4HUFA

Structure of 5-chlorouracil modified a:u base pair
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hufA00
4KHSA 3ZT1A 3KLIA 3AO5A 4DTMA 4OLAA 4CF0A 4FW1A 2QXFA 4AHSA 5FDLA 1T03A 4B9SA 1WSGA 1GOBA 4KTWA 4FM2A 1TL1A 4DF8A 1IKYA 3O3HA 1JKHA 4OPKA 3SUQA 1TKZA 4OVLA 3OYLA 1U04A 1DTTA 3KLHA 3CFPA 3M8QA 1NKBA 1BIUA 3DRPA 4CFCA 4CHZA 3ASMA 4C8NA 4JRPA 2XY7A 1X9WA 2FBTA 4HVJA 3RTVA 1L3TA 4CCHA 4BE2A 4B08A 4CF8A 4DTNA 2YNGA 4PWDA 5EU7A 1BQNA 5C42A 4DTOA 1SKRA 1QSSA 4Z4IA 2E6LA 4I9LA 4BWMA 2B6AA 4PA1A 3TAMA 3ZSVA 2LSNA 4AHCA 3QEXA 3AVHA 2WOMA 4B9LA 1BQMA 3I0RA 5J2MA 3C6UA 2VG5A 3AVAA 1B9DA 3M8PA 3HJFA 2RPIA 4N5SA 3IAYA 1RDDA 2B4JA 4CHQA 4CK3A 2G8FA 3RMDA 3K58A 3TR8A 1ZBIA 4N41A 1VSEA 1W0HA 1B9FA 3IG1A 4ZHRA 4C8MA 3TAQA 3KD5E 3K5MA 2G8IA 4KHWA 1RDAA 4O44A 2BANA 3NF6A 5HRNA 4IFVA 3KJVA 1RILA 3HP6A 1Y97A 4L8RB 1ZBLA 4DQSA 3L2UA 1TAUA 5HRSA 1TKTA 4KTQA 4CK1A 1VSDA 3E01A 3DLHA 3LZJA 3NF8A 2DTUA 4M45A 5K14A 4B8CA 3NGIA 1NJZA 4I2QA 4DTUA 1WLJA 2WONA 4FJ5A 4FLZA 1RT6A 4CGIA 1JLGA 4CJ5A 4MFBA 1WSFA 1JXEA 5CYMA 2VWJA 5HBMA 1L3SA 3U3GA 4AHUA 2X6SA 3DLRA 3PO5A 4FYDA 3THVA 4FJJA 4CECA 3H08A 4CFBA 3NFAA 2KZZA 4CGGA 2E4LA 3EYZA 3V9SA 5CZ1A 1VSLA 4DQQA 1VSIA 1S1XA 2HNYA 4CJVA 3BDPA 1NK7A 3OYMA 1KVCA 3ZSOA 3SJJA 1HYVA 3PX4A 4HUGA 1NK6A 4B9UA 4DSIA 3VQDA 3QLHA 1ASWA 1WSJA 1HNVA 1BCOA 3AO4A 3MEGA 3NCIA 2OZMA 3LALA 2YHAA 1Q8IA 4B9MA 3LPUA 4EZ9A 4Z4EA 4DTRA 1J53A 4CJRA 3HYFA 4CGDA 3VN5A 5I3UA 2QKKA 3PO4A 3SCXA 4KI4A 4DF4A 3HVTA 2VG6A 1EX4A 1N6QA 4KAZA 1U45A 3RMBA 4HCBA 3HM9A 3AA4A 1C1CA 4CEFA 3OS0A 3K59A 5HLFA 3G10A 4B8AB 2B5JA 1Z25A 3ZSZA 3K5LA 5J2PA 5J2QA 5E41A 1C1BA 3U3YA 1NJXA 1X9MA 4E7IA 3HT3A 1IG9A 3M8RA 2AJQA 2GV9A 1YTUA 3QINA 4OKKA 4F3TA 4ICLA 3S9HA 1WAFA 2VG7A 3ZSWA 1BGXT 3AO2A 4CESA 4DG1A 3TANA 2QKBA 4BDPA 1SL0A 2OYQA 1LWEA 1TK8A 1TL3A 3ZT0A 4DQPA 1VSMA 4W5QA 4PUOA 4FJMA 2ITGA 4CJLA 1U48A 1RT4A 4FJHA 2HHVA 4AILC 4FJNA 4M3TA 2IS3A 2DFFA 1NOZA 2HB5A 3OJUA 3F73A 2OPQA 3CYMA 1L5UA 5KRTA 3OYGA 1FKOA 3NAEA 4B9VA 3L2RA 2KTQA 1FK9A 3OYDA 4CIGA 1QTMA 1JLCA 1C1AA 1S6PA 3VQBA 1RTJA 4DTPA 3PV8A 1U47A 2F8SA 4E0DA 1U4BA 3NDKA 4I9QA 4F4KA 2ZE2A 3BGRA 3C6TA 3QESA 1T05A 3NF7A 1VSHA 4R5PA 2HHTA 2HHWA 5CZ2A 3MAQA 1J54A 4CHPA 4EP5A 3K5NA 3LAKA 5KGXA 4IG0A 1XC9A 2OA8A 3HPGA 4FJ7A 3K5OA 3ZT3A 5FRMA 2HNDA 4DSFA 1NOYA 4KFBA 2Z1HA 4CJSA 3L2QA 3LZIA 3O4QA 4CJ4A 3NGZA 3SQ0A 2P5OA 4IG3A 4ELVA 1VSJA 3DLBA 3LWMA 3LP0A 4J2EA 3T3FA 1QE1A 4CGJA 4HUEA 5T7BA 1WAJA 3OYAA 4Z4HA 3M8SA 3LP3A 4DFMA 3TAEA 4FK2A 4Z4CA 1U49A 3OYJA 4BWJA 4J2DA 4OGCA 5DMRA 3ZCMA 4GMJB 2G8WA 2X74A 4RW8A 4FLUA 1HYSA 1S1WA 4MQ3A 3OYBA 1TVRA 1IKXA 1JL1A 2FBYA 3DOLA 3OYIA 2G8HA 4KB1A 4DFKA 4AHRA 3RR8A 3DMJA 4W5NA 1D9DA 1DTQA 3RRHA 4J2AA 3V9UA 4DLGA 3B6PA 3VQ8A 3TABA 2R7YA 2P1JA 3P1GA 4KHYA 3UIQA 4DFJA 4CEOA 2OZSA 2GBZA 3LPTA 3WNFA 4YNQA 4KPYA 4DSLA 1RBTA 3QIPA 3C94A 4NYNA 4RW7A 4H8KA 2DY4A 4LH5A 2FBXA 4DU4A 1KFSA 1CZBA 3T1AA 4ELUA 4B3OA 4ID1A 3QETA 3TAGA 2HHXA 4KREA 3QO9A 1RBSA 3V4IA 2E6MA 1XI1A 3HXMA 1QS4A 4E3SA 3V9XA 3ZSRA 3AVBA 4AHTA 1RDCA 5DK5A 3ZSXA 4FZYA 3KLGA 3SUPA 3CFOA 3G0ZA 4GVMA 4M3YA 4I2PA 1O1WA 5HRRA 4M3RA 1TKXA 1NKEA 3DLGA 1TV6A 4H4MA 3L8BA 2ATQA 1C6VA 3AVFA 3NBPA 4CHOA 5D3GA 4M3UA 4CERA 2ZQBA 4CJPA 2RF2A 2YNIA 4DS5A 4IKFA 1WSEA 3L3UA 1REVA 2Z1JA 3AVGA 4KO0A 2IC3A 4DTSA 1NJYA 4CHNA 3ALYA 2Y1JA 2XRIA 2ZD1A 2O4IA 1A5WA 3VQ7A 1IKVA 2BDPA 4CE9A 4DTJA 4Z0UA 3OVNA 1TGOA 3NGYA 3VQQA 1C0MA 1ASVA 4OKJA 1EXQA 1S5JA 3DOKA 3KLFA 2D0AA 4WE1A 1A5VA 2KFZA 4E7LA 4FJXA 2HMIA 4F3OA 1HNIA 1S1UA 3IRXA 4M41A 1RT7A 4YFUA 3V6DA 4CJ3A 1BI4A 4O0IA 3CG7A 4CJKA 4DQIA 4FLVA 3IS9A 1HJRA 1QQCA 2HHUA 5HP1A 3TAPA 4RW4A 4FM0A 5J1EA 4IDKA 1BCMA 1SUQA 4O0JA 1TAQA 3V1OA 3VQ9A 3EZ5A 4BDYA 4DSEA 1NK9A 1QSLA 1JLBA 2FBVA 2HHQA 4J2BA 1C0TA 4N76A 4FJLA 1JLAA 4E89A 3CQ8A 3PY8A 4DU3A 2Z1IA 3NH1A 3SV3A 3DM2A 3PX6A 1R0AA 1RBRA 3O4NA 3AO1A 4W5OA 1SV5A 4BE0A 4M3XA 2X6NA 3AVNA 5KGWA 4ZTJA 2G8UA 4QOZB 1WSIA 2XY5A 1KSPA 1RTIA 3NF9A 4RW6A 3I8DA 2BE2A 3AA2A 3SPZA 1L3UA 4B9NA 2YKNA 3AVJA 2EX3A 3TARA 5FRNA 4PY5A 4N56A 1DLOA 1X9SA 3TWHA 3SI6A 3V81A 4CEBA 5C25A 3VQ6A 1EKEA 4H4OA 1S1TA 1KCFA 4FJIA 4CEDA 4O4GA 4NCAA 3OJSA 4W5TA 4CEEA 1WNSA 4E7KA 4KHNA 1RBUA 1CZ9A 4GW6A 3AA3A 3DRSA 4KKOA 3U6FA 2OPRA 1C0UA 3OYNA 4F8RA 3O3GA 1T8EA 4C8OA 4FJ8A 1UAXA 3MXMA 1IO2A 4OJRA 3DI6A 1IKWA 3F9KA 1WSHA 1ZBHA 1HQEA 3V1QA 4JRQA 4OPJA 1HMVA 4XIUA 2IGIA 3OYKA 3VA3A 3KIOA 2OPPA 1A5XA 3AVCA 2Y1IA 3WNGA 3MEDA 1SKSA 2P5GA 1BIZA 5I42A 3TI0A 4EZ6A 1XHXA 2YNHA 4FK4A 3ITHA 3OY9A 1JLEA 3ZSQA 1X1PA 2NUBA 3SUOA 4CEAA 4E7JA 3S3OA 3S3NA 4FLTA 2PY5A 1VSKA 1XHZA 3KKRA 1WN7A 1HYZA 4JS5A 4LD0A 3OS2A 4FCYA 1RT1A 4KV8A 1NJWA 4TSXA 4FK0A 4IBNA 2D0BA 5KRSA 2KFNA 4E19A 4CJUA 3QEPA 3DRRA 3P83D 4FJGA 3HO1A 3AVKA 4K8ZA 1L3VA 3D45A 3HPOA 3VA0A 4DLEA 4FZXC 2DFHA 2YKMA 1QSYA 3AO3A 3HSTB 4FZZA 2DFEA 4FW2A 2X78A 1YVUA 3VQ5A 1T7PA 2G8VA 4EP4A 3NH0A 4C8KA 1F21A 2IAJA 3SQ4A 3LP1A 1KVAA 3KD1E 1NK8A 3NE6A 3D0PA 4DTXA 1EETA 4B9TA 5J2NA 1BHLA 1RTHA 3SZ2A 5C24A 2IDOA 4CF2A 2FC0A 3P5JA 1D9FA 5JS2A 2KW4A 4ZTFA 4M3ZA 2OPSA 3QIOA 3HPHA 2RKIA 2YV0X 1BISA 4I7FA 4CJTA 3MECA 4CJWA 1VSFA 3NH2A 3MXJA 4FLWA 4FM1A 3RMAA 4Z4FA 4KB0A 3HK2A 3RR7A 4PQUA 1YTAA 1I3AA 4Q5VA 3SNNA 1TK0A 3OYCA 4HCCA 1ZYQA 3CM5A 3HL8A 2YNFA 4OKEA 1NK5A 4FLXA 2RN2A 3LP2A 2HVIA 2YHBA 3QEWA 1VK0A 4HTUA 1KTQA 4KTZA 1MU2A 1GOCA 1FXXA 1YT3A 3KK1A 1Q9YA 1RT5A 4AHVA 4DFPA 3KLEA 1ASUA 2KQ2A 3QNNA 3RWUA 5JS1A 1TKDA 1ZBUA 4NCBA 2F8TA 1NK4A 1RT2A 1RNHA 3K2PA 4Y1CA 1RDBA 5HROA 2XO7A 3S3MA 4BACA 4FXDA 1KLNA 4JLHA 4DU1A 1UA0A 4C8LA 2KZMA 3SQ2A 3KK2A 3AVLA 4HHTA 4ELTA 1I39A 3OYEA 4KHQA 3KK3A 3VQAA 4Z4GA 4N47A 3JYTA 3HP9A 4E1MA 3AVIA 1J5OA 1RT3A 4RG8A 4RW9A 4ID5A 1IH7A 1ITGA 1GOAA 3T19A 4CJQA 4LSLA 1QHTA 3LWLA 3NHGA 1LWCA 1RBVA 2XHBA 4FLYA 4DSKA 1SKWA 3A2FA 1W9HA 3O3FA 1TK5A 3L3VA 5HRPA 3MXIA 2ETJA 4E1NA 3RRGA 2Q3SA 4CJEA 3PX0A 1CXQA 1HRHA 2D0CA 3AA5X 3RMCA 3ULDA 1BL3A 3B6OA 3L2VA 2A1RA 1D8YA 4G1QA 1CLQA 1Z26A 1RTDA 3DLKA 1UOCA 3MEEA 3SV4A 2P51A 2HW3A 3I0SA 2BGGA 4M42A 1S6QA 4F2SA 3L2WA 3WNHA 3SUNA 2W42A 5KTQA 1UA1A 1KRPA 2F96A 4KI6A 4M3WA 1G15A 1HQUA 3SYZA 2JGUA 4BE1A 3QEVA 1LAWA 2VWKA 3AVMA 4CFAA 1B92A 4CGFA 4CHYA 3VQPA 3OS1A 3CFRA 3QERA 1SL1A 1NK0A 2HVHA 1LW0A 4O55A 1JXBA 2PYJA 1KLMA 1JLQA 2I5JA 2QK9A 4F2RA 3HVRA 1XWLA 4O5BA 1LV5A 4KHUA 4FJ9A 3KTQA 4Y1DA 2HNZA 4CIFA 1LAVA 1FKPA 1VRTA 1KFDA 4LY7A 4FVMA 2HHSA 2A1SA 4NYFA 3ISNC 3ZT2A 4W5RA 3QEIA 4CF9A 2D5RA 1HPZA 1UWBA 2PYLA 3CM6A 4DMNA 4HUFA 4OGEA 1BI4B 2GUIA 4OLBA 4KRFA 1N5YA 2G8KA 4JS4A 3V1RA 4QAGA 1Q9XA 3ZT4A 3V9ZA 4IFYA 4DQRA 4K8XA 3KKSA 4CGHA 3K57A 1SL2A 1K6YA 3C95A 3VQCA 3DYAA 1JLFA 4CFDA 4UQGA 1JL2A 4CEQA 5KI6A 3WNEA 4CJFA 4NCGA 4CIEA 4QCLA 1EP4A 3VQEA 3QNOA 1RCHA 3DLEA 5FROA 4Q0BA 1J9AA 3TAFA 1KVBA 2O4GA 2JLEA 3LDSA 3VQ4A 3OYHA 1D5AA 5SWMA 1LW2A 3OYFA 3AV9A 3V9WA 4DWIA 2XY6A 1LWFA 4CK2A 1S9EA 2Z1GA 3JSMA 4E7HA 1ZBFA 2XY8A 4FJKA 1VRUA 3EY1A 4LSNA 4CF1A 1S1VA 2IOCA 3LAMA 1S9GA 5SZTA 2PZSA 4DSJA 4AH9A 2EHGA 4DS4A 4CEZA 3SQ1A 4BDZA 1CXUA 5CY4A 5CYQA 1NKCA 3PUFA 3ZSYA 4LH4A 3LANA 3FFIA 3SPYA
chains in the Genus database with same CATH superfamily
4JKCA 3VPZA 1K9MO 4OLAA 5AQTA 4AHSA 1MWKA 1XC3A 1VQKN 3O3HA 4OVLA 1HUXA 4DR2K 4JI0K 4CF8A 4DTNA 1K73O 1BQNA 3OW2M 3S3NA 4AHCA 2B6AA 4PA1A 4PKHA 3CJAA 2P9IA 2WOMA 3ENHA 5GAGP 3C6UA 3AVAA 3EKUA 1IBMK 1IBKK 1N33K 2RPIA 4N5SA 2B4JA 5JVGL 2G8FA 3K58A 3BF1A 1B9FA 3CIPA 1KXPA 4C1NK 2FSJA 5BRDA 2P9LA 4O44A 2BANA 4LF7K 4BR4A 1ZBLA 2A42A 4BQLA 5HRSA 3L4IA 3ZETB 4CBXA 3KWGA 2OTLN 2E88A 3LZJA 4M45A 4DTUA 3ATVA 2WONA 4MDAA 1QQMA 3THYB 2HBMA 1JXEA 4CZLA 4AHUA 3DLRA 5BN9A 4DV1K 3CCVN 4A57A 4CZFA 2HNYA 3CPEA 1NK7A 3N4PA 1HYVA 1NK6A 4DSIA 3ZEUA 3FFKB 3QLHA 3NCIA 3AO4A 2VWBA 4B9MA 3RSEA 1MWMA 4EZ9A 4FWKA 5FPNA 2QKKA 2YHWA 3HVTA 5AZJB 4KAZA 1HJOA 4GV6A 1YAGA 2W41A 3LDOA 4CEFA 3OS0A 3G10A 4BC3A 4JN4A 1Z25A 3K5LA 3T7ZA 5J2PA 1NGHA 1X9MA 3HT3A 4FO0A 3M8RA 4WFBL 4BRAA 2AJQA 4OKKA 4EHUA 4F3TA 4ICLA 2VG7A 3ZSWA 1BGXT 1W97L 3TANA 3WXKA 2QKBA 2OYQA 5IT9O 1TL3A 4DQPA 1WOQA 3L6QA 3VEOA 3CMAN 2HHVA 4FJNA 2IS3A 3PLAA 3F73A 2OPQA 2HMPA 4H0TB 4BG8A 3O8MA 5JLFA 2FF3B 3NAEA 4JI6K 4CIGA 1QTMA 4KHPK 3O80A 3PV8A 5C2DA 2UU9K 3NF7A 3ULEA 3A5NC 3CMEN 3LAKA 4KBOA 5JVHL 1XC9A 2OA8A 4FJ7A 3ZT3A 3OTOK 4KFBA 3CJ9A 4CJ4A 2D0PA 4JKDA 2A41A 2P5OA 4ELVA 3DLBA 3E9OA 1HNWK 3T3FA 3KHYA 3VENA 4Z4HA 3TAEA 2VCPA 1U49A 2F9TA 4BRKA 3OYJA 4J2DA 4OGCA 4GMJB 2QWRA 3KWIA 2VQFK 1XMQK 1S1WA 3VESA 4JI5K 1NNEA 1JL1A 5E84A 3DOLA 2G8HA 4KB1A 1BG3A 1NBWA 3V9UA 2R7YA 1X3NA 2P1JA 4YOTA 4KHYA 3UIQA 4YNQA 3QBWA 1OH8A 4H8KA 4RW7A 2PAVA 4WFAL 4LH5A 2OCEA 4ID1A 3QO9A 3QFPA 2E6MA 3GE1A 3ZLJA 4RTFD 4FZYA 2O8FB 3SUPA 3G0ZA 3D6RA 2ITMA 4M3YA 3A5MC 1NKEA 3FZMA 4H4MA 3L8BA 2YCHA 4CHOA 4CJPA 4DS5A 4YDUA 3SAHA 3L3UA 4B3MK 