4HUFA

Structure of 5-chlorouracil modified a:u base pair
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hufA00
5FDLA 1ASWA 1RTIA 1QSLA 4PUOA 5HRPA 1T03A 3AO3A 4RW9A 2Y1IA 2A1RA 2EX3A 2OPSA 1IKVA 1TK5A 1TK8A 1L3TA 1RNHA 4CHPA 2HHTA 1NK4A 4BWJA 1HMVA 4AILC 4DMNA 4C8LA 4W5TA 2HNYA 2ZQBA 1BQMA 3AVNA 5I3UA 4RW4A 4WE1A 4OGCA 4N41A 4JLHA 4IG3A 2HB5A 4DFMA 4FJJA 4OKJA 5HRRA 5T7BA 1Q9XA 4CJWA 4E1MA 1HQUA 3KLIA 2D5RA 2EHGA 3KLGA 1ZBFA 2XY8A 3P83D 3WNHA 3CM5A 3TAFA 5JS1A 4CF0A 2YV0X 3IRXA 3K59A 2PYLA 3BDPA 3RR8A 1RBVA 3QINA 1WSJA 1ITGA 4FW1A 4CGGA 4CIGA 4CECA 3K5NA 2DTUA 5E41A 4E19A 1IH7A 1EETA 2E6LA 4M3WA 4HVJA 4F8RA 3NF9A 4AHSA 1JLCA 4OPJA 2XY6A 3DRRA 3QEWA 2X6SA 2PZSA 3VQBA 1CXUA 4CJVA 3OYKA 4O0IA 5FRNA 1TAUA 1DTTA 4F3TA 4RG8A 4AHRA 1G15A 1HJRA 4R5PA 3TAEA 1UA1A 4O4GA 3QESA 1NJXA 3ULDA 1RDAA 1BCOA 2HHWA 1VSEA 2XHBA 3VQ4A 1EXQA 4CFBA 5C24A 4KO0A 3U6FA 1Y97A 2B6AA 1BGXT 3HPHA 1CZBA 3LP3A 1JLBA 4LSLA 1NJYA 3G10A 2HVHA 4W5NA 4DSIA 3TI0A 3QEPA 2KFZA 1HNIA 2BANA 3OYIA 5KRSA 3NH0A 1WAJA 3PY8A 3ZSQA 2YNFA 5KRTA 2Z1HA 4CFDA 3KD1E 4DQRA 4JRQA 1I39A 2HNDA 4NYNA 1QSSA 3NAEA 1VSKA 3B6OA 4E7JA 3L3UA 3AVMA 3AA5X 1VSLA 3VQ9A 3ZT0A 3OYDA 2IGIA 4KAZA 4Z4GA 4CJQA 4O0JA 1DTQA 3AVBA 4AHCA 4DWIA 3KK2A 3TR8A 1VSJA 3NF6A 5C42A 4FK2A 1MU2A 3ASMA 3V9SA 1S1VA 4I7FA 3L2UA 1ZYQA 5KTQA 4O55A 4UQGA 1SL1A 3TABA 4KB0A 4MFBA 3NHGA 4F2SA 3I8DA 1BIUA 2JLEA 1GOCA 1KLNA 1LAWA 4FJGA 4DSLA 3T19A 1HQEA 4KTWA 4N56A 4DTNA 2YHBA 2XY7A 1FKOA 2O4IA 1ASUA 3LAMA 1D8YA 1TL1A 1B9FA 1QQCA 3NCIA 4DTXA 1BQNA 4B8CA 3ALYA 2G8VA 4CGFA 4HHTA 2XO7A 3HT3A 2IDOA 4DF8A 1WN7A 2X78A 3SUOA 3OYAA 4FJ9A 2G8FA 2KQ2A 2YKNA 4CEAA 3V9UA 3H08A 2B5JA 1QSYA 1RCHA 4BDZA 4Y1CA 3V9XA 3TANA 1UOCA 1CZ9A 2IAJA 4FXDA 2P51A 4XIUA 3SPYA 3PO4A 4CJLA 4J2AA 4KHSA 1BCMA 1U49A 4KTZA 3SV3A 3I0RA 3VQAA 1T05A 1VSHA 3SV4A 1BISA 4I2QA 1EKEA 5KI6A 3ZT4A 3OYGA 4KREA 4CEOA 1YVUA 3NH1A 3HM9A 4F4KA 1FXXA 1CLQA 4AHTA 1D5AA 1WSFA 2ETJA 3HXMA 1HYZA 3C95A 1LW2A 3V1OA 4FLYA 3K5LA 3P1GA 4I2PA 4B8AB 4FLVA 2Z1JA 1ASVA 3OYHA 2YHAA 3KK1A 4CIEA 3RTVA 2HMIA 3PX4A 3SCXA 1TKXA 4ELUA 3S3OA 3THVA 1VRTA 4FLXA 3O3GA 4CJEA 4C8MA 2RN2A 2IOCA 1T7PA 4Z4IA 3ZCMA 2FBTA 3CM6A 4NCGA 3JYTA 4M3UA 2ATQA 1NOZA 5CZ1A 4M3ZA 4CJTA 3ZSWA 1LW0A 3MXIA 1HYVA 3CG7A 4LH5A 4M41A 3ZSZA 2X74A 4B9TA 4BDPA 4KHYA 3HL8A 1ZBUA 2X6NA 4Q0BA 4RW7A 3TARA 4IFYA 2BDPA 3VQ6A 3CFRA 2G8UA 1J54A 5KGWA 1J5OA 3V1RA 3AA2A 3AVJA 1QS4A 1Z26A 2HHUA 5HLFA 4YNQA 3AVFA 4DFJA 3HP9A 1LV5A 2G8KA 4B9SA 4LY7A 3EZ5A 2GBZA 2O4GA 2OPPA 1RT4A 1VSFA 2WOMA 3K2PA 4LSNA 4IFVA 3L2VA 5J2MA 4B9UA 4DS5A 2BE2A 3VA3A 4FK0A 3NBPA 1KVBA 3VQEA 2OZMA 2F96A 1QE1A 3KIOA 3TAMA 3V81A 3DLGA 1UWBA 1VRUA 3FFIA 3HP6A 4CJ3A 3OYMA 3SZ2A 3IAYA 1KVAA 3C94A 3OYEA 1X9WA 4H8KA 4DS4A 4ELTA 4QAGA 3DRPA 2OZSA 2Y1JA 3DYAA 1TK0A 5CZ2A 3KLHA 3QNNA 2DFEA 3VQ7A 3OS0A 3SI6A 5I42A 3HO1A 2KTQA 4DG1A 4KI6A 2OPQA 4DFKA 4J2EA 1JKHA 1TKZA 3V6DA 3DLBA 4Z4FA 4GMJB 4AH9A 3OS1A 3LWLA 4CF8A 4KKOA 4E7IA 2DY4A 3I0SA 1TL3A 2WONA 3LPTA 3LP2A 1T8EA 3AVAA 4CJUA 4CK3A 1B9DA 4HTUA 1L3VA 4GW6A 4EP4A 2OA8A 3P5JA 2BGGA 1HRHA 1W0HA 1S6PA 1S9GA 1C0TA 4CEFA 3C6TA 3OYJA 1L3SA 1S1WA 5C25A 3RRGA 2QK9A 1JLFA 4CJRA 4CGDA 3AVHA 2E6MA 2G8HA 1IO2A 3EYZA 4FZXC 2QXFA 4ZTJA 1SUQA 3KJVA 4CEQA 3LDSA 3PX0A 3ZSXA 4J2DA 4K8XA 4DSJA 4IG0A 3T1AA 3ZSRA 1NK7A 4PWDA 3C6UA 3HVRA 3LZIA 1S6QA 2KZMA 1SL2A 4Y1DA 4KPYA 4OLBA 2OYQA 3DMJA 4M3RA 3K57A 4RW8A 2QKBA 1J9AA 1KFSA 1D9DA 1JXEA 2RKIA 1UA0A 3DLRA 3F73A 4PQUA 4QOZB 3RWUA 2YKMA 4AHUA 1S1XA 1DLOA 1KVCA 1WSIA 4H4MA 1RT3A 3ZSYA 3LPUA 3KKRA 3WNEA 4CK2A 4CHYA 4E7LA 4DTOA 1XC9A 1RBUA 4BE1A 4CF2A 1A5XA 4CGJA 4B08A 4M3TA 5KGXA 1NKBA 2P5OA 1LWEA 3ZT3A 1RDBA 1HPZA 5DMRA 3IG1A 1U4BA 1JLEA 4E7HA 1N6QA 4DLEA 4Z4EA 5J2NA 2NUBA 3ITHA 5EU7A 3NGIA 1NK8A 3AO5A 1S5JA 1EX4A 3OYNA 2HHQA 3DLEA 2DFHA 3QLHA 4DQIA 4FJ8A 2PY5A 3NGYA 3RR7A 3A2FA 4FJ7A 1JL2A 1WAFA 3G0ZA 4IBNA 2XRIA 1RT1A 3CFOA 4YFUA 4JS5A 1GOBA 3KKSA 4CEDA 1SKRA 3HK2A 3DI6A 4FLTA 3BGRA 4FW2A 3SUNA 4B3OA 2FC0A 3TAPA 3S3NA 4HUFA 1C1BA 1D9FA 4DFPA 4ZHRA 2FBXA 4KV8A 4HUGA 3O4NA 3OJUA 3LP1A 1L5UA 4B9MA 3RMDA 1SL0A 3DOLA 3LP0A 4E1NA 3V1QA 3T3FA 3V4IA 1W9HA 3VQCA 1ZBIA 1N5YA 2YNHA 1BIZA 1SV5A 4CCHA 2HNZA 3SNNA 1C1CA 3IS9A 1RBRA 4J2BA 4FZYA 4DLGA 3M8QA 4DSEA 4DTRA 3ZT1A 3AA4A 1HYSA 3WNGA 3RMBA 1YTAA 4LH4A 3CQ8A 1NK0A 1YTUA 1I3AA 4EP5A 3CFPA 3KD5E 1VSIA 1GOAA 3OS2A 3OYLA 3L2QA 3K5OA 4OGEA 1IKXA 5CYQA 4CK1A 3HJFA 2HHSA 4DTPA 1XI1A 1IKWA 1B92A 4ID1A 3VQQA 3L8BA 3K58A 2HHVA 4CHOA 3QIPA 4E0DA 1IKYA 4PA1A 1RT5A 1RT7A 3NH2A 3KTQA 2VG5A 3O3HA 4CF9A 1JL1A 4FJHA 1KLMA 2D0CA 4Z0UA 2VWKA 3SQ2A 4EZ6A 3JSMA 2HW3A 3DOKA 1A5WA 1S9EA 2A1SA 3AVGA 3QERA 5HRSA 1NJWA 3QEXA 4NCAA 1YT3A 1WSGA 3MEDA 4M45A 3M8RA 1NK5A 1JLAA 3NFAA 4CHQA 3D45A 4CJKA 3KLEA 5J2QA 1TAQA 3EY1A 5CY4A 4Q5VA 2IC3A 3SPZA 4NCBA 1BI4A 2ITGA 4FLUA 2I5JA 3MECA 1XHXA 2YNGA 4DSKA 3LALA 2P5GA 4KFBA 2XY5A 4CGHA 4Z4CA 3HYFA 1NKEA 4N5SA 3QO9A 3VQ5A 3OYCA 2D0BA 1XHZA 4FJIA 3SYZA 3LWMA 1S1TA 4FJLA 4ZTFA 4Z4HA 3M8SA 1HNVA 1BHLA 4M42A 4DTJA 3DLKA 4DTSA 2F8TA 3QETA 4BE2A 3DLHA 3V9WA 2AJQA 3NF7A 3HPGA 2ZE2A 1U48A 4E7KA 1X9SA 1NKCA 4DTUA 2D0AA 1KRPA 2IS3A 1L3UA 3PUFA 2VG6A 4CJ5A 4JS4A 4CFAA 4CESA 2QKKA 5J1EA 1QHTA 3RRHA 2Q3SA 3VA0A 3L2WA 4OLAA 4W5OA 4KRFA 1JXBA 1XWLA 4OPKA 1LWFA 4CJFA 1IG9A 5HP1A 2G8WA 4FCYA 4CJPA 5DK5A 3AVCA 1LWCA 5FROA 5SZTA 3U3GA 3O3FA 4DQQA 1C0MA 3E01A 4RW6A 4DQSA 3AA3A 4C8OA 4CF1A 4FJXA 4OJRA 4C8NA 3K5MA 4B9LA 3PO5A 3AV9A 2KFNA 1TV6A 3VQ8A 4CIFA 4BWMA 4W5RA 3CYMA 4CE9A 1CXQA 1S1UA 1FK9A 2HHXA 3OJSA 5JS2A 3MXJA 3L3VA 3MEGA 3DM2A 1BI4B 1KFDA 3AO2A 1RDCA 4CEZA 1SKWA 2KZZA 1QTMA 3VQPA 3NF8A 4FJNA 3ZT2A 1C6VA 1K6YA 4FM2A 1NK6A 4DU3A 4E3SA 2F8SA 4OKKA 4GVMA 4BDYA 2OPRA 4N76A 2JGUA 4KTQA 4DU4A 1Q9YA 3AVIA 4EZ9A 3VN5A 3TAGA 1TKTA 1TVRA 4FYDA 1R0AA 1RDDA 4TSXA 3QEVA 1EP4A 3B6PA 4CEEA 3PV8A 4FLZA 3AO4A 2RPIA 3HVTA 4FK4A 2GUIA 3KLFA 4IKFA 3SQ0A 1KTQA 1RT6A 2KW4A 3AO1A 1FKPA 4FM0A 3SJJA 4C8KA 3AVLA 1Q8IA 4FM1A 3L2RA 4DTMA 4HCBA 3QEIA 1A5VA 4AHVA 3HSTB 3LANA 3V9ZA 4FJKA 4K8ZA 3OYBA 3S9HA 4M3YA 1C1AA 1RTDA 4KHNA 4KI4A 3SUPA 4E89A 5FRMA 4NYFA 1TGOA 4B9NA 4F2RA 4KB1A 1TKDA 3QIOA 4ID5A 3LZJA 3LAKA 1WLJA 1UAXA 3ISNC 4BACA 3ZSOA 4F3OA 2VWJA 2DFFA 2PYJA 4MQ3A 2VG7A 1X9MA 2Z1GA 1NK9A 4OVLA 4FJ5A 1VSMA 3NDKA 1VSDA 4CGIA 3RMAA 4ELVA 4CJ4A 3RMCA 4FJMA 3D0PA 4DU1A 4M3XA 2ZD1A 3ZSVA 1J53A 1JLGA 2R7YA 5SWMA 2FBVA 3TWHA 1RTJA 3NE6A 3PX6A 4HCCA 5D3GA 4CHNA 2YNIA 1RILA 2Z1IA 4ICLA 5HBMA 3QNOA 3MXMA 3OVNA 4KHQA 1RT2A 3SUQA 1U45A 1NOYA 4CEBA 4JRPA 4G1QA 4LD0A 4DQPA 3DRSA 2B4JA 1U47A 1NJZA 3MEEA 4FVMA 3HPOA 1SKSA 4CERA 3O4QA 1Z25A 2FBYA 4O5BA 3WNFA 1WSHA 4IDKA 3AVKA 4PY5A 1RBSA 1KSPA 1BL3A 2GV9A 3F9KA 4N47A 1RTHA 4CJSA 2E4LA 1ZBLA 3S3MA 4L8RB 4W5QA 1LAVA 1WSEA 2W42A 1ZBHA 4CFCA 3VQDA 1JLQA 3NGZA 5J2PA 4FZZA 2P1JA 5K14A 5HROA 3U3YA 1RBTA 3MAQA 2HVIA 3SQ1A 2RF2A 3M8PA 1X1PA 4O44A 5CYMA 1KCFA 1WNSA 3SQ4A 3UIQA 1REVA 3KK3A 1F21A 3OY9A 4B9VA 1U04A 4KHWA 2G8IA 4QCLA 1O1WA 4KHUA 4I9QA 4BE0A 4I9LA 1VK0A 2LSNA 4DSFA 4OKEA 3TAQA 4DF4A 4FLWA 4H4OA 3OYFA 4HUEA 4CHZA 1C0UA 5HRNA
chains in the Genus database with same CATH superfamily
2Q2RA 1ASWA 1RTIA 3THWB 1T03A 3O1BA 1RNHA 1YVNA 4CHPA 2HHTA 4AILC 3C65A 2HNYA 3AVNA 5I3UA 4OGCA 1K73O 3R8EA 1N32K 5HRRA 4WQ5A 1TYQA 2CH6A 1VQ4N 1Q9XA 1HQUA 4H5VA 2EHGA 1ZBFA 2XY8A 3WNHA 3THYB 3CM5A 4H03B 3IRXA 3BDPA 1WSJA 3K5NA 4B3TK 3CQXA 3OHRA 3DXMB 4HVJA 4JKFA 4AHSA 4OPJA 3E1YA 4MO4A 2NNWA 4CJVA 4O0IA 4DR6K 3J8AA 3VENA 3TAEA 1UA1A 2O8DA 3MN7A 1NJXA 4BRDA 3CCLN 1HNZK 2BH1A 3AAQA 4KO0A 1YJWN 2B6AA 3FZKA 1CZBA 1NJYA 5KQDA 4DSIA 3QEPA 5GADP 3AAPA 3O9SA 1WAJA 4JRQA 4B1VA 2HNDA 4NYNA 4E7JA 3VETA 3J7ZO 3VQ9A 3ZT0A 3OYDA 2IGIA 4KAZA 4JHDA 4AHCA 1DTQA 3KK2A 3NF6A 4ILJA 1MU2A 3QBXA 1S1VA 4JKDA 1K8AO 4I7FA 3C0BA 5KTQA 4DUYK 3H3OB 4JI1K 4MFBA 3NHGA 2GWJA 1BIUA 1LAWA 3IMXA 3T19A 4IO8A 5IT9O 3SJHA 4F9OA 1FKOA 2O4IA 3LAMA 4H0YB 5AQJA 1B9FA 5AQXA 1BQNA 3M6GA 4HHTA 3HT3A 2X78A 1JCFA 3SUOA 4B1XB 3OYAA 2YKNA 4WYBA 1RCHA 2FF3B 4BDZA 3WEEB 3F5TA 4XIUA 1RGIA 3KZBA 3U9DA 3F2KA 3O9TA 1WOQA 1BCMA 3VGKA 4KTZA 3O08A 1VSHA 1EKEA 4KHPK 1NGGA 4AHTA 3UKRA 1HYZA 2FXUA 5GAGP 3P1GA 4B8AB 4FLVA 2FSKA 2AP1A 3OYHA 3BUZB 3RTVA 3SCXA 4ELUA 2A42A 5FPNA 3MX5A 4FLXA 3O3GA 4U7BA 3CCRN 1CZAN 4C8MA 1T7PA 4Z4IA 2QM1A 2FBTA 3SMPA 5HOOA 1HYVA 4KHYA 4Q0BA 2V51B 5AQNA 3FGUA 2G8UA 3Q7CA 4CZLA 4I6MB 4YNQA 3H6EA 3EZ5A 1EQYA 1VSFA 3BP8A 4LSNA 3K2PA 4FK0A 2BE2A 3VA3A 1T6DA 2E1ZA 3NBPA 4NO7A 3KIOA 5BN8A 3TAMA 3RVCA 4B1UB 4K42A 5JLHA 4MDBA 5F2RA 4BRCA 2P9PB 4DS4A 3DRPA 2OZSA 1QZ5A 5CZ2A 5I42A 4DG1A 3L4IA 2OPQA 3DLBA 3CXCM 4KKOA 2DY4A 3I0SA 4JD2B 3P5JA 2Q1NA 4AM7A 2BGGA 1HLUA 4HWIA 2HBMA 4DR1K 1S9GA 1C0TA 1L3SA 5CHIA 1S1WA 1JLFA 4GV6A 3M5RA 3EYZA 3VTIA 4ZTJA 3CMEN 3PX0A 4J2DA 4CEQA 4IG0A 2F4VK 