4HUGA

Structure of 5-chlorouracil modified a:u base pairs
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 40
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hugA00
1WLJA 1JLBA 3SQ0A 3K57A 4YFUA 1IO2A 1A5XA 4CGIA 4B8AB 4DFPA 1T7PA 1C0MA 1RBVA 1IKYA 3AVGA 3ZSYA 3P1GA 5C25A 3JYTA 4OLAA 4EP5A 4E1NA 1WSJA 4KFBA 4FCYA 2KQ2A 3CFOA 2E6MA 3L2QA 1IG9A 4DSJA 1ZBHA 2FBTA 2F8SA 3OYMA 3TAMA 3D0PA 4E7IA 2KFZA 4L8RB 5KGXA 4Y1DA 4DTRA 2HHTA 1C0UA 3SQ2A 1NK0A 4OGEA 1LWEA 3T3FA 2GBZA 3NFAA 4DSLA 3HP6A 3F9KA 1KFDA 2QK9A 3V9UA 1RDCA 3ZT1A 3JSMA 3V9WA 1HQEA 3MEDA 3S3NA 4M3ZA 5SWMA 3G10A 2YNFA 4CFCA 1S5JA 4BWJA 1UAXA 1U48A 4FK0A 4FM2A 4RW9A 5JS1A 1S9EA 1JL1A 3CG7A 1T03A 4B9SA 3DLBA 1ASWA 3HO1A 1UWBA 3SJJA 1VSLA 3DYAA 3K5LA 4DQRA 1SL1A 4F3OA 4DF4A 3AVIA 1TV6A 3MECA 4KAZA 4M3TA 1RBRA 3IS9A 4CHYA 1YTUA 4DG1A 4DU3A 3QEWA 3O4QA 4CERA 4CGHA 3KKRA 1HYZA 1RNHA 1RT3A 4DTOA 3HXMA 3AO2A 4Y1CA 3AO1A 3OYDA 3V1RA 4Z4FA 2ZE2A 4NYNA 1WSHA 2BE2A 1LW2A 1VSJA 4DMNA 1WSIA 4JRQA 3NGIA 1JLEA 3DLKA 2RKIA 3KJVA 3AV9A 4Z4HA 3MXIA 4OPKA 1LWFA 4G1QA 4B9VA 4FJJA 1VSEA 1ZBFA 4CIFA 4B9TA 3S3MA 3AA5X 3LWLA 5KRSA 3T1AA 4F4KA 3HM9A 3AVKA 4W5TA 3S3OA 3NHGA 4FVMA 3DRPA 4KKOA 5HROA 1D8YA 4FJKA 3KLEA 1TKXA 3V4IA 4IBNA 3DLGA 4IG3A 3AVHA 4CJKA 2AJQA 5FRMA 2KZZA 1L5UA 3LP0A 4B9LA 3QEPA 4CHOA 1LV5A 2IGIA 4KREA 1EX4A 3SV4A 1NK4A 1RTIA 1HYVA 2IC3A 4E3SA 3OYNA 2Y1JA 2IOCA 4CCHA 3ZSZA 4CJEA 1S1XA 2WOMA 3RRHA 3QETA 4R5PA 5HBMA 4KB1A 3DOKA 4AILC 3KKSA 4CK1A 3OYGA 4O0JA 3V9XA 1CZBA 2HNYA 1SL2A 3OYAA 3VQCA 3LWMA 1KCFA 3KK3A 3OS2A 2W42A 4AHCA 2FBVA 4KI4A 1KVBA 4FM0A 1NK9A 2XY7A 1KLNA 4N56A 3CM5A 2G8KA 4CGJA 2QXFA 3O3GA 1GOAA 3B6PA 3VQAA 3M8SA 3QESA 4IKFA 4YNQA 4PY5A 2D5RA 1NOZA 1EP4A 1VSKA 2P1JA 2X78A 1WSGA 2X6NA 1JLFA 4CESA 3NE6A 4FZYA 4KHQA 2DTUA 3OS0A 3THVA 4PQUA 2ETJA 3BGRA 2KFNA 4K8ZA 4M3WA 