPD 4U6YA 1P4BH 3NABL 4NUJB 4PRPA 4WFHE 5DJDB 1YHPA 2CIKA 1PKQB 3D25B 2DOCA 4F8TA 1CE1L 3UG3A 2C3WA 4FEMA 5FA4A 1JZHA 1KEGH 3DGGA 5EZOH 1UXSA 5ECJE 3MUGB 4BCXA 4QJ4B 1Z9LA 1ZSDA 4FXTA 2GUYA 2PXYD 5BOJA 1EAPA 4K3JH 1GMIA 1LWJA 1RZFL 4AMKL 5KWYC 3U82B 4Z7UF 2X41A 1CXIA 1U2YA 1U3NA 4U6XA 3MTXA 2D31B 2DS4A 4LLUB 5F8QC 3WNOA 4XN5A 5F9DC 4OB5H 1M7UA 4UQ3A 3D2UB 1IKNA 2B1HH 4HWBL 5C0JB 5H35B 4PLKD 1G1CA 4ADGA 3PWJA 2YMXL 5E1AA 4NI3A 4AYDC 2E4TA 1JHLH 3AY2A 1IGCH 2X70A 1FE8L 4ACTA 1A2YB 1H6TA 1GA2A 4MB4A 2N0MA 1XIWA 4JJ5B 3PABB 1MEXL 1VADB 3ALXA 3O8XD 1TFPA 3V52H 2VISA 4IOIA 2D7OA 4MS8D 2NY3C 3CQQA 2ZXQA 4JM4L 2ZF8A 3FRUA 3QUZD 4AQOA 5CGTA 2C1PA 2OJZH 3GSUA 3PHOA 2AQNA 3PWVB 1SUJA 3ETBF 2E6QA 3H9SE 2OZ4A 3S4SA 3O4LB 4P05A 4L18A 1OGTB 1EV2E 4MD5B 5B3JE 3RJQB 3A4DA 1S7RB 4BA0A 5PAZA 3ZTNH 5D71H 1I8KA 3F7LA 4XTRC 4U1SB 5KYYB 5KVEH 1X5AA 3AQXA 4HP5A 3KLAB 2DJ4A 3ECWA 4LHQB 4PJFA 3NIDE 5DA4A 2MTPA 4JFDA 5HJDA 2ZUYA 2WLHA 4AIZB 4EE2A 4LLQB 4MS8C 3WL9B 4ZX6A 1Y18B 4DVRH 3NJFA 2ZOKA 2DH2A 4FHBD 3TV3H 3SO5A 4BJLA 5KZCB 1UG9A 2OL3H 3BFWA 2J2ZA 3QPXH 3CMOH 3QIUA 5K1NA 1KN4L 3BRGC 5KBNC 2NNAA 1FVEB 1LLAA 4QYAA 5JMRA 2NR6A 1DVSA 1F86A 1Q9OB 3NQKA 3MX0B 2WBWB 5D2LF 1Q94B 4WVRA 4B5EA 3OAYK 5KBPA 4UT6A 1EZVX 4XI5D 1UB6B 4APXA 2IDQA 1RPUA 4PQXA 5F7UA 2I9LA 3O2VH 1O6VA 2CAKA 3NJJA 4OGZA 3D0AA 1PJ9A 3LSOB 1FG2A 2XZZA 1TZHB 2H0JA 3O3AB 1XTLA 2PYFA 4Y9BA 5B8CB 5DXWA 5T1LD 4H88L 4RMSA 1TQBB 5T5NF 1A1MA 1F1AA 2OMWA 4F93B 1U95B 5FW7A 4WFFE 4PRPE 1NA8A 4WFHD 4AOFA 1TG8A 4IJ3C 4JDTL 4HFWA 4X4MA 3K5RA 1P4UA 3ZL4L 4EF3A 2G5BB 2YQ3A 3F7YA 5TDNA 4YBQD 4GO6B 4H8QA 3G6JF 2HH0H 4QHNA 1J9TA 3L95A 4YXKL 2A74C 2FO4A 4GSUA 4D8OA 1EJOH 1OIOA 5A16A 5GS0C 4NI6A 4NP9A 5T1MA 4OF6A 3SGDH 4JO2L 1IBGL 4HS6B 2DYSB 3S98A 5BMFH 2OMXA 1WUNT 2YUWA 4EEEA 3JTSA 5H94A 3GMRB 1NC4B 3MUHL 4Q97A 3JSSA 4ZRGA 5I30L 3IF1A 1WIPA 2A4EA 3JWOC 5DFAA 5BZDA 3KZ8A 3ISRA 5JXAL 1TZ8A 2E7BA 4IRZH 3DOSB 3B7SA 4JPKL 3MODL 5EOCJ 3I2CH 3QNXB 3LB6C 2PW2A 2DQDL 1KTBA 2YFOA 2ITDA 4FTVA 3FO0H 1S6NA 3NH7L 2NY3B 2XN0A 4MJ4A 5BV7L 2CXKA 5EO9B 5F6IC 3N42B 1YYCA 4I1PA 4L29A 2BDNH 1KGXA 4TOYL 3ZMEA 5JORA 2B39A 4ZW8A 3TEUA 1JYVA 3VXMA 2P5WB 3VFUA 5HYSB 2QQKL 4XP5H 3C6EA 3TCXA 3ZW3A 3AB0C 1Z9PA 3POHA 1IFHH 2BVTA 2GVYA 4MZ2A 1CYWA 4NC0B 3DXAA 1NPNA 2BW5A 2BHYA 3MROA 3ARPA 4NM8L 4NT6B 3VXNA 4HAGA 1KWGA 2W9DL 2AJSL 2VN5A 1N67A 3DO4A 2OS7A 4FNLL 4PJ9A 2WXQA 2BVEA 3QFJE 4E5XB 1TO4A 3V6ZA 1SDAB 4P4KB 4P2OD 1VHPA 1AO7B 1ZWIA 2CM5A 3V5DB 1DVXA 1MFBL 1OAUH 2ZUQC 5KOMC 1OTSC 1QFHA 3LKRA 1SEQL 4PWHA 1OB1B 1UFUA 3NFPA 3H85A 4YHZH 2ZONA 3CX5J 4Y4FD 1CFSA 3K4DA 1AG0A 4HXAL 4NYLB 2CHDA 2J88H 3CFDB 2J3SA 1TF4A 3MJ9L 4L4JA 4ORZC 4MSWA 4OZFG 4Y2DB 4R2GB 2V9TA 5H2BA 4J8QA 2YGPA 4N8UA 3CFCL 4CKQA 5HGHA 2CG9X 1EBAA 3ZRFC 1FFOB 3ILQC 4K7PL 5TDOB 3QGVA 5I5IA 2OZ4H 1CFBA 1OOWA 4OV6F 1JNNH 1U3HD 5DS8B 4AMWA 4UB0L 4OT1H 1EGJH 1Q9WA 2C9XA 2CUIA 4TTDC 3UXFA 4DK5A 2OTWB 3B9KA 3BP7B 3LKSA 2IQAB 1F1GA 5DEGA 3RUGA 1JRHL 1MFCH 4LIQE 1OAYH 2EKSB 4FOMA 4X5PA 4YR6A 1KJ2H 3CIAA 4W6WB 3WMPA 1K8IB 4X98A 4IRZA 1FDLL 3FTWA 5CJXC 5JPNB 1ITBB 4PJ5D 3MKKA 3D25A 1KELH 2Q8AL 1A1OB 2WUCH 5FHBH 2HTKD 5FYJU 2P44B 3VGAB 2YKLH 2HJKA 1C5DB 3QNYA 2VCOA 5CCJA 3BEWA 1NBVL 2UWEB 5ACZA 1I8LC 3WS6C 1MJ7H 2EDKA 2WV3A 3MDJA 3TZVB 3NSYA 1J8RA 3AJ7A 4XCFH 1EUTA 2AEIT 3R0NA 4LEOB 3VI4F 2YFNA 1NOFA 5DI8B 3GMNA 5J11B 1MUJB 3LV3B 1K6QL 2X1OA 2BX5A 4X4ZA 4YSDA 5EOCL 5I8KL 3O9WD 3QC6X 4EDXA 4PRAA 5DEFA 5DUML 5I1IL 3RNKA 4NO0B 3VJ6A 5K59E 4PJXA 1DBMH 1P4IL 5GISH 2J44A 3V2AR 4GQ9H 4ODHL 2X70B 4AMKH 5CM1A 2H2SD 1F90H 1MHCB 4HEPA 5FO7B 1TPXB 1JXKA 3ARYA 1WA1X 4DP6X 4HDIB 3EOAA 43C9B 1B6UA 2VABA 3ARGB 1ACYH 1NGWB 1LK2A 3HE7D 3P30H 