4KO0A 1T3VA 3ALYA 4DR6K 3VGLA 1OKJA 1NGIA 3VQ7A 5AZJA 4FPBA 3OVNA 1O13A 2GWJA 4NXMK 4OKJA 4FWRA 1S5JA 3KLFA 1A5VA 2KFZA 4E7LA 1VHXA 4F3OA 1S1UA 4YFUA 3DXKB 3LDLA 2HHUA 4IO8A 3VQ9A 1SUQA 4JD2B 4GKJK 4BDYA 3UB5A 1S72N 1JLBA 2FBVA 4FOIA 2YJEA 5CR4A 4CZHA 3SV3A 1R0AA 1RBRA 3O4NA 3AO1A 5BPMA 4W5OA 4BE0A 2W40A 2X6NA 1LCUA 4ZTJA 4QOZB 3AAPA 3WXMB 1HLUA 2F7TA 3NF9A 3I8DA 3AA2A 2YKNA 3AVJA 3CQXA 5FRNA 2GWKA 1X9SA 5AQFA 1S1TA 1KCFA 3OJSA 4DV5K 3FZHA 1KC8O 1RBUA 4KKOA 1W2BM 4JEPA 2OPRA 4CD1A 4H5TA 3O3GA 3G71N 3VF6A 3MXMA 3I55N 1IO2A 4B1XB 3F9KA 3V1QA 4OPJA 5AQMA 3D2EB 3J7AP 3VA3A 3K9KA 1A5XA 1VQ9N 2P9KB 1N8RO 4YORA 5A2QO 3OY9A 1QQOA 3S3OA 3SUOA 2PY5A 4OPHA 1VSKA 3I8BA 4FCYA 4TSXA 4IBNA 4CJUA 3DRRA 4FJGA 3HO1A 3TSUA 4FZXC 2DFHA 2QM1A 4QS8A 4EP4A 1TYQB 2IAJA 3SQ4A 3LP1A 3SMPA 3DJCA 2HBLA 4BREA 5BPNA 5C12A 2O8FA 3E9LA 1BHLA 3A5LC 2F4VK 2FC0A 1YUWA 2KW4A 4ZTFA 3O08A 2FXUA 3QIOA 1L3VA 4OPAA 2YV0X 1BISA 4FLWA 4FM1A 3O9RA 3HM8A 4KH6A 3RR7A 1YTAA 1I3AA 5M1NA 4Q5VA 1TK0A 2HHHK 4DCHA 5F1XA 4H0OA 3HTVA 4OKEA 1NK5A 2HVIA 4FWOA 4WQ4C 1U2VA 1MU2A 1GOCA 4QS7A 4HTLA 1Q9YA 4DFPA 5JS1A 1TKDA 4JYAK 4Y1CA 4ILHA 1YF5L 3S3MA 5AQHA 3SBTA 2XO7A 1J5EK 4B1VA 3BY5A 4WCEL 1NGCA 5ADXA 3CJCA 2KZMA 4BR0A 4ELTA 3MCAB 3TU5A 4JD2A 4UY8O 3KK3A 4DR7K 3VQAA 1E4FT 3MK6A 3HP9A 3WT0A 4E1MA 3EE8A 4C23A 1J5OA 4RW9A 4EAHD 4Y0WA 4JHDB 4O8KA 1ITGA 3T19A 3EKSA 4DR4K 4CJQA 1QHTA 3LWLA 4FLYA 1YJWN 4IO9L 3O3FA 3CI5A 3PIPL 1CXQA 1HRHA 2NNWA 4K43A 3RMCA 2NRHA 4BRCA 1D8YA 2A6AA 3DLKA 1RDWX 1UOCA 3MEEA 3I0SA 4F2SA 3L2WA 1NLVA 2W42A 4ILGB 4KI6A 3D2EA 3LDNA 1KRPA 1HQUA 4JAXA 4LC9B 4BE1A 2P9KA 4JK8A 5MLCQ 3CFRA 2ASPA 1JXBA 4FL9A 3J80O 4O5BA 5BREA 3EE9A 1WB9A 3I33A 1FKPA 2HHSA 2A1SA 3PSFA 3ISNC 1Y64A 4CF9A 2D5RA 5DM7L 2PYLA 3CM6A 3CETA 1BI4B 4QAGA 3O6WA 4DQRA 1NGDA 3KKSA 4CGHA 1SL2A 1TYQA 3DYAA 3U4LA 1ZBSA 4H5RA 2WC9A 4IJNA 4GV3A 2JLEA 3OYHA 1HKCA 5SWMA 3U9DA 3AV9A 3TTCA 4CK2A 1S9EA 4FJKA 2P9UB 4MO4A 1ZC6A 2PZSA 3O9TA 3Q7CA 1BA1A 3PUFA 5F2RA 3GL1A 3KLIA 4DTMA 4FW1A 2HF3A 1WSGA 4FM2A 4DF8A 2P9SA 3SUQA 3M8QA 1BIUA 4JRPA 4CFCA 4CHZA 4C8NA 1GLEG 5GIPA 1X9WA 4I6MB 3RTVA 1T6DA 4BE2A 5KPRA 4B08A 4CZIA 3F2KA 5C42A 1SKRA 5AQXA 4I9LA 2BH1A 2LSNA 3LM9A 1BQMA 2HOEA 4JKGA 4BRDA 3L4QA 4J8FA 2VG5A 1B9DA 3M8PA 4CK3A 1VSEA 2HF4A 3IKMA 4ZHRA 2CGKA 4C8MA 4KHWA 3H46O 4DQ8A 4L8RB 5AQYA 4FOEA 1V4SA 3DLHA 3NF8A 3R1XA 4I2QA 1P8ZA 3UE5A 2E5LK 4CGIA 2ASOA 1L3SA 4GVEA 3PO5A 4FYDA 4FJJA 3H08A 4CFBA 3NFAA 2KZZA 4QS9A 4CZGA 1HKGA 1T44A 3MN6A 4DQQA 1VSIA 4CJVA 3JAMO 3OYMA 1KVCA 2VGNA 2I7PA 4JKFA 3ZSOA 3SJJA 1VQNN 4B9UA 2KHOA 3VQDA 1NGEA 1ASWA 1WSJA 4WYBA 1BCOA 2OZMA 3UKRB 2YHAA 5AQVA 1Q8IA 2W6KA 3Q7BA 1N34K 4CJRA 5CE3A 5I3UA 1YITN 4DR5K 2VG6A 1N6QA 2QWOA 3EN9A 1C1CA 3K59A 5HLFA 4B8AB 1ATRA 5E41A 3G6EN 4E7IA 3QICA 1YTUA 3CCJN 1EWRA 2P9UA 3KZBA 3AO2A 4CESA 3E9PA 1SL0A 2EWSA 1VQPN 3CCMN 1TK8A 4W5QA 4PUOA 4FJMA 5M1OA 4M3TA 2DFFA 2HB5A 4HWIA 3MCPA 3QFUA 5AQPA 3B8AX 1FKOA 4B9VA 3L2RA 1Q82O 1JLCA 2P9PA 3VQBA 2F8SA 1RTJA 1HX1A 3MN9A 3QB0A 2ZE2A 1T05A 2HHWA 3KVGA 5CZ2A 1YJNN 1GLLO 5C2FA 4X66K 4IG0A 4B3SK 5FRMA 3K5OA 2HNDA 1GLDG 4DSFA 1NOYA 4DB3A 2Z1HA 3NVKA 4IOAL 3NGZA 4NB4A 4IG3A 3NVMA 1T6CA 1KAYA 1QE1A 5DM6L 4A2BA 1BOTO 3OYAA 3M8SA 3LP3A 4WF9L 4BWJA 1HYSA 4MQ3A 4B9QA 1TVRA 1IKXA 3R9PA 4DFKA 4AHRA 1EO1A 3RR8A 3VOVA 4DLGA 4CBUA 4KPYA 1NJIO 1WBDA 1ZXOA 1RBTA 3QIPA 3C94A 2DY4A 3J81O 2FBXA 3WXJA 5BR9A 1CZBA 4ELUA 3TAGA 3JS6A 4LF6K 4JV5K 1RBSA 3V4IA 5FPMA 1MDUB 2FF6A 2IVNA 2NRWA 4CZEA 3O5BA 4GVMA 3T1YK 4JI2K 4YOUA 4BR7A 2ATQA 3AVFA 3NBPA 4BVPA 1IV0A 4M3UA 2RF2A 3THWB 1NWKA 3MWTA 2YI1A 2IC3A 5GADP 2Y1JA 2V52B 1NGBA 3FZLA 1TUUA 1NGGA 2BDPA 3GBTA 3VMFB 4PKGA 3DOKA 2Q36A 2QA4N 3MWPA 1RT7A 1Q86O 4DQIA 2Q97A 3IS9A 4PKIA 3TAPA 4RW4A 5J1EA 1YHQN 4DV0K 3EZ5A 1NK9A 1C0TA 4E89A 3PY8A 1BO5O 3PX6A 5KGWA 2Q31A 1XQSC 1KSPA 2NRXA 4RW6A 2BE2A 1DLOA 4XH4A 3SI6A 3V81A 4CEBA 1EKEA 1VQ5N 4W5TA 3GG4A 1WNSA 4E7KA 2NLXA 5FLXO 4NO7A 4F8RA 1UAXA 1IKWA 2D1KA 3WXLA 5M1KA 4JRQA 3WNGA 3MEDA 1BIZA 5I42A 3TI0A 4EZ6A 1JCFA 2YNHA 1NMDA 2NRVA 5I9EB 4FK4A 1VQON 3KKRA 1WN7A 4LFCK 2JWKA 1QZ6A 4JS5A 5C0YA 4IZ9A 4LD0A 4MDBA 3SMSA 4KV8A 5BRFA 4E19A 3P83D 3AVKA 4K8ZA 1X9JA 3H3OB 3E66A 2YHXA 3R6MA 3HSTB 4BC2A 1T7PA 3M6GA 1F21A 1XNRK 4WQ5A 4K42A 4MLHA 3NE6A 1NK8A 2UXBK 4LF8K 3SZ2A 3ZETA 5C24A 2IDOA 4CF2A 1HNXK 3K9JA 1QHAA 4CJTA 2VYPA 3HK2A 2OTJN 3THYA 4KB0A 4M63C 3OYCA 3CM5A 2YNFA 1XMOK 4CD3A 3LP2A 4FLXA 5KQ8A 3QNNA 4BRLA 3M5RA 1ZBUA 2ASMA 2F8TA 4RWTA 1RT2A 3K2PA 2Q0UA 1UA0A 5EXWA 3CC7N 2GUPA 4HHTA 2KLAA 3ENOA 2YHYA 3JXUA 5E26A 5M1PA 4KHQA 4IEEA 3I56N 4N47A 2HBJA 4IOCL 3DAWA 1YXQA 1IH7A 1GOAA 4JI3K 4EHTA 3NHGA 1LWCA 1SKWA 2ZJQL 3CCSN 1VQLN 3WEEB 3H6EA 3AA5X 2D0CA 3ULDA 2A1RA 4G1QA 3TSPA 4FSVA 1NGFA 2BGGA 4M42A 3WNHA 2F96A 3CF5L 3SAFA 1LAWA 3MN5A 2VWKA 4CFAA 3OS1A 1B92A 3VQPA 1NK0A 4AM6A 5GINA 1KLMA 1JLQA 2I5JA 4BRGA 3L0QA 4KHUA 4FJ9A 3SK3A 4Y1DA 4H0PA 4CIFA 4NYFA 4W5RA 3ZT2A 4YHHK 3QEIA 3P39A 3LDPA 4JS4A 3V9ZA 4IFYA 3K57A 1K6YA 3D2FB 3VQCA 1JLFA 4UQGA 1JL2A 4CEQA 3WNEA 4G9ZA 2HBKA 4NCGA 4CIEA 3CCQN 5FROA 4Q0BA 1J9AA 3TAFA 3FLCO 3ID6A 1H1VA 1R59O 1EWQA 3P4IA 3VTIA 1VRUA 4LSNA 4DS4A 2V51B 4BDZA 5CY4A 5CYQA 2QTDA 3FZFA 3ZSYA 3FFIA 3WQUA 3SPYA 4CF0A 5FDLA 1T03A 4B9SA 1GOBA 1TL1A 2CGLA 1IKYA 3VEZA 3BP8A 2GTDA 3KLHA 3CFPA 1DTTA 1NKBA 1VQ7N 4NXNK 4FWSA 4HVJA 4CVNE 4CCHA 4PWDA 2YNGA 2ZM6K 5EU7A 3CJ1A 4OX9K 2E6LA 3ZSVA 5FPEA 4JI8K 4CZMA 3VERA 4DUYK 4B9LA 3HOTA 3I0RA 3WQTA 5J2MA 4ILJA 4ISGA 3P31A 3G25A 5AR0A 1QZ5A 4CHQA 4EFHA 3RMDA 3DXKA 1ZBIA 3KD5E 1M90O 1RDAA 4H03B 4IFVA 1RILA 3HP6A 1KAXA 1KD1O 4DQSA 1OH6A 1IJJA 1TKTA 1VSDA 1SQKA 5AFUH 2E1YA 4B8CA 5K14A 3EEQA 1NJZA 3LM2A 3VF4A 1Q81O 4FJ5A 4FLZA 3MX2A 4B1ZA 1JLGA 4MFBA 1WSFA 5HBMA 4FWPA 3THVA 5AQZA 4CGGA 2NRZA 3OBYA 4BRQA 3QBXA 3CHWA 1VSLA 3BDPA 4CI6A 4KH5A 2BUPA 4FWNA 1K8KB 4HUGA 4B3RK 4LF9K 2QWPA 3MEGA 3LALA 3O1BA 3H3NO 1J53A 4BC5A 3HYFA 3PO4A 4JI1K 5AQLA 3SCXA 4KI4A 4DF4A 2QWQA 3H1QA 3RMBA 4HCBA 1VQMN 1MA9B 3CJ7A 3ID8A 3TSQA 2CGJA 2B5JA 5AZIB 5J2QA 1C1BA 3U3YA 1IG9A 3HZ6A 4JNEA 3S9HA 1WAFA 5AQQA 1E4GT 4DG1A 2D0OA 2RE2A 2GELA 3ZT0A 1VSMA 2ITGA 4CJLA 1RT4A 3CCUN 2VGMA 3CYMA 1Q18A 4AM7A 5KRTA 4CZJA 1E3MA 3OYGA 3VGKA 2KTQA 1FK9A 3UKUB 3OYDA 1C1AA 4DTPA 4BVOA 3WUHA 4E0DA 1U4BA 2WFBA 4F4KA 4I9QA 3BGRA 4LFBK 3OBWA 3QESA 2QWLA 4BRHA 3C7NB 4GV9A 4EP5A 2J4RA 3AAQA 2E8AA 5AQRA 2O8CB 1NM1A 4CJSA 3L2QA 3LZIA 3CC4N 3O4QA 3SQ0A 2ZGZA 4OO1J 3LP0A 4HUEA 4DFMA 3BZCA 1P90A 4Z4CA 3GDQA 1QVFM 2X74A 4RW8A 4FLUA 2O8BB 1EQYA 1I94K 4CJ7A 3CD6N 3DMJA 1SS6A 3RRHA 4J2AA 4JHDA 3VQ8A 3TABA 3N4QA 4DFJA 4CEOA 2NRTA 2AA4A 1YVNA 5EY4A 4WQ5C 4V19S 4DU4A 3FGUA 1KFSA 4B3OA 2CH5A 4YOVA 2Q0RA 4KREA 1N36K 3O1WA 4C1NI 3HXMA 4E3SA 3V9XA 3ZSRA 5DK5A 2WTUA 1ATSA 2QW9A 4I2PA 1O1WA 5HRRA 3DLGA 1TV6A 4BQZA 1C6VA 4CERA 2RHKA 3C65A 1WSEA 4B3TK 4BROA 1HKBA 2E2OA 2Z1JA 3AVGA 2UYTA 4DV4K 4DTSA 3H45C 4CHNA 1IKVA 4DTJA 4CZKA 4Z0UA 1TGOA 3NGYA 4YDUC 2ZJPL 1C0MA 1ASVA 1EXQA 1OH7A 2D0AA 4FJXA 4YOYA 4BC4A 3IRXA 4M41A 3SBGA 1HNZK 4CJ3A 1BI4A 4O0IA 3CG7A 4FLVA 5C10A 1QQCA 2P9LB 5HP1A 2UUBK 4FM0A 4IDKA 1BCMA 4DSEA 1QSLA 2NRRA 3F5TA 4H0VB 2HHQA 5LMNK 2W6LA 3DM2A 1SV5A 1ATNA 2QXLA 2XY5A 4B1WB 4DSKA 5LJVA 3SPZA 1L3UA 2EX3A 4PY5A 4N56A 3VEXA 5C25A 3VQ6A 4DR3K 5TKWA 4CEDA 4O4GA 4NCAA 2E2NA 3PSIA 4CW7B 5B8HA 3C7NA 4KHNA 1K8AO 4GW6A 3AA3A 3DRSA 5HL7L 3U6FA 4JKEA 3OYNA 1T8EA 3DI6A 2ZJRL 1HQEA 1HMVA 4XIUA 3OYKA 3ZEUB 3KIOA 3AVCA 1SKSA 3H1VX 3AY9A 4K25A 3RSEB 3ITHA 1JLEA 4CBWA 4I6MA 4FLTA 2O8BA 1XHZA 5F0XA 4LF5K 5GAHP 1HYZA 3DXMB 4YOWA 4FK0A 2O8DB 4FWMA 5TKYA 3VA0A 4DLEA 1QSYA 2Q2RA 1C0FA 1N32K 2DFEA 3ENBA 1Q7YO 1YVUA 4XH5A 3VQ5A 4C8KA 2PBDA 1KVAA 3D0PA 1EETA 4IFEA 5J2NA 1RTHA 1M1KO 3P5JA 4WQ4A 5AQGA 3PIOL 3HPHA 1VSFA 3MXJA 4Z4FA 2E20A 5M1FA 4HCCA 1ZYQA 4PL7A 2QI2A 1JCEA 3HL8A 3ULEB 2RN2A 2YHBA 3DWLA 3J8AA 1KTQA 4KTZA 4O8UA 1YT3A 3KK1A 1VQ6N 4AHVA 3RWUA 3KLEA 1ASUA 3THXB 1NK4A 2QWMA 1G99A 3IDHA 3UKRA 1KLNA 4JLHA 5BPLA 4C8LA 3FR0A 3KK2A 3AVLA 4BRNA 3O9QA 3RVCA 1RT3A 3P38A 3EL2A 4ID5A 4BGBA 4BRFA 4F9OA 1NU0A 4LSLA 5FPDA 4B1UB 2XHBA 4IXCA 3AARA 1TK5A 3L3VA 4H5WA 5HRPA 3MXIA 3O9UA 4K41A 3W0LA 2Q3SA 3PX0A 3AGRA 4YY3K 1BL3A 3B6OA 4E1JA 3L2VA 1CLQA 5AQWA 4YOXA 3T69A 3HOSA 3SV4A 5IWAK 1TUYA 2HW3A 3G4SN 2Q1NA 1S6QA 3SUNA 4M3WA 5CHIA 3SYZA 2JGUA 4IOXA 3FE1A 3QEVA 3AVMA 4FZZA 2NZTA 3QERA 1SL1A 5ELZA 1LW0A 4O55A 3ZX2A 1ESVA 1BWFO 2E1ZA 4F2RA 5BR8K 3CERA 3HVRA 1XWLA 3ATUA 3M3ZA 1J6ZA 3W3DA 3KTQA 4A59A 1KAZA 3DXMA 3BF3A 3HI0A 1VRTA 1KFDA 3O4WA 4FVMA 2O8DA 3R8EA 2YJFA 4OGEA 4KRFA 1Q9XA 3V1RA 5ADXH 3O9SA 3C95A 4CFDA 4CJFA 4QCLA 3J7YP 3QNOA 5GAEP 1RCHA 1FW6A 1KVBA 2GX9A 2YX6A 3TTDA 3IMXA 1FJGK 3V9WA 4DWIA 3TPQA 1ZBFA 2XY8A 3EY1A 1S9GA 5SZTA 3M1FA 1OH5A 4DSJA 4AH9A 2ZGYA 4CEZA 3SQ1A 1CXUA 1NKCA 2P9NB 