1QSSA 3TAFA 2PYLA 1NJYA 1SKSA 1L3UA 3L3VA 4FZZA 4JS5A 4CJ4A 3AO3A 4CJQA 4CJPA 3PX4A 3TAQA 4BE1A 3ZSRA 4DLEA 4F2SA 2VG5A 3EY1A 4O44A 3OYJA 1HRHA 1B9DA 3AVBA 2QKBA 1L3VA 4Z0UA 3C6UA 3AO4A 4CF2A 4LY7A 3HP9A 2O4GA 1KRPA 3AVFA 1U47A 4E7JA 4OJRA 3SUOA 1XC9A 3QIPA 4RG8A 4HCCA 4CGFA 2B6AA 4BDZA 4DS4A 1BHLA 4CF0A 3LPUA 1K6YA 4IG0A 5J2PA 2HW3A 3PUFA 1S1WA 4FW2A 3RR8A 3NGYA 3VQ9A 2HHSA 4KTZA 4CEDA 4CJ5A 4FLYA 3LAKA 3V9SA 4NCBA 4KTQA 4GW6A 4ID5A 4C8OA 4F3TA 1C1BA 1RT2A 4W5OA 2PZSA 1BCMA 1VSFA 3L8BA 1LW0A 4DSFA 2HNZA 5FROA 5HLFA 1RT6A 4C8MA 3OJUA 1ITGA 1NJXA 2OPPA 2G8VA 5KRTA 4FJLA 1EXQA 1RDAA 3RMCA 3T19A 4FJGA 4HTUA 1JL2A 4CJWA 1SKWA 1RT7A 1D5AA 3VQPA 3QNOA 1TAUA 3AVCA 3HPOA 3M8PA 4ZTJA 4O5BA 1S9GA 4W5RA 2I5JA 1L3TA 1JLAA 2DFHA 2FC0A 1NJWA 3VQ5A 4I2PA 4F2RA 3ZCMA 4CHZA 4DQSA 2YHAA 4BDYA 5KGWA 1WSFA 3MEGA 4E7HA 3SUQA 2BANA 1QSLA 5EU7A 1RTJA 4UQGA 4DFKA 1NK5A 4J2AA 4IFVA 3DMJA 5J2MA 2G8IA 4DTMA 1SL0A 5HRPA 2G8FA 3LP1A 3OYEA 1VSHA 3CYMA 3V1QA 4OLBA 3K58A 3C95A 4NYFA 1RILA 1JLGA 2BGGA 4IDKA 4Z4CA 2IS3A 4FK4A 1JXEA 2HVHA 4M41A 3HVTA 4LH5A 5FDLA 2HHUA 2HHXA 1N5YA 3ITHA 1S1UA 3TWHA 1A5WA 5CYQA 2OZSA 4KHWA 3V81A 3K5MA 1IKVA 4E7LA 4CEOA 3ZSVA 4KRFA 4HVJA 1C0TA 1YT3A 2RF2A 1R0AA 4CFDA 4QOZB 2DFFA 3D45A 2G8HA 3RR7A 1KVAA 2EHGA 2GV9A 5KI6A 1KLMA 3TAGA 3SPYA 2KW4A 3WNEA 4FJNA 3O3HA 4AHVA 4FJHA 1Q8IA 2XY8A 3NF7A 1TKTA 3DOLA 2Z1IA 1VSMA 1RT1A 4Q5VA 4FJXA 1WAJA 3LPTA 1L3SA 4MFBA 3KLFA 4M3XA 3HSTB 5D3GA 3L2WA 2JGUA 1UOCA 2F8TA 1BCOA 4KTWA 4CEQA 3AVNA 4DSEA 4DTSA 4DTNA 2NUBA 4KB0A 4B9NA 3VQEA 5KTQA 5SZTA 2FBYA 1YTAA 3KTQA 4CFAA 1J5OA 1EKEA 4E7KA 5CY4A 3HJFA 3K2PA 3SQ4A 3RTVA 3MXJA 1W0HA 5K14A 4CK3A 1I39A 2OPRA 3PO4A 3HPGA 3AA4A 3P5JA 4ICLA 4PUOA 3OY9A 3WNGA 4B3OA 1RBTA 3WNFA 1F21A 4O55A 3LP3A 3KK2A 1QTMA 4KHNA 4CK2A 1T8EA 2Q3SA 4CFBA 4ZTFA 3AVLA 2YKNA 4FXDA 2VG7A 1I3AA 