2CIKB 3NESA 4H2CA 4W9JC 1X5GA 1NWOA 4A2GA 4DQOH 4I77L 3FQUA 3SGKC 5LBVA 1MCRA 2YAMA 4JG0L 4MXQC 5HD8C 4YHPB 3OHXB 1UT9A 3BZ5A 3L9RB 4Q9BA 4G8FB 3L7FA 2YGVA 4MD5A 3QWQB 4XXDA 4DO6A 3N43F 2W0LA 4HVBA 1F3JB 2HPOA 4UNTA 5GS1B 2ZQKA 4YLQT 4U49A 3EJPA 4IJ3B 4WQOA 4DVRL 3MKGA 4O4YH 4HIJA 4NNPL 3ULVF 7PAZA 4LL9A 3FZUC 3RIFK 2X2IA 3LPOA 3Q7JA 1UATA 2QELA 3LZRA 2A6KA 4NQCE 1OY3B 3NN8B 1L9PA 4F8PA 4YDLC 5TQ0H 4PRIA 2Y22A 3ZQXA 2DKMA 3SJVB 1XCWA 3PHQB 4NXKA 1UCTA 3VFGH 4JJ5A 1KXHA 1U33A 2W9EL 4XBMA 4A7GA 2IGFH 3CN1A 3WO4C 3EXLA 4AM0Q 1UWEL 2ADJA 2ZCKL 3BSZA 3M7OA 3QISA 3D12B 4MMZC 5BXFB 2J21A 2EH7L 1LQSR 3R8BB 1JPEA 1RK0A 2C1PB 3O8XB 4AL8H 4MCMA 5FW6A 3QFJD 2WCSA 3JTTB 2DWDA 3HAEB 4UQ2A 3GQFA 4H4NA 2R1WA 7PCYA 2HLAB 1LDPL 5EC1B 3D3VB 1S7RA 3DA0A 1JF6A 2WIIA 1DLHA 4OD1H 1CE1H 3MV8A 4S10A 1QWUA 1MCHA 5A2IH 5B3JF 3PP4L 2YMXH 3VA2C 2YGNA 4GAGH 4QNPE 1ZJBA 4H20L 1QABA 4AIZA 1ZATA 5D1ZB 3ESVF 1N5YL 3TV8A 5EO0A 3GZOA 4BFBD 1ZSHA 4TNVK 3HZKA 3U2IA 3ZE1F 1B0RB 1XSJA 2W80C 3WIHA 7FABL 5DT1H 3G6AB 4JRFA 1JPGB 2R0KL 1NC4A 6PCYA 3EFOB 2ZICA 2IMNA 3T65B 5CZVH 5ICXA 4M7LT 3Q5TA 3MX0A 5CAYB 4LSTL 5I6XB 3L8QA 4UQCA 5HTSA 4LBEB 4JREB 1IAIH 5G4NA 4K7FA 3GI9L 3OKKB 2X05A 1Q1JH 2I9LB 1MH5B 1NCCL 4FCHA 4UV4L 1KBBA 1HHGA 5D5MA 1AHMA 4IKLA 2Y07L 4GLRH 4W9KC 4LLYB 1D9KC 2PCPB 3WU1A 4GG6E 3FT9A 4WU7B 5EA0L 1AQDB 4R7NB 4HUVA 1F0LA 3ZYZA 1JN6B 1UOKA 2LU3A 4AGMA 2EE3A 3EOTL 3FW6A 2BY1A 3DRTB 4MNGA 2R4SL 1Z1WA 1J48A 4LEXH 4TS6A 3WI9A 1OLLA 4GIAA 35C8L 3QC5X 3VXRB 2HVKA 1A6TA 3DXAB 1A6UH 3FB5A 5TGBB 4BKLB 1ADWA 4ESKA 1P7KB 3S8GB 1JFQL 4LLWB 4PH8A 2OMNA 4KI5F 2CRYA 4M6AA 4Z23A 1RUKH 5E8OA 3MV7A 4Q0XH 1TMCB 5LGHL 1KCKA 5I2IB 2MH4A 5DQDL 3BC9A 1FFNA 2XN9E 1F3RB 1T66C 1CFTB 5SWQA 5HHQA 1GPOL 2Y1AA 1DVQA 1PQZB 3HUJE 5DK0A 4IRSC 5E5RB 2ZX7A 2V7HA 4L4TE 3K72A 1NM9A 4H0LC 3H42L 1RP8A 2CLVB 2E6PA 4TMPA 5IVZA 1MQKH 3M46A 5C3TA 2PW2B 1ZLDA 3N44B 4U6VH 3R4DA 4N8CL 5D4IA 4PVLA 1SQ2N 5EO9A 3VMPA 5AW2B 3QAZB 3OKEA 4X6BB 1Y6KR 1Q9KA 1ID2A 4TSAL 3DOIA 5EDSA 4GY4A 3SKMA 4OFKA 2CKBH 4ZFOB 3FCSA 1VSCA 1AXSB 1CDGA 4YX2L 1TJIL 2HFTA 2CO6A 4GRWE 3DKHA 3DRQB 3EGXA 3S7GA 2EC8A 5TDOA 4CADB 2B1AL 2J25A 5F1SA 5JYMA 1JL8A 1IX2A 4P9ML 1OM9A 1FGVL 2YC1B 4MAYB 2V37A 5K59F 2FO8A 2ORBH 1T5XB 4J3XA 1U0QA 1K5NB 1DUZB 1RZKH 2AXGB 2IBBA 4P4KA 1TCRA 5E94B 1YNTA 3EH4B 3GSQA 1BAFH 3RY5A 4KDVA 2ZXAA 5EZLA 4GKZA 2BRRH 5BRZA 2XXGA 3QUZB 1N4XH 2B59A 3H6JA 4LASL 3TA3A 2BIIA 3Q48A 3Q05A 1MY5A 1KIUA 4YLBA 3TZVA 2X4PA 3VGAC 3VWJC 3OF6A 1QTPA 3VWKD 2HZHA 1CFSB 2ZJSH 2MHAB 3APNA 3RURA 3TA3C 2L4OA 3AS2A 3L1FA 3WEXA 2HKAA 4ZUTB 3KMDA 3EDEA 1XH1A 4XNUH 2BINA 2L8AA 3L3GB 5GZND 2XWJA 3ZKND 5BNXD 4DH2A 4FZEH 2QPFA 5FUOL 5KYUB 2YZ1A 2YWYA 3U9PH 1VFAB 1QTYT 5D93C 3V4UL 5JUEH 1Q1PA 4PJ7E 1NAMA 1TQCB 4MD0A 3QEHA 3WV0A 3IPFA 1EO5A 3QCTH 4YEEA 2J1KA 4BSWB 1EEUA 1I8IA 4GSRA 1I9JL 1ZHNA 3DSNA 5KZCD 3ULVD 3L3IB 3VXUD 2FX9L 1NCAL 2OMTA 2IV9A 4YR6B 2WYHA 2VOTA 1I3RB 2ICWI 3O11B 1LK2B 4XNXL 4ONHB 1NIAA 3H3PL 1A7QL 1HC1A 5C6PB 3LTVA 1ZTXE 4M3KB 4ODVL 4WJ5B 3HS0A 2BC4B 1WS7A 4XBPB 5E5UB 1C5DA 4YHPA 4FG6D 2ZIDA 5DGQA 1USZA 1MSPA 1QI3A 4TULL 2X9XA 4G8FA 4U4IA 3S3CB 1IC5H 4YXHH 2AERT 4HZLB 2OJZL 3QPXL 4KHTL 1QPXA 1NLBL 5HGAB 4EI0A 4F15C 4KKBD 3TF7C 5FGCB 1AZRA 4Y5XA 3ARFB 4OZ4A 4PRAB 1ZMYA 5DEJA 3V4VL 5E4AA 2JJSA 1TTUA 1P5UC 3P4MA 5ISZD 1C7SA 1CGUA 5BZXA 1IBHA 5JZ7D 1MLBA 3QW9A 3X11B 1ANUA 1NSNL 2NNXA 4AV0A 3C08H 4JAMB 4HJGB 4UAHA 1P5UA 3HMXA 1VDGA 5FYLH 1EQWA 4PEEA 3VRJA 5FB8A 3QUKA 1V10A 4PCTA 1RZIA 1X7TA 4HJJL 1DQKA 4FFZH 3FT0A 4OFYA 3QO1A 4N8PA 3MZTA 5IM7B 2A9ML 1FCCA 1MLCB 2EEAA 1KMGA 3CZJA 4DP9X 5DT1L 1NMBH 3A4AA 2EEFA 5F89B 2Y24A 3HAEA 4X6EA 1WZ1L 5CJOH 2W60B 1TOXA 1U3ZA 2QQLL 