4A61A 4KHSA 3ZT1A 3AO5A 1SAZA 3THXA 2QXFA 3LL3A 3BZKA 4KTWA 3VGMA 1JKHA 4OPKA 3CQYA 1TKZA 3THWA 3OYLA 1U04A 3DRPA 3ASMA 2A5XA 2XY7A 2FBTA 1L3TA 4IJAA 4PL8A 4DV6K 4DTOA 1QSSA 4Z4IA 4BWMA 3TAMA 1GLJO 3QEXA 3AVHA 2WBNA 3CCRN 3A8YA 3HJFA 3IAYA 1RDDA 2OANA 3TR8A 4N41A 3TAQA 1W0HA 3IG1A 3K5MA 2G8IA 4NLBA 5EVZA 2FSNA 3NF6A 5HRNA 3KJVA 1Y97A 1BUPA 3L2UA 1TAUA 3VEYA 4CK1A 3E01A 2DTUA 3NGIA 1WLJA 1RT6A 4CJ5A 5CYMA 2VWJA 3U3GA 1QVGM 2X6SA 3S41A 4CECA 1VQ8N 2QWNA 4GY2B 2E4LA 1U2VB 3EYZA 3V9SA 5CZ1A 1S1XA 3LDQA 3PX4A 3T1HK 1SZ2A 2BTFA 5JICA 3VEVA 4JK9A 1HNVA 3CPWM 3LPUA 4Z4EA 4DTRA 4CGDA 3VN5A 1NMNA 2FLOA 1EX4A 3IUCA 4DR1K 1U45A 3HM9A 3AA4A 1DGKN 5AQNA 3ZSZA 5KPZA 5KQDA 1NJXA 1YJ9N 2GV9A 3QINA 2UUCK 1HPMA 2V7YA 3F9MA 5C15A 4BDPA 3VF2A 1LWEA 4Z94A 1Z05A 1U48A 4FJHA 2P9NA 4AILC 4H5NA 3OJUA 1NOZA 2JWLA 1L5UA 3D7EO 3GOIA 2PFUA 1S6PA 4H0YB 1U47A 5AQJA 3NDKA 2IVPA 3C6TA 1DT9A 1VSHA 4R5PA 2HHTA 4XEIA 1GLBG 3HSCA 1J54A 4A2AA 4L3QA 4BR2A 4CHPA 1S22A 4BRIA 5KGXA 3K5NA 4BG9A 3HPGA 1DKGD 4X62K 2FSKA 2WUSA 1VSJA 3LWMA 2VQEK 4J2EA 4CGJA 5T7BA 1WAJA 5LL6Z 1BA0A 4FK2A 4JKHA 5AQUA 4DKWA 5DMRA 3ZCMA 2G8WA 3IFRA 4LF4K 3OYBA 3QDKA 2FBYA 3OYIA 2E2PA 4W5NA 1D9DA 4X64K 1DTQA 1S3XA 1VAZA 3B6PA 3ZX0A 3P1GA 4U67L 2OZSA 2GBZA 3LPTA 3WNFA 4DSLA 3WEEA 4NYNA 1IBLK 1V4TA 3T1AA 4IWVA 1GLCG 4H5VA 3QETA 2HHXA 4MLEA 3MN7A 1XI1A 1QS4A 3AVBA 4AHTA 1RDCA 3ZSXA 1VQ4N 3KLGA 3CFOA 3BEXA 1QQNA 3HBTA 4M3RA 4KH4A 1TKXA 4FWLA 3J7ZO 2P9SB 5D3GA 1LOTB 2ZQBA 4IKFA 2YNIA 5KPTA 4A62A 1REVA 1NJYA 1X3MA 2XRIA 2ZD1A 2O4IA 4X65K 1A5WA 1HR0K 4CE9A 1NG9A 3EO3A 3VQQA 1OVYA 4FWQA 4JKGB 4WE1A 4GNIA 2HMIA 1HNIA 4U7BA 2HSTA 3SJHA 3V6DA 5LJWA 1JJ2M 4CJKA 3FZKA 3C0BA 3MAQA 1HJRA 3CC2N 4O0JA 1GLAG 1TAQA 2DPNA 3D2FA 1OVQA 3V1OA 2V7ZA 4J2BA 4N76A 4FJLA 1JLAA 3CQ8A 4DU3A 2Z1IA 3NH1A 3C6HA 3ZYYX 4M3XA 3OHRA 3AVNA 1WUAA 2G8UA 4JKBA 1WSIA 1YIJN 1RTIA 4B9NA 2CH6A 2QEXN 4ISFA 3TARA 3C6AA 3A5OC 5GIOA 3TWHA 2O8EB 4H4OA 4FJIA 4BRMA 4CEEA 3OA9A 1C0GA 1CZ9A 5AQOA 1C0UA 2UXDK 4C8OA 4FJ8A 3AGKA 4OJRA 5BRHA 1WSHA 5LMUK 1ZBHA 3QMLA 4ISEA 2IIRA 2IGIA 4A5AA 2OPPA 2Y1IA 2P5GA 2D4WA 5M1QA 1XHXA 3CCEN 3ZSQA 5EX5A 3CJBA 1X1PA 2NUBA 4CEAA 4E7JA 5BN8A 4GKKK 4FPAA 1U6ZA 2E2QA 4JK7A 1NGAA 3OS2A 1BDGA 3E1YA 3VETA 1RT1A 1NJWA 2KKZA 2D0BA 5KRSA 2KFNA 3KK7A 3VTHA 3QEPA 4WFNL 4DV3K 3A0IX 3D45A 3WXIA 3HPOA 4AF1A 4MO5A 2YKMA 4JKAA 1BU6O 3AO3A 5JLHA 4R79A 4FW2A 2X78A 4A5BA 2G8VA 3NH0A 3CXCM 3KD1E 4DTXA 3TTFA 4B9TA 4M7XA 1GLFO 4DHYA 1DEJA 1RFQA 3DLLL 1D9FA 3BUZB 5JS2A 2A3ZA 4M3ZA 2OPSA 2P9PB 2RKIA 4IEIA 3NH2A 4I7FA 3MECA 2GEMA 4XH1A 4CJWA 3RMAA 5H1SQ 1KQSM 4PQUA 3SNNA 4BR5A 4EIAA 4LFAK 2F9WA 5AQIA 3QEWA 1VK0A 2A40A 3U9ZA 4HTUA 2IVOA 1FXXA 3SLCA 3MMVA 4DV2K 1RT5A 1ILYA 2KQ2A 1K8KA 1Z6RA 1XUPO 1WBBA 4NCBA 4RCHA 5HOOA 1RNHA 1D4XA 1RDBA 5HROA 4H0XB 4BACA 4FXDA 4DU1A 3EZWA 3SQ2A 1I39A 3OYEA 2H3GX 4Z4GA 2AP1A 3JYTA 3AVIA 5JMVA 4RG8A 2P9IB 5AJ3K 4B1YB 3MDQA 5AZIA 4JI4K 5AQKA 1RBVA 3A2FA 3HRGA 1W9HA 2ETJA 4DV7K 4E1NA 3RRGA 1RDUA 4CJEA 2O8EA 5EOYA 4K0KK 1Z26A 1RTDA 2P51A 1IG8A 3R3LA 5KTQA 1UA1A 1G15A 3UKUA 4CGFA 3ZX3A 4CHYA 1JCGA 2HVHA 2UUAK 2PYJA 2QK9A 5LY3A 3K0SA 3U8XA 1LV5A 2O8CA 2HNZA 4JI7K 2UXCK 1LAVA 2ZWHA 4M7YA 4LY7A 1CZAN 4FVUA 3NMUA 3SAGA 1HPZA 1UWBA 4DMNA 4HUFA 4OLBA 2GUIA 2ZF5O 1N5YA 2G8KA 3ZT4A 4K8XA 4O5FA 4BGAA 4PHTX 4IDHA 1NGJA 5KI6A 1EP4A 5AFUA 1W7AA 3CCLN 3VQEA 3DLEA 4BRPA 5AQSA 2O4GA 3LDSA 3VQ4A 1D5AA 4AQYK 1LW2A 3OYFA 2XY6A 1LWFA 3JSMA 2Z1GA 1YI2N 4E7HA 4CF1A 1S1VA 2IOCA 3LAMA 3MX5A 1XNQK 4DUZK 2EHGA 4BY9C 3VEWA 4NLCA 4BR9A 1RGIA 2I7NA 4KTQA 4LH4A 3LANA
chains in the Genus database with same CATH topology
4KHSA 3ZT1A 3KLIA 3AO5A 4DTMA 4OLAA 4CF0A 4FW1A 2QXFA 4AHSA 5FDLA 1T03A 4B9SA 1WSGA 1GOBA 4KTWA 4FM2A 1TL1A 4DF8A 1IKYA 3O3HA 1JKHA 4OPKA 3SUQA 1TKZA 4OVLA 3OYLA 1U04A 1DTTA 3KLHA 3CFPA 3M8QA 1NKBA 1BIUA 3DRPA 4CFCA 4CHZA 3ASMA 4C8NA 4JRPA 2XY7A 1X9WA 2FBTA 4HVJA 3RTVA 1L3TA 4CCHA 4BE2A 4B08A 4CF8A 4DTNA 2YNGA 4PWDA 5EU7A 1BQNA 5C42A 4DTOA 1SKRA 1QSSA 4Z4IA 2E6LA 4I9LA 4BWMA 2B6AA 4PA1A 3TAMA 3ZSVA 2LSNA 4AHCA 3QEXA 3AVHA 2WOMA 4B9LA 1BQMA 3I0RA 5J2MA 3C6UA 2VG5A 3AVAA 1B9DA 3M8PA 3HJFA 2RPIA 4N5SA 3IAYA 1RDDA 2B4JA 4CHQA 4CK3A 2G8FA 3RMDA 3K58A 3TR8A 1ZBIA 4N41A 1VSEA 1W0HA 1B9FA 3IG1A 4ZHRA 4C8MA 3TAQA 3KD5E 3K5MA 2G8IA 4KHWA 1RDAA 4O44A 2BANA 3NF6A 5HRNA 4IFVA 3KJVA 1RILA 3HP6A 1Y97A 4L8RB 1ZBLA 4DQSA 3L2UA 1TAUA 5HRSA 1TKTA 4KTQA 4CK1A 1VSDA 3E01A 3DLHA 3LZJA 3NF8A 2DTUA 4M45A 5K14A 4B8CA 3NGIA 1NJZA 4I2QA 4DTUA 1WLJA 2WONA 4FJ5A 4FLZA 1RT6A 4CGIA 1JLGA 4CJ5A 4MFBA 1WSFA 1JXEA 5CYMA 2VWJA 5HBMA 1L3SA 3U3GA 4AHUA 2X6SA 3DLRA 3PO5A 4FYDA 3THVA 4FJJA 4CECA 3H08A 4CFBA 3NFAA 2KZZA 4CGGA 2E4LA 3EYZA 3V9SA 5CZ1A 1VSLA 4DQQA 1VSIA 1S1XA 2HNYA 4CJVA 3BDPA 1NK7A 3OYMA 1KVCA 3ZSOA 3SJJA 1HYVA 3PX4A 4HUGA 1NK6A 4B9UA 4DSIA 3VQDA 3QLHA 1ASWA 1WSJA 1HNVA 1BCOA 3AO4A 3MEGA 3NCIA 2OZMA 3LALA 2YHAA 1Q8IA 4B9MA 3LPUA 4EZ9A 4Z4EA 4DTRA 1J53A 4CJRA 3HYFA 4CGDA 3VN5A 5I3UA 2QKKA 3PO4A 3SCXA 4KI4A 4DF4A 3HVTA 2VG6A 1EX4A 1N6QA 4KAZA 1U45A 3RMBA 4HCBA 3HM9A 3AA4A 1C1CA 4CEFA 3OS0A 3K59A 5HLFA 3G10A 4B8AB 2B5JA 1Z25A 3ZSZA 3K5LA 5J2PA 5J2QA 5E41A 1C1BA 3U3YA 1NJXA 1X9MA 4E7IA 3HT3A 1IG9A 3M8RA 2AJQA 2GV9A 1YTUA 3QINA 4OKKA 4F3TA 4ICLA 3S9HA 1WAFA 2VG7A 3ZSWA 1BGXT 3AO2A 4CESA 4DG1A 3TANA 2QKBA 4BDPA 1SL0A 2OYQA 1LWEA 1TK8A 1TL3A 3ZT0A 4DQPA 1VSMA 4W5QA 4PUOA 4FJMA 2ITGA 4CJLA 1U48A 1RT4A 4FJHA 2HHVA 4AILC 4FJNA 4M3TA 2IS3A 2DFFA 1NOZA 2HB5A 3OJUA 3F73A 2OPQA 3CYMA 1L5UA 5KRTA 3OYGA 1FKOA 3NAEA 4B9VA 3L2RA 2KTQA 1FK9A 3OYDA 4CIGA 1QTMA 1JLCA 1C1AA 1S6PA 3VQBA 1RTJA 4DTPA 3PV8A 1U47A 2F8SA 4E0DA 1U4BA 3NDKA 4I9QA 4F4KA 2ZE2A 3BGRA 3C6TA 3QESA 1T05A 3NF7A 1VSHA 4R5PA 2HHTA 2HHWA 5CZ2A 3MAQA 1J54A 4CHPA 4EP5A 3K5NA 3LAKA 5KGXA 4IG0A 1XC9A 2OA8A 3HPGA 4FJ7A 3K5OA 3ZT3A 5FRMA 2HNDA 4DSFA 1NOYA 4KFBA 2Z1HA 4CJSA 3L2QA 3LZIA 3O4QA 4CJ4A 3NGZA 3SQ0A 2P5OA 4IG3A 4ELVA 1VSJA 3DLBA 3LWMA 3LP0A 4J2EA 3T3FA 1QE1A 4CGJA 4HUEA 5T7BA 1WAJA 3OYAA 4Z4HA 3M8SA 3LP3A 4DFMA 3TAEA 4FK2A 4Z4CA 1U49A 3OYJA 4BWJA 4J2DA 4OGCA 5DMRA 3ZCMA 4GMJB 2G8WA 2X74A 4RW8A 4FLUA 1HYSA 1S1WA 4MQ3A 3OYBA 1TVRA 1IKXA 1JL1A 2FBYA 3DOLA 3OYIA 2G8HA 4KB1A 4DFKA 4AHRA 3RR8A 3DMJA 4W5NA 1D9DA 1DTQA 3RRHA 4J2AA 3V9UA 4DLGA 3B6PA 3VQ8A 3TABA 2R7YA 2P1JA 3P1GA 4KHYA 3UIQA 4DFJA 4CEOA 2OZSA 2GBZA 3LPTA 3WNFA 4YNQA 4KPYA 4DSLA 1RBTA 3QIPA 3C94A 4NYNA 4RW7A 4H8KA 2DY4A 4LH5A 2FBXA 4DU4A 1KFSA 1CZBA 3T1AA 4ELUA 4B3OA 4ID1A 3QETA 3TAGA 2HHXA 4KREA 3QO9A 1RBSA 3V4IA 2E6MA 1XI1A 3HXMA 1QS4A 4E3SA 3V9XA 3ZSRA 3AVBA 4AHTA 1RDCA 5DK5A 3ZSXA 4FZYA 3KLGA 3SUPA 3CFOA 3G0ZA 4GVMA 4M3YA 4I2PA 1O1WA 5HRRA 4M3RA 1TKXA 1NKEA 3DLGA 1TV6A 4H4MA 3L8BA 2ATQA 1C6VA 3AVFA 3NBPA 4CHOA 5D3GA 4M3UA 4CERA 2ZQBA 4CJPA 2RF2A 2YNIA 4DS5A 4IKFA 1WSEA 3L3UA 1REVA 2Z1JA 3AVGA 4KO0A 2IC3A 4DTSA 1NJYA 4CHNA 3ALYA 2Y1JA 2XRIA 2ZD1A 2O4IA 1A5WA 3VQ7A 1IKVA 2BDPA 4CE9A 4DTJA 4Z0UA 3OVNA 1TGOA 3NGYA 3VQQA 1C0MA 1ASVA 4OKJA 1EXQA 1S5JA 3DOKA 3KLFA 2D0AA 4WE1A 1A5VA 2KFZA 4E7LA 4FJXA 2HMIA 4F3OA 1HNIA 1S1UA 3IRXA 4M41A 1RT7A 4YFUA 3V6DA 4CJ3A 1BI4A 4O0IA 3CG7A 4CJKA 4DQIA 4FLVA 3IS9A 1HJRA 1QQCA 2HHUA 5HP1A 3TAPA 4RW4A 4FM0A 5J1EA 4IDKA 1BCMA 1SUQA 4O0JA 1TAQA 3V1OA 3VQ9A 3EZ5A 4BDYA 4DSEA 1NK9A 1QSLA 1JLBA 2FBVA 2HHQA 4J2BA 1C0TA 4N76A 4FJLA 1JLAA 4E89A 3CQ8A 3PY8A 4DU3A 2Z1IA 3NH1A 3SV3A 3DM2A 3PX6A 1R0AA 1RBRA 3O4NA 3AO1A 4W5OA 1SV5A 4BE0A 4M3XA 2X6NA 3AVNA 5KGWA 4ZTJA 2G8UA 4QOZB 1WSIA 2XY5A 1KSPA 1RTIA 3NF9A 4RW6A 3I8DA 2BE2A 3AA2A 3SPZA 1L3UA 4B9NA 2YKNA 3AVJA 2EX3A 3TARA 5FRNA 4PY5A 4N56A 1DLOA 1X9SA 3TWHA 3SI6A 3V81A 4CEBA 5C25A 3VQ6A 1EKEA 4H4OA 1S1TA 1KCFA 4FJIA 4CEDA 4O4GA 4NCAA 3OJSA 4W5TA 4CEEA 1WNSA 4E7KA 4KHNA 1RBUA 1CZ9A 4GW6A 3AA3A 3DRSA 4KKOA 3U6FA 2OPRA 1C0UA 3OYNA 4F8RA 3O3GA 1T8EA 4C8OA 4FJ8A 1UAXA 3MXMA 1IO2A 4OJRA 3DI6A 1IKWA 3F9KA 1WSHA 1ZBHA 1HQEA 3V1QA 4JRQA 4OPJA 1HMVA 4XIUA 2IGIA 3OYKA 3VA3A 3KIOA 2OPPA 1A5XA 3AVCA 2Y1IA 3WNGA 3MEDA 1SKSA 2P5GA 1BIZA 5I42A 3TI0A 4EZ6A 1XHXA 2YNHA 4FK4A 3ITHA 3OY9A 1JLEA 3ZSQA 1X1PA 2NUBA 3SUOA 4CEAA 4E7JA 3S3OA 3S3NA 4FLTA 2PY5A 1VSKA 1XHZA 3KKRA 1WN7A 1HYZA 4JS5A 4LD0A 3OS2A 4FCYA 1RT1A 4KV8A 1NJWA 4TSXA 4FK0A 4IBNA 2D0BA 5KRSA 2KFNA 4E19A 4CJUA 3QEPA 3DRRA 3P83D 4FJGA 3HO1A 3AVKA 4K8ZA 1L3VA 3D45A 3HPOA 3VA0A 4DLEA 4FZXC 2DFHA 2YKMA 1QSYA 3AO3A 3HSTB 4FZZA 2DFEA 4FW2A 2X78A 1YVUA 3VQ5A 1T7PA 2G8VA 4EP4A 3NH0A 4C8KA 1F21A 2IAJA 3SQ4A 3LP1A 1KVAA 3KD1E 1NK8A 3NE6A 3D0PA 4DTXA 1EETA 4B9TA 5J2NA 1BHLA 1RTHA 3SZ2A 5C24A 2IDOA 4CF2A 2FC0A 3P5JA 1D9FA 5JS2A 2KW4A 4ZTFA 4M3ZA 2OPSA 3QIOA 3HPHA 2RKIA 2YV0X 1BISA 4I7FA 4CJTA 3MECA 4CJWA 1VSFA 3NH2A 3MXJA 4FLWA 4FM1A 3RMAA 4Z4FA 4KB0A 3HK2A 3RR7A 4PQUA 1YTAA 1I3AA 4Q5VA 3SNNA 1TK0A 3OYCA 4HCCA 1ZYQA 3CM5A 3HL8A 