3LDSA 4FJMA 1VK0A 2XRIA 3PO5A 1JXBA 2YNHA 4AHSA 4CJVA 3MEEA 3DI6A 1RDBA 3NCIA 3TANA 1XHZA 2X6SA 1T05A 3VA3A 2KTQA 4CEFA 1RT5A 4Q0BA 3VQBA 2KZMA 4ELTA 3LAMA 5JS2A 3L2VA 4BWMA 1QSYA 1U45A 3NBPA 3HT3A 3SNNA 3OYLA 4GMJB 1TKDA 1U4BA 4JRPA 3NGZA 3L2RA 4DLGA 3MXMA 4KI6A 2HB5A 2OPQA 3FFIA 3U3GA 3LANA 3QNNA 2HHQA 4Z4EA 2B5JA 1QE1A 2LSNA 4CF9A 3ZT0A 4ID1A 1DTTA 1S1TA 3V9ZA 3OYIA 4DQQA 2XY6A 1NKBA 3QINA 3OJSA 3M8RA 5T7BA 4C8LA 2XY5A 4DSKA 1NK7A 3SYZA 4FLTA 5HP1A 1BI4A 4CF1A 1ASVA 4KHYA 3KD5E 3H08A 1DTQA 4M3YA 4HHTA 2Z1GA 4C8KA 3HL8A 2OZMA 1U04A 1TK0A 1NKCA 4AHRA 4BDPA 4E19A 1TAQA 1N6QA 2DFEA 4KHSA 3E01A 1RCHA 3HVRA 3IRXA 4HUEA 4BE0A 4DU4A 4H4MA 4AHUA 3SPZA 1SKRA 3DLEA 4Z4GA 4LD0A 3KD1E 4KO0A 2HHVA 5HRSA 2E6LA 5C42A 1DLOA 4ELVA 3I0SA 1YVUA 4K8XA 3HK2A 3AA2A 1MU2A 4OPJA 1FKPA 4I9LA 1RTDA 3TI0A 4JS4A 2JLEA 4CJTA 4FYDA 4CJRA 2F96A 1KVCA 4O0IA 4FK2A 4I2QA 1KTQA 2Y1IA 4FJ5A 1X9MA 2ATQA 1QS4A 3QEVA 4GVMA 1RBUA 3G0ZA 1BL3A 1O1WA 3A2FA 4E89A 4CHQA 4HUGA 2PY5A 2DY4A 2BDPA 3HPHA 3QIOA 1B9FA 1QQCA 5CZ1A 1TL3A 2IAJA 1A5VA 3EZ5A 3NDKA 4CECA 3V6DA 3PV8A 3ZT4A 4DWIA 2IDOA 3DM2A 3CFRA 1ZBUA 3SUNA 4LSNA 4TSXA 4H4OA 3KIOA 2O4IA 2ZD1A 1VSIA 4MQ3A 2YHBA 3ISNC 3LP2A 3CM6A 1S6PA 1S1VA 3M8QA 5DK5A 3TAEA 1BQMA 2G8WA 1NOYA 4NCAA 2ITGA 4CJFA 2RN2A 1RBSA 3ZT3A 3SZ2A 4DTUA 2B4JA 1ZBLA 3K59A 3SCXA 4F8RA 3K5NA 1KFSA 4PA1A 1ASUA 1IH7A 2Z1JA 3KLGA 4OVLA 4OGCA 3NH0A 3RRGA 1ZYQA 2R7YA 3NF9A 4B08A 2XHBA 4OKJA 3SI6A 5I3UA 4FLXA 1NKEA 3AA3A 4J2BA 1WAFA 4O4GA 1BIZA 1KSPA 4FW1A 4RW4A 2YNGA 4CEZA 3NF6A 1UA0A 4EZ6A 2GUIA 4RW7A 1BI4B 4DTXA 3B6OA 1BQNA 3QLHA 4QCLA 1LAVA 3SV3A 5CYMA 1HNVA 4B8CA 1J54A 1U49A 4DFMA 1WNSA 2RPIA 4DF8A 3AVAA 1Q9XA 3VQ7A 4ZHRA 3OVNA 4BE2A 3TARA 3I8DA 1UA1A 3DLHA 4FJIA 4AH9A 4W5NA 2P51A 1XWLA 2FBXA 4FJ9A 3TAPA 4FZXC 4CJ3A 4OKKA 4CJSA 1CZ9A 3NF8A 5E41A 1B92A 1JLQA 4KV8A 