1DQVA 2CJSA 2VLRA 4H8HA 4I2XE 4AENA 1HYSC 2X87A 1XVSA 5GGRY 3W38A 3BVVA 3FB6B 2FRGP 2YSSB 1HHHB 4RIRB 1E5UI 1ZKAA 5DD5L 2ZCLH 1FBIH 4HIJB 3OAWA 2RCSH 4LVHC 2WM0A 3GHEL 2A4ZA 3MLZL 1FSKB 4QF1A 4QRPE 3CXHJ 5DFVC 5DVOA 1LILA 2XKSA 3HUJB 4UIMB 3B5HA 4BK5A 3RWJA 3SDDD 3FO1A 2O6CA 5IGXL 2BY2A 2FLRT 4F7MA 1WDAA 4X9BA 1SMAA 2WMPA 3IBEA 4Q6IA 4EIBA 1R3KB 5BCAA 1NCDL 3NACL 3CSYA 2WUBL 4GAAA 3WEBA 2DQHL 3T0XA 1BQLH 4ELKA 2O5XL 3WD5H 1XR8A 2HT3D 1CIUA 1V7ML 2KKQA 5INDB 2IAMB 4JZJC 1WWBX 1YPZF 3UAJC 1EHAA 5IHZA 2PF6A 1S7WB 3IS1X 5AG8A 1MRCL 3VQLA 3W9DA 4LBEA 2XI9A 3D0VB 4XCEB 2B2XL 4MHHI 4AJVA 2PPAA 2Q76B 4I0PA 5EOQH 3RQ3A 4Q9QL 4KI1A 4Y5YA 3MC0A 3RWIB 3S3DB 5L4JA 3UYPA 3O8XA 2VZSA 2XA3A 2C1OA 1W72H 4JHAH 1YEHL 3C08L 1NM4A 3EJJX 4JFXA 2YUZA 4M1CC 5D7SH 2IDCA 3BGAA 3I6LE 1TTAA 3F64A 1JNJA 4X99B 5AKSA 4OFPA 1KPVA 1BZ7B 2ZD0A 1IC4H 4F2MB 4DUXA 4QOKA 4I3SH 4BFNA 2NYZA 2C7UB 3EFDH 1RJYA 3HN5A 3CC5A 3PWPD 5DQ9B 5F21B 3F58L 3L7EB 4X4XB 4LPXA 1M1SA 5IP4A 1RJZB 1FRGL 4PY8J 1SXBA 2B4CC 2XJLA 3JZ7A 3BEVA 3Q6FA 1JUFB 3TO4D 2GABA 3QCUL 4FFZA 5E8OB 4YK4B 5TH2B 4CDHA 4IS6B 4WO0A 5I2IA 1ZHBB 2EYSA 3I3BA 2J57A 2HRPH 2QPEB 4GBXA 3JWNC 3GM0A 3PNRB 2EIZA 3HAEH 3ZIYA 2G75B 1GGCL 1G7MB 1T7XA 1MDTA 1YEDB 4IDLA 1OGAE 4KPHH 3AFLA 2HJLB 1WWWX 1LYQA 3VWJB 4FXKA 4KJQC 3LXBA 5DMKA 3A6OA 5JIDA 4JRXB 4F58H 4X2UA 2DL9A 1JFHA 5TK4A 4TPRH 2HA1A 3EBIA 4V1DE 3ZRCC 4MNGB 4C47A 1AXSA 4FXLA 4GAJH 2BNQB 4RNRA 3DRQA 2CU9A 2G3XA 3UZEC 3DX7A 3PWPA 2AXHA 2LFEA 2MFNA 3MV9B 3KPRA 4MAZA 3S35X 4YHLL 4JGNA 4K94H 4NAJA 3GZKA 3HCVB 5DRNB 1P7KA 4J3OG 1HHJA 2UVEA 1EA9C 3F7VA 3T3ME 4NQEA 4XNDA 3A6CH 3L5WA 4PGDB 2I60L 5EBLA 1PLAA 3GI9H 1CFVH 1HKLL 3W56A 5B39G 4L4TB 3MV7B 1CTMA 4IKNA 4FFTA 2BP0A 1ZGLA 1PQZA 2ZKMX 3BD4A 1NCGA 4PS4H 4Y5VB 5D1ZC 5FA3B 5IY5B 3PAZA 4NQCB 1BF2A 2YEVB 4PU2A 5KG9A 1PAZA 4TQPA 2IBZX 1KB3A 2NYYD 2X4UB 3A21A 1PW3A 4MB5A 1D2OA 1J18A 1R1CA 2DQFA 2V5RA 2ZUVA 3BVWA 5D6CA 3ZIMA 4KXDA 2OW7A 5CZXC 2OL3A 4YPGA 4EPSA 1X3DA 1UUSA 1E6JL 1OARL 2AKRA 4FLSA 2NY4B 3FHAA 2XWJB 2NT1A 4YHLH 5E6YA 2WXFA 4RA3A 3D9AH 3PL6B 1A65A 1JWSA 5CLTA 1K5WA 2F8XC 5LJYH 1A9BA 5E9DE 2PPCA 5E70A 5KSBE 3TEYA 3QULB 4IK7A 1IM9D 3KPRD 3UAEA 4B27A 3SCMD 3CSPA 5E2VH 3DMMA 3MACL 2JLPA 2OMTB 1L7IH 1SHWA 3HHSB 2P5WE 1QSED 4R90H 4PJFF 3FULA 2R0ZL 3MJWA 3Q3GA 3BUYA 4JGUA 4GKZB 1CDJA 4QD2E 2GBUA 5DD1L 2JKXA 4FTVD 5FO8B 1M7DB 3DX4A 2NY0B 4CJ1A 1KIUB 2EDEA 4UM8A 4BFIB 4F8LA 4TN9A 5CS7A 1LQBC 4L9LB 4U0RB 1VKXA 2PW1B 2IC2A 3HHMA 3QH3A 2ARWA 3IJEB 2WZPD 4XR8C 2WQ8A 4L23A 4O4YL 4XNBA 2VNCA 2Z8RA 4KOBA 4AXWB 1EJ8A 2JKLA 2XVGA 4WI0B 3R1GH 3G5VA 2GY7B 3GSNA 2XG4A 3MLYH 3P11H 2EVGA 5DC4B 5K69A 3L5IA 4RX4A 5CIPH 1IILE 4XNQB 3O6LL 1NMCB 3W0WA 1BFVL 3CPLB 5C0IA 1E67A 4WNSA 3VFNB 2GKIA 2ETWA 1P5UB 3UTSA 1W72L 4G9FE 1R0AL 3SBRA 1QTSA 5AUMA 2EINB 1DVYA 3QIWD 1GS7A 5JXAH 1LMIA 4X7TA 3KS0J 5CLXA 1CGXA 1DBBH 1P1VA 1NFIA 2RALA 2VO8A 3HS0B 4RGMB 4DGIH 2ARJQ 4HFUL 4X5LA 1LD9B 4DP8X 4OTXL 3RGVB 2YD1A 2WUBH 5GGVY 3QZNA 5E00A 4PP1C 1E3ZA 1ET5A 4M6MH 2AW2A 1UT1A 2N3JA 2W60A 4IKIA 5T5FL 2WVTA 3ULVL 2NW3B 4GUQA 3M45A 5A2LH 1OM3H 1GZHC 2ORBL 3QEGH 3DHMA 2DY2A 2F7IA 1FVCA 1L6XA 1X5ZA 2I07B 4G70B 5EO1A 4ZW7A 5KVGL 5I18H 4NN5C 5L6YH 4CMHB 3KPRE 2NTSP 4S1QH 5BRZE 2E9BA 3QXVA 5EZJA 4ZMNA 2ZOTA 4F8NA 1RU9H 3VD4A 4MJIA 3JWDH 3UJJH 3LIUA 2QR0B 4KRPC 4H0GA 4CC4C 2YJLA 1M6OB 4L37B 3QHZL 3U1SH 1TTGA 4MJJA 1E4WL 3ULSB 4QRFA 5FKPA 4CC1A 3MNDA 5C0BE 3KWTA 1FFQA 1A22B 1RD6A 3B34A 3QUKB 4L8CB 1PKQE 3TBSB 5I1JL 3W9DB 1GMEA 1IE4A 3CBJB 3AQZA 1KJ2L 1A0QH 3FU0A 3QO1B 2Q76A 4I0PB 5EWIH 5GGRB 4EOWL 5IM7A 3ZL1A 2Y3NA 3DPDA 3K6IA 4HWBA 3QORD 1CICD 1AJ7H 3HKFA 2CJ3A 4NNYB 1U8IB 1PZSA 3P2TA 4K3DL 2P3YA 1R33A 2VXUH 