3PLAA 4DHYA 3LZIA 2GX9A 1SL2A 4OLBA 4CD3A 2OYQA 3WXMB 3VF4A 3K57A 4RW8A 2A40A 3H3NO 1YITN 1X9JA 1D9DA 2RKIA 2GELA 4O5FA 3DLRA 4PQUA 3UE5A 3RWUA 1RT3A 1U2VB 3LPUA 3KKRA 2QI2A 4DTOA 1XC9A 1GLCG 1RBUA 5BPMA 1NKBA 1Q81O 1HPZA 1U4BA 1JLEA 5EU7A 3NGIA 2HHQA 4R79A 2PY5A 5AJ3K 2KLAA 4IBNA 1RT1A 4JS5A 3KKSA 3EO3A 3DI6A 3BGRA 2FC0A 3TAPA 1KC8O 1OVYA 4HUFA 1D9FA 1Q86O 4DFPA 4ZHRA 3OJUA 1QQNA 1O13A 3LP0A 3TSUA 1W9HA 4ISEA 3SNNA 1DT9A 2FSNA 3AY9A 3SBTA 2Q0UA 4DLGA 3CJCA 4DTRA 2A3ZA 2Q97A 3ZT1A 3RMBA 1I3AA 2P9SA 2HHSA 4ILHA 1IKWA 1B92A 4ID1A 4YOVA 4CHOA 2YJFA 3H45C 1RT5A 3NH2A 1RDUA 3R3LA 4YY3K 5B8HA 3CD6N 3NMUA 3ZX2A 3SQ2A 4BRHA 2HW3A 4EHUA 1A5WA 3PIPL 1NJWA 4NCAA 1JCEA 5ADXA 4DR7K 1DGKN 3MEDA 4M7XA 4YOUA 4M45A 4CJKA 3M8RA 4LF7K 2IC3A 4NCBA 1BI4A 2YNGA 4KFBA 3HYFA 4MLEA 4FPAA 3VQ5A 5BRFA 4JKBA 1HX1A 1S1TA 4Z4HA 2UUAK 1BHLA 2F8TA 1OH6A 3C6AA 3V9WA 2AJQA 3NF7A 5H1SQ 1U48A 4E7KA 4FWNA 1KRPA 2IS3A 4CJ5A 4CFAA 3UKUB 1QHTA 2P9IA 3VA0A 3VERA 5AFUA 1XWLA 4FO0A 3UB5A 4FCYA 4CJPA 2NRTA 3O3FA 5FROA 5SZTA 4DQSA 1P8ZA 3AA3A 4C8OA 4BRNA 4FJXA 3K5MA 3CYMA 2P9KA 1VQPN 3MEGA 4JKGA 1KFDA 1QTMA 3ZT2A 4L3QA 2F8SA 3EN9A 3OTOK 4IOAL 4EZ9A 1KXPA 4JKCA 1SS6A 4BR9A 3LDQA 4AF1A 1R0AA 1EP4A 1VQLN 3CHWA 1T6CA 4CW7B 4FK4A 3SMSA 1RT6A 1WBBA 4FM0A 4C8KA 4FM1A 4B1YB 3LANA 4WQ4C 5AQRA 3V9ZA 5F1XA 4E89A 2NRHA 5AZJB 3LZJA 1WLJA 4F3OA 5BREA 1GLJO 2NRZA 2D1KA 4OVLA 1VSMA 5AQMA 4CGIA 5BRDA 3RMCA 4DU1A 4M3XA 3ZSVA 3TWHA 1RTJA 2UUBK 4BG8A 4CHNA 3D7EO 1NGBA 4CEBA 4DQPA 3DRSA 3SAHA 1U47A 1NJZA 1SKSA 2HBJA 2E2QA 3TTDA 2CH5A 2FBYA 5AQKA 1QZ6A 4BGAA 2W41A 1KSPA 1BL3A 1QQOA 3F9KA 1RTHA 5LJWA 2VQEK 4BG9A 4IOCL 1WSEA 3VQDA 1JLQA 1VAZA 5HROA 1RBTA 3CCMN 3SQ1A 3CCVN 4UY8O 4JAXA 3SQ4A 1REVA 4KHWA 4DUZK 4IZ9A 3PSFA 4DSFA 3TAQA 4A62A 4HUEA 5FDLA 3CPWM 3R1XA 4PUOA 5HRPA 4RW9A 2A1RA 1L3TA 2OPSA 1TK8A 2E2PA 3SBGA 1H1VA 3B8AX 3HSCA 3S41A 4BWJA 2RE2A 3U8XA 4QS7A 4DMNA 4C8LA 4XH4A 4W5TA 1Q7YO 3D2EA 4WE1A 4JLHA 2HB5A 4DFMA 2YHWA 4CI6A 3KLIA 3WXJA 3TAFA 4CF0A 3CCUN 2P9UB 1QVFM 1ITGA 4CGGA 4CECA 5E41A 4E19A 4FSVA 2DPNA 5IWAK 3ULEB 2PZSA 3VQBA 1GLBG 3MN5A 3OYKA 4EIAA 3N4QA 4RG8A 1G15A 1HJRA 5KPRA 5AQHA 3QESA 1BCOA 2XHBA 2GUPA 3O4WA 5C0YA 3U6FA 3MMVA 4H0OA 1BGXT 1JLBA 3DXKA 2Q36A 1HNIA 3OYIA 5KRSA 3NH0A 1NMDA 1YUWA 4DQRA 3MK6A 3R6MA 4CZKA 4C23A 3NAEA 4O8KA 2E88A 1OVQA 4LFAK 4Z4GA 3AVBA 2E2NA 3O80A 4DV4K 3J80O 3V9SA 3VF6A 3L2UA 2UU9K 1NNEA 1T44A 1C0GA 4UQGA 4BR5A 3I8DA 5BR8K 4LF5K 1KLNA 2NRXA 2HOEA 4LC9B 1VQNN 4N56A 2F7TA 2YHBA 3OA9A 1D8YA 1TL1A 4A57A 5BRHA 2W6KA 1QQCA 3NCIA 1IG8A 2O8DB 4B8CA 3CERA 2XO7A 4H0TB 4DF8A 4CZHA 3MWPA 4YHHK 4JKAA 4FJ9A 2KQ2A 3H08A 2B5JA 4B1WB 3P39A 2O8BA 1CZ9A 2IAJA 2P9LA 4FXDA 3PO4A 2QW9A 4KHSA 5KQ8A 5KI6A 3ZT4A 4JI5K 3O5BA 4CEOA 4JHDB 3JAMO 3NH1A 1GLLO 1WSFA 2QWNA 2E5LK 4I2PA 2Z1JA 5DM6L 3QDKA 1G99A 2YHAA 3KK1A 2O8CA 1TKXA 4PL8A 3S3OA 1E4FT 4C1NK 1VRTA 4K0KK 2JWKA 2RN2A 3LDPA 3ZCMA 3CM6A 4M3UA 1NOZA 5GIOA 4CJTA 1LW0A 3ZSZA 4LH5A 2QWLA 4M41A 4BDPA 3ZEUA 2FLOA 1HPMA 1HUXA 3CJ7A 3TARA 1SZ2A 5I9EB 3O9QA 5KGWA 1NGCA 3V1RA 5M1QA 3AVJA 1QS4A 2HMPA 1XMQK 3AVFA 4DFJA 1K8KA 1LV5A 3VEXA 4LY7A 4NB4A 1GLEG 2IIRA 2WOMA 3E9LA 5J2MA 1HKBA 3H46O 5FLXO 2F96A 1QE1A 3V81A 5ADXH 3HP6A 4CJ3A 3SZ2A 3UKRB 3OYEA 4DV3K 2UXCK 4H8KA 4FOEA 2Y1JA 3DYAA 3KLHA 3QNNA 4B1ZA 3OS0A 3SI6A 3HO1A 3A5NC 3CETA 1JKHA 1TKZA 1D4XA 3LWLA 2QWMA 4H5WA 2WONA 1T8EA 4CK3A 3SAFA 1L3VA 4A59A 4X65K 2OA8A 1V4SA 3CJAA 4BRMA 3MCPA 5TKYA 1HRHA 1W0HA 1V4TA 1S6PA 4CEFA 3IKMA 3OYJA 5C25A 5AFUH 5CR4A 4CGDA 1IO2A 1SUQA 3LDSA 2PFUA 4K8XA 3D2FA 3T1AA 3ZSRA 4PWDA 3HVRA 3BY5A 2KZMA 5AQSA 4KPYA 4NXMK 4M3RA 2WC9A 3RSEA 3I56N 4QOZB 1DLOA 1KVCA 4BQZA 4FWMA 4FL9A 1A5XA 4CGJA 4B08A 1BUPA 4BY9C 3ZT3A 1Q82O 3IG1A 1KAYA 1LOTB 4HTLA 4E7HA 2HF4A 4Z4EA 3ITHA 1NK8A 2VWBA 4FWKA 3ID8A 4O8UA 4DQIA 3RR7A 1X3MA 3A2FA 1JL2A 1WAFA 2XRIA 1SKRA 1XNQK 1GOBA 3HK2A 4FLTA 4FW2A 3SUNA 3S3NA 1OH8A 3M3ZA 3GG4A 4BRLA 2FBXA 4KV8A 3O4NA 3LP1A 4XH1A 1L5UA 1SL0A 3DOLA 4E1NA 3V4IA 3VQCA 1GLAG 4PL7A 1BIZA 3ZYYX 4FZYA 4WQ4A 2UXDK 4JI4K 3THWA 3AA4A 4LH4A 1MWMA 3CFPA 3OS2A 1K9MO 4OGEA 1IKXA 2V7YA 4JK8A 5CYQA 5FPEA 4DV7K 3HJFA 4DTPA 5C2FA 3K58A 3L8BA 4IJAA 3E9PA 4E0DA 4PA1A 4FVUA 1RT7A 2VG5A 3O3HA 1JL1A 5AQWA 4Z0UA 3THXA 4EZ6A 2ASMA 1S9EA 1XMOK 3QEXA 3VMFB 1WSGA 5LMNK 2QTDA 1NK5A 3CC4N 3NFAA 1S3XA 4CHQA 3SPZA 5CY4A 1VQ7N 4IEEA 5LJVA 2IVPA 1XHXA 4CZEA 4DSKA 3LALA 2WBNA 3P4IA 2XY5A 3FLCO 4GY2B 1NKEA 3QO9A 2ITMA 3SYZA 3LWMA 4WFAL 4M42A 1HNWK 4G9ZA 3P31A 4BE2A 4B3SK 5M1PA 4CZGA 3G71N 2ZE2A 3MN6A 1NKCA 1L3UA 2VG6A 3FZMA 1X3NA 4CESA 4ISFA 3T69A 3L2WA 4W5OA 4OPKA 1NBWA 1LWFA 2ZM6K 5DK5A 3U3GA 1C0MA 4CF1A 1BWFO 4OJRA 4C8NA 4B9LA 3PO5A 3AV9A 1TV6A 4BRAA 2HHXA 4LF6K 3OJSA 5JS2A 3MXJA 3L3VA 3DM2A 1BI4B 3AO2A 2QWOA 1RDCA 4A5AA 4A2AA 3NF8A 1K6YA 4WFNL 4FM2A 4E3SA 4DR2K 2HF3A 4OKKA 2HBKA 2JGUA 4QS9A 1EWRA 2E20A 4DU4A 1NGFA 3AVIA 1Q9YA 3TAGA 1TKTA 1TVRA 4M63C 4C1NI 4KH6A 2KW4A 2NRRA 2P9IB 2NZTA 1Q8IA 4FWRA 3QEIA 3I8BA 4AHVA 3HOSA 5C2DA 3OYBA 3S9HA 4F2RA 3QB0A 4KB1A 4GNIA 1KD1O 5EOYA 2P9KB 3C7NA 3LAKA 4JKEA 1UAXA 4K25A 1BO5O 2A5XA 4WCEL 4MQ3A 3ZX0A 4JKGB 2Z1GA 1NK9A 2O8FA 2P9NB 1VSDA 3D0PA 3A5OC 2ZD1A 1JLGA 3N4PA 4KBOA 3PX6A 5D3GA 3AGRA 1RILA 2YI1A 4FWPA 2Z1IA 1RT2A 3SUQA 4IJNA 1U45A 5AQZA 2BUPA 4G1QA 4LD0A 2ZGYA 5FPMA 3ZETB 1Z25A 4O5BA 3CC7N 1WSHA 4MLHA 4PY5A 1RBSA 1SQKA 4CJSA 4U67L 4L8RB 1LAVA 4V19S 2P9PA 5J2PA 2A6AA 1HJOA 5CE3A 3MAQA 3O1WA 5EY4A 2RF2A 3OBYA 1ZXOA 2G8IA 3KK3A 1F21A 5LMUK 4B9VA 1U04A 4PKHA 4I9LA 1VK0A 3WXLA 4OKEA 5AQGA 3O6WA 1C0UA 3MXIA 3GBTA 3KWGA 1QSLA 2PBDA 3FE1A 3AO3A 2EX3A 1TK5A 3HTVA 1NK4A 2Q31A 1HMVA 1BQMA 4BR2A 4RW4A 4CZIA 4X64K 4N41A 2HHHK 4IG3A 3T1HK 4FJJA 4OO1J 3D6RA 3P83D 3L0QA 2YV0X 3K59A 2PYLA 3RR8A 3QINA 3IUCA 4FW1A 5EVZA 2E6LA 3CCSN 4F8RA 3ID6A 1KAXA 2XY6A 3DRRA 2X6SA 1CXUA 5FRNA 1DTTA 3WXIA 4R5PA 1VQ8N 3P38A 1YHQN 1VSEA 1VQMN 3VQ4A 1QHAA 1EXQA 2ZJQL 4CFBA 4KH5A 5C24A 2KFNA 2HVHA 3G10A 3TI0A 2KFZA 4JI7K 3ZSQA 5ELZA 2VGMA 4CFDA 3KD1E 4JYAK 3LM2A 3D2EB 3HRGA 3L3UA 3AVMA 3KHYA 1VSLA 4IO9L 4CJQA 4O0JA 4DWIA 3TR8A 1VSJA 2UUCK 2O8EB 4FK2A 5M1FA 2OCEA 1ZYQA 4BGBA 4O55A 3C6HA 4FPBA 3TABA 4KB0A 4F2SA 1N8RO 4FJGA 4Y0WA 3TSPA 4CD1A 3VEZA 3CPEA 1ASUA 4LF9K 3LL3A 3MX2A 3FZFA 2IDOA 1WN7A 2ZJPL 3QFPA 2G8FA 4CEAA 4JI0K 1E3MA 3V9UA 1QSYA 5MLCQ 1W97L 1UOCA 4IFEA 2QA4N 4NLBA 3SPYA 4XH5A 5GAEP 4J2AA 4BC4A 1T05A 1BISA 4I2QA 4KREA 3EE8A 3HM9A 1FXXA 1D5AA 3C95A 1LW2A 3WT0A 1ASVA 2HMIA 5M1KA 1ATNA 3THVA 3VGMA 4CJEA 4FWOA 4NCGA 4CZFA 5CZ1A 1Z6RA 4M3ZA 5BPNA 3ZSWA 1J6ZA 4CZJA 3CG7A 1ZBUA 2GTDA 4IFYA 2BDPA 3VQ6A 1Z05A 3L4QA 3AA2A 3NVMA 1ATSA 1Z26A 3EZWA 3QMLA 4H0XB 4DV0K 5HLFA 1NM1A 4B9SA 2O8BB 2OANA 2GBZA 2OPPA 5AQYA 1RT4A 3A0IX 2P9LB 3BZCA 3L2VA 1OH7A 3VQEA 4BC2A 2OZMA 3VTHA 3DLGA 1UWBA 1VRUA 3GL1A 3FFIA 5AQFA 3OYMA 3IAYA 4BRPA 2YHXA 3BZKA 4GVEA 1X9WA 3M1FA 1XNRK 4ELTA 4QAGA 1TK0A 4JV5K 3TTFA 2DFEA 3VQ7A 2NRVA 4KI6A 4J2EA 4BRKA 3V6DA 3CCJN 4BQLA 4CF8A 2QWQA 2KHOA 3LP2A 4QS8A 3AVAA 4CJUA 4HTUA 1BOTO 2V52B 4GW6A 1MDUB 4LF4K 4K43A 3ZEUB 1N36K 4GKKK 5GAHP 3RRGA 4OX9K 2QK9A 3JS6A 2PAVA 1NGIA 3AVHA 3U4LA 2G8HA 1K8KB 2WFBA 1DKGD 2QXFA 3EL2A 4CVNE 3ZLJA 4BREA 3C6UA 1S6QA 1TYQB 3H1VX 1WUAA 4KH4A 3CMAN 2QKBA 1J9AA 1JXEA 3IFRA 1S1XA 5AR0A 4CK2A 3FZHA 3WNEA 4CHYA 1EO1A 5KPZA 5JVGL 4BE1A 4CF2A 1BU6O 5KGXA 1LWEA 1RDBA 5DMRA 4BROA 2JWLA 3W3DA 1IV0A 2D4WA 5J2NA 4LF8K 1XUPO 2VQFK 1ESVA 3AO5A 3OYNA 1EX4A 2DFHA 1VQ6N 2ZWHA 5C12A 4FJ8A 4FJ7A 4BRQA 3CFOA 4JK9A 4YFUA 1BA1A 4H5NA 4B3OA 4RWTA 5AQLA 1C1BA 2RHKA 4JEPA 1W2BM 4YORA 3V1QA 3T3FA 2ZGZA 4GV9A 1YF5L 3AGKA 3D2FB 4CCHA 2HNZA 1RBRA 3M8QA 4DSEA 1YTUA 3CQ8A 1VQ5N 1EWQA 3ENOA 3OYLA 4CK1A 1VQON 1XI1A 1WB9A 2I7PA 2HHVA 1U6ZA 2YCHA 3TTCA 2ZJRL 1J5EK 3KTQA 4B3MK 1KLMA 4BVPA 2YJEA 2V7ZA 5A2QO 2A1SA 3AVGA 5BR9A 5HRSA 3VEYA 4H5TA 3KLEA 4IXCA 1TAQA 3EY1A 4GKJK 4FLUA 1YI2N 3MECA 2P5GA 4Z4CA 2UYTA 3OYCA 4PHTX 1XHZA 4FJLA 5FPDA 3FZLA 3M8SA 1HNVA 4DTJA 4DV1K 5JLFA 1HKCA 4NXNK 3DLHA 2D0AA 4WF9L 5AZIA 3ATUA 4JS4A 3CCQN 5J1EA 4OLAA 2Q3SA 4KRFA 1JXBA 4CJFA 5HP1A 2G8WA 3SK3A 3VEWA 4DQQA 4RCHA 3THXB 3A5LC 1P90A 3VQ8A 4CIFA 5GINA 1TUYA 4CE9A 1CXQA 3K0SA 1FK9A 2GWKA 3WQUA 3LM9A 1YAGA 1NGAA 4JI8K 1C6VA 1NK6A 4GVMA 3OBWA 4M7YA 3BF1A 4N76A 2YX6A 3VN5A 3CF5L 3W0LA 1QVGM 4TSXA 4XEIA 2IVNA 3B6PA 3KWIA 3HVTA 2GUIA 3KLFA 3OW2M 1KTQA 3AO1A 4RTFD 1FKPA 3SJJA 3AVLA 4DTMA 1A5VA 3NVKA 4K8ZA 1C1AA 3SUPA 3BEXA 5FRMA 4NYFA 1TGOA 4B9NA 4LFBK 3QIOA 3K9JA 1NU0A 3VOVA 4BACA 2PYJA 3VF2A 5JVHL 2VG7A 1X9MA 1ILYA 4LFCK 3NDKA 4ELVA 3RMAA 4CJ4A 2KKZA 4DKWA 4EFHA 5SWMA 2FBVA 4HCCA 1ZBSA 1ZC6A 2QXLA 2YNIA 4ICLA 3MXMA 4KHQA 5E84A 4BRGA 4JRPA 4FWLA 5E26A 1VQKN 3IDHA 3MEEA 3MCAB 3CQYA 3O4QA 1BG3A 3AVKA 2GV9A 4NLCA 3GDQA 2E4LA 3THYA 5M1OA 1HNXK 4DV2K 4W5QA 3O8MA 3CJ9A 1ZBHA 2IVOA 3NGZA 