4H8KA 4M3RA 3CQ8A 4AHTA 4CHPA 4HUFA 3RMBA 3IG1A 2WONA 1FKOA 4RW6A 4CEBA 1D9FA 4CEEA 5I42A 4HCBA 3L2UA 4W5QA 5DMRA 3VQ4A 3DRSA 2YV0X 1REVA 4FLVA 4WE1A 2OA8A 2XO7A 4RW8A 3NH1A 3SQ1A 4DS5A 1SUQA 4PWDA 1HYSA 1Z25A 3BDPA 2D0AA 2QKKA 1JLCA 4FM1A 1RTHA 1JKHA 4BACA 4J2DA 1BISA 2OYQA 1IKWA 3KK1A 1C1CA 3PX6A 2ZQBA 1FK9A 3UIQA 1TL1A 3QO9A 1VRTA 4DTPA 3LZJA 4B9MA 3OS1A 4JLHA 2E4LA 2A1RA 4CIEA 3VQQA 1HNIA 3I0RA 3AO5A 3KLIA 3PY8A 3ULDA 1XHXA 3ZSWA 4CE9A 2HHWA 3DRRA 2P5OA 4DQIA 3RWUA 3L3UA 4QAGA 1RDDA 2EX3A 3F73A 4FLWA 2PYJA 1CLQA 1D9DA 3HYFA 3WNHA 1G15A 4CJLA 1X1PA 3OYFA 2HMIA 1Y97A 3TR8A 4DFJA 4I7FA 3QERA 2VWJA 1BGXT 3C94A 4OKEA 3P83D 3C6TA 3VN5A 1QHTA 4M45A 4E0DA 3NH2A 4FLUA 4CF8A 3EYZA 5HRRA 4N47A 4DU1A 2P5GA 1ZBIA 1C6VA 1EETA 1SV5A 3VA0A 1VRUA 4M42A 5HRNA 1WN7A 3VQDA 1TVRA 2A1SA 2D0CA 2HVIA 3ZT2A 1HJRA 4XIUA 3IAYA 1Z26A 4M3UA 3ZSQA 3ASMA 5J2NA 1HMVA 3MAQA 4CGGA 3OYBA 3K5OA 4LSLA 4KPYA 4N76A 5J2QA 3LALA 1Q9YA 1J53A 5J1EA 4DSIA 1TK8A 3CFPA 1TGOA 3OYCA 3PX0A 2YNIA 4EZ9A 2G8UA 1TKZA 4NCGA 5C24A 5CZ2A 4C8NA 2VWKA 1FXXA 4DQPA 1WSEA 4IFYA 4FLZA 3AVMA 1W9HA 1HQUA 3VQ8A 1HPZA 2YKMA 2Z1HA 1LAWA 1LWCA 3ALYA 3OYHA 3NAEA 1C1AA 3OYKA 3RMAA 2HNDA 1NK8A 4CEAA 4B9UA 3RMDA 4FJ7A 3ZSOA 4Z4IA 2D0BA 3O3FA 4CGDA 3QEXA 1BIUA 3TABA 1NJZA 2OPSA 2X74A 1X9SA 1X9WA 4J2EA 3LZIA 3U3YA 1GOBA 4N41A 1J9AA 4LH4A 4CJUA 3U6FA 1IKXA 4KHUA 3VQ6A 4FJ8A 3KLHA 1GOCA 2VG6A 3QEIA 3AVJA 1CXQA 4N5SA 4I9QA 3SUPA 1XI1A 1S6QA 4DTJA 4EP4A 4CHNA 5FRNA 3V1OA 3DLRA 4CIGA 1RT4A 1VSDA 3O4NA 1TK5A 3S9HA 3ZSXA 1NK6A 4E1MA 4ELUA 1CXUA
chains in the Genus database with same CATH superfamily