1OB0A 1PGRB 1IJNA 4M7LL 5DK2A 1AGBA 4IIQB 2YSSA 4RAHA 1P5VA 4M48L 2Z93B 2FEDD 3WNIA 2YSTA 3GO1L 1ZLUH 5GQBA 2NUTB 4QF1B 4KX9A 3SYQA 5DHDA 2VLKE 1KB5A 5DD6B 4ISVB 5HVHC 5FV2A 4LMQE 1HZLA 4MA8H 5AOLA 1KJ3L 1GGIH 2YO3A 2BHUA 1BG9A 1QRNA 2D31A 1XCTB 5EBWB 1TQBC 3IVKA 4KRMB 1WEJH 3LCYA 2E76C 4J8RB 3HHRB 4ZFFA 3DUSB 4NQSA 3VFTB 5C2UB 5FR3A 1PCSA 2WP3T 3PWJB 3TLRA 3QWOA 4TXVB 3GMOB 2R0LH 4O9HL 5F7DB 2XN1A 4TNWK 2X7LB 1GCYA 4K4KA 2HJLA 4OJFH 1ZV5A 1GCFA 3ZYIA 4ZUVB 3QAZC 3U48A 4KH9A 1GGTA 1ZVHA 2Y0SA 4Y4KB 3WFHA 4WWKD 5E9DB 2ED9A 1CT8A 3LEXA 1LEIB 5D7KE 1A6WH 1LE9A 4D94A 4XNAA 4X5WB 3T4AA 4BDVB 3DX6B 1BP3B 4IOIB 3FO9B 4FXGB 3S97C 4YDZA 3FRUB 2ZUUA 1OE1A 2PTUA 4GW5B 3WJMA 5BW7A 1MFUA 4OZGF 5GSRA 3TNMA 1HCZA 4E9RA 3NJIA 3TWYA 4AGPA 2VDQL 1QBAA 3D39E 3NSFA 2YPLE 4LHUG 4O02L 4UYQA 4OLUH 2EXTA 5I0ZA 2X4OA 3B5TA 5BW7C 4YUEH 5EBLB 3VI4A 1IKFL 1I8KB 5CLWA 1ZEAH 1T0NB 3HFFA 4UTCA 2ZP0T 5JNYA 2H45A 2WHVA 2E4FA 2BP0B 4LVHB 1ZGLB 3MLUL 2QSTA 2XVLA 3IKKA 4KXZI 4FI8A 3BRDA 3H3BC 4EI5B 2GI7A 3LNFA 3FU3A 2FVNA 5L9DH 2EIZB 5F0JB 1QZ1A 4XNZC 5D6DA 3PGCA 2HP4A 4NJ9H 5DJ2B 3H1ZA 1NKRA 3MJ6A 4YHIA 2DQFB 1M71A 1V05A 1T20A 4FQLL 5ID1B 2CJUL 2O6DA 2WW8A 2NMSA 3OAUL 1Z5HA 3HR6A 3DO3A 3MV9E 2XZCL 4KKCD 4M5TA 3NEOA 3TYGH 3PL6A 2J20A 3FKUS 3LS4L 4IBSA 4JN1H 4ZO6A 3SOBL 4TTGA 2A38A 4Z7IA 4K5LA 1FG9C 1TZHA 3O3AA 4EUPA 1JOIA 4L8SC 4PGZA 2Q7NA 3GHPA 4PB0H 5DTFB 3TF4A 3MCG1 5K9QG 4G6KH 3S37X 3F65A 3G3LA 1NCWL 3MFGB 5D4HA 1KT2A 2VDKB 4LGSB 4JM0A 1BLIA 3QDGE 5J1SC 4FYTA 4HFWB 3F12A 5DK3A 4M1DL 1CPUA 1KZYA 4A37A 4ZS6D 5HHXL 1F02I 4MDJB 2B3RA 1V3LA 4PWFA 3INUH 4QHNB 4L5FL 5DMIH 1FL5B 2C7FA 3WS3B 1K8DB 5HHOE 2AXJA 2WXOA 1I7TA 4GH7B 4NBXB 5TDPB 4RFNC 3TV3L 1M7XA 3QUYD 4KJWC 4C4BA 3JTSB 5H94B 1IAMA 2UY6A 3OQ3B 4DEPC 4PJFE 5KUMA 2ZAHA 4Y4FB 5CR8A 2J72A 2JTDA 3WFZA 3ZGHA 2XZCH 3O4OC 3V9FA 4OKVB 3ZTNL 1N26A 5H37G 3RFZC 3DV4B 1RURL 2V2WA 3LKOA 3ALWA 4L2YA 2G2RB 3JWNE 4M6OH 1I3GH 1QUPA 4U1LA 5TK2A 5HDQH 4ZXBA 1PNDA 2WQXA 3CLWA 3MNMA 4P2AA 3RWCB 3W81A 1T22B 5HYQB 3MRIA 4MDIA 2C26A 4UT9A 4OGYH 2YLHA 4P8QA 4MZRA 1QLEH 2XWBB 1GAFL 2F1BA 3BPCB 3ELAT 3OXSB 5FGCE 4Z95L 3ZZLA 1BG1A 2DWYA 1QKZL 3MCLL 2WTPA 5DC9B 4A2DA 2NNFA 5EUOF 3UERA 5DUBA 4HETA 1OAJA 3EHBC 3H9ZA 2H2PD 1U91A 1QLRA 5IJBC 1IGML 2K6WA 2VUYA 2HX9A 1OP3K 1F90L 4PP2B 4DIXA 3AWEA 1DUYB 2EDYA 4I0CC 3CZNA 2H0FA 1AO7A 3N5AA 4ICXA 1RSFA 2XQ0A 3QH3B 2EADA 3TTSA 4BZ2L 1VF5C 5JMOC 4APQD 4YDIL 4PWIA 3UTQB 2V8MA 2W8CA 3DJSA 2L7JA 3GMLB 4OB5L 5T1DH 1HEJC 3HI1A 3LXCA 2EEXA 5I15H 1R24B 3WIAA 4TVPD 4PVMA 5IIEA 1BZEA 3ZO9A 3HN3A 2DMCA 1SY6L 4JY4B 3NAAH 4G1MA 2YA1A 4HJUA 3ZKXC 5LXGL 3MBXL 2HFEB 1VFMA 4YX2H 2OMYB 3C2SA 1NTDA 2BO0A 2MQCA 4CUCA 1M6OA 3FFDA 4L37A 4LRNH 3PPEA 5E56A 4R26L 1NOLA 5L2KD 5F6HJ 2Z8SA 4P9HH 1T04B 5FHBL 3WJJA 3TBSA 1KCUL 1OLZA 4KNSA 2J43A 3UC0L 4LCCC 4X7TB 3QUHA 5GGRA 1MQKL 3ES6A 1MXDA 3R18A 1R17A 4CC0A 1QLFA 4X6DB 3LKSB 4QRPB 1Q9LB 3SDAD 4LDEB 4OF3A 1JGDB 5IBLD 5KS9F 5LGJA 4O51B 3UABA 1AS8A 1K8IA 3IKCB 4JLRA 5IQ7L 3QZBA 1CXHA 1AO7D 1C1EH 1K3IA 2IQ9H 3WFCH 1XGYL 2NUPB 1Z5LA 5IVXF 2I9TB 2G9KA 2WNWA 1FVCB 2I07A 2G4GA 3LZPA 2GK2A 2QEJA 2F8OA 2VN3A 4TNEA 5AFAA 4G6FD 3AS1A 1TDQA 3HZYA 3PQYD 2HT2D 1DSFH 1NINA 1YNLH 4G6JH 3DIFB 1KGYE 5KJ4A 5JXEA 3KD4A 1PMYA 1QUNA 2X0VA 4PLJD 5EBWA 3VD7A 4FFVD 2NXYD 1JS4A 2L3BA 2FJGA 2ZYSA 4ZFFB 4HSQA 4L3FA 1P1ZA 3VSTA 4XVTH 4D9LH 1L9OA 3FOMB 3H6AA 5HPOA 2RD0A 1B4TA 3RAJL 3F85A 1N5AB 4YFLI 4YJZL 2EILB 2ZYIA 4E9LA 3AROA 1O6TA 2AK4A 3MNVB 4IRSB 1RZKC 4G6AD 2BMKB 2IALB 2JCCF 1YMME 2CA3A 2DIEA 3GXIA 2J7LA 1KGJA 4DEWA 1M3IA 3CLFH 4UTAA 5EUOE 1HAUA 1F42A 1G7PB 1CT8B 3LEXB 1QEWA 2CO2A 3QZWB 2R9HC 3UG5A 1ZTXH 1LXMA 2X3BA 3EOYG 4PJAF 3QFDB 4HOZA 