2YNFA 4OKEA 1NK5A 4FLXA 2RN2A 3LP2A 2HVIA 2YHBA 3QEWA 1VK0A 4HTUA 1KTQA 4KTZA 1MU2A 1GOCA 1FXXA 1YT3A 3KK1A 1Q9YA 1RT5A 4AHVA 4DFPA 3KLEA 1ASUA 2KQ2A 3QNNA 3RWUA 5JS1A 1TKDA 1ZBUA 4NCBA 2F8TA 1NK4A 1RT2A 1RNHA 3K2PA 4Y1CA 1RDBA 5HROA 2XO7A 3S3MA 4BACA 4FXDA 1KLNA 4JLHA 4DU1A 1UA0A 4C8LA 2KZMA 3SQ2A 3KK2A 3AVLA 4HHTA 4ELTA 1I39A 3OYEA 4KHQA 3KK3A 3VQAA 4Z4GA 4N47A 3JYTA 3HP9A 4E1MA 3AVIA 1J5OA 1RT3A 4RG8A 4RW9A 4ID5A 1IH7A 1ITGA 1GOAA 3T19A 4CJQA 4LSLA 1QHTA 3LWLA 3NHGA 1LWCA 1RBVA 2XHBA 4FLYA 4DSKA 1SKWA 3A2FA 1W9HA 3O3FA 1TK5A 3L3VA 5HRPA 3MXIA 2ETJA 4E1NA 3RRGA 2Q3SA 4CJEA 3PX0A 1CXQA 1HRHA 2D0CA 3AA5X 3RMCA 3ULDA 1BL3A 3B6OA 3L2VA 2A1RA 1D8YA 4G1QA 1CLQA 1Z26A 1RTDA 3DLKA 1UOCA 3MEEA 3SV4A 2P51A 2HW3A 3I0SA 2BGGA 4M42A 1S6QA 4F2SA 3L2WA 3WNHA 3SUNA 2W42A 5KTQA 1UA1A 1KRPA 2F96A 4KI6A 4M3WA 1G15A 1HQUA 3SYZA 2JGUA 4BE1A 3QEVA 1LAWA 2VWKA 3AVMA 4CFAA 1B92A 4CGFA 4CHYA 3VQPA 3OS1A 3CFRA 3QERA 1SL1A 1NK0A 2HVHA 1LW0A 4O55A 1JXBA 2PYJA 1KLMA 1JLQA 2I5JA 2QK9A 4F2RA 3HVRA 1XWLA 4O5BA 1LV5A 4KHUA 4FJ9A 3KTQA 4Y1DA 2HNZA 4CIFA 1LAVA 1FKPA 1VRTA 1KFDA 4LY7A 4FVMA 2HHSA 2A1SA 4NYFA 3ISNC 3ZT2A 4W5RA 3QEIA 4CF9A 2D5RA 1HPZA 1UWBA 2PYLA 3CM6A 4DMNA 4HUFA 4OGEA 1BI4B 2GUIA 4OLBA 4KRFA 1N5YA 2G8KA 4JS4A 3V1RA 4QAGA 1Q9XA 3ZT4A 3V9ZA 4IFYA 4DQRA 4K8XA 3KKSA 4CGHA 3K57A 1SL2A 1K6YA 3C95A 3VQCA 3DYAA 1JLFA 4CFDA 4UQGA 1JL2A 4CEQA 5KI6A 3WNEA 4CJFA 4NCGA 4CIEA 4QCLA 1EP4A 3VQEA 3QNOA 1RCHA 3DLEA 5FROA 4Q0BA 1J9AA 3TAFA 1KVBA 2O4GA 2JLEA 3LDSA 3VQ4A 3OYHA 1D5AA 5SWMA 1LW2A 3OYFA 3AV9A 3V9WA 4DWIA 2XY6A 1LWFA 4CK2A 1S9EA 2Z1GA 3JSMA 4E7HA 1ZBFA 2XY8A 4FJKA 1VRUA 3EY1A 4LSNA 4CF1A 1S1VA 2IOCA 3LAMA 1S9GA 5SZTA 2PZSA 4DSJA 4AH9A 2EHGA 4DS4A 4CEZA 3SQ1A 4BDZA 1CXUA 5CY4A 5CYQA 1NKCA 3PUFA 3ZSYA 4LH4A 3LANA 3FFIA 3SPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHS A;  3ZT1 A;  3KLI A;  3AO5 A;  4DTM A;  4OLA A;  4CF0 A;  4FW1 A;  2QXF A;  4AHS A;  5FDL A;  1T03 A;  4B9S A;  1WSG A;  1GOB A;  4KTW A;  4FM2 A;  1TL1 A;  4DF8 A;  1IKY A;  3O3H A;  1JKH A;  4OPK A;  3SUQ A;  1TKZ A;  4OVL A;  3OYL A;  1U04 A;  1DTT A;  3KLH A;  3CFP A;  3M8Q A;  1NKB A;  1BIU A;  3DRP A;  4CFC A;  4CHZ A;  3ASM A;  4C8N A;  4JRP A;  2XY7 A;  1X9W A;  2FBT A;  4HVJ A;  3RTV A;  1L3T A;  4CCH A;  4BE2 A;  4B08 A;  4CF8 A;  4DTN A;  2YNG A;  4PWD A;  5EU7 A;  1BQN A;  5C42 A;  4DTO A;  1SKR A;  1QSS A;  4Z4I A;  2E6L A;  4I9L A;  4BWM A;  2B6A A;  4PA1 A;  3TAM A;  3ZSV A;  2LSN A;  4AHC A;  3QEX A;  3AVH A;  2WOM A;  4B9L A;  1BQM A;  3I0R A;  5J2M A;  3C6U A;  2VG5 A;  3AVA A;  1B9D A;  3M8P A;  3HJF A;  2RPI A;  4N5S A;  3IAY A;  1RDD A;  2B4J A;  4CHQ A;  4CK3 A;  2G8F A;  3RMD A;  3K58 A;  3TR8 A;  1ZBI A;  4N41 A;  1VSE A;  1W0H A;  1B9F A;  3IG1 A;  4ZHR A;  4C8M A;  3TAQ A;  3KD5 E;  3K5M A;  2G8I A;  4KHW A;  1RDA A;  4O44 A;  2BAN A;  3NF6 A;  5HRN A;  4IFV A;  3KJV A;  1RIL A;  3HP6 A;  1Y97 A;  4L8R B;  1ZBL A;  4DQS A;  3L2U A;  1TAU A;  5HRS A;  1TKT A;  4KTQ A;  4CK1 A;  1VSD A;  3E01 A;  3DLH A;  3LZJ A;  3NF8 A;  2DTU A;  4M45 A;  5K14 A;  4B8C A;  3NGI A;  1NJZ A;  4I2Q A;  4DTU A;  1WLJ A;  2WON A;  4FJ5 A;  4FLZ A;  1RT6 A;  4CGI A;  1JLG A;  4CJ5 A;  4MFB A;  1WSF A;  1JXE A;  5CYM A;  2VWJ A;  5HBM A;  1L3S A;  3U3G A;  4AHU A;  2X6S A;  3DLR A;  3PO5 A;  4FYD A;  3THV A;  4FJJ A;  4CEC A;  3H08 A;  4CFB A;  3NFA A;  2KZZ A;  4CGG A;  2E4L A;  3EYZ A;  3V9S A;  5CZ1 A;  1VSL A;  4DQQ A;  1VSI A;  1S1X A;  2HNY A;  4CJV A;  3BDP A;  1NK7 A;  3OYM A;  1KVC A;  3ZSO A;  3SJJ A;  1HYV A;  3PX4 A;  4HUG A;  1NK6 A;  4B9U A;  4DSI A;  3VQD A;  3QLH A;  1ASW A;  1WSJ A;  1HNV A;  1BCO A;  3AO4 A;  3MEG A;  3NCI A;  2OZM A;  3LAL A;  2YHA A;  1Q8I A;  4B9M A;  3LPU A;  4EZ9 A;  4Z4E A;  4DTR A;  1J53 A;  4CJR A;  3HYF A;  4CGD A;  3VN5 A;  5I3U A;  2QKK A;  3PO4 A;  3SCX A;  4KI4 A;  4DF4 A;  3HVT A;  2VG6 A;  1EX4 A;  1N6Q A;  4KAZ A;  1U45 A;  3RMB A;  4HCB A;  3HM9 A;  3AA4 A;  1C1C A;  4CEF A;  3OS0 A;  3K59 A;  5HLF A;  3G10 A;  4B8A B;  2B5J A;  1Z25 A;  3ZSZ A;  3K5L A;  5J2P A;  5J2Q A;  5E41 A;  1C1B A;  3U3Y A;  1NJX A;  1X9M A;  4E7I A;  3HT3 A;  1IG9 A;  3M8R A;  2AJQ A;  2GV9 A;  1YTU A;  3QIN A;  4OKK A;  4F3T A;  4ICL A;  3S9H A;  1WAF A;  2VG7 A;  3ZSW A;  1BGX T;  3AO2 A;  4CES A;  4DG1 A;  3TAN A;  2QKB A;  4BDP A;  1SL0 A;  2OYQ A;  1LWE A;  1TK8 A;  1TL3 A;  3ZT0 A;  4DQP A;  1VSM A;  4W5Q A;  4PUO A;  4FJM A;  2ITG A;  4CJL A;  1U48 A;  1RT4 A;  4FJH A;  2HHV A;  4AIL C;  4FJN A;  4M3T A;  2IS3 A;  2DFF A;  1NOZ A;  2HB5 A;  3OJU A;  3F73 A;  2OPQ A;  3CYM A;  1L5U A;  5KRT A;  3OYG A;  1FKO A;  3NAE A;  4B9V A;  3L2R A;  2KTQ A;  1FK9 A;  3OYD A;  4CIG A;  1QTM A;  1JLC A;  1C1A A;  1S6P A;  3VQB A;  1RTJ A;  4DTP A;  3PV8 A;  1U47 A;  2F8S A;  4E0D A;  1U4B A;  3NDK A;  4I9Q A;  4F4K A;  2ZE2 A;  3BGR A;  3C6T A;  3QES A;  1T05 A;  3NF7 A;  1VSH A;  4R5P A;  2HHT A;  2HHW A;  5CZ2 A;  3MAQ A;  1J54 A;  4CHP A;  4EP5 A;  3K5N A;  3LAK A;  5KGX A;  4IG0 A;  1XC9 A;  2OA8 A;  3HPG A;  4FJ7 A;  3K5O A;  3ZT3 A;  5FRM A;  2HND A;  4DSF A;  1NOY A;  4KFB A;  2Z1H A;  4CJS A;  3L2Q A;  3LZI A;  3O4Q A;  4CJ4 A;  3NGZ A;  3SQ0 A;  2P5O A;  4IG3 A;  4ELV A;  1VSJ A;  3DLB A;  3LWM A;  3LP0 A;  4J2E A;  3T3F A;  1QE1 A;  4CGJ A;  4HUE A;  5T7B A;  1WAJ A;  3OYA A;  4Z4H A;  3M8S A;  3LP3 A;  4DFM A;  3TAE A;  4FK2 A;  4Z4C A;  1U49 A;  3OYJ A;  4BWJ A;  4J2D A;  4OGC A;  5DMR A;  3ZCM A;  4GMJ B;  2G8W A;  2X74 A;  4RW8 A;  4FLU A;  1HYS A;  1S1W A;  4MQ3 A;  3OYB A;  1TVR A;  1IKX A;  1JL1 A;  2FBY A;  3DOL A;  3OYI A;  2G8H A;  4KB1 A;  4DFK A;  4AHR A;  3RR8 A;  3DMJ A;  4W5N A;  1D9D A;  1DTQ A;  3RRH A;  4J2A A;  3V9U A;  4DLG A;  3B6P A;  3VQ8 A;  3TAB A;  2R7Y A;  2P1J A;  3P1G A;  4KHY A;  3UIQ A;  4DFJ A;  4CEO A;  2OZS A;  2GBZ A;  3LPT A;  3WNF A;  4YNQ A;  4KPY A;  4DSL A;  1RBT A;  3QIP A;  3C94 A;  4NYN A;  4RW7 A;  4H8K A;  2DY4 A;  4LH5 A;  2FBX A;  4DU4 A;  1KFS A;  1CZB A;  3T1A A;  4ELU A;  4B3O A;  4ID1 A;  3QET A;  3TAG A;  2HHX A;  4KRE A;  3QO9 A;  1RBS A;  3V4I A;  2E6M A;  1XI1 A;  3HXM A;  1QS4 A;  4E3S A;  3V9X A;  3ZSR A;  3AVB A;  4AHT A;  1RDC A;  5DK5 A;  3ZSX A;  4FZY A;  3KLG A;  3SUP A;  3CFO A;  3G0Z A;  4GVM A;  4M3Y A;  4I2P A;  1O1W A;  5HRR A;  4M3R A;  1TKX A;  1NKE A;  3DLG A;  1TV6 A;  4H4M A;  3L8B A;  2ATQ A;  1C6V A;  3AVF A;  3NBP A;  4CHO A;  5D3G A;  4M3U A;  4CER A;  2ZQB A;  4CJP A;  2RF2 A;  2YNI A;  4DS5 A;  4IKF A;  1WSE A;  3L3U A;  1REV A;  2Z1J A;  3AVG A;  4KO0 A;  2IC3 A;  4DTS A;  1NJY A;  4CHN A;  3ALY A;  2Y1J A;  2XRI A;  2ZD1 A;  2O4I A;  1A5W A;  3VQ7 A;  1IKV A;  2BDP A;  4CE9 A;  4DTJ A;  4Z0U A;  3OVN A;  1TGO A;  3NGY A;  3VQQ A;  1C0M A;  1ASV A;  4OKJ A;  1EXQ A;  1S5J A;  3DOK A;  3KLF A;  2D0A A;  4WE1 A;  1A5V A;  2KFZ A;  4E7L A;  4FJX A;  2HMI A;  4F3O A;  1HNI A;  1S1U A;  3IRX A;  4M41 A;  1RT7 A;  4YFU A;  3V6D A;  4CJ3 A;  1BI4 A;  4O0I A;  3CG7 A;  4CJK A;  4DQI A;  4FLV A;  3IS9 A;  1HJR A;  1QQC A;  2HHU A;  5HP1 A;  3TAP A;  4RW4 A;  4FM0 A;  5J1E A;  4IDK A;  1BCM A;  1SUQ A;  4O0J A;  1TAQ A;  3V1O A;  3VQ9 A;  3EZ5 A;  4BDY A;  4DSE A;  1NK9 A;  1QSL A;  1JLB A;  2FBV A;  2HHQ A;  4J2B A;  1C0T A;  4N76 A;  4FJL A;  1JLA A;  4E89 A;  3CQ8 A;  3PY8 A;  4DU3 A;  2Z1I A;  3NH1 A;  3SV3 A;  3DM2 A;  3PX6 A;  1R0A A;  1RBR A;  3O4N A;  3AO1 A;  4W5O A;  1SV5 A;  4BE0 A;  4M3X A;  2X6N A;  3AVN A;  5KGW A;  4ZTJ A;  2G8U A;  4QOZ B;  1WSI A;  2XY5 A;  1KSP A;  1RTI A;  3NF9 A;  4RW6 A;  3I8D A;  2BE2 A;  3AA2 A;  3SPZ A;  1L3U A;  4B9N A;  2YKN A;  3AVJ A;  2EX3 A;  3TAR A;  5FRN A;  4PY5 A;  4N56 A;  1DLO A;  1X9S A;  3TWH A;  3SI6 A;  3V81 A;  4CEB A;  5C25 A;  3VQ6 A;  1EKE A;  4H4O A;  1S1T A;  1KCF A;  4FJI A;  4CED A;  4O4G A;  4NCA A;  3OJS A;  4W5T A;  4CEE A;  1WNS A;  4E7K A;  4KHN A;  1RBU A;  1CZ9 A;  4GW6 A;  3AA3 A;  3DRS A;  4KKO A;  3U6F A;  2OPR A;  1C0U A;  3OYN A;  4F8R A;  3O3G A;  1T8E A;  4C8O A;  4FJ8 A;  1UAX A;  3MXM A;  1IO2 A;  4OJR A;  3DI6 A;  1IKW A;  3F9K A;  1WSH A;  1ZBH A;  1HQE A;  3V1Q A;  4JRQ A;  4OPJ A;  1HMV A;  4XIU A;  2IGI A;  3OYK A;  3VA3 A;  3KIO A;  2OPP A;  1A5X A;  3AVC A;  2Y1I A;  3WNG A;  3MED A;  1SKS A;  2P5G A;  1BIZ A;  5I42 A;  3TI0 A;  4EZ6 A;  1XHX A;  2YNH A;  4FK4 A;  3ITH A;  3OY9 A;  1JLE A;  3ZSQ A;  1X1P A;  2NUB A;  3SUO A;  4CEA A;  4E7J A;  3S3O A;  3S3N A;  4FLT A;  2PY5 A;  1VSK A;  1XHZ A;  3KKR A;  1WN7 A;  1HYZ A;  4JS5 A;  4LD0 A;  3OS2 A;  4FCY A;  1RT1 A;  4KV8 A;  1NJW A;  4TSX A;  4FK0 A;  4IBN A;  2D0B A;  5KRS A;  2KFN A;  4E19 A;  4CJU A;  3QEP A;  3DRR A;  