3SQ0A 4FWMA 4H5RA 4IDHA 2CGLA 4JKEA 1IO2A 1A5XA 2RE2A 5KPRA 4DFPA 3AVGA 1IKYA 3VGLA 1TYQA 1DKGD 2P9UB 1OKJA 3HM8A 3SBTA 4FCYA 3L2QA 3QMLA 3HOSA 5AQFA 3H6EA 3TAMA 4JI1K 5KGXA 2YJFA 3QBXA 3K0SA 4DSLA 1YHQN 4BC4A 2QK9A 3ZETB 4FWPA 3V9UA 3S3NA 3WQUA 3M3ZA 1FW6A 5SWMA 2YNFA 4BRGA 3PSIA 4FM2A 4FK0A 4RW9A 4B1YB 5JS1A 1JL1A 1ASWA 4BREA 2O8CA 4YOYA 4FWLA 4M7YA 4CBUA 1QZ6A 4JI8K 3VETA 4DU3A 3O4QA 4H0OA 4U7BA 1RNHA 4DTOA 4Y1CA 3AO1A 4BC3A 1X3MA 3OYDA 1NGCA 2ZE2A 1WSHA 2BE2A 3NGIA 3MXIA 1Z6RA 4GVEA 1KXPA 3EE8A 2P9NA 4G1QA 3R6MA 4FJJA 1ZBFA 4CIFA 5AQNA 3S3MA 3LWLA 4JK7A 3THXA 4CD1A 1KC8O 3THYB 1MA9B 3AVHA 3ZX0A 4DB3A 3WXKA 2KZZA 3EKSA 4CZFA 1LV5A 2IGIA 3VESA 4GV9A 4QS8A 1VQ5N 3RRHA 5AQRA 5HBMA 4AILC 3W3DA 4FWOA 3EE9A 2VYPA 1SL2A 3OYAA 3VMFB 4LC9B 3D2FA 1KVBA 4FM0A 1NK9A 1KLNA 4FWKA 2QXFA 2IVNA 3D2EA 1K8KA 4PY5A 2D5RA 3Q7BA 3J8AA 4KHQA 4JI2K 3CMEN 4FZYA 2V7YA 2DTUA 5ELZA 3THVA 3O4WA 3EZWA 1EQYA 2KFNA 1MWMA 1L3UA 1V4TA 3WXJA 3C6HA 3SK3A 4CJ4A 3PX4A 3TAQA 3T7ZA 4BE1A 4DLEA 1HLUA 3AO4A 4LY7A 1Q82O 2O4GA 3AVFA 5C2FA 3SUOA 2B6AA 2KLAA 2HW3A 3RR8A 4FW2A 4KTZA 4CEDA 4NCBA 4GW6A 4ID5A 4C8OA 4FSVA 2PZSA 2QEXN 5HLFA 2HNZA 1RT6A 4C8MA 5JLFA 3DLLL 2NRZA 4FJGA 3CXCM 3HBTA 1RT7A 3VQPA 3AVCA 4IO8A 3HPOA 4O5BA 2I5JA 2DFHA 4I2PA 4F2RA 2YHAA 5KPZA 5BR9A 1NGAA 4BDYA 4DFKA 1RTJA 4UQGA 4JKGA 3H45C 3DMJA 4DR2K 1SL0A 2Q1NA 4OLBA 4NLCA 1RILA 1JLGA 3MCPA 1XQSC 2IS3A 4M41A 2HHUA 2HHXA 3CHWA 2P9PB 4CZHA 2OZSA 3I33A 4KHWA 3V81A 1IKVA 1GLBG 4E7LA 5F2RA 4R79A 4KRFA 2A42A 4CZEA 3UKRA 2RF2A 4QOZB 5CR4A 2G8HA 2EHGA 1VQON 5KI6A 1KLMA 3TAGA 4FJNA 4HWIA 4B1XB 3DOLA 3M5RA 4Q5VA 4JHDB 1L3SA 3L2WA 3I55N 3AVNA 2HF4A 4DTNA 3ID6A 5KTQA 3CJBA 4CFAA 4E7KA 4BR4A 5CY4A 5A2QO 3RTVA 4CK3A 1VQ6N 3PO4A 4FPBA 2DPNA 5BPLA 4DR5K 3KK2A 1F21A 4KHNA 4CK2A 4LF5K 3CCRN 4FXDA 3RVCA 3CI5A 1CXUA 3FZHA 4A62A 4WFAL 4FJMA 4DCHA 3NCIA 2X6SA 1G99A 5AQYA 1T05A 3A5MC 3VA3A 4Q0BA 2KZMA 4ELTA 1QSYA 3CC2N 1U45A 3ATVA 5KPTA 3SNNA 1TKDA 3MXMA 2HB5A 4OO1J 3FFIA 3U3GA 3DXKA 3HK2A 4CF9A 1DTTA 1S1TA 5AQGA 3NMUA 4DQQA 4B3TK 5T7BA 1YJ9N 3IKMA 