4AW4A 3FO9A 3BCFA 5JW4M 4KKLC 2EVJA 3GZPA 4R3SB 4GG6B 1TQSA 1WFIA 1BECA 5C0BA 3HE6C 3Q1EA 4FFYH 3DX8A 3KYKL 5BUPA 4Z7WF 1Z9SA 5IHZB 5L2KA 1KB5B 5DD6A 1HXYA 5IESL 2DBJA 3K2IA 2YBRA 4P46C 4BUGA 5JHDA 1T2XA 5AW1B 1BVKA 2DQDH 2WBJC 3T0BA 2GBAA 4KH2A 1A7OL 1SXSA 3NJMA 4JM2D 1VPOL 4KK5D 4LKXB 4U1NB 4XPAH 3UROR 3MJ8B 2ICWA 3FB7B 4PRNA 4LEBA 3NN8A 3WDIA 2XXCB 3PDOA 4PN6A 3SB3A 1CXLA 5C7ZA 3DX9B 4ENZA 5A2JH 3Q1SH 1J5DA 2C3VA 4N0FB 3MGTA 3VGEA 1DO5A 1MHPH 3PV6A 1MIMH 3HC3H 1WG3A 1AKJB 4AQ8A 2VITA 4KRNA 4R4ND 4FXKC 1K72A 3DBXA 5DEZA 4BGDA 2FX7H 3NCJH 3JV6B 4LQFH 2JJVA 3MRJB 3ZDXF 1JRHI 4GQRA 1BOYA 2EKJA 3N6YA 4PS7A 4LCWB 1U8LB 5C0BD 5DUPH 3IDJB 2B0SH 4NRYB 5KVFL 2DMBA 5F3HB 3E3QE 2ZCZA 3GMPB 4Z95H 2XG5B 2HLAA 3Q2WA 5EC1A 1ONQB 1KT2B 3ILDA 3ZX1A 2A77L 4WWNA 1JHKH 1LO0L 1M57B 3QS2A 5HHMD 2VDNH 3ARQA 1S7TB 2B9BA 1B90A 2W92A 1TTCA 3CN2A 3WY2A 1EEZB 4HLJA 3OG6B 5FX3A 2Z4TA 3QQ9C 2VAJA 3RTQC 3AREB 4JHZA 4RDBA 1F6FB 1OAUL 4F9LA 1SOQA 3R1GL 3BDBA 2V9RA 5E23A 4ZO8A 4MLSA 1T3FA 3KVDD 3RGVD 3QFGA 3DROB 4JQXC 1NCWH 2JMRA 4RRPM 5E2JA 2E9JA 1ZT4A 4RGNE 5ICXB 4KK6D 2YQ2A 4M5SA 4Y1TA 5LO7A 1OF2B 4YQXH 1IKOP 2AF2A 3NYKA 2QQKH 1F6LL 3ERXA 4OKVA 4XP5L 2XWTA 1AIZA 1THAA 2C3HA 1ASPA 3GSOB 4Z8FL 2YGQA 4OCYH 4RMWA 5JW4N 2YOAA 5L0QB 3LKOB 2PWHA 4LLYA 2W59A 3QFJB 1EZUA 1R5IA 3JV4A 1IGYB 4RSVA 1KTLB 4UBDC 5CSZA 4BZ2H 1AQDA 4R7NA 4HUVB 3AVEA 4HC1A 4IHBA 3MLTB 3AREC 2RA1A 3B9DA 3PJLA 2AC0A 5KSBA 5FOBB 3L4VA 1WS8A 5IK3A 3F7QA 3FCTB 4BZYA 2OK0L 4NERA 2HFFB 2BCKB 3QJSB 4QXUL 2RJMA 3VXRA 2RTTA 3WO3B 4K2UL 4Q7DA 2YKLL 3FU6A 4OCWH 5J1TC 1QAWA 3G6JB 5B38A 1MCJA 4JN1L 4P2QD 1U8QA 2WWNA 1S7QB 3MLSH 4N8VB 2VDOH 3CXDL 1GZQA 4D9QD 4YHYC 5E24E 2H26B 2CQVA 2F58H 3STZB 3CN0A 4YHOH 3AACA 5A1AA 2APTA 3KXFB 1O9VA 4I0KA 1SMOA 5D2NC 3K6SB 4R7VA 3K72B 2WWKT 3LEVH 4XVSL 1UJ3C 5FCSH 4ZK8A 2XWZA 4KK5C 4HUUA 2BSTB 3P54A 3II3A 1RJLA 2R8SL 4F7CB 1L9SA 4EZKA 2WC7A 1ZGLM 3PWUA 5C8JA 4P46D 4WKXA 5I1GH 5E8EA 1XF2B 1VGEH 5HHNB 5CO1A 4JZNA 3ARDC 4JCMA 4WI8A 1T22A 4YOKA 1KEGL 5HBBA 3KHQA 3PS6A 4NJAL 1OAQL 1CXFA 1AE6L 2XWBA 4L2LA 4D0DB 1UCBL 2DEXX 2PTVA 4P23D 1WPCA 4WTQA 2XXFA 2BVQA 2ERJB 4C56D 5SX4I 4WV1B 5SWZD 4MAUL 1MFBH 4S1DD 5K9JH 4MMZB 2DKSA 4HPYH 1W6LA 1L9NA 2GK0A 5HVGB 1EIBA 1NH6A 2MNWA 1LWHA 4MS6A 3WUWG 2NY5C 3MGOA 3N91A 3M8OH 1S3KH 1X7QA 4DTGH 2NY6C 1HILA 2ZE0A 3ZK0A 1IC4L 4ZQTA 4G1EA 1AQ8A 3QJTB 1UM6L 2J8HA 3S96A 3KVPA 1UOVA 2LV4A 3D48R 5DMGD 5C08B 5DJZA 4JY4A 5EEZA 5EORL 3PPSA 4PLJC 3RIAF 2HFEA 3C8HA 3KEHA 3U30B 4JO1H 1AC0A 4PWJA 4A7VA 5HSFA 3CDGB 1EZLA 1FPTH 5EOQL 3TOPA 2VZTA 1KTDB 4U1JA 3ESOA 4S1SL 4ANXA 5IMKA 4C56E 5I73B 3QDJE 1V7NL 5CU9A 3TBVA 3DC0A 1IAOA 2BMKA 2O5XH 4IRZL 2P8PA 4FE9A 2XRAH 1UOWA 4YZFF 2B0SL 1QR1A 3SDAC 1G7PA 1VZIA 4M56A 4BSVA 4QXVA 1IGCL 4JLRB 5E6ZA 3BKJL 5ENWA 2NSMA 1HVXA 1ES0B 2ZXEB 2NUPA 2CMRH 2I9TA 3CLEL 1WCQA 5CIPA 1UCBH 4R3SA 2EAEA 4Z9KB 1LP9F 2GJPA 5KANG 4AUYA 4ILDA 3AZUA 3MLVH 3TPKA 1J0ZA 1QWHA 2GPZA 4F2EA 3D8MA 5FA4B 4N87A 3G5XB 5HYEA 3V0IA 1N8OE 5CILH 3FPYA 5IVXA 5T8IA 1BHGA 2BIOA 3QJZA 3STLB 4PW4A 5IESH 1QOKA 3ZGPA 2J55A 4WLCA 4FQ2L 1OHZA 2R1YB 4PG9A 3ZDZF 3D2UA 1Q0XL 4UMGA 3S5LA 1G87A 3MNVA 2VJ8A 4TSBL 1PFCA 4A6YH 1QNZL 4AGQA 1F4WL 5EH1A 3KPTA 5MP6L 2PO6B 1UD4A 4XCFL 1URLA 3UDWA 4KAQH 2E7LA 5D7IE 3PV6B 4O00A 4YSRA 5CJQL 3JVFC 1OKEA 4TNFA 1INDH 3QDME 1J12A 2GITB 2QADB 2R56H 3ZR6A 5EF2A 3J7HA 1RZ7H 3GIZL 3ZTJG 1K3ZA 1RAMA 2VXQH 3SDXE 4F33B 1VADA 1UHVA 1B2WH 1JPFA 4L8BA 4F7PA 3P3TA 4ETQB 1JTOA 5CP3A 2VISB 3DX3A 1FGNH 3MFFB 1BFSA 3T09A 2DTSA 1DFXA 4OLZH 2NR6C 1D5ZA 3L2MA 3UPAA 2EZ0C 1IC5L 1ONQA 2A83B 4X8JB 5LBGA 3U6RB 1EGJL 3JXAA 1R0AH 3QE5A 3SGJA 4WEMB 1OCWL 1S7TA 1OGTA 4HWZA 4Z8FH 1AR2A 1S7XB 