3P83 D;  4FJG A;  3HO1 A;  3AVK A;  4K8Z A;  1L3V A;  3D45 A;  3HPO A;  3VA0 A;  4DLE A;  4FZX C;  2DFH A;  2YKM A;  1QSY A;  3AO3 A;  3HST B;  4FZZ A;  2DFE A;  4FW2 A;  2X78 A;  1YVU A;  3VQ5 A;  1T7P A;  2G8V A;  4EP4 A;  3NH0 A;  4C8K A;  1F21 A;  2IAJ A;  3SQ4 A;  3LP1 A;  1KVA A;  3KD1 E;  1NK8 A;  3NE6 A;  3D0P A;  4DTX A;  1EET A;  4B9T A;  5J2N A;  1BHL A;  1RTH A;  3SZ2 A;  5C24 A;  2IDO A;  4CF2 A;  2FC0 A;  3P5J A;  1D9F A;  5JS2 A;  2KW4 A;  4ZTF A;  4M3Z A;  2OPS A;  3QIO A;  3HPH A;  2RKI A;  2YV0 X;  1BIS A;  4I7F A;  4CJT A;  3MEC A;  4CJW A;  1VSF A;  3NH2 A;  3MXJ A;  4FLW A;  4FM1 A;  3RMA A;  4Z4F A;  4KB0 A;  3HK2 A;  3RR7 A;  4PQU A;  1YTA A;  1I3A A;  4Q5V A;  3SNN A;  1TK0 A;  3OYC A;  4HCC A;  1ZYQ A;  3CM5 A;  3HL8 A;  2YNF A;  4OKE A;  1NK5 A;  4FLX A;  2RN2 A;  3LP2 A;  2HVI A;  2YHB A;  3QEW A;  1VK0 A;  4HTU A;  1KTQ A;  4KTZ A;  1MU2 A;  1GOC A;  1FXX A;  1YT3 A;  3KK1 A;  1Q9Y A;  1RT5 A;  4AHV A;  4DFP A;  3KLE A;  1ASU A;  2KQ2 A;  3QNN A;  3RWU A;  5JS1 A;  1TKD A;  1ZBU A;  4NCB A;  2F8T A;  1NK4 A;  1RT2 A;  1RNH A;  3K2P A;  4Y1C A;  1RDB A;  5HRO A;  2XO7 A;  3S3M A;  4BAC A;  4FXD A;  1KLN A;  4JLH A;  4DU1 A;  1UA0 A;  4C8L A;  2KZM A;  3SQ2 A;  3KK2 A;  3AVL A;  4HHT A;  4ELT A;  1I39 A;  3OYE A;  4KHQ A;  3KK3 A;  3VQA A;  4Z4G A;  4N47 A;  3JYT A;  3HP9 A;  4E1M A;  3AVI A;  1J5O A;  1RT3 A;  4RG8 A;  4RW9 A;  4ID5 A;  1IH7 A;  1ITG A;  1GOA A;  3T19 A;  4CJQ A;  4LSL A;  1QHT A;  3LWL A;  3NHG A;  1LWC A;  1RBV A;  2XHB A;  4FLY A;  4DSK A;  1SKW A;  3A2F A;  1W9H A;  3O3F A;  1TK5 A;  3L3V A;  5HRP A;  3MXI A;  2ETJ A;  4E1N A;  3RRG A;  2Q3S A;  4CJE A;  3PX0 A;  1CXQ A;  1HRH A;  2D0C A;  3AA5 X;  3RMC A;  3ULD A;  1BL3 A;  3B6O A;  3L2V A;  2A1R A;  1D8Y A;  4G1Q A;  1CLQ A;  1Z26 A;  1RTD A;  3DLK A;  1UOC A;  3MEE A;  3SV4 A;  2P51 A;  2HW3 A;  3I0S A;  2BGG A;  4M42 A;  1S6Q A;  4F2S A;  3L2W A;  3WNH A;  3SUN A;  2W42 A;  5KTQ A;  1UA1 A;  1KRP A;  2F96 A;  4KI6 A;  4M3W A;  1G15 A;  1HQU A;  3SYZ A;  2JGU A;  4BE1 A;  3QEV A;  1LAW A;  2VWK A;  3AVM A;  4CFA A;  1B92 A;  4CGF A;  4CHY A;  3VQP A;  3OS1 A;  3CFR A;  3QER A;  1SL1 A;  1NK0 A;  2HVH A;  1LW0 A;  4O55 A;  1JXB A;  2PYJ A;  1KLM A;  1JLQ A;  2I5J A;  2QK9 A;  4F2R A;  3HVR A;  1XWL A;  4O5B A;  1LV5 A;  4KHU A;  4FJ9 A;  3KTQ A;  4Y1D A;  2HNZ A;  4CIF A;  1LAV A;  1FKP A;  1VRT A;  1KFD A;  4LY7 A;  4FVM A;  2HHS A;  2A1S A;  4NYF A;  3ISN C;  3ZT2 A;  4W5R A;  3QEI A;  4CF9 A;  2D5R A;  1HPZ A;  1UWB A;  2PYL A;  3CM6 A;  4DMN A;  4HUF A;  4OGE A;  1BI4 B;  2GUI A;  4OLB A;  4KRF A;  1N5Y A;  2G8K A;  4JS4 A;  3V1R A;  4QAG A;  1Q9X A;  3ZT4 A;  3V9Z A;  4IFY A;  4DQR A;  4K8X A;  3KKS A;  4CGH A;  3K57 A;  1SL2 A;  1K6Y A;  3C95 A;  3VQC A;  3DYA A;  1JLF A;  4CFD A;  4UQG A;  1JL2 A;  4CEQ A;  5KI6 A;  3WNE A;  4CJF A;  4NCG A;  4CIE A;  4QCL A;  1EP4 A;  3VQE A;  3QNO A;  1RCH A;  3DLE A;  5FRO A;  4Q0B A;  1J9A A;  3TAF A;  1KVB A;  2O4G A;  2JLE A;  3LDS A;  3VQ4 A;  3OYH A;  1D5A A;  5SWM A;  1LW2 A;  3OYF A;  3AV9 A;  3V9W A;  4DWI A;  2XY6 A;  1LWF A;  4CK2 A;  1S9E A;  2Z1G A;  3JSM A;  4E7H A;  1ZBF A;  2XY8 A;  4FJK A;  1VRU A;  3EY1 A;  4LSN A;  4CF1 A;  1S1V A;  2IOC A;  3LAM A;  1S9G A;  5SZT A;  2PZS A;  4DSJ A;  4AH9 A;  2EHG A;  4DS4 A;  4CEZ A;  3SQ1 A;  4BDZ A;  1CXU A;  5CY4 A;  5CYQ A;  1NKC A;  3PUF A;  3ZSY A;  4LH4 A;  3LAN A;  3FFI A;  3SPY A; 
#chains in the Genus database with same CATH topology
 4JKC A;  3VPZ A;  1K9M O;  4OLA A;  5AQT A;  4AHS A;  1MWK A;  1XC3 A;  1VQK N;  3O3H A;  4OVL A;  1HUX A;  4DR2 K;  4JI0 K;  4CF8 A;  4DTN A;  1K73 O;  1BQN A;  3OW2 M;  3S3N A;  4AHC A;  2B6A A;  4PA1 A;  4PKH A;  3CJA A;  2P9I A;  2WOM A;  3ENH A;  5GAG P;  3C6U A;  3AVA A;  3EKU A;  1IBM K;  1IBK K;  1N33 K;  2RPI A;  4N5S A;  2B4J A;  5JVG L;  2G8F A;  3K58 A;  3BF1 A;  1B9F A;  3CIP A;  1KXP A;  4C1N K;  2FSJ A;  5BRD A;  2P9L A;  4O44 A;  2BAN A;  4LF7 K;  4BR4 A;  1ZBL A;  2A42 A;  4BQL A;  5HRS A;  3L4I A;  3ZET B;  4CBX A;  3KWG A;  2OTL N;  2E88 A;  3LZJ A;  4M45 A;  4DTU A;  3ATV A;  2WON A;  4MDA A;  1QQM A;  3THY B;  2HBM A;  1JXE A;  4CZL A;  4AHU A;  3DLR A;  5BN9 A;  4DV1 K;  3CCV N;  4A57 A;  4CZF A;  2HNY A;  3CPE A;  1NK7 A;  3N4P A;  1HYV A;  1NK6 A;  4DSI A;  3ZEU A;  3FFK B;  3QLH A;  3NCI A;  3AO4 A;  2VWB A;  4B9M A;  3RSE A;  1MWM A;  4EZ9 A;  4FWK A;  5FPN A;  2QKK A;  2YHW A;  3HVT A;  5AZJ B;  4KAZ A;  1HJO A;  4GV6 A;  1YAG A;  2W41 A;  3LDO A;  4CEF A;  3OS0 A;  3G10 A;  4BC3 A;  4JN4 A;  1Z25 A;  3K5L A;  3T7Z A;  5J2P A;  1NGH A;  1X9M A;  3HT3 A;  4FO0 A;  3M8R A;  4WFB L;  4BRA A;  2AJQ A;  4OKK A;  4EHU A;  4F3T A;  4ICL A;  2VG7 A;  3ZSW A;  1BGX T;  1W97 L;  3TAN A;  3WXK A;  2QKB A;  2OYQ A;  5IT9 O;  1TL3 A;  4DQP A;  1WOQ A;  3L6Q A;  3VEO A;  3CMA N;  2HHV A;  4FJN A;  2IS3 A;  3PLA A;  3F73 A;  2OPQ A;  2HMP A;  4H0T B;  4BG8 A;  3O8M A;  5JLF A;  2FF3 B;  3NAE A;  4JI6 K;  4CIG A;  1QTM A;  4KHP K;  3O80 A;  3PV8 A;  5C2D A;  2UU9 K;  3NF7 A;  3ULE A;  3A5N C;  3CME N;  3LAK A;  4KBO A;  5JVH L;  1XC9 A;  2OA8 A;  4FJ7 A;  3ZT3 A;  3OTO K;  4KFB A;  3CJ9 A;  4CJ4 A;  2D0P A;  4JKD A;  2A41 A;  2P5O A;  4ELV A;  3DLB A;  3E9O A;  1HNW K;  3T3F A;  3KHY A;  3VEN A;  4Z4H A;  3TAE A;  2VCP A;  1U49 A;  2F9T A;  4BRK A;  3OYJ A;  4J2D A;  4OGC A;  4GMJ B;  2QWR A;  3KWI A;  2VQF K;  1XMQ K;  1S1W A;  3VES A;  4JI5 K;  1NNE A;  1JL1 A;  5E84 A;  3DOL A;  2G8H A;  4KB1 A;  1BG3 A;  1NBW A;  3V9U A;  2R7Y A;  1X3N A;  2P1J A;  4YOT A;  4KHY A;  3UIQ A;  4YNQ A;  3QBW A;  1OH8 A;  4H8K A;  4RW7 A;  2PAV A;  4WFA L;  4LH5 A;  2OCE A;  4ID1 A;  3QO9 A;  3QFP A;  2E6M A;  3GE1 A;  3ZLJ A;  4RTF D;  4FZY A;  2O8F B;  3SUP A;  3G0Z A;  3D6R A;  2ITM A;  4M3Y A;  3A5M C;  1NKE A;  3FZM A;  4H4M A;  3L8B A;  2YCH A;  4CHO A;  4CJP A;  4DS5 A;  4YDU A;  3SAH A;  3L3U A;  4B3M K;  4KO0 A;  1T3V A;  3ALY A;  4DR6 K;  3VGL A;  1OKJ A;  1NGI A;  3VQ7 A;  5AZJ A;  4FPB A;  3OVN A;  1O13 A;  2GWJ A;  4NXM K;  4OKJ A;  4FWR A;  1S5J A;  3KLF A;  1A5V A;  2KFZ A;  4E7L A;  1VHX A;  4F3O A;  1S1U A;  4YFU A;  3DXK B;  3LDL A;  2HHU A;  4IO8 A;  3VQ9 A;  1SUQ A;  4JD2 B;  4GKJ K;  4BDY A;  3UB5 A;  1S72 N;  1JLB A;  2FBV A;  4FOI A;  2YJE A;  5CR4 A;  4CZH A;  3SV3 A;  1R0A A;  1RBR A;  3O4N A;  3AO1 A;  5BPM A;  4W5O A;  4BE0 A;  2W40 A;  2X6N A;  1LCU A;  4ZTJ A;  4QOZ B;  3AAP A;  3WXM B;  1HLU A;  2F7T A;  3NF9 A;  3I8D A;  3AA2 A;  2YKN A;  3AVJ A;  3CQX A;  5FRN A;  2GWK A;  1X9S A;  5AQF A;  1S1T A;  1KCF A;  3OJS A;  4DV5 K;  3FZH A;  1KC8 O;  1RBU A;  4KKO A;  1W2B M;  4JEP A;  2OPR A;  4CD1 A;  4H5T A;  3O3G A;  3G71 N;  3VF6 A;  3MXM A;  3I55 N;  1IO2 A;  4B1X B;  3F9K A;  3V1Q A;  4OPJ A;  5AQM A;  3D2E B;  3J7A P;  3VA3 A;  3K9K A;  1A5X A;  1VQ9 N;  2P9K B;  1N8R O;  4YOR A;  5A2Q O;  3OY9 A;  1QQO A;  3S3O A;  3SUO A;  2PY5 A;  4OPH A;  1VSK A;  3I8B A;  4FCY A;  4TSX A;  4IBN A;  4CJU A;  3DRR A;  4FJG A;  3HO1 A;  3TSU A;  4FZX C;  2DFH A;  2QM1 A;  4QS8 A;  4EP4 A;  1TYQ B;  2IAJ A;  3SQ4 A;  3LP1 A;  3SMP A;  3DJC A;  2HBL A;  4BRE A;  5BPN A;  5C12 A;  2O8F A;  3E9L A;  1BHL A;  3A5L C;  2F4V K;  2FC0 A;  1YUW A;  2KW4 A;  4ZTF A;  3O08 A;  2FXU A;  3QIO A;  1L3V A;  4OPA A;  2YV0 X;  1BIS A;  4FLW A;  4FM1 A;  3O9R A;  3HM8 A;  4KH6 A;  3RR7 A;  1YTA A;  1I3A A;  5M1N A;  4Q5V A;  1TK0 A;  2HHH K;  4DCH A;  5F1X A;  4H0O A;  3HTV A;  4OKE A;  1NK5 A;  2HVI A;  4FWO A;  4WQ4 C;  1U2V A;  1MU2 A;  1GOC A;  4QS7 A;  4HTL A;  1Q9Y A;  4DFP A;  5JS1 A;  1TKD A;  4JYA K;  4Y1C A;  4ILH A;  1YF5 L;  3S3M A;  5AQH A;  3SBT A;  2XO7 A;  1J5E K;  4B1V A;  3BY5 A;  4WCE L;  1NGC A;  5ADX A;  3CJC A;  2KZM A;  4BR0 A;  4ELT A;  3MCA B;  3TU5 A;  4JD2 A;  4UY8 O;  3KK3 A;  4DR7 K;  3VQA A;  1E4F T;  3MK6 A;  3HP9 A;  3WT0 A;  4E1M A;  3EE8 A;  4C23 A;  1J5O A;  4RW9 A;  4EAH D;  4Y0W A;  4JHD B;  4O8K A;  1ITG A;  3T19 A;  3EKS A;  4DR4 K;  4CJQ A;  1QHT A;  3LWL A;  4FLY A;  1YJW N;  4IO9 L;  3O3F A;  3CI5 A;  3PIP L;  1CXQ A;  1HRH A;  2NNW A;  4K43 A;  3RMC A;  2NRH A;  4BRC A;  1D8Y A;  2A6A A;  3DLK A;  1RDW X;  1UOC A;  3MEE A;  3I0S A;  4F2S A;  3L2W A;  1NLV A;  2W42 A;  4ILG B;  4KI6 A;  3D2E A;  3LDN A;  1KRP A;  1HQU A;  4JAX A;  4LC9 B;  4BE1 A;  2P9K A;  4JK8 A;  5MLC Q;  3CFR A;  2ASP A;  1JXB A;  4FL9 A;  3J80 O;  4O5B A;  5BRE A;  3EE9 A;  1WB9 A;  3I33 A;  1FKP A;  2HHS A;  2A1S A;  3PSF A;  3ISN C;  1Y64 A;  4CF9 A;  2D5R A;  5DM7 L;  2PYL A;  3CM6 A;  3CET A;  1BI4 B;  4QAG A;  3O6W A;  4DQR A;  1NGD A;  3KKS A;  4CGH A;  1SL2 