4FZZA 2P1JA 5K14A 5AQIA 5LL6Z 3TSQA 3U3YA 4CBXA 2YHYA 4EAHD 3DXMA 3M8PA 1X1PA 4O44A 3C7NB 5CYMA 1M90O 4GV3A 3UIQA 3E9OA 1YXQA 4CBWA 4EHTA 1M1KO 2O8FB 4KHUA 1NGJA 1DEJA 4DR5K 1IBKK 3OYFA 3PSIA 4CHZA 4CGFA 5HRNA 4KHNA 4IEIA 3ZX3A 2E8AA 3T7ZA 2Y1IA 3TPQA 4MDAA 1IKVA 2I7NA 2P9SB 1NGHA 4FWQA 3JXUA 2ZQBA 3Q7BA 4YOTA 1T3VA 4OKJA 5T7BA 4CJWA 4E1MA 2J4RA 4IWVA 2D5RA 3KLGA 3QFUA 5JMVA 2ZF5O 2HBLA 5JS1A 2NRWA 3J81O 1VHXA 1RBVA 4FWSA 4CIGA 2DTUA 1IH7A 1EETA 4M3WA 1Y64A 3NF9A 1JLCA 3EKSA 3QEWA 1TAUA 4F3TA 4AHRA 4O4GA 2CGLA 3ULDA 1RDAA 2HHWA 3ENHA 5F0XA 2CGKA 3HZ6A 1Y97A 4LSLA 1NLVA 3HPHA 3LP3A 5AQUA 1NG9A 4W5NA 3U9ZA 2BANA 5AQOA 1C0FA 3WEEA 3PY8A 1OKJA 2YNFA 5KRTA 2Z1HA 1YJ9N 1I39A 1QSSA 5HL7L 1NMNA 1VSKA 3B6OA 1KQSM 3AA5X 5AQVA 2QWPA 3DWLA 4AM6A 1WBDA 5C42A 3ASMA 3K9KA 4PKGA 3GOIA 1SL1A 1HKGA 3PIOL 2JLEA 1GOCA 4DV6K 4DSLA 1XC3A 1HQEA 3G6EN 5DM7L 4KTWA 3FR0A 4OPHA 4DTNA 1IJJA 2XY7A 4DTXA 3ALYA 2G8VA 3DJCA 2FF6A 4FOIA 4I6MA 3TU5A 4H5RA 4DR3K 3CI5A 4H0PA 2QWRA 4Y1CA 3V9XA 3TANA 2VGNA 2P51A 4CJLA 1U49A 3SV3A 1S22A 3I0RA 3VQAA 4AQYK 5AQTA 3SV4A 3OYGA 3HBTA 1YVUA 1CLQA 4F4KA 3F9MA 2ETJA 3WXKA 4BR4A 3HXMA 3EEQA 3V1OA 4FLYA 3K5LA 3GE1A 4CIEA 3PX4A 4ISGA 2IOCA 2GEMA 4WQ5C 3JYTA 2ATQA 2E1YA 5KPTA 1JCGA 4OPAA 4B9TA 4JD2A 2X74A 4CZMA 3HL8A 2X6NA 3A5MC 3H1QA 4RW7A 3CFRA 5AQPA 1J54A 1J5OA 4BRFA 2HHUA 4A61A 3HP9A 1JJ2M 2AA4A 2G8KA 2A41A 2O4GA 3ENBA 3LDLA 4IFVA 4B9UA 3E66A 4DS5A 4YDUA 1KVBA 3MDQA 3EE9A 5GIPA 3CJ1A 1KVAA 2BTFA 3C94A 1U2VA 3LDNA 3QICA 1GLDG 4BVOA 2KTQA 4DFKA 4Z4FA 4GMJB 4AH9A 4E1JA 3OS1A 1NGEA 4E7IA 1TL3A 3LPTA 5BN9A 1B9DA 4EP4A 4J8FA 2F9TA 3FFKB 1ATRA 4JI6K 3C6TA 3HM8A 3MN9A 4CJRA 2E6MA 1XQSC 4FZXC 2P9NA 3KJVA 3ZSXA 4DSJA 1NK7A 1W7AA 4Y1DA 3DMJA 1NWKA 1QQMA 1KFSA 3VGLA 5BPLA 1UA0A 3F73A 2W40A 2YKMA 4AHUA 4CJ7A 3ZSYA 3J7AP 1WSIA 4H4MA 4E7LA 4M3TA 3ZETA 2P5OA 1N6QA 4JN4A 4DLEA 2NUBA 3HI0A 1S5JA 3DLEA 3QLHA 3NGYA 3G0ZA 3SAGA 4CEDA 4B9QA 3DXKB 4JNEA 3VPZA 3EKUA 4K41A 4HUGA 3I33A 4B9MA 3RMDA 3CC2N 1ZBIA 1N5YA 2YNHA 2OTJN 1SV5A 2D0OA 1C1CA 3IS9A 4J2BA 4ILGB 2EWSA 1HYSA 3WNGA 1YTAA 1NK0A 1LCUA 4EP5A 3KD5E 1VSIA 1GOAA 3L2QA 3K5OA 3UKUA 3VEVA 3VQQA 3QIPA 1IKYA 3CJBA 4CF9A 3WQTA 4FJHA 2D0CA 2VWKA 4BR0A 3JSMA 4JKHA 3DOKA 5TKWA 3QERA 1YJNN 1YT3A 4H0VB 1JLAA 5J2QA 3D45A 4Q5VA 2ITGA 2I5JA 3VEOA 4YOWA 4CGHA 4N5SA 2D0BA 4FJIA 4BR7A 4ZTFA 3KVGA 3DLKA 1NJIO 2E2OA 3LDOA 4DTSA 1MA9B 3A8YA 3QETA 2VYPA 4DCHA 1IBLK 3HPGA 2O8CB 1X9SA 4DTUA 2VCPA 3PUFA 2QKKA 3RRHA 4B3RK 5EXWA 1RDWX 1IG9A 4BC3A 2O8EA 3AVCA 1LWCA 3E01A 4RW6A 1N33K 1GLFO 3G4SN 5AZJA 3VESA 4BWMA 4W5RA 5M1NA 1S1UA 4YOXA 1VQ9N 1SAZA 1SKWA 4CEZA 2KZZA 3VQPA 4FJNA 4X62K 1IBMK 4BRIA 4DU3A 4DR4K 4BDYA 2OPRA 4MO5A 4KTQA 4A2BA 1FW6A 4BC5A 2Q0RA 4FYDA 1RDDA 4YOYA 3QEVA 4CEEA 3PV8A 4FLZA 3AO4A 2RPIA 4IKFA 5EX5A 3SQ0A 1NGDA 5AZIB 4A5BA 4JI2K 5JICA 3CCEN 3L2RA 4HCBA 5AQQA 2D0PA 3HSTB 3I55N 1N34K 3R9PA 2HSTA 4FJKA 3J7YP 4M3YA 3HOTA 1YIJN 1RTDA 4KI4A 1OH5A 1BDGA 1TKDA 2NLXA 4ID5A 3SLCA 3ISNC 3ZSOA 2VWJA 2DFFA 3BF3A 4FJ5A 1S72N 3L6QA 1FJGK 4FJMA 3MWTA 3KK7A 4IDHA 2WTUA 1J53A 2R7YA 5LY3A 2FSJA 3CIPA 3NE6A 1R59O 1KAZA 2WUSA 5HBMA 2CGJA 3RSEB 4X66K 3OVNA 3QNOA 4JI3K 1I94K 1HR0K 2F9WA 1NOYA 4CBUA 3O9RA 3DLLL 4YDUC 2B4JA 4FVMA 3HPOA 4CERA 4DB3A 3WNFA 4IDKA 4JK7A 1Q18A 2ASPA 2H3GX 4N47A 4WFBL 1ZBLA 3S3MA 3QBWA 4PKIA 2W42A 2P9UA 4CFCA 1MWKA 3DAWA 2ASOA 3G25A 2OTLN 2QEXN 2W6LA 2HVIA 2UXBK 4DQ8A 4Z94A 3ULEA 1KCFA 1WNSA 1BA0A 4DV5K 3OY9A 4QCLA 1TUUA 1O1WA 3O9UA 5C15A 4I9QA 4BE0A 3T1YK 2LSNA 1RFQA 4IOXA 3ATVA 5C10A 4DF4A 1E4GT 4FLWA 4H4OA 3AARA 3WUHA
chains in the Genus database with same CATH topology
5FDLA 1ASWA 1RTIA 1QSLA 4PUOA 5HRPA 1T03A 3AO3A 4RW9A 2Y1IA 2A1RA 2EX3A 2OPSA 1IKVA 1TK5A 1TK8A 1L3TA 1RNHA 4CHPA 2HHTA 1NK4A 4BWJA 1HMVA 4AILC 4DMNA 4C8LA 4W5TA 2HNYA 2ZQBA 1BQMA 3AVNA 5I3UA 4RW4A 4WE1A 4OGCA 4N41A 4JLHA 4IG3A 2HB5A 4DFMA 4FJJA 4OKJA 5HRRA 5T7BA 1Q9XA 4CJWA 4E1MA 1HQUA 3KLIA 2D5RA 2EHGA 3KLGA 1ZBFA 2XY8A 3P83D 3WNHA 3CM5A 3TAFA 5JS1A 4CF0A 2YV0X 3IRXA 3K59A 2PYLA 3BDPA 3RR8A 1RBVA 3QINA 1WSJA 1ITGA 4FW1A 4CGGA 4CIGA 4CECA 3K5NA 2DTUA 5E41A 4E19A 1IH7A 1EETA 2E6LA 4M3WA 4HVJA 4F8RA 3NF9A 4AHSA 1JLCA 4OPJA 2XY6A 3DRRA 3QEWA 2X6SA 2PZSA 3VQBA 1CXUA 4CJVA 3OYKA 4O0IA 5FRNA 1TAUA 1DTTA 4F3TA 4RG8A 4AHRA 1G15A 1HJRA 4R5PA 3TAEA 1UA1A 4O4GA 3QESA 1NJXA 3ULDA 1RDAA 1BCOA 2HHWA 1VSEA 2XHBA 3VQ4A 1EXQA 4CFBA 5C24A 4KO0A 3U6FA 1Y97A 2B6AA 1BGXT 3HPHA 1CZBA 3LP3A 1JLBA 4LSLA 1NJYA 3G10A 2HVHA 4W5NA 4DSIA 3TI0A 3QEPA 2KFZA 1HNIA 2BANA 3OYIA 5KRSA 3NH0A 1WAJA 3PY8A 3ZSQA 2YNFA 5KRTA 2Z1HA 4CFDA 3KD1E 4DQRA 4JRQA 1I39A 2HNDA 4NYNA 1QSSA 3NAEA 1VSKA 3B6OA 4E7JA 3L3UA 3AVMA 3AA5X 1VSLA 3VQ9A 3ZT0A 3OYDA 2IGIA 4KAZA 4Z4GA 4CJQA 4O0JA 1DTQA 3AVBA 4AHCA 4DWIA 3KK2A 3TR8A 1VSJA 3NF6A 5C42A 4FK2A 1MU2A 3ASMA 3V9SA 1S1VA 4I7FA 3L2UA 1ZYQA 5KTQA 4O55A 4UQGA 1SL1A 3TABA 4KB0A 4MFBA 3NHGA 4F2SA 3I8DA 1BIUA 2JLEA 1GOCA 1KLNA 1LAWA 4FJGA 4DSLA 3T19A 1HQEA 4KTWA 4N56A 4DTNA 2YHBA 2XY7A 1FKOA 2O4IA 1ASUA 3LAMA 1D8YA 1TL1A 1B9FA 1QQCA 3NCIA 4DTXA 1BQNA 4B8CA 3ALYA 2G8VA 4CGFA 4HHTA 2XO7A 3HT3A 2IDOA 4DF8A 1WN7A 2X78A 3SUOA 3OYAA 4FJ9A 2G8FA 2KQ2A 2YKNA 4CEAA 3V9UA 3H08A 2B5JA 1QSYA 1RCHA 4BDZA 4Y1CA 3V9XA 3TANA 1UOCA 1CZ9A 2IAJA 4FXDA 2P51A 4XIUA 3SPYA 3PO4A 4CJLA 4J2AA 4KHSA 1BCMA 1U49A 4KTZA 3SV3A 3I0RA 3VQAA 1T05A 1VSHA 3SV4A 1BISA 4I2QA 1EKEA 5KI6A 3ZT4A 3OYGA 4KREA 4CEOA 1YVUA 3NH1A 3HM9A 4F4KA 1FXXA 1CLQA 4AHTA 1D5AA 1WSFA 2ETJA 3HXMA 1HYZA 3C95A 1LW2A 3V1OA 4FLYA 3K5LA 3P1GA 4I2PA 4B8AB 4FLVA 2Z1JA 1ASVA 3OYHA 2YHAA 3KK1A 4CIEA 3RTVA 2HMIA 3PX4A 3SCXA 1TKXA 4ELUA 3S3OA 3THVA 1VRTA 4FLXA 3O3GA 4CJEA 4C8MA 2RN2A 2IOCA 1T7PA 4Z4IA 3ZCMA 2FBTA 3CM6A 4NCGA 3JYTA 4M3UA 2ATQA 1NOZA 5CZ1A 4M3ZA 4CJTA 3ZSWA 1LW0A 3MXIA 1HYVA 3CG7A 4LH5A 4M41A 3ZSZA 2X74A 4B9TA 4BDPA 4KHYA 3HL8A 1ZBUA 2X6NA 4Q0BA 4RW7A 3TARA 4IFYA 2BDPA 3VQ6A 3CFRA 2G8UA 1J54A 5KGWA 1J5OA 3V1RA 3AA2A 3AVJA 1QS4A 1Z26A 2HHUA 5HLFA 4YNQA 3AVFA 4DFJA 3HP9A 1LV5A 2G8KA 4B9SA 4LY7A 3EZ5A 2GBZA 2O4GA 2OPPA 1RT4A 1VSFA 2WOMA 3K2PA 4LSNA 4IFVA 3L2VA 5J2MA 4B9UA 4DS5A 2BE2A 3VA3A 4FK0A 3NBPA 1KVBA 3VQEA 2OZMA 2F96A 1QE1A 3KIOA 3TAMA 3V81A 3DLGA 1UWBA 1VRUA 3FFIA 3HP6A 4CJ3A 3OYMA 3SZ2A 3IAYA 1KVAA 3C94A 3OYEA 1X9WA 4H8KA 4DS4A 4ELTA 4QAGA 3DRPA 2OZSA 2Y1JA 3DYAA 1TK0A 5CZ2A 3KLHA 3QNNA 2DFEA 3VQ7A 3OS0A 3SI6A 5I42A 3HO1A 2KTQA 4DG1A 4KI6A 2OPQA 4DFKA 4J2EA 1JKHA 1TKZA 3V6DA 3DLBA 4Z4FA 4GMJB 4AH9A 3OS1A 3LWLA 4CF8A 4KKOA 4E7IA 2DY4A 3I0SA 1TL3A 2WONA 3LPTA 3LP2A 1T8EA 3AVAA 4CJUA 4CK3A 1B9DA 4HTUA 1L3VA 4GW6A 4EP4A 2OA8A 3P5JA 2BGGA 1HRHA 1W0HA 1S6PA 1S9GA 1C0TA 4CEFA 3C6TA 3OYJA 1L3SA 1S1WA 5C25A 3RRGA 2QK9A 1JLFA 4CJRA 4CGDA 3AVHA 2E6MA 2G8HA 1IO2A 3EYZA 4FZXC 2QXFA 4ZTJA 1SUQA 3KJVA 4CEQA 3LDSA 3PX0A 3ZSXA 4J2DA 4K8XA 4DSJA 4IG0A 3T1AA 3ZSRA 1NK7A 4PWDA 3C6UA 3HVRA 3LZIA 1S6QA 2KZMA 1SL2A 4Y1DA 4KPYA 4OLBA 2OYQA 3DMJA 4M3RA 3K57A 4RW8A 2QKBA 1J9AA 1KFSA 1D9DA 1JXEA 2RKIA 1UA0A 3DLRA 3F73A 4PQUA 4QOZB 3RWUA 2YKMA 4AHUA 1S1XA 1DLOA 1KVCA 1WSIA 4H4MA 1RT3A 3ZSYA 3LPUA 3KKRA 3WNEA 4CK2A 4CHYA 4E7LA 4DTOA 1XC9A 1RBUA 4BE1A 4CF2A 1A5XA 4CGJA 4B08A 4M3TA 5KGXA 1NKBA 2P5OA 1LWEA 3ZT3A 1RDBA 1HPZA 5DMRA 3IG1A 1U4BA 1JLEA 4E7HA 1N6QA 4DLEA 4Z4EA 5J2NA 2NUBA 3ITHA 5EU7A 3NGIA 1NK8A 3AO5A 1S5JA 1EX4A 3OYNA 2HHQA 3DLEA 2DFHA 3QLHA 4DQIA 4FJ8A 2PY5A 3NGYA 3RR7A 3A2FA 4FJ7A 1JL2A 1WAFA 3G0ZA 4IBNA 2XRIA 1RT1A 3CFOA 4YFUA 4JS5A 1GOBA 3KKSA 4CEDA 1SKRA 3HK2A 3DI6A 4FLTA 3BGRA 4FW2A 3SUNA 4B3OA 2FC0A 3TAPA 3S3NA 4HUFA 1C1BA 1D9FA 4DFPA 4ZHRA 2FBXA 4KV8A 4HUGA 3O4NA 3OJUA 3LP1A 1L5UA 4B9MA 3RMDA 1SL0A 3DOLA 3LP0A 4E1NA 3V1QA 3T3FA 3V4IA 1W9HA 3VQCA 1ZBIA 1N5YA 2YNHA 1BIZA 1SV5A 4CCHA 2HNZA 3SNNA 1C1CA 3IS9A 1RBRA 4J2BA 4FZYA 4DLGA 3M8QA 4DSEA 4DTRA 3ZT1A 3AA4A 1HYSA 3WNGA 3RMBA 1YTAA 4LH4A 3CQ8A 1NK0A 1YTUA 1I3AA 4EP5A 3CFPA 3KD5E 1VSIA 1GOAA 3OS2A 3OYLA 3L2QA 3K5OA 4OGEA 1IKXA 5CYQA 4CK1A 3HJFA 2HHSA 4DTPA 1XI1A 1IKWA 1B92A 4ID1A 3VQQA 3L8BA 3K58A 2HHVA 4CHOA 3QIPA 4E0DA 1IKYA 4PA1A 1RT5A 1RT7A 3NH2A 3KTQA 2VG5A 3O3HA 4CF9A 1JL1A 4FJHA 1KLMA 2D0CA 4Z0UA 2VWKA 3SQ2A 4EZ6A 3JSMA 2HW3A 3DOKA 1A5WA 1S9EA 2A1SA 3AVGA 3QERA 5HRSA 1NJWA 3QEXA 4NCAA 1YT3A 1WSGA 3MEDA 4M45A 3M8RA 1NK5A 1JLAA 3NFAA 4CHQA 3D45A 4CJKA 3KLEA 5J2QA 1TAQA 3EY1A 5CY4A 4Q5VA 2IC3A 3SPZA 4NCBA 1BI4A 2ITGA 4FLUA 2I5JA 3MECA 1XHXA 2YNGA 4DSKA 3LALA 2P5GA 4KFBA 2XY5A 4CGHA 4Z4CA 3HYFA 1NKEA 4N5SA 3QO9A 3VQ5A 3OYCA 2D0BA 1XHZA 4FJIA 3SYZA 3LWMA 1S1TA 4FJLA 4ZTFA 4Z4HA 3M8SA 1HNVA 1BHLA 4M42A 4DTJA 3DLKA 4DTSA 2F8TA 3QETA 4BE2A 3DLHA 3V9WA 2AJQA 3NF7A 3HPGA 2ZE2A 1U48A 4E7KA 1X9SA 1NKCA 4DTUA 2D0AA 1KRPA 2IS3A 1L3UA 3PUFA 2VG6A 4CJ5A 4JS4A 4CFAA 4CESA 2QKKA 5J1EA 1QHTA 3RRHA 2Q3SA 3VA0A 3L2WA 4OLAA 4W5OA 4KRFA 1JXBA 