3VNZA 4FQIL 4GI8A 2ICWB 3FB7A 1UWXH 1OCCB 2O6EA 2WOYA 2HT4D 4PFEA 4PJDF 3MAWA 1HZHH 5JOPD 4I18A 2ZG1A 3OZ9L 4LLVA 3QIUB 1T0MB 3KLKA 4ELKB 1BEXA 2ZOKB 1RZ7L 3ULAB 2WVSA 3QHZH 4KJYB 1BQSA 3CTTA 2AVFA 5CLZA 3HPJA 4B53A 1RH8A 2WXJA 3V0VB 4NN7C 2CO1A 2H3NB 5CJQH 4BXSV 4LF3B 1H6FA 1WK0A 4ZS6C 5IVOA 4L1HA 4CNIB 1Q9OA 4QRQB 3ZE2F 3DETD 4HV8A 1CS6A 1F4WH 1NUDA 2V4LA 4KUCD 5EBMB 1FG2B 4N1CA 2C1OB 1E0OB 1BVLA 3T9WA 4JL1A 1L9MA 4ZUUA 2R2CA 1KGCE 3E2HC 2XIIA 2R0ZH 1F56A 2N59A 4DKTA 4XCCL 5DHEA 2V3EA 2PR4H 3IM1A 3WELA 3KPMB 5KSBB 5B8CA 3L4TA 3ZYOA 2RH0A 5D7HA 1NUNB 4Y9CA 2EO7A 3F7PC 4U3HA 1RPKA 5DQ9A 3MLRL 3F7YB 3SBWC 4LSRL 1T2JA 5CZKA 5DJCA 1RJZA 3QT2A 3L95B 4I1RA 2G5BA 2WVVB 1YYMH 3D4GA 5J12C 4UIKL 1KBGL 1XZWA 3TJEL 2E5EA 4WY7H 1FQ9C 4JPIB 3DROA 5ETUB 4Q89A 1A6VH 3O41B 1UVQB 1SMDA 4N6RB 3AU1B 3B5GA 4LLDB 1SOSA 4FCAA 4HX1B 1ZJAA 2P8LB 3QRLA 1MZZA 2X9WA 3LJ3A 3GMRA 2JIXA 4W81A 3QJQB 4KJPD 2UZYB 3AUWB 2IMMA 4XXCC 3RKPA 3O4LD 4NIKB 1SF3A 3QJUB 4HA1A 4JRXA 2G30A 5GS2H 5T1LB 1IGYA 3T3MB 1N19A 4G9FA 1GTFA 5JORB 2OM5A 4PJHA 4NUMA 1EAQA 2VUKA 1E9QB 3AG2B 1KIRB 2EP6A 1NC2B 2B77A 1E42A 3CSBA 3MRFA 4NPKA 4OZHE 4XO4A 3C5SB 5IK3B 4OGYL 2DLEA 1JV2B 1JTPA 1RZGA 3DX7B 2X09A 1GKEA 3PWPB 2YHGA 2K4WA 1UM5H 2J8UE 3LRMA 4WNQA 4Z7OF 3VYNA 4GSXA 4GPVA 3APFA 4E9WA 3HC0A 3D39A 4FHKA 3D39D 4BRVA 4B60A 3TBWA 3V7MA 2VO5A 4Y5VC 2GK0B 3H7LA 4MA7H 1FHGA 4QRRE 4HULB 2JCCB 4C4KT 4OI7A 1JZ5A 3N85L 1YEJL 3FBKA 4U3SB 4OJEH 4Q2ZA 3U7WH 3VFSB 1JWMB 3GPSA 2EACA 4HIXH 3V0HA 1BQ5A 1PG7L 1F58L 4OV5B 5CGYC 3MLXH 3H42H 4L05A 1D5RA 2XSKA 5E5LA 1Y0LA 5ICYB 3U0WH 2ZUQB 3KXFD 4YSEA 1C9SA 5EA0H 2F1EA 2OR7A 1L7TL 4FKKA 4DERA 4X6DE 1C5CL 2ZYHA 3MRNB 5FO9A 3GS0A 3EH1A 3IGAB 4X4KA 5C7XH 4Y9EA 3QJRB 4ZTPH 1JNHA 5CEYB 1TLKA 2M2DA 3S5LG 4WF7A 3GS4A 1MRCH 5SX5H 2ESVB 3VTTA 3WXWL 4X83A 2FWUA 1U8HA 1IAOB 5DRZA 2IQ9L 5DS8A 4RAVA 3EJUA 2P8PB 2BFVH 2PNDA 1JYWA 2OTWA 5DEGB 3ZU8A 4B95C 3ZE0B 4WV1A 3VAEA 4YFLF 5ABZA 3L3OC 1TZGH 3MV7D 5J13C 4G8GD 4IRJD 3VXQB 3QDGD 4YVUA 5JHMA 4PJCB 1A14H 4L3AA 3QB7C 2XYBA 1GL4B 3HR5A 1A3RL 1YMHA 1IQDB 5D4JA 3GHEH 5F8RC 4ZG1A 4ODWA 2VC2B 5T1KA 3MA7B 2P1YA 1U2CA 2A0LC 2G3MA 3IGKA 4KQ3L 3VGBA 3GYRA 4HWEL 3EAKA 1NBQA 3CFEB 3WKPA 3X14B 2DJMA 4XPHL 3H2WA 1O9ZA 3I74A 4KRPD 2XUWA 1HQ4B 2PP9A 4R7DB 3BYTA 4FMKA 3UJIL 1II4E 1WBZB 4G8IB 5ITFA 1Z2KA 3CDGA 1DQQA 1MJJA 1NCDH 3NACH 4GS7B 1KPUA 4L0PB 3GMNB 3GGWA 1W0VA 2PMZA 5TD4A 1JSYA 1NPJA 4HIHA 3W11C 4V1DA 3VU2A 3OAZH 5K9OB 1B0GA 3NRFA 4S2SA 2K9UA 1IO4C 1DL7L 3NFSL 3VD9A 3ZQWA 1FLTX 4H1LH 2VDPH 4GMSH 2JKJA 2J4WL 1IC7L 3FL7A 4EN2A 4ZTEA 2QPDB 3ARGA 4PRHA 1OEZW 2XY1A 5FO7A 3NK3A 1RXLA 5ENWB 3ZJAA 2EVIA 2P26A 1EEYA 5E95B 5IB4A 3SYOA 4BFFA 5M95B 5CFAA 2R0LL 2BY3A 3B6SA 3F58H 2WYTA 4I13B 1BQHG 4OJAA 1KOAA 4X80H 1HSBB 3T0DA 2IO5A 1WH0A 1NEZG 4WW2F 4HQQH 4U7KA 3KPQB 3F3HA 1RIUL 3GSVB 3T0EC 3T3PE 4O58L 5BS0E 1FPTL 1R5VB 3DWTA 3BT2H 2NZ9D 5LG1A 2GG1A 1XH3A 3EJSA 4XN7A 3CK0L 1OAXL 3STLA 1DQIA 3LS5H 4V2BA 3HZVA 2DQCH 5HHVL 1OSZA 5IMOA 1SQMA 3IJ7A 2W95A 4QHMB 4B6ZA 4N0YH 3UMTA 1J1OL 4GEIA 4J3OC 3X3FH 3IMBA 5IJKA 2FL5A 2KI6A 4WW2B 3SJVA 5IEKA 3BIKA 2OTUB 3ZTJH 3WFBH 5EG6C 1Q72L 3KNBA 3O45B 1KENL 1SF5A 4ODTH 2VXSL 2BZDA 2D0FA 4KHTH 4QJ3B 3LH9A 1ERNA 1NCBH 1G4RA 4XOEA 5I8CA 1FO0A 2OR8A 4HMCA 1NKGA 2L7QA 3HS0C 5FUOH 4ETQA 2ADJB 3KDPB 5DC0A 4WZ9A 2OA9A 1G7QB 5C0EA 4IK6A 4ZW3A 3CZGA 4ERSH 2EECA 5DJXA 1DEEB 2VQ4A 3JTTA 2GCYA 5DK2B 4XP4L 4RRPA 2A9AA 1IAIM 3LS4H 3SOBH 5C92A 5F44A 5ADOH 3MRCA 2FNWA 4R83A 4UTAH 2VQUA 2E6JA 3NVQA 4BQBA 4H1LG 3CVDA 4O2CA 2NXZB 4XPBL 2PYEA 5CZXD 3QEGL 5GS1C 3FONA 4NQXA 3S3PA 4UQ9A 1QRNB 1GKOA 3MLVL 5D1ZA 5D7JD 4KNQA 3DV6B 4LLVB 2GIYA 4KKAD 5A3IC 2C9UA 4W4NA 4Y9FA 3BIAX 