A;  1TYQ A;  3DYA A;  3U4L A;  1ZBS A;  4H5R A;  2WC9 A;  4IJN A;  4GV3 A;  2JLE A;  3OYH A;  1HKC A;  5SWM A;  3U9D A;  3AV9 A;  3TTC A;  4CK2 A;  1S9E A;  4FJK A;  2P9U B;  4MO4 A;  1ZC6 A;  2PZS A;  3O9T A;  3Q7C A;  1BA1 A;  3PUF A;  5F2R A;  3GL1 A;  3KLI A;  4DTM A;  4FW1 A;  2HF3 A;  1WSG A;  4FM2 A;  4DF8 A;  2P9S A;  3SUQ A;  3M8Q A;  1BIU A;  4JRP A;  4CFC A;  4CHZ A;  4C8N A;  1GLE G;  5GIP A;  1X9W A;  4I6M B;  3RTV A;  1T6D A;  4BE2 A;  5KPR A;  4B08 A;  4CZI A;  3F2K A;  5C42 A;  1SKR A;  5AQX A;  4I9L A;  2BH1 A;  2LSN A;  3LM9 A;  1BQM A;  2HOE A;  4JKG A;  4BRD A;  3L4Q A;  4J8F A;  2VG5 A;  1B9D A;  3M8P A;  4CK3 A;  1VSE A;  2HF4 A;  3IKM A;  4ZHR A;  2CGK A;  4C8M A;  4KHW A;  3H46 O;  4DQ8 A;  4L8R B;  5AQY A;  4FOE A;  1V4S A;  3DLH A;  3NF8 A;  3R1X A;  4I2Q A;  1P8Z A;  3UE5 A;  2E5L K;  4CGI A;  2ASO A;  1L3S A;  4GVE A;  3PO5 A;  4FYD A;  4FJJ A;  3H08 A;  4CFB A;  3NFA A;  2KZZ A;  4QS9 A;  4CZG A;  1HKG A;  1T44 A;  3MN6 A;  4DQQ A;  1VSI A;  4CJV A;  3JAM O;  3OYM A;  1KVC A;  2VGN A;  2I7P A;  4JKF A;  3ZSO A;  3SJJ A;  1VQN N;  4B9U A;  2KHO A;  3VQD A;  1NGE A;  1ASW A;  1WSJ A;  4WYB A;  1BCO A;  2OZM A;  3UKR B;  2YHA A;  5AQV A;  1Q8I A;  2W6K A;  3Q7B A;  1N34 K;  4CJR A;  5CE3 A;  5I3U A;  1YIT N;  4DR5 K;  2VG6 A;  1N6Q A;  2QWO A;  3EN9 A;  1C1C A;  3K59 A;  5HLF A;  4B8A B;  1ATR A;  5E41 A;  3G6E N;  4E7I A;  3QIC A;  1YTU A;  3CCJ N;  1EWR A;  2P9U A;  3KZB A;  3AO2 A;  4CES A;  3E9P A;  1SL0 A;  2EWS A;  1VQP N;  3CCM N;  1TK8 A;  4W5Q A;  4PUO A;  4FJM A;  5M1O A;  4M3T A;  2DFF A;  2HB5 A;  4HWI A;  3MCP A;  3QFU A;  5AQP A;  3B8A X;  1FKO A;  4B9V A;  3L2R A;  1Q82 O;  1JLC A;  2P9P A;  3VQB A;  2F8S A;  1RTJ A;  1HX1 A;  3MN9 A;  3QB0 A;  2ZE2 A;  1T05 A;  2HHW A;  3KVG A;  5CZ2 A;  1YJN N;  1GLL O;  5C2F A;  4X66 K;  4IG0 A;  4B3S K;  5FRM A;  3K5O A;  2HND A;  1GLD G;  4DSF A;  1NOY A;  4DB3 A;  2Z1H A;  3NVK A;  4IOA L;  3NGZ A;  4NB4 A;  4IG3 A;  3NVM A;  1T6C A;  1KAY A;  1QE1 A;  5DM6 L;  4A2B A;  1BOT O;  3OYA A;  3M8S A;  3LP3 A;  4WF9 L;  4BWJ A;  1HYS A;  4MQ3 A;  4B9Q A;  1TVR A;  1IKX A;  3R9P A;  4DFK A;  4AHR A;  1EO1 A;  3RR8 A;  3VOV A;  4DLG A;  4CBU A;  4KPY A;  1NJI O;  1WBD A;  1ZXO A;  1RBT A;  3QIP A;  3C94 A;  2DY4 A;  3J81 O;  2FBX A;  3WXJ A;  5BR9 A;  1CZB A;  4ELU A;  3TAG A;  3JS6 A;  4LF6 K;  4JV5 K;  1RBS A;  3V4I A;  5FPM A;  1MDU B;  2FF6 A;  2IVN A;  2NRW A;  4CZE A;  3O5B A;  4GVM A;  3T1Y K;  4JI2 K;  4YOU A;  4BR7 A;  2ATQ A;  3AVF A;  3NBP A;  4BVP A;  1IV0 A;  4M3U A;  2RF2 A;  3THW B;  1NWK A;  3MWT A;  2YI1 A;  2IC3 A;  5GAD P;  2Y1J A;  2V52 B;  1NGB A;  3FZL A;  1TUU A;  1NGG A;  2BDP A;  3GBT A;  3VMF B;  4PKG A;  3DOK A;  2Q36 A;  2QA4 N;  3MWP A;  1RT7 A;  1Q86 O;  4DQI A;  2Q97 A;  3IS9 A;  4PKI A;  3TAP A;  4RW4 A;  5J1E A;  1YHQ N;  4DV0 K;  3EZ5 A;  1NK9 A;  1C0T A;  4E89 A;  3PY8 A;  1BO5 O;  3PX6 A;  5KGW A;  2Q31 A;  1XQS C;  1KSP A;  2NRX A;  4RW6 A;  2BE2 A;  1DLO A;  4XH4 A;  3SI6 A;  3V81 A;  4CEB A;  1EKE A;  1VQ5 N;  4W5T A;  3GG4 A;  1WNS A;  4E7K A;  2NLX A;  5FLX O;  4NO7 A;  4F8R A;  1UAX A;  1IKW A;  2D1K A;  3WXL A;  5M1K A;  4JRQ A;  3WNG A;  3MED A;  1BIZ A;  5I42 A;  3TI0 A;  4EZ6 A;  1JCF A;  2YNH A;  1NMD A;  2NRV A;  5I9E B;  4FK4 A;  1VQO N;  3KKR A;  1WN7 A;  4LFC K;  2JWK A;  1QZ6 A;  4JS5 A;  5C0Y A;  4IZ9 A;  4LD0 A;  4MDB A;  3SMS A;  4KV8 A;  5BRF A;  4E19 A;  3P83 D;  3AVK A;  4K8Z A;  1X9J A;  3H3O B;  3E66 A;  2YHX A;  3R6M A;  3HST B;  4BC2 A;  1T7P A;  3M6G A;  1F21 A;  1XNR K;  4WQ5 A;  4K42 A;  4MLH A;  3NE6 A;  1NK8 A;  2UXB K;  4LF8 K;  3SZ2 A;  3ZET A;  5C24 A;  2IDO A;  4CF2 A;  1HNX K;  3K9J A;  1QHA A;  4CJT A;  2VYP A;  3HK2 A;  2OTJ N;  3THY A;  4KB0 A;  4M63 C;  3OYC A;  3CM5 A;  2YNF A;  1XMO K;  4CD3 A;  3LP2 A;  4FLX A;  5KQ8 A;  3QNN A;  4BRL A;  3M5R A;  1ZBU A;  2ASM A;  2F8T A;  4RWT A;  1RT2 A;  3K2P A;  2Q0U A;  1UA0 A;  5EXW A;  3CC7 N;  2GUP A;  4HHT A;  2KLA A;  3ENO A;  2YHY A;  3JXU A;  5E26 A;  5M1P A;  4KHQ A;  4IEE A;  3I56 N;  4N47 A;  2HBJ A;  4IOC L;  3DAW A;  1YXQ A;  1IH7 A;  1GOA A;  4JI3 K;  4EHT A;  3NHG A;  1LWC A;  1SKW A;  2ZJQ L;  3CCS N;  1VQL N;  3WEE B;  3H6E A;  3AA5 X;  2D0C A;  3ULD A;  2A1R A;  4G1Q A;  3TSP A;  4FSV A;  1NGF A;  2BGG A;  4M42 A;  3WNH A;  2F96 A;  3CF5 L;  3SAF A;  1LAW A;  3MN5 A;  2VWK A;  4CFA A;  3OS1 A;  1B92 A;  3VQP A;  1NK0 A;  4AM6 A;  5GIN A;  1KLM A;  1JLQ A;  2I5J A;  4BRG A;  3L0Q A;  4KHU A;  4FJ9 A;  3SK3 A;  4Y1D A;  4H0P A;  4CIF A;  4NYF A;  4W5R A;  3ZT2 A;  4YHH K;  3QEI A;  3P39 A;  3LDP A;  4JS4 A;  3V9Z A;  4IFY A;  3K57 A;  1K6Y A;  3D2F B;  3VQC A;  1JLF A;  4UQG A;  1JL2 A;  4CEQ A;  3WNE A;  4G9Z A;  2HBK A;  4NCG A;  4CIE A;  3CCQ N;  5FRO A;  4Q0B A;  1J9A A;  3TAF A;  3FLC O;  3ID6 A;  1H1V A;  1R59 O;  1EWQ A;  3P4I A;  3VTI A;  1VRU A;  4LSN A;  4DS4 A;  2V51 B;  4BDZ A;  5CY4 A;  5CYQ A;  2QTD A;  3FZF A;  3ZSY A;  3FFI A;  3WQU A;  3SPY A;  4CF0 A;  5FDL A;  1T03 A;  4B9S A;  1GOB A;  1TL1 A;  2CGL A;  1IKY A;  3VEZ A;  3BP8 A;  2GTD A;  3KLH A;  3CFP A;  1DTT A;  1NKB A;  1VQ7 N;  4NXN K;  4FWS A;  4HVJ A;  4CVN E;  4CCH A;  4PWD A;  2YNG A;  2ZM6 K;  5EU7 A;  3CJ1 A;  4OX9 K;  2E6L A;  3ZSV A;  5FPE A;  4JI8 K;  4CZM A;  3VER A;  4DUY K;  4B9L A;  3HOT A;  3I0R A;  3WQT A;  5J2M A;  4ILJ A;  4ISG A;  3P31 A;  3G25 A;  5AR0 A;  1QZ5 A;  4CHQ A;  4EFH A;  3RMD A;  3DXK A;  1ZBI A;  3KD5 E;  1M90 O;  1RDA A;  4H03 B;  4IFV A;  1RIL A;  3HP6 A;  1KAX A;  1KD1 O;  4DQS A;  1OH6 A;  1IJJ A;  1TKT A;  1VSD A;  1SQK A;  5AFU H;  2E1Y A;  4B8C A;  5K14 A;  3EEQ A;  1NJZ A;  3LM2 A;  3VF4 A;  1Q81 O;  4FJ5 A;  4FLZ A;  3MX2 A;  4B1Z A;  1JLG A;  4MFB A;  1WSF A;  5HBM A;  4FWP A;  3THV A;  5AQZ A;  4CGG A;  2NRZ A;  3OBY A;  4BRQ A;  3QBX A;  3CHW A;  1VSL A;  3BDP A;  4CI6 A;  4KH5 A;  2BUP A;  4FWN A;  1K8K B;  4HUG A;  4B3R K;  4LF9 K;  2QWP A;  3MEG A;  3LAL A;  3O1B A;  3H3N O;  1J53 A;  4BC5 A;  3HYF A;  3PO4 A;  4JI1 K;  5AQL A;  3SCX A;  4KI4 A;  4DF4 A;  2QWQ A;  3H1Q A;  3RMB A;  4HCB A;  1VQM N;  1MA9 B;  3CJ7 A;  3ID8 A;  3TSQ A;  2CGJ A;  2B5J A;  5AZI B;  5J2Q A;  1C1B A;  3U3Y A;  1IG9 A;  3HZ6 A;  4JNE A;  3S9H A;  1WAF A;  5AQQ A;  1E4G T;  4DG1 A;  2D0O A;  2RE2 A;  2GEL A;  3ZT0 A;  1VSM A;  2ITG A;  4CJL A;  1RT4 A;  3CCU N;  2VGM A;  3CYM A;  1Q18 A;  4AM7 A;  5KRT A;  4CZJ A;  1E3M A;  3OYG A;  3VGK A;  2KTQ A;  1FK9 A;  3UKU B;  3OYD A;  1C1A A;  4DTP A;  4BVO A;  3WUH A;  4E0D A;  1U4B A;  2WFB A;  4F4K A;  4I9Q A;  3BGR A;  4LFB K;  3OBW A;  3QES A;  2QWL A;  4BRH A;  3C7N B;  4GV9 A;  4EP5 A;  2J4R A;  3AAQ A;  2E8A A;  5AQR A;  2O8C B;  1NM1 A;  4CJS A;  3L2Q A;  3LZI A;  3CC4 N;  3O4Q A;  3SQ0 A;  2ZGZ A;  4OO1 J;  3LP0 A;  4HUE A;  4DFM A;  3BZC A;  1P90 A;  4Z4C A;  3GDQ A;  1QVF M;  2X74 A;  4RW8 A;  4FLU A;  2O8B B;  1EQY A;  1I94 K;  4CJ7 A;  3CD6 N;  3DMJ A;  1SS6 A;  3RRH A;  4J2A A;  4JHD A;  3VQ8 A;  3TAB A;  3N4Q A;  4DFJ A;  4CEO A;  2NRT A;  2AA4 A;  1YVN A;  5EY4 A;  4WQ5 C;  4V19 S;  4DU4 A;  3FGU A;  1KFS A;  4B3O A;  2CH5 A;  4YOV A;  2Q0R A;  4KRE A;  1N36 K;  3O1W A;  4C1N I;  3HXM A;  4E3S A;  3V9X A;  3ZSR A;  5DK5 A;  2WTU A;  1ATS A;  2QW9 A;  4I2P A;  1O1W A;  5HRR A;  3DLG A;  1TV6 A;  4BQZ A;  1C6V A;  4CER A;  2RHK A;  3C65 A;  1WSE A;  4B3T K;  4BRO A;  1HKB A;  2E2O A;  2Z1J A;  3AVG A;  2UYT A;  4DV4 K;  4DTS A;  3H45 C;  4CHN A;  1IKV A;  4DTJ A;  4CZK A;  4Z0U A;  1TGO A;  3NGY A;  4YDU C;  2ZJP L;  1C0M A;  1ASV A;  1EXQ A;  1OH7 A;  2D0A A;  4FJX A;  4YOY A;  4BC4 A;  3IRX A;  4M41 A;  3SBG A;  1HNZ K;  4CJ3 A;  1BI4 A;  4O0I A;  3CG7 A;  4FLV A;  5C10 A;  1QQC A;  2P9L B;  5HP1 A;  2UUB K;  4FM0 A;  4IDK A;  1BCM A;  4DSE A;  1QSL A;  2NRR A;  3F5T A;  4H0V B;  2HHQ A;  5LMN K;  2W6L A;  3DM2 A;  1SV5 A;  1ATN A;  2QXL A;  2XY5 A;  4B1W B;  4DSK A;  5LJV A;  3SPZ A;  1L3U A;  2EX3 A;  4PY5 A;  4N56 A;  3VEX A;  5C25 A;  3VQ6 A;  4DR3 K;  5TKW A;  4CED A;  4O4G A;  4NCA A;  2E2N A;  3PSI A;  4CW7 B;  5B8H A;  3C7N A;  4KHN A;  1K8A O;  4GW6 A;  3AA3 A;  3DRS A;  5HL7 L;  3U6F A;  4JKE A;  3OYN A;  1T8E A;  3DI6 A;  2ZJR L;  1HQE A;  1HMV A;  4XIU A;  3OYK A;  3ZEU B;  3KIO A;  3AVC A;  1SKS A;  3H1V X;  3AY9 A;  4K25 A;  3RSE B;  3ITH A;  1JLE A;  4CBW A;  4I6M A;  4FLT A;  2O8B A;  1XHZ A;  5F0X A;  4LF5 K;  5GAH P;  1HYZ A;  3DXM B;  4YOW A;  4FK0 A;  2O8D B;  4FWM A;  5TKY A;  3VA0 A;  4DLE A;  1QSY A;  2Q2R A;  1C0F A;  1N32 K;  2DFE A;  3ENB A;  1Q7Y O;  1YVU A;  4XH5 A;  3VQ5 A;  4C8K A;  2PBD A;  1KVA A;  3D0P A;  1EET A;  