1XWLA 4OPKA 1LWFA 4CJFA 1IG9A 5HP1A 2G8WA 4FCYA 4CJPA 5DK5A 3AVCA 1LWCA 5FROA 5SZTA 3U3GA 3O3FA 4DQQA 1C0MA 3E01A 4RW6A 4DQSA 3AA3A 4C8OA 4CF1A 4FJXA 4OJRA 4C8NA 3K5MA 4B9LA 3PO5A 3AV9A 2KFNA 1TV6A 3VQ8A 4CIFA 4BWMA 4W5RA 3CYMA 4CE9A 1CXQA 1S1UA 1FK9A 2HHXA 3OJSA 5JS2A 3MXJA 3L3VA 3MEGA 3DM2A 1BI4B 1KFDA 3AO2A 1RDCA 4CEZA 1SKWA 2KZZA 1QTMA 3VQPA 3NF8A 4FJNA 3ZT2A 1C6VA 1K6YA 4FM2A 1NK6A 4DU3A 4E3SA 2F8SA 4OKKA 4GVMA 4BDYA 2OPRA 4N76A 2JGUA 4KTQA 4DU4A 1Q9YA 3AVIA 4EZ9A 3VN5A 3TAGA 1TKTA 1TVRA 4FYDA 1R0AA 1RDDA 4TSXA 3QEVA 1EP4A 3B6PA 4CEEA 3PV8A 4FLZA 3AO4A 2RPIA 3HVTA 4FK4A 2GUIA 3KLFA 4IKFA 3SQ0A 1KTQA 1RT6A 2KW4A 3AO1A 1FKPA 4FM0A 3SJJA 4C8KA 3AVLA 1Q8IA 4FM1A 3L2RA 4DTMA 4HCBA 3QEIA 1A5VA 4AHVA 3HSTB 3LANA 3V9ZA 4FJKA 4K8ZA 3OYBA 3S9HA 4M3YA 1C1AA 1RTDA 4KHNA 4KI4A 3SUPA 4E89A 5FRMA 4NYFA 1TGOA 4B9NA 4F2RA 4KB1A 1TKDA 3QIOA 4ID5A 3LZJA 3LAKA 1WLJA 1UAXA 3ISNC 4BACA 3ZSOA 4F3OA 2VWJA 2DFFA 2PYJA 4MQ3A 2VG7A 1X9MA 2Z1GA 1NK9A 4OVLA 4FJ5A 1VSMA 3NDKA 1VSDA 4CGIA 3RMAA 4ELVA 4CJ4A 3RMCA 4FJMA 3D0PA 4DU1A 4M3XA 2ZD1A 3ZSVA 1J53A 1JLGA 2R7YA 5SWMA 2FBVA 3TWHA 1RTJA 3NE6A 3PX6A 4HCCA 5D3GA 4CHNA 2YNIA 1RILA 2Z1IA 4ICLA 5HBMA 3QNOA 3MXMA 3OVNA 4KHQA 1RT2A 3SUQA 1U45A 1NOYA 4CEBA 4JRPA 4G1QA 4LD0A 4DQPA 3DRSA 2B4JA 1U47A 1NJZA 3MEEA 4FVMA 3HPOA 1SKSA 4CERA 3O4QA 1Z25A 2FBYA 4O5BA 3WNFA 1WSHA 4IDKA 3AVKA 4PY5A 1RBSA 1KSPA 1BL3A 2GV9A 3F9KA 4N47A 1RTHA 4CJSA 2E4LA 1ZBLA 3S3MA 4L8RB 4W5QA 1LAVA 1WSEA 2W42A 1ZBHA 4CFCA 3VQDA 1JLQA 3NGZA 5J2PA 4FZZA 2P1JA 5K14A 5HROA 3U3YA 1RBTA 3MAQA 2HVIA 3SQ1A 2RF2A 3M8PA 1X1PA 4O44A 5CYMA 1KCFA 1WNSA 3SQ4A 3UIQA 1REVA 3KK3A 1F21A 3OY9A 4B9VA 1U04A 4KHWA 2G8IA 4QCLA 1O1WA 4KHUA 4I9QA 4BE0A 4I9LA 1VK0A 2LSNA 4DSFA 4OKEA 3TAQA 4DF4A 4FLWA 4H4OA 3OYFA 4HUEA 4CHZA 1C0UA 5HRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FDL A;  1ASW A;  1RTI A;  1QSL A;  4PUO A;  5HRP A;  1T03 A;  3AO3 A;  4RW9 A;  2Y1I A;  2A1R A;  2EX3 A;  2OPS A;  1IKV A;  1TK5 A;  1TK8 A;  1L3T A;  1RNH A;  4CHP A;  2HHT A;  1NK4 A;  4BWJ A;  1HMV A;  4AIL C;  4DMN A;  4C8L A;  4W5T A;  2HNY A;  2ZQB A;  1BQM A;  3AVN A;  5I3U A;  4RW4 A;  4WE1 A;  4OGC A;  4N41 A;  4JLH A;  4IG3 A;  2HB5 A;  4DFM A;  4FJJ A;  4OKJ A;  5HRR A;  5T7B A;  1Q9X A;  4CJW A;  4E1M A;  1HQU A;  3KLI A;  2D5R A;  2EHG A;  3KLG A;  1ZBF A;  2XY8 A;  3P83 D;  3WNH A;  3CM5 A;  3TAF A;  5JS1 A;  4CF0 A;  2YV0 X;  3IRX A;  3K59 A;  2PYL A;  3BDP A;  3RR8 A;  1RBV A;  3QIN A;  1WSJ A;  1ITG A;  4FW1 A;  4CGG A;  4CIG A;  4CEC A;  3K5N A;  2DTU A;  5E41 A;  4E19 A;  1IH7 A;  1EET A;  2E6L A;  4M3W A;  4HVJ A;  4F8R A;  3NF9 A;  4AHS A;  1JLC A;  4OPJ A;  2XY6 A;  3DRR A;  3QEW A;  2X6S A;  2PZS A;  3VQB A;  1CXU A;  4CJV A;  3OYK A;  4O0I A;  5FRN A;  1TAU A;  1DTT A;  4F3T A;  4RG8 A;  4AHR A;  1G15 A;  1HJR A;  4R5P A;  3TAE A;  1UA1 A;  4O4G A;  3QES A;  1NJX A;  3ULD A;  1RDA A;  1BCO A;  2HHW A;  1VSE A;  2XHB A;  3VQ4 A;  1EXQ A;  4CFB A;  5C24 A;  4KO0 A;  3U6F A;  1Y97 A;  2B6A A;  1BGX T;  3HPH A;  1CZB A;  3LP3 A;  1JLB A;  4LSL A;  1NJY A;  3G10 A;  2HVH A;  4W5N A;  4DSI A;  3TI0 A;  3QEP A;  2KFZ A;  1HNI A;  2BAN A;  3OYI A;  5KRS A;  3NH0 A;  1WAJ A;  3PY8 A;  3ZSQ A;  2YNF A;  5KRT A;  2Z1H A;  4CFD A;  3KD1 E;  4DQR A;  4JRQ A;  1I39 A;  2HND A;  4NYN A;  1QSS A;  3NAE A;  1VSK A;  3B6O A;  4E7J A;  3L3U A;  3AVM A;  3AA5 X;  1VSL A;  3VQ9 A;  3ZT0 A;  3OYD A;  2IGI A;  4KAZ A;  4Z4G A;  4CJQ A;  4O0J A;  1DTQ A;  3AVB A;  4AHC A;  4DWI A;  3KK2 A;  3TR8 A;  1VSJ A;  3NF6 A;  5C42 A;  4FK2 A;  1MU2 A;  3ASM A;  3V9S A;  1S1V A;  4I7F A;  3L2U A;  1ZYQ A;  5KTQ A;  4O55 A;  4UQG A;  1SL1 A;  3TAB A;  4KB0 A;  4MFB A;  3NHG A;  4F2S A;  3I8D A;  1BIU A;  2JLE A;  1GOC A;  1KLN A;  1LAW A;  4FJG A;  4DSL A;  3T19 A;  1HQE A;  4KTW A;  4N56 A;  4DTN A;  2YHB A;  2XY7 A;  1FKO A;  2O4I A;  1ASU A;  3LAM A;  1D8Y A;  1TL1 A;  1B9F A;  1QQC A;  3NCI A;  4DTX A;  1BQN A;  4B8C A;  3ALY A;  2G8V A;  4CGF A;  4HHT A;  2XO7 A;  3HT3 A;  2IDO A;  4DF8 A;  1WN7 A;  2X78 A;  3SUO A;  3OYA A;  4FJ9 A;  2G8F A;  2KQ2 A;  2YKN A;  4CEA A;  3V9U A;  3H08 A;  2B5J A;  1QSY A;  1RCH A;  4BDZ A;  4Y1C A;  3V9X A;  3TAN A;  1UOC A;  1CZ9 A;  2IAJ A;  4FXD A;  2P51 A;  4XIU A;  3SPY A;  3PO4 A;  4CJL A;  4J2A A;  4KHS A;  1BCM A;  1U49 A;  4KTZ A;  3SV3 A;  3I0R A;  3VQA A;  1T05 A;  1VSH A;  3SV4 A;  1BIS A;  4I2Q A;  1EKE A;  5KI6 A;  3ZT4 A;  3OYG A;  4KRE A;  4CEO A;  1YVU A;  3NH1 A;  3HM9 A;  4F4K A;  1FXX A;  1CLQ A;  4AHT A;  1D5A A;  1WSF A;  2ETJ A;  3HXM A;  1HYZ A;  3C95 A;  1LW2 A;  3V1O A;  4FLY A;  3K5L A;  3P1G A;  4I2P A;  4B8A B;  4FLV A;  2Z1J A;  1ASV A;  3OYH A;  2YHA A;  3KK1 A;  4CIE A;  3RTV A;  2HMI A;  3PX4 A;  3SCX A;  1TKX A;  4ELU A;  3S3O A;  3THV A;  1VRT A;  4FLX A;  3O3G A;  4CJE A;  4C8M A;  2RN2 A;  2IOC A;  1T7P A;  4Z4I A;  3ZCM A;  2FBT A;  3CM6 A;  4NCG A;  3JYT A;  4M3U A;  2ATQ A;  1NOZ A;  5CZ1 A;  4M3Z A;  4CJT A;  3ZSW A;  1LW0 A;  3MXI A;  1HYV A;  3CG7 A;  4LH5 A;  4M41 A;  3ZSZ A;  2X74 A;  4B9T A;  4BDP A;  4KHY A;  3HL8 A;  1ZBU A;  2X6N A;  4Q0B A;  4RW7 A;  3TAR A;  4IFY A;  2BDP A;  3VQ6 A;  3CFR A;  2G8U A;  1J54 A;  5KGW A;  1J5O A;  3V1R A;  3AA2 A;  3AVJ A;  1QS4 A;  1Z26 A;  2HHU A;  5HLF A;  4YNQ A;  3AVF A;  4DFJ A;  3HP9 A;  1LV5 A;  2G8K A;  4B9S A;  4LY7 A;  3EZ5 A;  2GBZ A;  2O4G A;  2OPP A;  1RT4 A;  1VSF A;  2WOM A;  3K2P A;  4LSN A;  4IFV A;  3L2V A;  5J2M A;  4B9U A;  4DS5 A;  2BE2 A;  3VA3 A;  4FK0 A;  3NBP A;  1KVB A;  3VQE A;  2OZM A;  2F96 A;  1QE1 A;  3KIO A;  3TAM A;  3V81 A;  3DLG A;  1UWB A;  1VRU A;  3FFI A;  3HP6 A;  4CJ3 A;  3OYM A;  3SZ2 A;  3IAY A;  1KVA A;  3C94 A;  3OYE A;  1X9W A;  4H8K A;  4DS4 A;  4ELT A;  4QAG A;  3DRP A;  2OZS A;  2Y1J A;  3DYA A;  1TK0 A;  5CZ2 A;  3KLH A;  3QNN A;  2DFE A;  3VQ7 A;  3OS0 A;  3SI6 A;  5I42 A;  3HO1 A;  2KTQ A;  4DG1 A;  4KI6 A;  2OPQ A;  4DFK A;  4J2E A;  1JKH A;  1TKZ A;  3V6D A;  3DLB A;  4Z4F A;  4GMJ B;  4AH9 A;  3OS1 A;  3LWL A;  4CF8 A;  4KKO A;  4E7I A;  2DY4 A;  3I0S A;  1TL3 A;  2WON A;  3LPT A;  3LP2 A;  1T8E A;  3AVA A;  4CJU A;  4CK3 A;  1B9D A;  4HTU A;  1L3V A;  4GW6 A;  4EP4 A;  2OA8 A;  3P5J A;  2BGG A;  1HRH A;  1W0H A;  1S6P A;  1S9G A;  1C0T A;  4CEF A;  3C6T A;  3OYJ A;  1L3S A;  1S1W A;  5C25 A;  3RRG A;  2QK9 A;  1JLF A;  4CJR A;  4CGD A;  3AVH A;  2E6M A;  2G8H A;  1IO2 A;  3EYZ A;  4FZX C;  2QXF A;  4ZTJ A;  1SUQ A;  3KJV A;  4CEQ A;  3LDS A;  3PX0 A;  3ZSX A;  4J2D A;  4K8X A;  4DSJ A;  4IG0 A;  3T1A A;  3ZSR A;  1NK7 A;  4PWD A;  3C6U A;  3HVR A;  3LZI A;  1S6Q A;  2KZM A;  1SL2 A;  4Y1D A;  4KPY A;  4OLB A;  2OYQ A;  3DMJ A;  4M3R A;  3K57 A;  4RW8 A;  2QKB A;  1J9A A;  1KFS A;  1D9D A;  1JXE A;  2RKI A;  1UA0 A;  3DLR A;  3F73 A;  4PQU A;  4QOZ B;  3RWU A;  2YKM A;  4AHU A;  1S1X A;  1DLO A;  1KVC A;  1WSI A;  4H4M A;  1RT3 A;  3ZSY A;  3LPU A;  3KKR A;  3WNE A;  4CK2 A;  4CHY A;  4E7L A;  4DTO A;  1XC9 A;  1RBU A;  4BE1 A;  4CF2 A;  1A5X A;  4CGJ A;  4B08 A;  4M3T A;  5KGX A;  1NKB A;  2P5O A;  1LWE A;  3ZT3 A;  1RDB A;  1HPZ A;  5DMR A;  3IG1 A;  1U4B A;  1JLE A;  4E7H A;  1N6Q A;  4DLE A;  4Z4E A;  5J2N A;  2NUB A;  3ITH A;  5EU7 A;  3NGI A;  1NK8 A;  3AO5 A;  1S5J A;  1EX4 A;  3OYN A;  2HHQ A;  3DLE A;  2DFH A;  3QLH A;  4DQI A;  4FJ8 A;  2PY5 A;  3NGY A;  3RR7 A;  3A2F A;  4FJ7 A;  1JL2 A;  1WAF A;  3G0Z A;  4IBN A;  2XRI A;  1RT1 A;  3CFO A;  4YFU A;  4JS5 A;  1GOB A;  3KKS A;  4CED A;  1SKR A;  3HK2 A;  3DI6 A;  4FLT A;  3BGR A;  4FW2 A;  3SUN A;  4B3O A;  2FC0 A;  3TAP A;  3S3N A;  4HUF A;  1C1B A;  1D9F A;  4DFP A;  4ZHR A;  2FBX A;  4KV8 A;  4HUG A;  3O4N A;  3OJU A;  3LP1 A;  1L5U A;  4B9M A;  3RMD A;  1SL0 A;  3DOL A;  3LP0 A;  4E1N A;  3V1Q A;  3T3F A;  3V4I A;  1W9H A;  3VQC A;  1ZBI A;  1N5Y A;  2YNH A;  1BIZ A;  1SV5 A;  4CCH A;  2HNZ A;  3SNN A;  1C1C A;  3IS9 A;  1RBR A;  4J2B A;  4FZY A;  4DLG A;  3M8Q A;  4DSE A;  4DTR A;  3ZT1 A;  3AA4 A;  1HYS A;  3WNG A;  3RMB A;  1YTA A;  4LH4 A;  3CQ8 A;  1NK0 A;  1YTU A;  1I3A A;  4EP5 A;  3CFP A;  3KD5 E;  1VSI A;  1GOA A;  3OS2 A;  3OYL A;  3L2Q A;  3K5O A;  4OGE A;  1IKX A;  5CYQ A;  4CK1 A;  3HJF A;  2HHS A;  4DTP A;  1XI1 A;  1IKW A;  1B92 A;  4ID1 A;  3VQQ A;  3L8B A;  3K58 A;  2HHV A;  4CHO A;  3QIP A;  4E0D A;  1IKY A;  4PA1 A;  1RT5 A;  1RT7 A;  3NH2 A;  3KTQ A;  2VG5 A;  3O3H A;  4CF9 A;  1JL1 A;  4FJH A;  1KLM A;  2D0C A;  4Z0U A;  2VWK A;  3SQ2 A;  4EZ6 A;  3JSM A;  2HW3 A;  3DOK A;  1A5W A;  1S9E A;  2A1S A;  3AVG A;  3QER A;  5HRS A;  1NJW A;  3QEX A;  4NCA A;  1YT3 A;  1WSG A;  3MED A;  4M45 A;  3M8R A;  1NK5 A;  1JLA A;  