3DUSA 4NQSB 1F6AA 3CFQA 3MJ9A 4CU7A 4KJYA 1XIWC 3AU1A 3MCKB 4GRWF 5AZUA 3MLSL 3P9MB 3V0VA 2D9QB 2P8LA 2PWDA 3IFPB 4XPTL 2OX5B 5CJBA 3CLFL 3O6FB 3WBDA 4CVXA 1MH5A 1I4FB 4JFEB 4UQIM 5A2KH 4QXUH 1A7RH 3OQRA 4PGJA 1ND0B 3GB7B 4ODTL 3S6CA 2WXLA 2X38A 3SE6A 1V3MA 1L3NA 2WCGA 1LEIA 1D5IH 1KYOK 1N59B 1KIRA 4ALAH 5CD3B 2UXTA 1MRDL 3DRTA 5L4IA 1AR1C 1C7TA 1Q0YH 4G8EA 2SEBA 2OZ4L 1JGEA 1KC5H 4NZJA 1AQKL 2YWZA 1IL1A 1KG0B 4FI6A 5DJCB 3H9SA 1X5LA 1WT5C 3LHPH 1UB5B 4JGMA 3UCQA 2WYIA 4JKPH 4RAUA 4P2RB 3TBWB 1WAPA 2AJUL 4LSVH 2W9DH 2Z91A 4A39A 4GP5B 4LIQH 3FU8A 3IWVA 4KNTA 4NN7B 7CGTA 1FFNB 5T33L 1CD9B 3O41A 3QRFM 1FN4A 5I1HL 3FBQA 3DDGA 1LO2L 3L3JB 4MNHB 4DKEH 4YH6A 2HX7A 1HCVA 1WV7T 4E36A 1BZ9B 2FJHA 4KROC 1VERA 2JIXB 1Y0LB 5DJ2A 2R83A 2XETA 2FCBA 1H8LA 2OSXA 3FU9A 5BZZA 4GSQA 4Y4HB 5BV7C 5ID1A 5FYLD 2CLVA 5EC2B 2GSGB 4HOXA 3QJXA 1KCUH 4P4KC 1CLVA 9PCYA 1LE5B 3BT0A 2G60H 3EDDA 1A9EB 3QVAA 4QHKJ 1UA3A 2E9WA 3KPOA 5AL0A 4PJHE 4G7YL 4PJ7A 3S35H 4ADJA 3GJFH 32C2B 4GUOA 2YRPA 3JWNG 1BXXA 3HLKA 4F9PC 3FU5A 2CWRA 1Q0YL 2N01B 1JV2A 1U36A 2Y1VA 4HKJB 5IT2H 4WNQB 4E41B 4AQZA 5GRJL 3HC0B 5K1VA 1QSFE 3MRRA 3HMWL 4O5LH 3IRZA 4WUUE 2VM3A 1AYOA 1XSIA 2YC1A 3EYVB 2O5ZL 4NKMB 1E4XL 4NXSA 2MTZA 5GGSA 1YNTB 4Q2ZB 3VFSA 4C59B 2PABA 4NO5A 1J88A 1I85C 3T3PB 4GYBA 3UAJD 3QUZA 4FP8L 1PZ5A 2OXHA 5J06A 1ZVNA 2HT3C 1I7TB 1SJEB 3KLQA 3ZSTA 1DQTA 2ARJA 4KFMA 2DL2A 2ZOLA 4JKWA 4UU9A 5DGRA 3SDYL 1IEBA 2BXYA 2K9FB 2UX6A 4F7TA 2WANA 4MNQD 5DVLA 4I48B 3EO1A 4TYUA 3UOAB 2X4NB 3H9SD 2H9GB 4GO9A 5KVDE 2IF7A 2JJUA 2WLLB 1CDBA 3KJ6L 4LE8A 1XFPA 1NPUA 1UD8A 3T71A 3GWJA 3ZUNC 3UGEA 4OBSA 4HEME 1PAMA 1UXMA 1N7ML 2LLNA 4HAKA 3DV4A 4HIHB 4YLCA 3BAKA 1K2DB 1HZKA 5D7LA 4JFHD 4MAYD 4B97A 3NTCH 2FECL 5B1JA 4DPRA 5IV2A 1CLZH 4XT1C 2XIDA 3TP4A 4RMRA 4ANWA 4XC3L 1M2VB 3BKCH 3Q9PA 4OD1L 3S36X 1YMMD 2XQYK 5AB0A 2A6JA 1EEYB 4B9IA 1KCSL 1F58H 1N18A 1A66A 1QG3A 3O11A 3KPPB 4ZODA 2ICEC 3KW7A 4U6YB 2VLKB 3AS0A 4ODWB 4ZQKB 3T0WA 4O2FB 3RVXD 3VD2A 3ZT6A 1FWXA 3I75A 1KENH 5IUCA 1IFRA 3CFEA 2OMUA 5FWRA 2BC4A 3G08A 4PD4K 1ECYA 3N40F 2EDOA 1FVDA 4G6FB 4LVNB 3MUGA 5JZ7C 2DQGL 2F8VA 2YRBA 4P5TC 3X3FL 1G6VK 3UTQA 4B9ZA 3AABA 3QQXA 4Y5XB 3GMLA 3RI5K 4X5RA 4DWHA 2NZ1A 2WAHA 3F84A 1FJ1B 2IANE 3ABKB 2BIQA 3N0AA 4QDGA 2Y36L 3H8NA 4FYRA 4V1DB 1E8ZA 4YAQB 4LARH 1B0GB 2OTUA 3KWVA 2AQ2A 5FGBC 1MLBB 3PYCA 5K39A 2I27N 1KXVC 2Z65C 3IBOA 4DKAA 4HJGA 5I6LA 5D8JL 5CEZH 1MVYA 4U1IB 3EFDL 3CDYA 4LPYA 1FLRL 2Y2TA 4PRHB 4LCUB 4MX7A 2WSDA 4JFFA 5F7MC 3SPIA 1F4HA 1MHPL 3W9EB 4OF7A 2ILLA 4MNQA 3APMA 3HE7A 5DR5H 3VACA 4X6CF 2D2OA 4QRPA 5F89A 4LAQL 4Y19B 3BAEL 3R06B 2RBLA 4M1GL 3W5NA 1BYOA 4X6EB 3IKCA 5F3FA 3ULVC 4BFOA 2BSBA 3KE0A 2J8UA 4TRPH 5DJXB 3GSNH 2X28A 1R5VA 3BPNC 3FT3B 2NYKA 5ESVB 3TC9A 1XH3B 1CLYL 1JZDC 5J6SA 3VXTB 2C8NA 4JM2F 2X89A 4UYPA 4KQ3H 4U1SA 5KYYA 4E68A 1IGTA 4G6MH 1LO3L 3LRSB 4MFHA 1WAAA 4M1GH 5AEAA 3KLAA 4A2MA 1LJMA 2FL5B 2RHEA 4LSQH 4WW2A 2PYEB 1UEYA 5AOIA 1QUNB 2JSFA 4YDIH 4BK4A 2R0WL 3RWDA 1R3KA 3S48A 4HWEH 2AQSA 3NJGA 3VRIA 2J6EL 3IPEA 4ZZKA 3HMXH 5GGSY 1CI3M 5INDA 4XB7A 4LOUD 4JCWA 4DZBA 1MCLA 5FWQA 3U6XS 4JCLA 1ZT1A 2CKNA 5J0BA 4N2BA 3CE1A 2WKGA 3GSNL 3K2MC 5HDBB 5B3NA 5F72S 3HC4H 4UM9B 2VDKL 3ZZSA 1MJUH 4X4YA 4OLYH 4CRPA 1C12B 2CCWA 4LAQH 4XH2B 4R0LC 3N1GC 5DO8A 1QBBA 3QUXC 1KPVB 2EABA 5FHAL 4JFXB 4PTUA 5EU6D 4IMKA 3FT4B 3ILPB 4PGBB 2MOGA 1R5WB 4X6CE 4ZSOB 4AT6B 4NENB 1XH2A 3QUXA 2VTFA 3I84A 1SM3L 4NGHL 5IOKA 2CO4A 5ISZB 1FIGH 4R4BA 1S5HB 4OY9A 1KTKE 1HI6A 5FEBA 3FONB 1DBAH 3K1DA 4X7FC 5EN3A 3FK3A 3WAJA 5C0CE 2X1XR 3GHBH 1O6SB 3WHE0 5AD0B 5KS9A 1FORL 2G0KA 1YEKH 1R46A 1PDKA 3DVIA 4NM8H 4ZXBD 1HWGB 2QVKA 2Q7YB 4HS6A 4IS6A 4CSZA 3IFPA 2GSIA 3LVTA 