4IFE A;  5J2N A;  1RTH A;  1M1K O;  3P5J A;  4WQ4 A;  5AQG A;  3PIO L;  3HPH A;  1VSF A;  3MXJ A;  4Z4F A;  2E20 A;  5M1F A;  4HCC A;  1ZYQ A;  4PL7 A;  2QI2 A;  1JCE A;  3HL8 A;  3ULE B;  2RN2 A;  2YHB A;  3DWL A;  3J8A A;  1KTQ A;  4KTZ A;  4O8U A;  1YT3 A;  3KK1 A;  1VQ6 N;  4AHV A;  3RWU A;  3KLE A;  1ASU A;  3THX B;  1NK4 A;  2QWM A;  1G99 A;  3IDH A;  3UKR A;  1KLN A;  4JLH A;  5BPL A;  4C8L A;  3FR0 A;  3KK2 A;  3AVL A;  4BRN A;  3O9Q A;  3RVC A;  1RT3 A;  3P38 A;  3EL2 A;  4ID5 A;  4BGB A;  4BRF A;  4F9O A;  1NU0 A;  4LSL A;  5FPD A;  4B1U B;  2XHB A;  4IXC A;  3AAR A;  1TK5 A;  3L3V A;  4H5W A;  5HRP A;  3MXI A;  3O9U A;  4K41 A;  3W0L A;  2Q3S A;  3PX0 A;  3AGR A;  4YY3 K;  1BL3 A;  3B6O A;  4E1J A;  3L2V A;  1CLQ A;  5AQW A;  4YOX A;  3T69 A;  3HOS A;  3SV4 A;  5IWA K;  1TUY A;  2HW3 A;  3G4S N;  2Q1N A;  1S6Q A;  3SUN A;  4M3W A;  5CHI A;  3SYZ A;  2JGU A;  4IOX A;  3FE1 A;  3QEV A;  3AVM A;  4FZZ A;  2NZT A;  3QER A;  1SL1 A;  5ELZ A;  1LW0 A;  4O55 A;  3ZX2 A;  1ESV A;  1BWF O;  2E1Z A;  4F2R A;  5BR8 K;  3CER A;  3HVR A;  1XWL A;  3ATU A;  3M3Z A;  1J6Z A;  3W3D A;  3KTQ A;  4A59 A;  1KAZ A;  3DXM A;  3BF3 A;  3HI0 A;  1VRT A;  1KFD A;  3O4W A;  4FVM A;  2O8D A;  3R8E A;  2YJF A;  4OGE A;  4KRF A;  1Q9X A;  3V1R A;  5ADX H;  3O9S A;  3C95 A;  4CFD A;  4CJF A;  4QCL A;  3J7Y P;  3QNO A;  5GAE P;  1RCH A;  1FW6 A;  1KVB A;  2GX9 A;  2YX6 A;  3TTD A;  3IMX A;  1FJG K;  3V9W A;  4DWI A;  3TPQ A;  1ZBF A;  2XY8 A;  3EY1 A;  1S9G A;  5SZT A;  3M1F A;  1OH5 A;  4DSJ A;  4AH9 A;  2ZGY A;  4CEZ A;  3SQ1 A;  1CXU A;  1NKC A;  2P9N B;  4A61 A;  4KHS A;  3ZT1 A;  3AO5 A;  1SAZ A;  3THX A;  2QXF A;  3LL3 A;  3BZK A;  4KTW A;  3VGM A;  1JKH A;  4OPK A;  3CQY A;  1TKZ A;  3THW A;  3OYL A;  1U04 A;  3DRP A;  3ASM A;  2A5X A;  2XY7 A;  2FBT A;  1L3T A;  4IJA A;  4PL8 A;  4DV6 K;  4DTO A;  1QSS A;  4Z4I A;  4BWM A;  3TAM A;  1GLJ O;  3QEX A;  3AVH A;  2WBN A;  3CCR N;  3A8Y A;  3HJF A;  3IAY A;  1RDD A;  2OAN A;  3TR8 A;  4N41 A;  3TAQ A;  1W0H A;  3IG1 A;  3K5M A;  2G8I A;  4NLB A;  5EVZ A;  2FSN A;  3NF6 A;  5HRN A;  3KJV A;  1Y97 A;  1BUP A;  3L2U A;  1TAU A;  3VEY A;  4CK1 A;  3E01 A;  2DTU A;  3NGI A;  1WLJ A;  1RT6 A;  4CJ5 A;  5CYM A;  2VWJ A;  3U3G A;  1QVG M;  2X6S A;  3S41 A;  4CEC A;  1VQ8 N;  2QWN A;  4GY2 B;  2E4L A;  1U2V B;  3EYZ A;  3V9S A;  5CZ1 A;  1S1X A;  3LDQ A;  3PX4 A;  3T1H K;  1SZ2 A;  2BTF A;  5JIC A;  3VEV A;  4JK9 A;  1HNV A;  3CPW M;  3LPU A;  4Z4E A;  4DTR A;  4CGD A;  3VN5 A;  1NMN A;  2FLO A;  1EX4 A;  3IUC A;  4DR1 K;  1U45 A;  3HM9 A;  3AA4 A;  1DGK N;  5AQN A;  3ZSZ A;  5KPZ A;  5KQD A;  1NJX A;  1YJ9 N;  2GV9 A;  3QIN A;  2UUC K;  1HPM A;  2V7Y A;  3F9M A;  5C15 A;  4BDP A;  3VF2 A;  1LWE A;  4Z94 A;  1Z05 A;  1U48 A;  4FJH A;  2P9N A;  4AIL C;  4H5N A;  3OJU A;  1NOZ A;  2JWL A;  1L5U A;  3D7E O;  3GOI A;  2PFU A;  1S6P A;  4H0Y B;  1U47 A;  5AQJ A;  3NDK A;  2IVP A;  3C6T A;  1DT9 A;  1VSH A;  4R5P A;  2HHT A;  4XEI A;  1GLB G;  3HSC A;  1J54 A;  4A2A A;  4L3Q A;  4BR2 A;  4CHP A;  1S22 A;  4BRI A;  5KGX A;  3K5N A;  4BG9 A;  3HPG A;  1DKG D;  4X62 K;  2FSK A;  2WUS A;  1VSJ A;  3LWM A;  2VQE K;  4J2E A;  4CGJ A;  5T7B A;  1WAJ A;  5LL6 Z;  1BA0 A;  4FK2 A;  4JKH A;  5AQU A;  4DKW A;  5DMR A;  3ZCM A;  2G8W A;  3IFR A;  4LF4 K;  3OYB A;  3QDK A;  2FBY A;  3OYI A;  2E2P A;  4W5N A;  1D9D A;  4X64 K;  1DTQ A;  1S3X A;  1VAZ A;  3B6P A;  3ZX0 A;  3P1G A;  4U67 L;  2OZS A;  2GBZ A;  3LPT A;  3WNF A;  4DSL A;  3WEE A;  4NYN A;  1IBL K;  1V4T A;  3T1A A;  4IWV A;  1GLC G;  4H5V A;  3QET A;  2HHX A;  4MLE A;  3MN7 A;  1XI1 A;  1QS4 A;  3AVB A;  4AHT A;  1RDC A;  3ZSX A;  1VQ4 N;  3KLG A;  3CFO A;  3BEX A;  1QQN A;  3HBT A;  4M3R A;  4KH4 A;  1TKX A;  4FWL A;  3J7Z O;  2P9S B;  5D3G A;  1LOT B;  2ZQB A;  4IKF A;  2YNI A;  5KPT A;  4A62 A;  1REV A;  1NJY A;  1X3M A;  2XRI A;  2ZD1 A;  2O4I A;  4X65 K;  1A5W A;  1HR0 K;  4CE9 A;  1NG9 A;  3EO3 A;  3VQQ A;  1OVY A;  4FWQ A;  4JKG B;  4WE1 A;  4GNI A;  2HMI A;  1HNI A;  4U7B A;  2HST A;  3SJH A;  3V6D A;  5LJW A;  1JJ2 M;  4CJK A;  3FZK A;  3C0B A;  3MAQ A;  1HJR A;  3CC2 N;  4O0J A;  1GLA G;  1TAQ A;  2DPN A;  3D2F A;  1OVQ A;  3V1O A;  2V7Z A;  4J2B A;  4N76 A;  4FJL A;  1JLA A;  3CQ8 A;  4DU3 A;  2Z1I A;  3NH1 A;  3C6H A;  3ZYY X;  4M3X A;  3OHR A;  3AVN A;  1WUA A;  2G8U A;  4JKB A;  1WSI A;  1YIJ N;  1RTI A;  4B9N A;  2CH6 A;  2QEX N;  4ISF A;  3TAR A;  3C6A A;  3A5O C;  5GIO A;  3TWH A;  2O8E B;  4H4O A;  4FJI A;  4BRM A;  4CEE A;  3OA9 A;  1C0G A;  1CZ9 A;  5AQO A;  1C0U A;  2UXD K;  4C8O A;  4FJ8 A;  3AGK A;  4OJR A;  5BRH A;  1WSH A;  5LMU K;  1ZBH A;  3QML A;  4ISE A;  2IIR A;  2IGI A;  4A5A A;  2OPP A;  2Y1I A;  2P5G A;  2D4W A;  5M1Q A;  1XHX A;  3CCE N;  3ZSQ A;  5EX5 A;  3CJB A;  1X1P A;  2NUB A;  4CEA A;  4E7J A;  5BN8 A;  4GKK K;  4FPA A;  1U6Z A;  2E2Q A;  4JK7 A;  1NGA A;  3OS2 A;  1BDG A;  3E1Y A;  3VET A;  1RT1 A;  1NJW A;  2KKZ A;  2D0B A;  5KRS A;  2KFN A;  3KK7 A;  3VTH A;  3QEP A;  4WFN L;  4DV3 K;  3A0I X;  3D45 A;  3WXI A;  3HPO A;  4AF1 A;  4MO5 A;  2YKM A;  4JKA A;  1BU6 O;  3AO3 A;  5JLH A;  4R79 A;  4FW2 A;  2X78 A;  4A5B A;  2G8V A;  3NH0 A;  3CXC M;  3KD1 E;  4DTX A;  3TTF A;  4B9T A;  4M7X A;  1GLF O;  4DHY A;  1DEJ A;  1RFQ A;  3DLL L;  1D9F A;  3BUZ B;  5JS2 A;  2A3Z A;  4M3Z A;  2OPS A;  2P9P B;  2RKI A;  4IEI A;  3NH2 A;  4I7F A;  3MEC A;  2GEM A;  4XH1 A;  4CJW A;  3RMA A;  5H1S Q;  1KQS M;  4PQU A;  3SNN A;  4BR5 A;  4EIA A;  4LFA K;  2F9W A;  5AQI A;  3QEW A;  1VK0 A;  2A40 A;  3U9Z A;  4HTU A;  2IVO A;  1FXX A;  3SLC A;  3MMV A;  4DV2 K;  1RT5 A;  1ILY A;  2KQ2 A;  1K8K A;  1Z6R A;  1XUP O;  1WBB A;  4NCB A;  4RCH A;  5HOO A;  1RNH A;  1D4X A;  1RDB A;  5HRO A;  4H0X B;  4BAC A;  4FXD A;  4DU1 A;  3EZW A;  3SQ2 A;  1I39 A;  3OYE A;  2H3G X;  4Z4G A;  2AP1 A;  3JYT A;  3AVI A;  5JMV A;  4RG8 A;  2P9I B;  5AJ3 K;  4B1Y B;  3MDQ A;  5AZI A;  4JI4 K;  5AQK A;  1RBV A;  3A2F A;  3HRG A;  1W9H A;  2ETJ A;  4DV7 K;  4E1N A;  3RRG A;  1RDU A;  4CJE A;  2O8E A;  5EOY A;  4K0K K;  1Z26 A;  1RTD A;  2P51 A;  1IG8 A;  3R3L A;  5KTQ A;  1UA1 A;  1G15 A;  3UKU A;  4CGF A;  3ZX3 A;  4CHY A;  1JCG A;  2HVH A;  2UUA K;  2PYJ A;  2QK9 A;  5LY3 A;  3K0S A;  3U8X A;  1LV5 A;  2O8C A;  2HNZ A;  4JI7 K;  2UXC K;  1LAV A;  2ZWH A;  4M7Y A;  4LY7 A;  1CZA N;  4FVU A;  3NMU A;  3SAG A;  1HPZ A;  1UWB A;  4DMN A;  4HUF A;  4OLB A;  2GUI A;  2ZF5 O;  1N5Y A;  2G8K A;  3ZT4 A;  4K8X A;  4O5F A;  4BGA A;  4PHT X;  4IDH A;  1NGJ A;  5KI6 A;  1EP4 A;  5AFU A;  1W7A A;  3CCL N;  3VQE A;  3DLE A;  4BRP A;  5AQS A;  2O4G A;  3LDS A;  3VQ4 A;  1D5A A;  4AQY K;  1LW2 A;  3OYF A;  2XY6 A;  1LWF A;  3JSM A;  2Z1G A;  1YI2 N;  4E7H A;  4CF1 A;  1S1V A;  2IOC A;  3LAM A;  3MX5 A;  1XNQ K;  4DUZ K;  2EHG A;  4BY9 C;  3VEW A;  4NLC A;  4BR9 A;  1RGI A;  2I7N A;  4KTQ A;  4LH4 A;  3LAN A; 
#chains in the Genus database with same CATH homology
 4KHS A;  3ZT1 A;  3KLI A;  3AO5 A;  4DTM A;  4OLA A;  4CF0 A;  4FW1 A;  2QXF A;  4AHS A;  5FDL A;  1T03 A;  4B9S A;  1WSG A;  1GOB A;  4KTW A;  4FM2 A;  1TL1 A;  4DF8 A;  1IKY A;  3O3H A;  1JKH A;  4OPK A;  3SUQ A;  1TKZ A;  4OVL A;  3OYL A;  1U04 A;  1DTT A;  3KLH A;  3CFP A;  3M8Q A;  1NKB A;  1BIU A;  3DRP A;  4CFC A;  4CHZ A;  3ASM A;  4C8N A;  4JRP A;  2XY7 A;  1X9W A;  2FBT A;  4HVJ A;  3RTV A;  1L3T A;  4CCH A;  4BE2 A;  4B08 A;  4CF8 A;  4DTN A;  2YNG A;  4PWD A;  5EU7 A;  1BQN A;  5C42 A;  4DTO A;  1SKR A;  1QSS A;  4Z4I A;  2E6L A;  4I9L A;  4BWM A;  2B6A A;  4PA1 A;  3TAM A;  3ZSV A;  2LSN A;  4AHC A;  3QEX A;  3AVH A;  2WOM A;  4B9L A;  1BQM A;  3I0R A;  5J2M A;  3C6U A;  2VG5 A;  3AVA A;  1B9D A;  3M8P A;  3HJF A;  2RPI A;  4N5S A;  3IAY A;  1RDD A;  2B4J A;  4CHQ A;  4CK3 A;  2G8F A;  3RMD A;  3K58 A;  3TR8 A;  1ZBI A;  4N41 A;  1VSE A;  1W0H A;  1B9F A;  3IG1 A;  4ZHR A;  4C8M A;  3TAQ A;  3KD5 E;  3K5M A;  2G8I A;  4KHW A;  1RDA A;  4O44 A;  2BAN A;  3NF6 A;  5HRN A;  4IFV A;  3KJV A;  1RIL A;  3HP6 A;  1Y97 A;  4L8R B;  1ZBL A;  4DQS A;  3L2U A;  1TAU A;  5HRS A;  1TKT A;  4KTQ A;  4CK1 A;  1VSD A;  3E01 A;  3DLH A;  3LZJ A;  3NF8 A;  2DTU A;  4M45 A;  5K14 A;  4B8C A;  3NGI A;  1NJZ A;  4I2Q A;  4DTU A;  1WLJ A;  2WON A;  4FJ5 A;  4FLZ A;  1RT6 A;  4CGI A;  1JLG A;  4CJ5 A;  4MFB A;  1WSF A;  1JXE A;  5CYM A;  2VWJ A;  5HBM A;  1L3S A;  3U3G A;  4AHU A;  2X6S A;  3DLR A;  3PO5 A;  4FYD A;  3THV A;  4FJJ A;  4CEC A;  3H08 A;  4CFB A;  3NFA A;  2KZZ A;  4CGG A;  2E4L A;  3EYZ A;  3V9S A;  5CZ1 A;  1VSL A;  4DQQ A;  1VSI A;  1S1X A;  2HNY A;  4CJV A;  3BDP A;  1NK7 A;  3OYM A;  