3NFA A;  4CHQ A;  3D45 A;  4CJK A;  3KLE A;  5J2Q A;  1TAQ A;  3EY1 A;  5CY4 A;  4Q5V A;  2IC3 A;  3SPZ A;  4NCB A;  1BI4 A;  2ITG A;  4FLU A;  2I5J A;  3MEC A;  1XHX A;  2YNG A;  4DSK A;  3LAL A;  2P5G A;  4KFB A;  2XY5 A;  4CGH A;  4Z4C A;  3HYF A;  1NKE A;  4N5S A;  3QO9 A;  3VQ5 A;  3OYC A;  2D0B A;  1XHZ A;  4FJI A;  3SYZ A;  3LWM A;  1S1T A;  4FJL A;  4ZTF A;  4Z4H A;  3M8S A;  1HNV A;  1BHL A;  4M42 A;  4DTJ A;  3DLK A;  4DTS A;  2F8T A;  3QET A;  4BE2 A;  3DLH A;  3V9W A;  2AJQ A;  3NF7 A;  3HPG A;  2ZE2 A;  1U48 A;  4E7K A;  1X9S A;  1NKC A;  4DTU A;  2D0A A;  1KRP A;  2IS3 A;  1L3U A;  3PUF A;  2VG6 A;  4CJ5 A;  4JS4 A;  4CFA A;  4CES A;  2QKK A;  5J1E A;  1QHT A;  3RRH A;  2Q3S A;  3VA0 A;  3L2W A;  4OLA A;  4W5O A;  4KRF A;  1JXB A;  1XWL A;  4OPK A;  1LWF A;  4CJF A;  1IG9 A;  5HP1 A;  2G8W A;  4FCY A;  4CJP A;  5DK5 A;  3AVC A;  1LWC A;  5FRO A;  5SZT A;  3U3G A;  3O3F A;  4DQQ A;  1C0M A;  3E01 A;  4RW6 A;  4DQS A;  3AA3 A;  4C8O A;  4CF1 A;  4FJX A;  4OJR A;  4C8N A;  3K5M A;  4B9L A;  3PO5 A;  3AV9 A;  2KFN A;  1TV6 A;  3VQ8 A;  4CIF A;  4BWM A;  4W5R A;  3CYM A;  4CE9 A;  1CXQ A;  1S1U A;  1FK9 A;  2HHX A;  3OJS A;  5JS2 A;  3MXJ A;  3L3V A;  3MEG A;  3DM2 A;  1BI4 B;  1KFD A;  3AO2 A;  1RDC A;  4CEZ A;  1SKW A;  2KZZ A;  1QTM A;  3VQP A;  3NF8 A;  4FJN A;  3ZT2 A;  1C6V A;  1K6Y A;  4FM2 A;  1NK6 A;  4DU3 A;  4E3S A;  2F8S A;  4OKK A;  4GVM A;  4BDY A;  2OPR A;  4N76 A;  2JGU A;  4KTQ A;  4DU4 A;  1Q9Y A;  3AVI A;  4EZ9 A;  3VN5 A;  3TAG A;  1TKT A;  1TVR A;  4FYD A;  1R0A A;  1RDD A;  4TSX A;  3QEV A;  1EP4 A;  3B6P A;  4CEE A;  3PV8 A;  4FLZ A;  3AO4 A;  2RPI A;  3HVT A;  4FK4 A;  2GUI A;  3KLF A;  4IKF A;  3SQ0 A;  1KTQ A;  1RT6 A;  2KW4 A;  3AO1 A;  1FKP A;  4FM0 A;  3SJJ A;  4C8K A;  3AVL A;  1Q8I A;  4FM1 A;  3L2R A;  4DTM A;  4HCB A;  3QEI A;  1A5V A;  4AHV A;  3HST B;  3LAN A;  3V9Z A;  4FJK A;  4K8Z A;  3OYB A;  3S9H A;  4M3Y A;  1C1A A;  1RTD A;  4KHN A;  4KI4 A;  3SUP A;  4E89 A;  5FRM A;  4NYF A;  1TGO A;  4B9N A;  4F2R A;  4KB1 A;  1TKD A;  3QIO A;  4ID5 A;  3LZJ A;  3LAK A;  1WLJ A;  1UAX A;  3ISN C;  4BAC A;  3ZSO A;  4F3O A;  2VWJ A;  2DFF A;  2PYJ A;  4MQ3 A;  2VG7 A;  1X9M A;  2Z1G A;  1NK9 A;  4OVL A;  4FJ5 A;  1VSM A;  3NDK A;  1VSD A;  4CGI A;  3RMA A;  4ELV A;  4CJ4 A;  3RMC A;  4FJM A;  3D0P A;  4DU1 A;  4M3X A;  2ZD1 A;  3ZSV A;  1J53 A;  1JLG A;  2R7Y A;  5SWM A;  2FBV A;  3TWH A;  1RTJ A;  3NE6 A;  3PX6 A;  4HCC A;  5D3G A;  4CHN A;  2YNI A;  1RIL A;  2Z1I A;  4ICL A;  5HBM A;  3QNO A;  3MXM A;  3OVN A;  4KHQ A;  1RT2 A;  3SUQ A;  1U45 A;  1NOY A;  4CEB A;  4JRP A;  4G1Q A;  4LD0 A;  4DQP A;  3DRS A;  2B4J A;  1U47 A;  1NJZ A;  3MEE A;  4FVM A;  3HPO A;  1SKS A;  4CER A;  3O4Q A;  1Z25 A;  2FBY A;  4O5B A;  3WNF A;  1WSH A;  4IDK A;  3AVK A;  4PY5 A;  1RBS A;  1KSP A;  1BL3 A;  2GV9 A;  3F9K A;  4N47 A;  1RTH A;  4CJS A;  2E4L A;  1ZBL A;  3S3M A;  4L8R B;  4W5Q A;  1LAV A;  1WSE A;  2W42 A;  1ZBH A;  4CFC A;  3VQD A;  1JLQ A;  3NGZ A;  5J2P A;  4FZZ A;  2P1J A;  5K14 A;  5HRO A;  3U3Y A;  1RBT A;  3MAQ A;  2HVI A;  3SQ1 A;  2RF2 A;  3M8P A;  1X1P A;  4O44 A;  5CYM A;  1KCF A;  1WNS A;  3SQ4 A;  3UIQ A;  1REV A;  3KK3 A;  1F21 A;  3OY9 A;  4B9V A;  1U04 A;  4KHW A;  2G8I A;  4QCL A;  1O1W A;  4KHU A;  4I9Q A;  4BE0 A;  4I9L A;  1VK0 A;  2LSN A;  4DSF A;  4OKE A;  3TAQ A;  4DF4 A;  4FLW A;  4H4O A;  3OYF A;  4HUE A;  4CHZ A;  1C0U A;  5HRN A; 
#chains in the Genus database with same CATH topology
 2Q2R A;  1ASW A;  1RTI A;  3THW B;  1T03 A;  3O1B A;  1RNH A;  1YVN A;  4CHP A;  2HHT A;  4AIL C;  3C65 A;  2HNY A;  3AVN A;  5I3U A;  4OGC A;  1K73 O;  3R8E A;  1N32 K;  5HRR A;  4WQ5 A;  1TYQ A;  2CH6 A;  1VQ4 N;  1Q9X A;  1HQU A;  4H5V A;  2EHG A;  1ZBF A;  2XY8 A;  3WNH A;  3THY B;  3CM5 A;  4H03 B;  3IRX A;  3BDP A;  1WSJ A;  3K5N A;  4B3T K;  3CQX A;  3OHR A;  3DXM B;  4HVJ A;  4JKF A;  4AHS A;  4OPJ A;  3E1Y A;  4MO4 A;  2NNW A;  4CJV A;  4O0I A;  4DR6 K;  3J8A A;  3VEN A;  3TAE A;  1UA1 A;  2O8D A;  3MN7 A;  1NJX A;  4BRD A;  3CCL N;  1HNZ K;  2BH1 A;  3AAQ A;  4KO0 A;  1YJW N;  2B6A A;  3FZK A;  1CZB A;  1NJY A;  5KQD A;  4DSI A;  3QEP A;  5GAD P;  3AAP A;  3O9S A;  1WAJ A;  4JRQ A;  4B1V A;  2HND A;  4NYN A;  4E7J A;  3VET A;  3J7Z O;  3VQ9 A;  3ZT0 A;  3OYD A;  2IGI A;  4KAZ A;  4JHD A;  4AHC A;  1DTQ A;  3KK2 A;  3NF6 A;  4ILJ A;  1MU2 A;  3QBX A;  1S1V A;  4JKD A;  1K8A O;  4I7F A;  3C0B A;  5KTQ A;  4DUY K;  3H3O B;  4JI1 K;  4MFB A;  3NHG A;  2GWJ A;  1BIU A;  1LAW A;  3IMX A;  3T19 A;  4IO8 A;  5IT9 O;  3SJH A;  4F9O A;  1FKO A;  2O4I A;  3LAM A;  4H0Y B;  5AQJ A;  1B9F A;  5AQX A;  1BQN A;  3M6G A;  4HHT A;  3HT3 A;  2X78 A;  1JCF A;  3SUO A;  4B1X B;  3OYA A;  2YKN A;  4WYB A;  1RCH A;  2FF3 B;  4BDZ A;  3WEE B;  3F5T A;  4XIU A;  1RGI A;  3KZB A;  3U9D A;  3F2K A;  3O9T A;  1WOQ A;  1BCM A;  3VGK A;  4KTZ A;  3O08 A;  1VSH A;  1EKE A;  4KHP K;  1NGG A;  4AHT A;  3UKR A;  1HYZ A;  2FXU A;  5GAG P;  3P1G A;  4B8A B;  4FLV A;  2FSK A;  2AP1 A;  3OYH A;  3BUZ B;  3RTV A;  3SCX A;  4ELU A;  2A42 A;  5FPN A;  3MX5 A;  4FLX A;  3O3G A;  4U7B A;  3CCR N;  1CZA N;  4C8M A;  1T7P A;  4Z4I A;  2QM1 A;  2FBT A;  3SMP A;  5HOO A;  1HYV A;  4KHY A;  4Q0B A;  2V51 B;  5AQN A;  3FGU A;  2G8U A;  3Q7C A;  4CZL A;  4I6M B;  4YNQ A;  3H6E A;  3EZ5 A;  1EQY A;  1VSF A;  3BP8 A;  4LSN A;  3K2P A;  4FK0 A;  2BE2 A;  3VA3 A;  1T6D A;  2E1Z A;  3NBP A;  4NO7 A;  3KIO A;  5BN8 A;  3TAM A;  3RVC A;  4B1U B;  4K42 A;  5JLH A;  4MDB A;  5F2R A;  4BRC A;  2P9P B;  4DS4 A;  3DRP A;  2OZS A;  1QZ5 A;  5CZ2 A;  5I42 A;  4DG1 A;  3L4I A;  2OPQ A;  3DLB A;  3CXC M;  4KKO A;  2DY4 A;  3I0S A;  4JD2 B;  3P5J A;  2Q1N A;  4AM7 A;  2BGG A;  1HLU A;  4HWI A;  2HBM A;  4DR1 K;  1S9G A;  1C0T A;  1L3S A;  5CHI A;  1S1W A;  1JLF A;  4GV6 A;  3M5R A;  3EYZ A;  3VTI A;  4ZTJ A;  3CME N;  3PX0 A;  4J2D A;  4CEQ A;  4IG0 A;  2F4V K;  3PLA A;  4DHY A;  3LZI A;  2GX9 A;  1SL2 A;  4OLB A;  4CD3 A;  2OYQ A;  3WXM B;  3VF4 A;  3K57 A;  4RW8 A;  2A40 A;  3H3N O;  1YIT N;  1X9J A;  1D9D A;  2RKI A;  2GEL A;  4O5F A;  3DLR A;  4PQU A;  3UE5 A;  3RWU A;  1RT3 A;  1U2V B;  3LPU A;  3KKR A;  2QI2 A;  4DTO A;  1XC9 A;  1GLC G;  1RBU A;  5BPM A;  1NKB A;  1Q81 O;  1HPZ A;  1U4B A;  1JLE A;  5EU7 A;  3NGI A;  2HHQ A;  4R79 A;  2PY5 A;  5AJ3 K;  2KLA A;  4IBN A;  1RT1 A;  4JS5 A;  3KKS A;  3EO3 A;  3DI6 A;  3BGR A;  2FC0 A;  3TAP A;  1KC8 O;  1OVY A;  4HUF A;  1D9F A;  1Q86 O;  4DFP A;  4ZHR A;  3OJU A;  1QQN A;  1O13 A;  3LP0 A;  3TSU A;  1W9H A;  4ISE A;  3SNN A;  1DT9 A;  2FSN A;  3AY9 A;  3SBT A;  2Q0U A;  4DLG A;  3CJC A;  4DTR A;  2A3Z A;  2Q97 A;  3ZT1 A;  3RMB A;  1I3A A;  2P9S A;  2HHS A;  4ILH A;  1IKW A;  1B92 A;  4ID1 A;  4YOV A;  4CHO A;  2YJF A;  3H45 C;  1RT5 A;  3NH2 A;  1RDU A;  3R3L A;  4YY3 K;  5B8H A;  3CD6 N;  3NMU A;  3ZX2 A;  3SQ2 A;  4BRH A;  2HW3 A;  4EHU A;  1A5W A;  3PIP L;  1NJW A;  4NCA A;  1JCE A;  5ADX A;  4DR7 K;  1DGK N;  3MED A;  4M7X A;  4YOU A;  4M45 A;  4CJK A;  3M8R A;  4LF7 K;  2IC3 A;  4NCB A;  1BI4 A;  2YNG A;  4KFB A;  3HYF A;  4MLE A;  4FPA A;  3VQ5 A;  5BRF A;  4JKB A;  1HX1 A;  1S1T A;  4Z4H A;  2UUA K;  1BHL A;  2F8T A;  1OH6 A;  3C6A A;  3V9W A;  2AJQ A;  3NF7 A;  5H1S Q;  1U48 A;  4E7K A;  4FWN A;  1KRP A;  2IS3 A;  4CJ5 A;  4CFA A;  3UKU B;  1QHT A;  2P9I A;  3VA0 A;  3VER A;  5AFU A;  1XWL A;  4FO0 A;  3UB5 A;  4FCY A;  4CJP A;  2NRT A;  3O3F A;  5FRO A;  5SZT A;  4DQS A;  1P8Z A;  3AA3 A;  4C8O A;  4BRN A;  4FJX A;  3K5M A;  3CYM A;  2P9K A;  1VQP N;  3MEG A;  4JKG A;  1KFD A;  1QTM A;  3ZT2 A;  4L3Q A;  2F8S A;  3EN9 A;  3OTO K;  4IOA L;  4EZ9 A;  1KXP A;  4JKC A;  1SS6 A;  4BR9 A;  3LDQ A;  4AF1 A;  1R0A A;  1EP4 A;  1VQL N;  3CHW A;  1T6C A;  4CW7 B;  4FK4 A;  3SMS A;  1RT6 A;  1WBB A;  4FM0 A;  4C8K A;  4FM1 A;  4B1Y B;  3LAN A;  4WQ4 C;  5AQR A;  3V9Z A;  5F1X A;  4E89 A;  2NRH A;  5AZJ B;  3LZJ A;  1WLJ A;  4F3O A;  5BRE A;  1GLJ O;  2NRZ A;  2D1K A;  4OVL A;  1VSM A;  5AQM A;  4CGI A;  5BRD A;  3RMC A;  4DU1 A;  4M3X A;  3ZSV A;  3TWH A;  1RTJ A;  2UUB K;  4BG8 A;  4CHN A;  3D7E O;  1NGB A;  4CEB A;  4DQP A;  3DRS A;  3SAH A;  1U47 A;  1NJZ A;  1SKS A;  2HBJ A;  2E2Q A;  3TTD A;  2CH5 A;  2FBY A;  5AQK A;  1QZ6 A;  4BGA A;  2W41 A;  1KSP A;  1BL3 A;  1QQO A;  3F9K A;  1RTH A;  5LJW A;  2VQE K;  4BG9 A;  4IOC L;  1WSE A;  3VQD A;  1JLQ A;  1VAZ A;  5HRO A;  1RBT A;  3CCM N;  3SQ1 A;  3CCV N;  4UY8 O;  4JAX A;  3SQ4 A;  1REV A;  4KHW A;  4DUZ K;  4IZ9 A;  3PSF A;  4DSF A;  3TAQ A;  4A62 A;  4HUE A;  5FDL A;  3CPW M;  3R1X A;  4PUO A;  5HRP A;  4RW9 A;  2A1R