3O6FA 2CBTA 1ZLWH 3DX9A 3IS0X 1WFMA 3CZFA 5E03A 5DMKB 2AI0H 3KM2A 2WOBA 1NCAH 4Z3FA 1JNLL 1A9EA 3B2VH 2XVBA 2FQEA 1YN7A 1ROCA 4QTFA 5CD3A 4FNUA 5D70L 5B7EA 1LO2H 3JV6A 2BHFA 5E6IA 4M93C 5JUEL 3V4UH 4LCWA 4JR9L 3VM5A 2X6BA 3QXAA 4PJBB 3B2DC 5HP5A 3B1TA 2P5WA 4KK8D 5FUZL 1FO0H 1MAJA 1MPAL 4LASH 1UQSA 3IRCA 5F9WB 2BRRL 4NZUL 4CU8A 2BJMH 2R69L 1OT2A 1D9KD 1ZV2A 2VMDA 4YFDB 3EYSH 3TJHD 2CCVA 3OKDB 2VKWA 2OJEB 2J5WA 2BSDA 4Q9QH 3HC3L 5GZOC 5TE6H 4HWNA 3BPOB 4Y5VA 5DLLA 5FA3A 1CD1A 3SJVD 1QRKA 4X9HA 1PZ5B 2OXHB 3PWNA 2GBTA 2X4UA 2YPLB 2PPFA 2ARJB 3K8MA 4RMQA 1P4LA 1T3FB 3RA7L 4XNYL 5AZEL 3VFPB 3OHXC 3VFVB 4RISH 1IEBB 3Q0HA 4NKIL 1N10A 5CJXA 3HB3D 2JIXD 4K5NA 3D0LA 4IRJA 4XVUD 2AKRB 1NEPA 4Z7OE 2H9GA 3L48A 4OGXH 2R27A 4CBPA 1YO4A 3W2DL 3FRPA 5I19L 5AYQA 1WBXA 4LCWD 1VIWA 4NKDA 3EIFA 4YXLL 1RUPH 4W9EC 1J9QA 4YL4A 1G9ML 3MRQA 5EMYA 2NX5B 3ZZQA 4DP0X 3DMMB 3MLYL 1FYHB 4S11A 2UWEF 1A9BB 4ZW5A 2JK5A 4LCCA 3NZ8A 2R23B 4NZUH 3HHSA 2XN2A 4WK2B 5IROC 2GJZB 2LW3A 5IROD 1ZTXL 5ICZB 3IU4L 3WLBA 5EUKA 1B9KA 4DP1X 3DHJA 1BM3H 3I9PA 4HC1L 3O2WL 1SXCA 1OCRB 2EDDA 4Q6KA 4M8UA 3S35L 5JPNA 3D33A 3IU3A 2RQ8A 2SODB 3FQYA 1VZGA 1Y07A 3SYAA 4PRDA 3QNYB 3F7RA 4JW3A 5CD5D 1VKXB 2R4SH 1WP6A 2AV7A 4FJZA 4MJ6B 4YDJA 2FR4B 4K07A 1XTMA 3KXFA 3PDGA 3FQXB 4OLZL 1E5ZA 2F54A 3MGAA 2FWOB 35C8H 3SDCB 5DQDH 3FH7A 3FZUD 4R4FL 5DI8A 1OCWH 4B9CA 1FL3A 4MVBD 3EO9H 4UDUB 1MUJA 1XZ0A 1YY8A 3OJVC 4KZEH 4YBLC 5I71B 3TNNB 3V52L 5D7LB 3WNJA 3VFNA 1JF1B 1J1OH 4JZNB 3ZY7A 1V54B 2A7BA 3CN3A 1DEDA 2BVPA 3K2UL 4JRLA 5IQ7H 1O7DE 1BD2A 1MWAH 5H4YA 1T83A 4HDIA 2IOOA 3BT2L 1FFPB 1G0YR 5KYNA 4MCZA 4PHXA 5HI5D 2YXVA 3CC1A 4TQHA 3UJTL 4XP6L 1UEMA 5FLUA 4FQQA 5AVSB 2ZX6A 4PY7B 1TQVA 3QDJD 4FDWA 4OCSH 5FKAB 3T77B 1U8PB 1XCQA 3SQBB 2QFRA 3BH9A 2H2SC 1LD9A 4HPHA 1FNSL 3QZPA 4EI5D 4H40A 5ESVA 5I74C 3Q8FA 3L7FB 1N6QL 1X7QB 2R29L 4GUPB 2D3LA 3H7BA 1IAKA 1ZS8A 3C2AH 4WFGE 2NW3A 2MPVA 3L16A 1WLHA 3US0A 3O2VL 3B2PA 3T2LA 2BSSA 4MZIA 7FABH 4I9WE 1DJSA 5DS2A 3NCWA 3D18A 3PP4H 3OMNB 2X6UA 2HJFB 3T8MA 4KKZA 3C5ZB 1ZDQA 3BAEH 3JUZA 1G9NC 4AIOA 1X6NA 4WWID 1IE5A 1MFDL 1JYNA 4ZXBC 1WBYB 2QKIC 4QO1B 3T5WA 3LIZL 2DLTA 1IARB 2P80A 4U1IA 2HSIA 1BJ8A 3ELQA 5MEQB 3I9GL 4ZUWB 4BK8A 1PS3A 3IT8D 4QHUB 1XGPB 1ZT1B 1E50A 3GT6A 4AQ8C 1NWPA 1E90A 2A9BA 3A4FA 4ES8A 4AQ1A 3CSFA 3M17B 4TVUA 2IWEA 5D7IF 2FQFA 1BM7A 4IJTA 4Y4HD 5JQHC 2ZCHH 3TT1H 1NFKA 5DQJB 5L7XL 2JI2A 1P7BA 4XH2A 1S5IH 2Y36H 5CXPA 1I7ZA 2JLLA 4K3EH 4JFHE 1XGTB 5A43C 3Q6GH 2DM2A 4G43B 4AJYV 4KDWA 1AGBB 4IIQA 1A14L 1OSYA 3IEAA 5DC2A 1T03H 1JVOA 2WXPA 1NBZB 1CF1A 4ODSH 1M6UA 1U3YA 1EO8L 1S5HA 4LVEA 4KMTH 5AOKA 2YARA 5I82A 5IB5B 5IR1B 4KTEH 2BNRD 2BVYA 3EG9B 4KZDH 1IBBA 4OCXH 4TUUA 3ZYJA 4K3HA 3NDYE 3LH8A 1KYAA 4FL4B 4A66A 1A6AA 2Y7LA 2V2XA 4N2OA 4R5XA 5DZPA 1XCTA 2IPUK 1EAJA 4QRRA 1JPGA 1J0JA 3VG0L 4N5ED 1U8JB 3CZFB 1IIIA 1JCVA 1S9XB 3OPUA 3PCYA 5EN2B 3IJHA 3BQUA 5TF0A 4Z1PA 3QORB 5J12B 4Y4KA 4YZFE 3SY6A 1X4XA 4NQDA 5T3ZD 5IVNA 1VGEL 4NRXA 4X80L 2HRLA 1VZHA 1RV6X 1XB8A 3DX6A 1BQLL 2PCPA 4UNIA 5C0CA 1N70A 4DQOL 2Q8BL 5D6DC 4NJAH 4F33A 1DLFL 4PCYA 5FOJA 1INQA 3QUXB 1KY6A 4X7DC 4PJBA 3C60A 1F4YH 15C8H 3GLZA 3IFOB 3MNWA 4G2AA 3WJMB 1WFUA 4Z3EA 3VXMD 4YHNB 1L4IA 3GS7A 3OKDA 2WQRA 3T3PF 2C5DC 3H4HA 1HEHC 1JIBA 2DW5A 4HCRA 2CLZB 5KSUB 5AVWB 4WFEE 2DWSA 1TZGL 5L4MA 1SYVA 2ID5A 1T0NA 1GC1H 4UB0H 3TPUB 5AW8B 2CIIA 2R8SH 4PJ9D 2WB1A 1WE5A 3ALPA 3OGOE 3P02A 4OJDH 5FAAA 5GS0D 3IPBA 2BHZA 4TLSA 5E9NA 1Z5YD 1JD9A 2Z7ZA 1VA9A 3SKNB 5FECA 3BHBB 2GTWB 3OKNB 3NJKA 1NBYB 1COBA 3R0MA 4YBQC 5FYKH 1Q9KB 2ZXDA 2AQRA 4NLAA 1EWHA 4QRQA 5GPRA 5EEXA 4JO3L 4FZ8H 3J2PA 2QHLA 3CVBA 4ZFOA 3FCSB 1CMOA 3QZWG 3MRPA 4YHML 2JXMA 3EGXB 1QBMH