1KVC A;  3ZSO A;  3SJJ A;  1HYV A;  3PX4 A;  4HUG A;  1NK6 A;  4B9U A;  4DSI A;  3VQD A;  3QLH A;  1ASW A;  1WSJ A;  1HNV A;  1BCO A;  3AO4 A;  3MEG A;  3NCI A;  2OZM A;  3LAL A;  2YHA A;  1Q8I A;  4B9M A;  3LPU A;  4EZ9 A;  4Z4E A;  4DTR A;  1J53 A;  4CJR A;  3HYF A;  4CGD A;  3VN5 A;  5I3U A;  2QKK A;  3PO4 A;  3SCX A;  4KI4 A;  4DF4 A;  3HVT A;  2VG6 A;  1EX4 A;  1N6Q A;  4KAZ A;  1U45 A;  3RMB A;  4HCB A;  3HM9 A;  3AA4 A;  1C1C A;  4CEF A;  3OS0 A;  3K59 A;  5HLF A;  3G10 A;  4B8A B;  2B5J A;  1Z25 A;  3ZSZ A;  3K5L A;  5J2P A;  5J2Q A;  5E41 A;  1C1B A;  3U3Y A;  1NJX A;  1X9M A;  4E7I A;  3HT3 A;  1IG9 A;  3M8R A;  2AJQ A;  2GV9 A;  1YTU A;  3QIN A;  4OKK A;  4F3T A;  4ICL A;  3S9H A;  1WAF A;  2VG7 A;  3ZSW A;  1BGX T;  3AO2 A;  4CES A;  4DG1 A;  3TAN A;  2QKB A;  4BDP A;  1SL0 A;  2OYQ A;  1LWE A;  1TK8 A;  1TL3 A;  3ZT0 A;  4DQP A;  1VSM A;  4W5Q A;  4PUO A;  4FJM A;  2ITG A;  4CJL A;  1U48 A;  1RT4 A;  4FJH A;  2HHV A;  4AIL C;  4FJN A;  4M3T A;  2IS3 A;  2DFF A;  1NOZ A;  2HB5 A;  3OJU A;  3F73 A;  2OPQ A;  3CYM A;  1L5U A;  5KRT A;  3OYG A;  1FKO A;  3NAE A;  4B9V A;  3L2R A;  2KTQ A;  1FK9 A;  3OYD A;  4CIG A;  1QTM A;  1JLC A;  1C1A A;  1S6P A;  3VQB A;  1RTJ A;  4DTP A;  3PV8 A;  1U47 A;  2F8S A;  4E0D A;  1U4B A;  3NDK A;  4I9Q A;  4F4K A;  2ZE2 A;  3BGR A;  3C6T A;  3QES A;  1T05 A;  3NF7 A;  1VSH A;  4R5P A;  2HHT A;  2HHW A;  5CZ2 A;  3MAQ A;  1J54 A;  4CHP A;  4EP5 A;  3K5N A;  3LAK A;  5KGX A;  4IG0 A;  1XC9 A;  2OA8 A;  3HPG A;  4FJ7 A;  3K5O A;  3ZT3 A;  5FRM A;  2HND A;  4DSF A;  1NOY A;  4KFB A;  2Z1H A;  4CJS A;  3L2Q A;  3LZI A;  3O4Q A;  4CJ4 A;  3NGZ A;  3SQ0 A;  2P5O A;  4IG3 A;  4ELV A;  1VSJ A;  3DLB A;  3LWM A;  3LP0 A;  4J2E A;  3T3F A;  1QE1 A;  4CGJ A;  4HUE A;  5T7B A;  1WAJ A;  3OYA A;  4Z4H A;  3M8S A;  3LP3 A;  4DFM A;  3TAE A;  4FK2 A;  4Z4C A;  1U49 A;  3OYJ A;  4BWJ A;  4J2D A;  4OGC A;  5DMR A;  3ZCM A;  4GMJ B;  2G8W A;  2X74 A;  4RW8 A;  4FLU A;  1HYS A;  1S1W A;  4MQ3 A;  3OYB A;  1TVR A;  1IKX A;  1JL1 A;  2FBY A;  3DOL A;  3OYI A;  2G8H A;  4KB1 A;  4DFK A;  4AHR A;  3RR8 A;  3DMJ A;  4W5N A;  1D9D A;  1DTQ A;  3RRH A;  4J2A A;  3V9U A;  4DLG A;  3B6P A;  3VQ8 A;  3TAB A;  2R7Y A;  2P1J A;  3P1G A;  4KHY A;  3UIQ A;  4DFJ A;  4CEO A;  2OZS A;  2GBZ A;  3LPT A;  3WNF A;  4YNQ A;  4KPY A;  4DSL A;  1RBT A;  3QIP A;  3C94 A;  4NYN A;  4RW7 A;  4H8K A;  2DY4 A;  4LH5 A;  2FBX A;  4DU4 A;  1KFS A;  1CZB A;  3T1A A;  4ELU A;  4B3O A;  4ID1 A;  3QET A;  3TAG A;  2HHX A;  4KRE A;  3QO9 A;  1RBS A;  3V4I A;  2E6M A;  1XI1 A;  3HXM A;  1QS4 A;  4E3S A;  3V9X A;  3ZSR A;  3AVB A;  4AHT A;  1RDC A;  5DK5 A;  3ZSX A;  4FZY A;  3KLG A;  3SUP A;  3CFO A;  3G0Z A;  4GVM A;  4M3Y A;  4I2P A;  1O1W A;  5HRR A;  4M3R A;  1TKX A;  1NKE A;  3DLG A;  1TV6 A;  4H4M A;  3L8B A;  2ATQ A;  1C6V A;  3AVF A;  3NBP A;  4CHO A;  5D3G A;  4M3U A;  4CER A;  2ZQB A;  4CJP A;  2RF2 A;  2YNI A;  4DS5 A;  4IKF A;  1WSE A;  3L3U A;  1REV A;  2Z1J A;  3AVG A;  4KO0 A;  2IC3 A;  4DTS A;  1NJY A;  4CHN A;  3ALY A;  2Y1J A;  2XRI A;  2ZD1 A;  2O4I A;  1A5W A;  3VQ7 A;  1IKV A;  2BDP A;  4CE9 A;  4DTJ A;  4Z0U A;  3OVN A;  1TGO A;  3NGY A;  3VQQ A;  1C0M A;  1ASV A;  4OKJ A;  1EXQ A;  1S5J A;  3DOK A;  3KLF A;  2D0A A;  4WE1 A;  1A5V A;  2KFZ A;  4E7L A;  4FJX A;  2HMI A;  4F3O A;  1HNI A;  1S1U A;  3IRX A;  4M41 A;  1RT7 A;  4YFU A;  3V6D A;  4CJ3 A;  1BI4 A;  4O0I A;  3CG7 A;  4CJK A;  4DQI A;  4FLV A;  3IS9 A;  1HJR A;  1QQC A;  2HHU A;  5HP1 A;  3TAP A;  4RW4 A;  4FM0 A;  5J1E A;  4IDK A;  1BCM A;  1SUQ A;  4O0J A;  1TAQ A;  3V1O A;  3VQ9 A;  3EZ5 A;  4BDY A;  4DSE A;  1NK9 A;  1QSL A;  1JLB A;  2FBV A;  2HHQ A;  4J2B A;  1C0T A;  4N76 A;  4FJL A;  1JLA A;  4E89 A;  3CQ8 A;  3PY8 A;  4DU3 A;  2Z1I A;  3NH1 A;  3SV3 A;  3DM2 A;  3PX6 A;  1R0A A;  1RBR A;  3O4N A;  3AO1 A;  4W5O A;  1SV5 A;  4BE0 A;  4M3X A;  2X6N A;  3AVN A;  5KGW A;  4ZTJ A;  2G8U A;  4QOZ B;  1WSI A;  2XY5 A;  1KSP A;  1RTI A;  3NF9 A;  4RW6 A;  3I8D A;  2BE2 A;  3AA2 A;  3SPZ A;  1L3U A;  4B9N A;  2YKN A;  3AVJ A;  2EX3 A;  3TAR A;  5FRN A;  4PY5 A;  4N56 A;  1DLO A;  1X9S A;  3TWH A;  3SI6 A;  3V81 A;  4CEB A;  5C25 A;  3VQ6 A;  1EKE A;  4H4O A;  1S1T A;  1KCF A;  4FJI A;  4CED A;  4O4G A;  4NCA A;  3OJS A;  4W5T A;  4CEE A;  1WNS A;  4E7K A;  4KHN A;  1RBU A;  1CZ9 A;  4GW6 A;  3AA3 A;  3DRS A;  4KKO A;  3U6F A;  2OPR A;  1C0U A;  3OYN A;  4F8R A;  3O3G A;  1T8E A;  4C8O A;  4FJ8 A;  1UAX A;  3MXM A;  1IO2 A;  4OJR A;  3DI6 A;  1IKW A;  3F9K A;  1WSH A;  1ZBH A;  1HQE A;  3V1Q A;  4JRQ A;  4OPJ A;  1HMV A;  4XIU A;  2IGI A;  3OYK A;  3VA3 A;  3KIO A;  2OPP A;  1A5X A;  3AVC A;  2Y1I A;  3WNG A;  3MED A;  1SKS A;  2P5G A;  1BIZ A;  5I42 A;  3TI0 A;  4EZ6 A;  1XHX A;  2YNH A;  4FK4 A;  3ITH A;  3OY9 A;  1JLE A;  3ZSQ A;  1X1P A;  2NUB A;  3SUO A;  4CEA A;  4E7J A;  3S3O A;  3S3N A;  4FLT A;  2PY5 A;  1VSK A;  1XHZ A;  3KKR A;  1WN7 A;  1HYZ A;  4JS5 A;  4LD0 A;  3OS2 A;  4FCY A;  1RT1 A;  4KV8 A;  1NJW A;  4TSX A;  4FK0 A;  4IBN A;  2D0B A;  5KRS A;  2KFN A;  4E19 A;  4CJU A;  3QEP A;  3DRR A;  3P83 D;  4FJG A;  3HO1 A;  3AVK A;  4K8Z A;  1L3V A;  3D45 A;  3HPO A;  3VA0 A;  4DLE A;  4FZX C;  2DFH A;  2YKM A;  1QSY A;  3AO3 A;  3HST B;  4FZZ A;  2DFE A;  4FW2 A;  2X78 A;  1YVU A;  3VQ5 A;  1T7P A;  2G8V A;  4EP4 A;  3NH0 A;  4C8K A;  1F21 A;  2IAJ A;  3SQ4 A;  3LP1 A;  1KVA A;  3KD1 E;  1NK8 A;  3NE6 A;  3D0P A;  4DTX A;  1EET A;  4B9T A;  5J2N A;  1BHL A;  1RTH A;  3SZ2 A;  5C24 A;  2IDO A;  4CF2 A;  2FC0 A;  3P5J A;  1D9F A;  5JS2 A;  2KW4 A;  4ZTF A;  4M3Z A;  2OPS A;  3QIO A;  3HPH A;  2RKI A;  2YV0 X;  1BIS A;  4I7F A;  4CJT A;  3MEC A;  4CJW A;  1VSF A;  3NH2 A;  3MXJ A;  4FLW A;  4FM1 A;  3RMA A;  4Z4F A;  4KB0 A;  3HK2 A;  3RR7 A;  4PQU A;  1YTA A;  1I3A A;  4Q5V A;  3SNN A;  1TK0 A;  3OYC A;  4HCC A;  1ZYQ A;  3CM5 A;  3HL8 A;  2YNF A;  4OKE A;  1NK5 A;  4FLX A;  2RN2 A;  3LP2 A;  2HVI A;  2YHB A;  3QEW A;  1VK0 A;  4HTU A;  1KTQ A;  4KTZ A;  1MU2 A;  1GOC A;  1FXX A;  1YT3 A;  3KK1 A;  1Q9Y A;  1RT5 A;  4AHV A;  4DFP A;  3KLE A;  1ASU A;  2KQ2 A;  3QNN A;  3RWU A;  5JS1 A;  1TKD A;  1ZBU A;  4NCB A;  2F8T A;  1NK4 A;  1RT2 A;  1RNH A;  3K2P A;  4Y1C A;  1RDB A;  5HRO A;  2XO7 A;  3S3M A;  4BAC A;  4FXD A;  1KLN A;  4JLH A;  4DU1 A;  1UA0 A;  4C8L A;  2KZM A;  3SQ2 A;  3KK2 A;  3AVL A;  4HHT A;  4ELT A;  1I39 A;  3OYE A;  4KHQ A;  3KK3 A;  3VQA A;  4Z4G A;  4N47 A;  3JYT A;  3HP9 A;  4E1M A;  3AVI A;  1J5O A;  1RT3 A;  4RG8 A;  4RW9 A;  4ID5 A;  1IH7 A;  1ITG A;  1GOA A;  3T19 A;  4CJQ A;  4LSL A;  1QHT A;  3LWL A;  3NHG A;  1LWC A;  1RBV A;  2XHB A;  4FLY A;  4DSK A;  1SKW A;  3A2F A;  1W9H A;  3O3F A;  1TK5 A;  3L3V A;  5HRP A;  3MXI A;  2ETJ A;  4E1N A;  3RRG A;  2Q3S A;  4CJE A;  3PX0 A;  1CXQ A;  1HRH A;  2D0C A;  3AA5 X;  3RMC A;  3ULD A;  1BL3 A;  3B6O A;  3L2V A;  2A1R A;  1D8Y A;  4G1Q A;  1CLQ A;  1Z26 A;  1RTD A;  3DLK A;  1UOC A;  3MEE A;  3SV4 A;  2P51 A;  2HW3 A;  3I0S A;  2BGG A;  4M42 A;  1S6Q A;  4F2S A;  3L2W A;  3WNH A;  3SUN A;  2W42 A;  5KTQ A;  1UA1 A;  1KRP A;  2F96 A;  4KI6 A;  4M3W A;  1G15 A;  1HQU A;  3SYZ A;  2JGU A;  4BE1 A;  3QEV A;  1LAW A;  2VWK A;  3AVM A;  4CFA A;  1B92 A;  4CGF A;  4CHY A;  3VQP A;  3OS1 A;  3CFR A;  3QER A;  1SL1 A;  1NK0 A;  2HVH A;  1LW0 A;  4O55 A;  1JXB A;  2PYJ A;  1KLM A;  1JLQ A;  2I5J A;  2QK9 A;  4F2R A;  3HVR A;  1XWL A;  4O5B A;  1LV5 A;  4KHU A;  4FJ9 A;  3KTQ A;  4Y1D A;  2HNZ A;  4CIF A;  1LAV A;  1FKP A;  1VRT A;  1KFD A;  4LY7 A;  4FVM A;  2HHS A;  2A1S A;  4NYF A;  3ISN C;  3ZT2 A;  4W5R A;  3QEI A;  4CF9 A;  2D5R A;  1HPZ A;  1UWB A;  2PYL A;  3CM6 A;  4DMN A;  4HUF A;  4OGE A;  1BI4 B;  2GUI A;  4OLB A;  4KRF A;  1N5Y A;  2G8K A;  4JS4 A;  3V1R A;  4QAG A;  1Q9X A;  3ZT4 A;  3V9Z A;  4IFY A;  4DQR A;  4K8X A;  3KKS A;  4CGH A;  3K57 A;  1SL2 A;  1K6Y A;  3C95 A;  3VQC A;  3DYA A;  1JLF A;  4CFD A;  4UQG A;  1JL2 A;  4CEQ A;  5KI6 A;  3WNE A;  4CJF A;  4NCG A;  4CIE A;  4QCL A;  1EP4 A;  3VQE A;  3QNO A;  1RCH A;  3DLE A;  5FRO A;  4Q0B A;  1J9A A;  3TAF A;  1KVB A;  2O4G A;  2JLE A;  3LDS A;  3VQ4 A;  3OYH A;  1D5A A;  5SWM A;  1LW2 A;  3OYF A;  3AV9 A;  3V9W A;  4DWI A;  2XY6 A;  1LWF A;  4CK2 A;  1S9E A;  2Z1G A;  3JSM A;  4E7H A;  1ZBF A;  2XY8 A;  4FJK A;  1VRU A;  3EY1 A;  4LSN A;  4CF1 A;  1S1V A;  2IOC A;  3LAM A;  1S9G A;  5SZT A;  2PZS A;  4DSJ A;  4AH9 A;  2EHG A;  4DS4 A;  4CEZ A;  3SQ1 A;  4BDZ A;  1CXU A;  5CY4 A;  5CYQ A;  1NKC A;  3PUF A;  3ZSY A;  4LH4 A;  3LAN A;  3FFI A;  3SPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...