A;  1L3T A;  2OPS A;  1TK8 A;  2E2P A;  3SBG A;  1H1V A;  3B8A X;  3HSC A;  3S41 A;  4BWJ A;  2RE2 A;  3U8X A;  4QS7 A;  4DMN A;  4C8L A;  4XH4 A;  4W5T A;  1Q7Y O;  3D2E A;  4WE1 A;  4JLH A;  2HB5 A;  4DFM A;  2YHW A;  4CI6 A;  3KLI A;  3WXJ A;  3TAF A;  4CF0 A;  3CCU N;  2P9U B;  1QVF M;  1ITG A;  4CGG A;  4CEC A;  5E41 A;  4E19 A;  4FSV A;  2DPN A;  5IWA K;  3ULE B;  2PZS A;  3VQB A;  1GLB G;  3MN5 A;  3OYK A;  4EIA A;  3N4Q A;  4RG8 A;  1G15 A;  1HJR A;  5KPR A;  5AQH A;  3QES A;  1BCO A;  2XHB A;  2GUP A;  3O4W A;  5C0Y A;  3U6F A;  3MMV A;  4H0O A;  1BGX T;  1JLB A;  3DXK A;  2Q36 A;  1HNI A;  3OYI A;  5KRS A;  3NH0 A;  1NMD A;  1YUW A;  4DQR A;  3MK6 A;  3R6M A;  4CZK A;  4C23 A;  3NAE A;  4O8K A;  2E88 A;  1OVQ A;  4LFA K;  4Z4G A;  3AVB A;  2E2N A;  3O80 A;  4DV4 K;  3J80 O;  3V9S A;  3VF6 A;  3L2U A;  2UU9 K;  1NNE A;  1T44 A;  1C0G A;  4UQG A;  4BR5 A;  3I8D A;  5BR8 K;  4LF5 K;  1KLN A;  2NRX A;  2HOE A;  4LC9 B;  1VQN N;  4N56 A;  2F7T A;  2YHB A;  3OA9 A;  1D8Y A;  1TL1 A;  4A57 A;  5BRH A;  2W6K A;  1QQC A;  3NCI A;  1IG8 A;  2O8D B;  4B8C A;  3CER A;  2XO7 A;  4H0T B;  4DF8 A;  4CZH A;  3MWP A;  4YHH K;  4JKA A;  4FJ9 A;  2KQ2 A;  3H08 A;  2B5J A;  4B1W B;  3P39 A;  2O8B A;  1CZ9 A;  2IAJ A;  2P9L A;  4FXD A;  3PO4 A;  2QW9 A;  4KHS A;  5KQ8 A;  5KI6 A;  3ZT4 A;  4JI5 K;  3O5B A;  4CEO A;  4JHD B;  3JAM O;  3NH1 A;  1GLL O;  1WSF A;  2QWN A;  2E5L K;  4I2P A;  2Z1J A;  5DM6 L;  3QDK A;  1G99 A;  2YHA A;  3KK1 A;  2O8C A;  1TKX A;  4PL8 A;  3S3O A;  1E4F T;  4C1N K;  1VRT A;  4K0K K;  2JWK A;  2RN2 A;  3LDP A;  3ZCM A;  3CM6 A;  4M3U A;  1NOZ A;  5GIO A;  4CJT A;  1LW0 A;  3ZSZ A;  4LH5 A;  2QWL A;  4M41 A;  4BDP A;  3ZEU A;  2FLO A;  1HPM A;  1HUX A;  3CJ7 A;  3TAR A;  1SZ2 A;  5I9E B;  3O9Q A;  5KGW A;  1NGC A;  3V1R A;  5M1Q A;  3AVJ A;  1QS4 A;  2HMP A;  1XMQ K;  3AVF A;  4DFJ A;  1K8K A;  1LV5 A;  3VEX A;  4LY7 A;  4NB4 A;  1GLE G;  2IIR A;  2WOM A;  3E9L A;  5J2M A;  1HKB A;  3H46 O;  5FLX O;  2F96 A;  1QE1 A;  3V81 A;  5ADX H;  3HP6 A;  4CJ3 A;  3SZ2 A;  3UKR B;  3OYE A;  4DV3 K;  2UXC K;  4H8K A;  4FOE A;  2Y1J A;  3DYA A;  3KLH A;  3QNN A;  4B1Z A;  3OS0 A;  3SI6 A;  3HO1 A;  3A5N C;  3CET A;  1JKH A;  1TKZ A;  1D4X A;  3LWL A;  2QWM A;  4H5W A;  2WON A;  1T8E A;  4CK3 A;  3SAF A;  1L3V A;  4A59 A;  4X65 K;  2OA8 A;  1V4S A;  3CJA A;  4BRM A;  3MCP A;  5TKY A;  1HRH A;  1W0H A;  1V4T A;  1S6P A;  4CEF A;  3IKM A;  3OYJ A;  5C25 A;  5AFU H;  5CR4 A;  4CGD A;  1IO2 A;  1SUQ A;  3LDS A;  2PFU A;  4K8X A;  3D2F A;  3T1A A;  3ZSR A;  4PWD A;  3HVR A;  3BY5 A;  2KZM A;  5AQS A;  4KPY A;  4NXM K;  4M3R A;  2WC9 A;  3RSE A;  3I56 N;  4QOZ B;  1DLO A;  1KVC A;  4BQZ A;  4FWM A;  4FL9 A;  1A5X A;  4CGJ A;  4B08 A;  1BUP A;  4BY9 C;  3ZT3 A;  1Q82 O;  3IG1 A;  1KAY A;  1LOT B;  4HTL A;  4E7H A;  2HF4 A;  4Z4E A;  3ITH A;  1NK8 A;  2VWB A;  4FWK A;  3ID8 A;  4O8U A;  4DQI A;  3RR7 A;  1X3M A;  3A2F A;  1JL2 A;  1WAF A;  2XRI A;  1SKR A;  1XNQ K;  1GOB A;  3HK2 A;  4FLT A;  4FW2 A;  3SUN A;  3S3N A;  1OH8 A;  3M3Z A;  3GG4 A;  4BRL A;  2FBX A;  4KV8 A;  3O4N A;  3LP1 A;  4XH1 A;  1L5U A;  1SL0 A;  3DOL A;  4E1N A;  3V4I A;  3VQC A;  1GLA G;  4PL7 A;  1BIZ A;  3ZYY X;  4FZY A;  4WQ4 A;  2UXD K;  4JI4 K;  3THW A;  3AA4 A;  4LH4 A;  1MWM A;  3CFP A;  3OS2 A;  1K9M O;  4OGE A;  1IKX A;  2V7Y A;  4JK8 A;  5CYQ A;  5FPE A;  4DV7 K;  3HJF A;  4DTP A;  5C2F A;  3K58 A;  3L8B A;  4IJA A;  3E9P A;  4E0D A;  4PA1 A;  4FVU A;  1RT7 A;  2VG5 A;  3O3H A;  1JL1 A;  5AQW A;  4Z0U A;  3THX A;  4EZ6 A;  2ASM A;  1S9E A;  1XMO K;  3QEX A;  3VMF B;  1WSG A;  5LMN K;  2QTD A;  1NK5 A;  3CC4 N;  3NFA A;  1S3X A;  4CHQ A;  3SPZ A;  5CY4 A;  1VQ7 N;  4IEE A;  5LJV A;  2IVP A;  1XHX A;  4CZE A;  4DSK A;  3LAL A;  2WBN A;  3P4I A;  2XY5 A;  3FLC O;  4GY2 B;  1NKE A;  3QO9 A;  2ITM A;  3SYZ A;  3LWM A;  4WFA L;  4M42 A;  1HNW K;  4G9Z A;  3P31 A;  4BE2 A;  4B3S K;  5M1P A;  4CZG A;  3G71 N;  2ZE2 A;  3MN6 A;  1NKC A;  1L3U A;  2VG6 A;  3FZM A;  1X3N A;  4CES A;  4ISF A;  3T69 A;  3L2W A;  4W5O A;  4OPK A;  1NBW A;  1LWF A;  2ZM6 K;  5DK5 A;  3U3G A;  1C0M A;  4CF1 A;  1BWF O;  4OJR A;  4C8N A;  4B9L A;  3PO5 A;  3AV9 A;  1TV6 A;  4BRA A;  2HHX A;  4LF6 K;  3OJS A;  5JS2 A;  3MXJ A;  3L3V A;  3DM2 A;  1BI4 B;  3AO2 A;  2QWO A;  1RDC A;  4A5A A;  4A2A A;  3NF8 A;  1K6Y A;  4WFN L;  4FM2 A;  4E3S A;  4DR2 K;  2HF3 A;  4OKK A;  2HBK A;  2JGU A;  4QS9 A;  1EWR A;  2E20 A;  4DU4 A;  1NGF A;  3AVI A;  1Q9Y A;  3TAG A;  1TKT A;  1TVR A;  4M63 C;  4C1N I;  4KH6 A;  2KW4 A;  2NRR A;  2P9I B;  2NZT A;  1Q8I A;  4FWR A;  3QEI A;  3I8B A;  4AHV A;  3HOS A;  5C2D A;  3OYB A;  3S9H A;  4F2R A;  3QB0 A;  4KB1 A;  4GNI A;  1KD1 O;  5EOY A;  2P9K B;  3C7N A;  3LAK A;  4JKE A;  1UAX A;  4K25 A;  1BO5 O;  2A5X A;  4WCE L;  4MQ3 A;  3ZX0 A;  4JKG B;  2Z1G A;  1NK9 A;  2O8F A;  2P9N B;  1VSD A;  3D0P A;  3A5O C;  2ZD1 A;  1JLG A;  3N4P A;  4KBO A;  3PX6 A;  5D3G A;  3AGR A;  1RIL A;  2YI1 A;  4FWP A;  2Z1I A;  1RT2 A;  3SUQ A;  4IJN A;  1U45 A;  5AQZ A;  2BUP A;  4G1Q A;  4LD0 A;  2ZGY A;  5FPM A;  3ZET B;  1Z25 A;  4O5B A;  3CC7 N;  1WSH A;  4MLH A;  4PY5 A;  1RBS A;  1SQK A;  4CJS A;  4U67 L;  4L8R B;  1LAV A;  4V19 S;  2P9P A;  5J2P A;  2A6A A;  1HJO A;  5CE3 A;  3MAQ A;  3O1W A;  5EY4 A;  2RF2 A;  3OBY A;  1ZXO A;  2G8I A;  3KK3 A;  1F21 A;  5LMU K;  4B9V A;  1U04 A;  4PKH A;  4I9L A;  1VK0 A;  3WXL A;  4OKE A;  5AQG A;  3O6W A;  1C0U A;  3MXI A;  3GBT A;  3KWG A;  1QSL A;  2PBD A;  3FE1 A;  3AO3 A;  2EX3 A;  1TK5 A;  3HTV A;  1NK4 A;  2Q31 A;  1HMV A;  1BQM A;  4BR2 A;  4RW4 A;  4CZI A;  4X64 K;  4N41 A;  2HHH K;  4IG3 A;  3T1H K;  4FJJ A;  4OO1 J;  3D6R A;  3P83 D;  3L0Q A;  2YV0 X;  3K59 A;  2PYL A;  3RR8 A;  3QIN A;  3IUC A;  4FW1 A;  5EVZ A;  2E6L A;  3CCS N;  4F8R A;  3ID6 A;  1KAX A;  2XY6 A;  3DRR A;  2X6S A;  1CXU A;  5FRN A;  1DTT A;  3WXI A;  4R5P A;  1VQ8 N;  3P38 A;  1YHQ N;  1VSE A;  1VQM N;  3VQ4 A;  1QHA A;  1EXQ A;  2ZJQ L;  4CFB A;  4KH5 A;  5C24 A;  2KFN A;  2HVH A;  3G10 A;  3TI0 A;  2KFZ A;  4JI7 K;  3ZSQ A;  5ELZ A;  2VGM A;  4CFD A;  3KD1 E;  4JYA K;  3LM2 A;  3D2E B;  3HRG A;  3L3U A;  3AVM A;  3KHY A;  1VSL A;  4IO9 L;  4CJQ A;  4O0J A;  4DWI A;  3TR8 A;  1VSJ A;  2UUC K;  2O8E B;  4FK2 A;  5M1F A;  2OCE A;  1ZYQ A;  4BGB A;  4O55 A;  3C6H A;  4FPB A;  3TAB A;  4KB0 A;  4F2S A;  1N8R O;  4FJG A;  4Y0W A;  3TSP A;  4CD1 A;  3VEZ A;  3CPE A;  1ASU A;  4LF9 K;  3LL3 A;  3MX2 A;  3FZF A;  2IDO A;  1WN7 A;  2ZJP L;  3QFP A;  2G8F A;  4CEA A;  4JI0 K;  1E3M A;  3V9U A;  1QSY A;  5MLC Q;  1W97 L;  1UOC A;  4IFE A;  2QA4 N;  4NLB A;  3SPY A;  4XH5 A;  5GAE P;  4J2A A;  4BC4 A;  1T05 A;  1BIS A;  4I2Q A;  4KRE A;  3EE8 A;  3HM9 A;  1FXX A;  1D5A A;  3C95 A;  1LW2 A;  3WT0 A;  1ASV A;  2HMI A;  5M1K A;  1ATN A;  3THV A;  3VGM A;  4CJE A;  4FWO A;  4NCG A;  4CZF A;  5CZ1 A;  1Z6R A;  4M3Z A;  5BPN A;  3ZSW A;  1J6Z A;  4CZJ A;  3CG7 A;  1ZBU A;  2GTD A;  4IFY A;  2BDP A;  3VQ6 A;  1Z05 A;  3L4Q A;  3AA2 A;  3NVM A;  1ATS A;  1Z26 A;  3EZW A;  3QML A;  4H0X B;  4DV0 K;  5HLF A;  1NM1 A;  4B9S A;  2O8B B;  2OAN A;  2GBZ A;  2OPP A;  5AQY A;  1RT4 A;  3A0I X;  2P9L B;  3BZC A;  3L2V A;  1OH7 A;  3VQE A;  4BC2 A;  2OZM A;  3VTH A;  3DLG A;  1UWB A;  1VRU A;  3GL1 A;  3FFI A;  5AQF A;  3OYM A;  3IAY A;  4BRP A;  2YHX A;  3BZK A;  4GVE A;  1X9W A;  3M1F A;  1XNR K;  4ELT A;  4QAG A;  1TK0 A;  4JV5 K;  3TTF A;  2DFE A;  3VQ7 A;  2NRV A;  4KI6 A;  4J2E A;  4BRK A;  3V6D A;  3CCJ N;  4BQL A;  4CF8 A;  2QWQ A;  2KHO A;  3LP2 A;  4QS8 A;  3AVA A;  4CJU A;  4HTU A;  1BOT O;  2V52 B;  4GW6 A;  1MDU B;  4LF4 K;  4K43 A;  3ZEU B;  1N36 K;  4GKK K;  5GAH P;  3RRG A;  4OX9 K;  2QK9 A;  3JS6 A;  2PAV A;  1NGI A;  3AVH A;  3U4L A;  2G8H A;  1K8K B;  2WFB A;  1DKG D;  2QXF A;  3EL2 A;  4CVN E;  3ZLJ A;  4BRE A;  3C6U A;  1S6Q A;  1TYQ B;  3H1V X;  1WUA A;  4KH4 A;  3CMA N;  2QKB A;  1J9A A;  1JXE A;  3IFR A;  1S1X A;  5AR0 A;  4CK2 A;  3FZH A;  3WNE A;  4CHY A;  1EO1 A;  5KPZ A;  5JVG L;  4BE1 A;  4CF2 A;  1BU6 O;  5KGX A;  1LWE A;  1RDB A;  5DMR A;  4BRO A;  2JWL A;  3W3D A;  1IV0 A;  2D4W A;  5J2N A;  4LF8 K;  1XUP O;  2VQF K;  1ESV A;  3AO5 A;  3OYN A;  1EX4 A;  2DFH A;  1VQ6 N;  2ZWH A;  5C12 A;  4FJ8 A;  4FJ7 A;  4BRQ A;  3CFO A;  4JK9 A;  4YFU A;  1BA1 A;  4H5N A;  4B3O A;  4RWT A;  5AQL A;  1C1B A;  2RHK A;  4JEP A;  1W2B M;  4YOR A;  3V1Q A;  3T3F A;  2ZGZ A;  4GV9 A;  1YF5 L;  3AGK A;  3D2F B;  4CCH A;  2HNZ A;  1RBR A;  3M8Q A;  4DSE A;  1YTU A;  3CQ8 A;  1VQ5 N;  1EWQ A;  3ENO A;  3OYL A;  4CK1 A;  1VQO N;  1XI1 A;  1WB9 A;  2I7P A;  2HHV A;  1U6Z A;  2YCH A;  3TTC A;  2ZJR L;  1J5E K;  3KTQ A;  4B3M K;  1KLM A;  4BVP A;  2YJE A;  2V7Z A;  5A2Q O;  2A1S A;  3AVG A;  5BR9 A;  5HRS A;  3VEY A;  4H5T A;  3KLE A;  4IXC A;  1TAQ A;  3EY1 A;  4GKJ K;  4FLU A;  1YI2 N;  3MEC A;  2P5G A;  4Z4C A;  2UYT A;  3OYC A;  4PHT X;  1XHZ A;  4FJL A;  5FPD A;  3FZL A;  3M8S A;  1HNV A;  4DTJ A;  4DV1 K;  5JLF A;  1HKC A;  4NXN K;  3DLH A;  2D0A A;  4WF9 L;  5AZI A;  3ATU A;  4JS4 A;  3CCQ N;  5J1E A;  4OLA A;  2Q3S A;  4KRF A;  1JXB A;  4CJF A;  5HP1 A;  2G8W A;  3SK3 A;  3VEW A;  4DQQ A;  4RCH A;  3THX B;  3A5L C;  1P90 A;  3VQ8 A;  4CIF A;  5GIN A;  1TUY A;  4CE9 A;  1CXQ A;  3K0S A;  1FK9 A;  2GWK A;  3WQU A;  3LM9 A;  1YAG A;  1NGA A;  4JI8 K;  1C6V A;  1NK6 A;  4GVM A;  3OBW A;  4M7Y A;  3BF1 A;  4N76 A;  2YX6 A;  3VN5 A;  3CF5 L;  3W0L A;  1QVG M;  4TSX A;  4XEI A;  2IVN A;  3B6P A;  3KWI A;  3HVT A;  2GUI A;  3KLF A;  3OW2 M;  1KTQ A;  3AO1 A;  4RTF D;  1FKP A;  3SJJ A;  3AVL A;  4DTM A;  1A5V A;  3NVK A;  4K8Z A;  1C1A A;  3SUP A;  3BEX A;  5FRM A;  4NYF A;  1TGO A;  4B9N A;  4LFB K;  3QIO A;  3K9J A;  1NU0 A;  3VOV A;  4BAC A;  2PYJ A;  3VF2 A;  5JVH L;  2VG7 A;  1X9M A;  1ILY A;  4LFC K;  3NDK A;  4ELV A;  3RMA A;  4CJ4 A;  2KKZ A;  4DKW A;  4EFH A;  5SWM A;  2FBV A;  4HCC A;  1ZBS A;  1ZC6 A;  2QXL A;  2YNI A;  4ICL A;  3MXM A;  4KHQ A;  5E84 A;  4BRG A;  4JRP A;  4FWL A;  5E26 A;  1VQK N;  3IDH A;  3MEE A;  3MCA B;  3CQY A;  3O4Q A;  1BG3 A;  3AVK A;  2GV9 A;  4NLC A;  3GDQ A;  2E4L A;  3THY A;  5M1O A;  1HNX K;  4DV2 K;  4W5Q A;  3O8M A;  3CJ9 A;  1ZBH A;  2IVO A;  3NGZ A;  4FZZ A;  2P1J A;  5K14 A;  5AQI A;  5LL6 Z;  3TSQ A;  3U3Y A;  4CBX A;  2YHY A;  4EAH D;  3DXM A;  3M8P A;  1X1P A;  4O44 A;  3C7N B;  5CYM A;  1M90 O;  4GV3 A;  3UIQ A;  3E9O A;  1YXQ A;  4CBW A;  4EHT A;  1M1K O;  2O8F B;  4KHU A;  1NGJ A;  1DEJ A;  4DR5 K;  1IBK K;  3OYF A;  3PSI A;  4CHZ A;  4CGF A;  5HRN A;  4KHN A;  4IEI A;  3ZX3 A;  2E8A A;  3T7Z A;  2Y1I A;  3TPQ A;  4MDA A;  1IKV A;  2I7N A;  2P9S B;  1NGH A;  4FWQ A;  3JXU A;  2ZQB A;  3Q7B A;  4YOT A;  1T3V A;  4OKJ A;  5T7B A;  4CJW A;  4E1M A;  2J4R A;  4IWV A;  2D5R A;  3KLG A;  3QFU A;  5JMV A;  2ZF5 O;  2HBL A;  5JS1 A;  2NRW A;  3J81 O;  1VHX A;  1RBV A;  4FWS A;  4CIG A;  2DTU A;  1IH7 A;  1EET A;  4M3W A;  1Y64 A;  3NF9 A;  1JLC A;  3EKS A;  3QEW A;  1TAU A;  4F3T A;  4AHR A;  4O4G A;  2CGL A;  3ULD A;  1RDA A;  2HHW A;  3ENH A;  5F0X A;  2CGK A;  3HZ6 A;  1Y97 A;  4LSL A;  1NLV A;  3HPH A;  3LP3 A;  5AQU A;  1NG9 A;  4W5N A;  3U9Z A;  2BAN A;  5AQO A;  1C0F A;  3WEE A;  3PY8 A;  1OKJ A;  2YNF A;  5KRT A;  2Z1H A;  1YJ9 N;  1I39 A;  1QSS A;  5HL7 L;  1NMN A;  1VSK A;  3B6O A;  1KQS M;  3AA5 X;  5AQV A;  2QWP A;  3DWL A;  4AM6 A;  1WBD A;  5C42 A;  3ASM A;  3K9K A;  4PKG A;  3GOI A;  1SL1 A;  1HKG A;  3PIO L;  2JLE A;  1GOC A;  4DV6 K;  4DSL A;  1XC3 A;  1HQE A;  3G6E N;  5DM7 L;  4KTW A;  3FR0 A;  4OPH A;  4DTN A;  1IJJ A;  2XY7 A;  4DTX A;  3ALY A;  2G8V A;  3DJC A;  2FF6 A;  4FOI A;  4I6M A;  3TU5 A;  4H5R A;  4DR3 K;  3CI5 A;  4H0P A;  2QWR A;  4Y1C A;  3V9X A;  3TAN A;  2VGN A;  2P51 A;  4CJL A;  1U49 A;  3SV3 A;  1S22 A;  3I0R A;  3VQA A;  4AQY K;  5AQT A;  3SV4 A;  3OYG A;  3HBT A;  1YVU A;  1CLQ A;  4F4K A;  3F9M A;  2ETJ A;  3WXK A;  4BR4 A;  3HXM A;  3EEQ A;  3V1O A;  4FLY A;  3K5L A;  3GE1 A;  4CIE A;  3PX4 A;  4ISG A;  2IOC A;  2GEM A;  4WQ5 C;  3JYT A;  2ATQ A;  2E1Y A;  5KPT A;  1JCG A;  4OPA A;  4B9T A;  4JD2 A;  2X74 A;  4CZM A;  3HL8 A;  2X6N A;  3A5M C;  3H1Q A;  4RW7 A;  3CFR A;  5AQP A;  1J54 A;  1J5O A;  4BRF A;  2HHU A;  4A61 A;  3HP9 A;  1JJ2 M;  2AA4 A;  2G8K A;  2A41 A;  2O4G A;  3ENB A;  3LDL A;  4IFV A;  4B9U A;  3E66 A;  4DS5 A;  4YDU A;  1KVB A;  3MDQ A;  3EE9 A;  5GIP A;  3CJ1 A;  1KVA A;  2BTF A;  3C94 A;  1U2V A;  3LDN A;  3QIC A;  1GLD G;  4BVO A;  2KTQ A;  4DFK A;  4Z4F A;  4GMJ B;  4AH9 A;  4E1J A;  3OS1 A;  1NGE A;  4E7I A;  1TL3 A;  3LPT A;  5BN9 A;  1B9D A;  4EP4 A;  4J8F A;  2F9T A;  3FFK B;  1ATR A;  4JI6 K;  3C6T A;  3HM8 A;  3MN9 A;  4CJR A;  2E6M A;  1XQS C;  4FZX C;  2P9N A;  3KJV A;  3ZSX A;  4DSJ A;  1NK7 A;  1W7A A;  4Y1D A;  3DMJ A;  1NWK A;  1QQM A;  1KFS A;  3VGL A;  5BPL A;  1UA0 A;  3F73 A;  2W40 A;  2YKM A;  4AHU A;  4CJ7 A;  3ZSY A;  3J7A P;  1WSI A;  4H4M A;  4E7L A;  4M3T A;  3ZET A;  2P5O A;  1N6Q A;  4JN4 A;  4DLE A;  2NUB A;  3HI0 A;  1S5J A;  3DLE A;  3QLH A;  3NGY A;  3G0Z A;  3SAG A;  4CED A;  4B9Q A;  3DXK B;  4JNE A;  3VPZ A;  3EKU A;  4K41 A;  4HUG A;  3I33 A;  4B9M A;  3RMD A;  3CC2 N;  1ZBI A;  1N5Y A;  2YNH A;  2OTJ N;  1SV5 A;  2D0O A;  1C1C A;  3IS9 A;  4J2B A;  4ILG B;  2EWS A;  1HYS A;  3WNG A;  1YTA A;  1NK0 A;  1LCU A;  4EP5 A;  3KD5 E;  1VSI A;  1GOA A;  3L2Q A;  3K5O A;  3UKU A;  3VEV A;  3VQQ A;  3QIP A;  1IKY A;  3CJB A;  4CF9 A;  3WQT A;  4FJH A;  2D0C A;  2VWK A;  4BR0 A;  3JSM A;  4JKH A;  3DOK A;  5TKW A;  3QER A;  1YJN N;  1YT3 A;  4H0V B;  1JLA A;  5J2Q A;  3D45 A;  4Q5V A;  2ITG A;  2I5J A;  3VEO A;  4YOW A;  4CGH A;  4N5S A;  2D0B A;  4FJI A;  4BR7 A;  4ZTF A;  3KVG A;  3DLK A;  1NJI O;  2E2O A;  3LDO A;  4DTS A;  1MA9 B;  3A8Y A;  3QET A;  2VYP A;  4DCH A;  1IBL K;  3HPG A;  2O8C B;  1X9S A;  4DTU A;  2VCP A;  3PUF A;  2QKK A;  3RRH A;  4B3R K;  5EXW A;  1RDW X;  1IG9 A;  4BC3 A;  2O8E A;  3AVC A;  1LWC A;  3E01 A;  4RW6 A;  1N33 K;  1GLF O;  3G4S N;  5AZJ A;  3VES A;  4BWM A;  4W5R A;  5M1N A;  1S1U A;  4YOX A;  1VQ9 N;  1SAZ A;  1SKW A;  4CEZ A;  2KZZ A;  3VQP A;  4FJN A;  4X62 K;  1IBM K;  4BRI A;  4DU3 A;  4DR4 K;  4BDY A;  2OPR A;  4MO5 A;  4KTQ A;  4A2B A;  1FW6 A;  4BC5 A;  2Q0R A;  4FYD A;  1RDD A;  4YOY A;  3QEV A;  4CEE A;  3PV8 A;  4FLZ A;  3AO4 A;  2RPI A;  4IKF A;  5EX5 A;  3SQ0 A;  1NGD A;  5AZI B;  4A5B A;  4JI2 K;  5JIC A;  3CCE N;  3L2R A;  4HCB A;  5AQQ A;  2D0P A;  3HST B;  3I55 N;  1N34 K;  3R9P A;  2HST A;  4FJK A;  3J7Y P;  4M3Y A;  3HOT A;  1YIJ N;  1RTD A;  4KI4 A;  1OH5 A;  1BDG A;  1TKD A;  2NLX A;  4ID5 A;  3SLC A;  3ISN C;  3ZSO A;  2VWJ A;  2DFF A;  3BF3 A;  4FJ5 A;  1S72 N;  3L6Q A;  1FJG K;  4FJM A;  3MWT A;  3KK7 A;  4IDH A;  2WTU A;  1J53 A;  2R7Y A;  5LY3 A;  2FSJ A;  3CIP A;  3NE6 A;  1R59 O;  1KAZ A;  2WUS A;  5HBM A;  2CGJ A;  3RSE B;  4X66 K;  3OVN A;  3QNO A;  4JI3 K;  1I94 K;  1HR0 K;  2F9W A;  1NOY A;  4CBU A;  3O9R A;  3DLL L;  4YDU C;  2B4J A;  4FVM A;  3HPO A;  4CER A;  4DB3 A;  3WNF A;  4IDK A;  4JK7 A;  1Q18 A;  2ASP A;  2H3G X;  4N47 A;  4WFB L;  1ZBL A;  3S3M A;  3QBW A;  4PKI A;  2W42 A;  2P9U A;  4CFC A;  1MWK A;  3DAW A;  2ASO A;  3G25 A;  2OTL N;  2QEX N;  2W6L A;  2HVI A;  2UXB K;  4DQ8 A;  4Z94 A;  3ULE A;  1KCF A;  1WNS A;  1BA0 A;  4DV5 K;  3OY9 A;  4QCL A;  1TUU A;  1O1W A;  3O9U A;  5C15 A;  4I9Q A;  4BE0 A;  3T1Y K;  2LSN A;  1RFQ A;  4IOX A;  3ATV A;  5C10 A;  4DF4 A;  1E4G T;  4FLW A;  4H4O A;  3AAR A;  3WUH A; 
#chains in the Genus database with same CATH homology
 5FDL A;  1ASW A;  1RTI A;  1QSL A;  4PUO A;  5HRP A;  1T03 A;  3AO3 A;  4RW9 A;  2Y1I A;  2A1R A;  2EX3 A;  2OPS A;  1IKV A;  1TK5 A;  1TK8 A;  1L3T A;  1RNH A;  4CHP A;  2HHT A;  1NK4 A;  4BWJ A;  1HMV A;  4AIL C;  4DMN A;  4C8L A;  4W5T A;  2HNY A;  2ZQB A;  1BQM A;  3AVN A;  5I3U A;  4RW4 A;  4WE1 A;  4OGC A;  4N41 A;  4JLH A;  4IG3 A;  2HB5 A;  4DFM A;  4FJJ A;  4OKJ A;  5HRR A;  5T7B A;  1Q9X A;  4CJW A;  4E1M A;  1HQU A;  3KLI A;  2D5R A;  2EHG A;  3KLG A;  1ZBF A;  2XY8 A;  3P83 D;  3WNH A;  3CM5 A;  3TAF A;  5JS1 A;  4CF0 A;  2YV0 X;  3IRX A;  3K59 A;  2PYL A;  3BDP A;  3RR8 A;  1RBV A;  3QIN A;  1WSJ A;  1ITG A;  4FW1 A;  4CGG A;  4CIG A;  4CEC A;  3K5N A;  2DTU A;  5E41 A;  4E19 A;  1IH7 A;  1EET A;  2E6L A;  4M3W A;  4HVJ A;  4F8R A;  3NF9 A;  4AHS A;  1JLC A;  4OPJ A;  2XY6 A;  3DRR A;  3QEW A;  2X6S A;  2PZS A;  3VQB A;  1CXU A;  4CJV A;  3OYK A;  4O0I A;  5FRN A;  1TAU A;  1DTT A;  4F3T A;  4RG8 A;  4AHR A;  1G15 A;  1HJR A;  4R5P A;  3TAE A;  1UA1 A;  4O4G A;  3QES A;  1NJX A;  3ULD A;  1RDA A;  1BCO A;  2HHW A;  1VSE A;  2XHB A;  3VQ4 A;  1EXQ A;  4CFB A;  5C24 A;  4KO0 A;  3U6F A;  1Y97 A;  2B6A A;  1BGX T;  3HPH A;  1CZB A;  3LP3 A;  1JLB A;  4LSL A;  1NJY A;  3G10 A;  2HVH A;  4W5N A;  4DSI A;  3TI0 A;  3QEP A;  2KFZ A;  1HNI A;  2BAN A;  3OYI A;  5KRS A;  3NH0 A;  1WAJ A;  3PY8 A;  3ZSQ A;  2YNF A;  5KRT A;  2Z1H A;  4CFD A;  3KD1 E;  4DQR A;  4JRQ A;  1I39 A;  2HND A;  4NYN A;  1QSS A;  3NAE A;  1VSK A;  3B6O A;  4E7J A;  3L3U A;  3AVM A;  3AA5 X;  1VSL A;  3VQ9 A;  3ZT0 A;  3OYD A;  2IGI A;  4KAZ A;  4Z4G A;  4CJQ A;  4O0J A;  1DTQ A;  3AVB A;  4AHC A;  4DWI A;  3KK2 A;  3TR8 A;  1VSJ A;  3NF6 A;  5C42 A;  4FK2 A;  1MU2 A;  3ASM A;  3V9S A;  1S1V A;  4I7F A;  3L2U A;  1ZYQ A;  5KTQ A;  4O55 A;  4UQG A;  1SL1 A;  3TAB A;  4KB0 A;  4MFB A;  3NHG A;  4F2S A;  3I8D A;  1BIU A;  2JLE A;  1GOC A;  1KLN A;  1LAW A;  4FJG A;  4DSL A;  3T19 A;  1HQE A;  4KTW A;  4N56 A;  4DTN A;  2YHB A;  2XY7 A;  1FKO A;  2O4I A;  1ASU A;  3LAM A;  1D8Y A;  1TL1 A;  1B9F A;  1QQC A;  3NCI A;  4DTX A;  1BQN A;  4B8C A;  3ALY A;  2G8V A;  4CGF A;  4HHT A;  2XO7 A;  3HT3 A;  2IDO A;  4DF8 A;  1WN7 A;  2X78 A;  3SUO A;  3OYA A;  4FJ9 A;  2G8F A;  2KQ2 A;  2YKN A;  4CEA A;  3V9U A;  3H08 A;  2B5J A;  1QSY A;  1RCH A;  4BDZ A;  4Y1C A;  3V9X A;  3TAN A;  1UOC A;  1CZ9 A;  2IAJ A;  4FXD A;  2P51 A;  4XIU A;  3SPY A;  3PO4 A;  4CJL A;  4J2A A;  4KHS A;  1BCM A;  1U49 A;  4KTZ A;  3SV3 A;  3I0R A;  3VQA A;  1T05 A;  1VSH A;  3SV4 A;  1BIS A;  4I2Q A;  1EKE A;  5KI6 A;  3ZT4 A;  3OYG A;  4KRE A;  4CEO A;  1YVU A;  3NH1 A;  3HM9 A;  4F4K A;  1FXX A;  1CLQ A;  4AHT A;  1D5A A;  1WSF A;  2ETJ A;  3HXM A;  1HYZ A;  3C95 A;  1LW2 A;  3V1O A;  4FLY A;  3K5L A;  3P1G A;  4I2P A;  4B8A B;  4FLV A;  2Z1J A;  1ASV A;  3OYH A;  2YHA A;  3KK1 A;  4CIE A;  3RTV A;  2HMI A;  3PX4 A;  3SCX A;  1TKX A;  4ELU A;  3S3O A;  3THV A;  1VRT A;  4FLX A;  3O3G A;  4CJE A;  4C8M A;  2RN2 A;  2IOC A;  1T7P A;  4Z4I A;  3ZCM A;  2FBT A;  3CM6 A;  4NCG A;  3JYT A;  4M3U A;  2ATQ A;  1NOZ A;  5CZ1 A;  4M3Z A;  4CJT A;  3ZSW A;  1LW0 A;  3MXI A;  1HYV A;  3CG7 A;  4LH5 A;  4M41 A;  3ZSZ A;  2X74 A;  4B9T A;  4BDP A;  4KHY A;  3HL8 A;  1ZBU A;  2X6N A;  4Q0B A;  4RW7 A;  3TAR A;  4IFY A;  2BDP A;  3VQ6 A;  3CFR A;  2G8U A;  1J54 A;  5KGW A;  1J5O A;  3V1R A;  3AA2 A;  3AVJ A;  1QS4 A;  1Z26 A;  2HHU A;  5HLF A;  4YNQ A;  3AVF A;  4DFJ A;  3HP9 A;  1LV5 A;  2G8K A;  4B9S A;  4LY7 A;  3EZ5 A;  2GBZ A;  2O4G A;  2OPP A;  1RT4 A;  1VSF A;  2WOM A;  3K2P A;  4LSN A;  4IFV A;  3L2V A;  5J2M A;  4B9U A;  4DS5 A;  2BE2 A;  3VA3 A;  4FK0 A;  3NBP A;  1KVB A;  3VQE A;  2OZM A;  2F96 A;  1QE1 A;  3KIO A;  3TAM A;  3V81 A;  3DLG A;  1UWB A;  1VRU A;  3FFI A;  3HP6 A;  4CJ3 A;  3OYM A;  3SZ2 A;  3IAY A;  1KVA A;  3C94 A;  3OYE A;  1X9W A;  4H8K A;  4DS4 A;  4ELT A;  4QAG A;  3DRP A;  2OZS A;  2Y1J A;  3DYA A;  1TK0 A;  5CZ2 A;  3KLH A;  3QNN A;  2DFE A;  3VQ7 A;  3OS0 A;  3SI6 A;  5I42 A;  3HO1 A;  2KTQ A;  4DG1 A;  4KI6 A;  2OPQ A;  4DFK A;  4J2E A;  1JKH A;  1TKZ A;  3V6D A;  3DLB A;  4Z4F A;  4GMJ B;  4AH9 A;  3OS1 A;  3LWL A;  4CF8 A;  4KKO A;  4E7I A;  2DY4 A;  3I0S A;  1TL3 A;  2WON A;  3LPT A;  3LP2 A;  1T8E A;  3AVA A;  4CJU A;  4CK3 A;  1B9D A;  4HTU A;  1L3V A;  4GW6 A;  4EP4 A;  2OA8 A;  3P5J A;  2BGG A;  1HRH A;  1W0H A;  1S6P A;  1S9G A;  1C0T A;  4CEF A;  3C6T A;  3OYJ A;  1L3S A;  1S1W A;  5C25 A;  3RRG A;  2QK9 A;  1JLF A;  4CJR A;  4CGD A;  3AVH A;  2E6M A;  2G8H A;  1IO2 A;  3EYZ A;  4FZX C;  2QXF A;  4ZTJ A;  1SUQ A;  3KJV A;  4CEQ A;  3LDS A;  3PX0 A;  3ZSX A;  4J2D A;  4K8X A;  4DSJ A;  4IG0 A;  3T1A A;  3ZSR A;  1NK7 A;  4PWD A;  3C6U A;  3HVR A;  3LZI A;  1S6Q A;  2KZM A;  1SL2 A;  4Y1D A;  4KPY A;  4OLB A;  2OYQ A;  3DMJ A;  4M3R A;  3K57 A;  4RW8 A;  2QKB A;  1J9A A;  1KFS A;  1D9D A;  1JXE A;  2RKI A;  1UA0 A;  3DLR A;  3F73 A;  4PQU A;  4QOZ B;  3RWU A;  2YKM A;  4AHU A;  1S1X A;  1DLO A;  1KVC A;  1WSI A;  4H4M A;  1RT3 A;  3ZSY A;  3LPU A;  3KKR A;  3WNE A;  4CK2 A;  4CHY A;  4E7L A;  4DTO A;  1XC9 A;  1RBU A;  4BE1 A;  4CF2 A;  1A5X A;  4CGJ A;  4B08 A;  4M3T A;  5KGX A;  1NKB A;  2P5O A;  1LWE A;  3ZT3 A;  1RDB A;  1HPZ A;  5DMR A;  3IG1 A;  1U4B A;  1JLE A;  4E7H A;  1N6Q A;  4DLE A;  4Z4E A;  5J2N A;  2NUB A;  3ITH A;  5EU7 A;  3NGI A;  1NK8 A;  3AO5 A;  1S5J A;  1EX4 A;  3OYN A;  2HHQ A;  3DLE A;  2DFH A;  3QLH A;  4DQI A;  4FJ8 A;  2PY5 A;  3NGY A;  3RR7 A;  3A2F A;  4FJ7 A;  1JL2 A;  1WAF A;  3G0Z A;  4IBN A;  2XRI A;  1RT1 A;  3CFO A;  4YFU A;  4JS5 A;  1GOB A;  3KKS A;  4CED A;  1SKR A;  3HK2 A;  3DI6 A;  4FLT A;  3BGR A;  4FW2 A;  3SUN A;  4B3O A;  2FC0 A;  3TAP A;  3S3N A;  4HUF A;  1C1B A;  1D9F A;  4DFP A;  4ZHR A;  2FBX A;  4KV8 A;  4HUG A;  3O4N A;  3OJU A;  3LP1 A;  1L5U A;  4B9M A;  3RMD A;  1SL0 A;  3DOL A;  3LP0 A;  4E1N A;  3V1Q A;  3T3F A;  3V4I A;  1W9H A;  3VQC A;  1ZBI A;  1N5Y A;  2YNH A;  1BIZ A;  1SV5 A;  4CCH A;  2HNZ A;  3SNN A;  1C1C A;  3IS9 A;  1RBR A;  4J2B A;  4FZY A;  4DLG A;  3M8Q A;  4DSE A;  4DTR A;  3ZT1 A;  3AA4 A;  1HYS A;  3WNG A;  3RMB A;  1YTA A;  4LH4 A;  3CQ8 A;  1NK0 A;  1YTU A;  1I3A A;  4EP5 A;  3CFP A;  3KD5 E;  1VSI A;  1GOA A;  3OS2 A;  3OYL A;  3L2Q A;  3K5O A;  4OGE A;  1IKX A;  5CYQ A;  4CK1 A;  3HJF A;  2HHS A;  4DTP A;  1XI1 A;  1IKW A;  1B92 A;  4ID1 A;  3VQQ A;  3L8B A;  3K58 A;  2HHV A;  4CHO A;  3QIP A;  4E0D A;  1IKY A;  4PA1 A;  1RT5 A;  1RT7 A;  3NH2 A;  3KTQ A;  2VG5 A;  3O3H A;  4CF9 A;  1JL1 A;  4FJH A;  1KLM A;  2D0C A;  4Z0U A;  2VWK A;  3SQ2 A;  4EZ6 A;  3JSM A;  2HW3 A;  3DOK A;  1A5W A;  1S9E A;  2A1S A;  3AVG A;  3QER A;  5HRS A;  1NJW A;  3QEX A;  4NCA A;  1YT3 A;  1WSG A;  3MED A;  4M45 A;  3M8R A;  1NK5 A;  1JLA A;  3NFA A;  4CHQ A;  3D45 A;  4CJK A;  3KLE A;  5J2Q A;  1TAQ A;  3EY1 A;  5CY4 A;  4Q5V A;  2IC3 A;  3SPZ A;  4NCB A;  1BI4 A;  2ITG A;  4FLU A;  2I5J A;  3MEC A;  1XHX A;  2YNG A;  4DSK A;  3LAL A;  2P5G A;  4KFB A;  2XY5 A;  4CGH A;  4Z4C A;  3HYF A;  1NKE A;  4N5S A;  3QO9 A;  3VQ5 A;  3OYC A;  2D0B A;  1XHZ A;  4FJI A;  3SYZ A;  3LWM A;  1S1T A;  4FJL A;  4ZTF A;  4Z4H A;  3M8S A;  1HNV A;  1BHL A;  4M42 A;  4DTJ A;  3DLK A;  4DTS A;  2F8T A;  3QET A;  4BE2 A;  3DLH A;  3V9W A;  2AJQ A;  3NF7 A;  3HPG A;  2ZE2 A;  1U48 A;  4E7K A;  1X9S A;  1NKC A;  4DTU A;  2D0A A;  1KRP A;  2IS3 A;  1L3U A;  3PUF A;  2VG6 A;  4CJ5 A;  4JS4 A;  4CFA A;  4CES A;  2QKK A;  5J1E A;  1QHT A;  3RRH A;  2Q3S A;  3VA0 A;  3L2W A;  4OLA A;  4W5O A;  4KRF A;  1JXB A;  1XWL A;  4OPK A;  1LWF A;  4CJF A;  1IG9 A;  5HP1 A;  2G8W A;  4FCY A;  4CJP A;  5DK5 A;  3AVC A;  1LWC A;  5FRO A;  5SZT A;  3U3G A;  3O3F A;  4DQQ A;  1C0M A;  3E01 A;  4RW6 A;  4DQS A;  3AA3 A;  4C8O A;  4CF1 A;  4FJX A;  4OJR A;  4C8N A;  3K5M A;  4B9L A;  3PO5 A;  3AV9 A;  2KFN A;  1TV6 A;  3VQ8 A;  4CIF A;  4BWM A;  4W5R A;  3CYM A;  4CE9 A;  1CXQ A;  1S1U A;  1FK9 A;  2HHX A;  3OJS A;  5JS2 A;  3MXJ A;  3L3V A;  3MEG A;  3DM2 A;  1BI4 B;  1KFD A;  3AO2 A;  1RDC A;  4CEZ A;  1SKW A;  2KZZ A;  1QTM A;  3VQP A;  3NF8 A;  4FJN A;  3ZT2 A;  1C6V A;  1K6Y A;  4FM2 A;  1NK6 A;  4DU3 A;  4E3S A;  2F8S A;  4OKK A;  4GVM A;  4BDY A;  2OPR A;  4N76 A;  2JGU A;  4KTQ A;  4DU4 A;  1Q9Y A;  3AVI A;  4EZ9 A;  3VN5 A;  3TAG A;  1TKT A;  1TVR A;  4FYD A;  1R0A A;  1RDD A;  4TSX A;  3QEV A;  1EP4 A;  3B6P A;  4CEE A;  3PV8 A;  4FLZ A;  3AO4 A;  2RPI A;  3HVT A;  4FK4 A;  2GUI A;  3KLF A;  4IKF A;  3SQ0 A;  1KTQ A;  1RT6 A;  2KW4 A;  3AO1 A;  1FKP A;  4FM0 A;  3SJJ A;  4C8K A;  3AVL A;  1Q8I A;  4FM1 A;  3L2R A;  4DTM A;  4HCB A;  3QEI A;  1A5V A;  4AHV A;  3HST B;  3LAN A;  3V9Z A;  4FJK A;  4K8Z A;  3OYB A;  3S9H A;  4M3Y A;  1C1A A;  1RTD A;  4KHN A;  4KI4 A;  3SUP A;  4E89 A;  5FRM A;  4NYF A;  1TGO A;  4B9N A;  4F2R A;  4KB1 A;  1TKD A;  3QIO A;  4ID5 A;  3LZJ A;  3LAK A;  1WLJ A;  1UAX A;  3ISN C;  4BAC A;  3ZSO A;  4F3O A;  2VWJ A;  2DFF A;  2PYJ A;  4MQ3 A;  2VG7 A;  1X9M A;  2Z1G A;  1NK9 A;  4OVL A;  4FJ5 A;  1VSM A;  3NDK A;  1VSD A;  4CGI A;  3RMA A;  4ELV A;  4CJ4 A;  3RMC A;  4FJM A;  3D0P A;  4DU1 A;  4M3X A;  2ZD1 A;  3ZSV A;  1J53 A;  1JLG A;  2R7Y A;  5SWM A;  2FBV A;  3TWH A;  1RTJ A;  3NE6 A;  3PX6 A;  4HCC A;  5D3G A;  4CHN A;  2YNI A;  1RIL A;  2Z1I A;  4ICL A;  5HBM A;  3QNO A;  3MXM A;  3OVN A;  4KHQ A;  1RT2 A;  3SUQ A;  1U45 A;  1NOY A;  4CEB A;  4JRP A;  4G1Q A;  4LD0 A;  4DQP A;  3DRS A;  2B4J A;  1U47 A;  1NJZ A;  3MEE A;  4FVM A;  3HPO A;  1SKS A;  4CER A;  3O4Q A;  1Z25 A;  2FBY A;  4O5B A;  3WNF A;  1WSH A;  4IDK A;  3AVK A;  4PY5 A;  1RBS A;  1KSP A;  1BL3 A;  2GV9 A;  3F9K A;  4N47 A;  1RTH A;  4CJS A;  2E4L A;  1ZBL A;  3S3M A;  4L8R B;  4W5Q A;  1LAV A;  1WSE A;  2W42 A;  1ZBH A;  4CFC A;  3VQD A;  1JLQ A;  3NGZ A;  5J2P A;  4FZZ A;  2P1J A;  5K14 A;  5HRO A;  3U3Y A;  1RBT A;  3MAQ A;  2HVI A;  3SQ1 A;  2RF2 A;  3M8P A;  1X1P A;  4O44 A;  5CYM A;  1KCF A;  1WNS A;  3SQ4 A;  3UIQ A;  1REV A;  3KK3 A;  1F21 A;  3OY9 A;  4B9V A;  1U04 A;  4KHW A;  2G8I A;  4QCL A;  1O1W A;  4KHU A;  4I9Q A;  4BE0 A;  4I9L A;  1VK0 A;  2LSN A;  4DSF A;  4OKE A;  3TAQ A;  4DF4 A;  4FLW A;  4H4O A;  3OYF A;  4HUE A;  4CHZ A;  1C0U A;  5HRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...