1ZBSA 5GADP 3CD6N 3VEWA 3VF4A 1Q81O 3SYZA 1NMNA 1ASVA 2HSTA 3KD5E 1YIJN 3O6WA 5DM6L 3VEXA 5LY3A 3HL8A 3CCEN 1NKCA 1TAQA 1VQ9N 4KHSA 1RCHA 5AJ3K 3HVRA 3SPZA 3SLCA 3DLEA 2O8EB 5AR0A 5M1PA 1YVUA 5GINA 4OPJA 1FKPA 2NRWA 3R3LA 4A5AA 4AM7A 5C15A 5AFUA 3CCUN 4MDBA 2O8BA 4FJ5A 1BOTO 5C0YA 2ATQA 4B9UA 3G0ZA 3W0LA 1HNXK 5FPMA 4NXNK 1QQCA 2IAJA 1A5VA 4OPAA 3SUNA 3ENBA 4TSXA 3TTFA 4JI4K 3KIOA 2YHBA 4DR1K 3LP2A 1S1VA 3TAEA 2G8WA 1BQMA 1NOYA 5JLHA 3GL1A 4BRFA 3TTCA 3S41A 4CJFA 4JI7K 2RN2A 1RBSA 3SZ2A 4DTUA 1W7AA 4JI0K 4PA1A 1S72N 4OVLA 1ZYQA 3SI6A 4OKJA 5JVHL 4O4GA 2CH6A 1VAZA 1UA0A 4EZ6A 4MO5A 3CJAA 4DTXA 1T6CA 3J80O 3TTDA 3B6OA 3QLHA 1LAVA 1HNVA 3AVAA 4RCHA 3PLAA 3TARA 3I8DA 3DLHA 5EXWA 1XWLA 2FSJA 4WF9L 4OKKA 3NF8A 5E41A 1JLQA 3CPWM 4M3RA 1T3VA 4CHPA 3RMBA 4RW6A 1D9FA 3D7EO 4CZJA 4B3RK 3VQ4A 1XNQK 1REVA 1Z25A 1HNWK 1NGBA 1X9JA 4AQYK 1HPMA 1BISA 2OYQA 1IKWA 3O08A 1C1CA 4K43A 5AQUA 3KK1A 4IEIA 2E4LA 5AZIB 1QHAA 3ZX3A 3ULDA 1XHXA 4CE9A 3U9ZA 3DRRA 1BUPA 1CLQA 4EHTA 3HYFA 3WNHA 3DXMB 1G15A 1X1PA 4LF6K 4IJAA 3P83D 1V4SA 5CHIA 4CF8A 2JWKA 1SV5A 2A1SA 3MCAB 4M3UA 5IT9O 5J2QA 4FWSA 5J1EA 4DSIA 1TK8A 1OH7A 3MN5A 3O9RA 5KQ8A 1N32K 4X62K 5CZ2A 1JJ2M 3SAHA 4DQPA 1WSEA 5LMUK 3K9KA 4FLZA 1HPZA 2Z1HA 1LWCA 3ALYA 2HBLA 2NZTA 4CEAA 3RMDA 3ZSOA 3O8MA 1BIUA 2GEMA 1X9SA 2X74A 3CJ1A 3WQTA 1X9WA 4J2EA 2HBMA 5BRDA 3U6FA 3VQ6A 4FJ8A 3QEIA 2VG6A 1CXQA 3SUPA 1XI1A 3B8AX 2F4VK 3DLRA 3O4NA 4BRCA 1Q18A 3GG4A 4E1MA 4C23A 5ADXH 2ZM6K 4YFUA 5AQHA 4B8AB 3ULEA 1T7PA 4WCEL 5C25A 3JYTA 3P1GA 2NRRA 3IMXA 4EP5A 4E1NA 4KFBA 3CFOA 3KWGA 2E6MA 4DSJA 3D0PA 5FPEA 2KFZA 3LDLA 4L8RB 4CBXA 4B1UB 4JNEA 4PL7A 3SQ2A 1NK0A 1LWEA 3F9KA 3LDNA 1HX1A 4BR9A 1IG8A 1NMDA 4IOXA 3JSMA 1HQEA 2P9SA 4XH5A 2O8FA 5HL7L 3SJJA 1VSLA 3DYAA 4F3OA 4M3TA 1RBRA 1YTUA 3JXUA 3FZFA 2GWKA 2QW9A 3H3OB 3KKRA 1HYZA 1JCGA 3AO2A 3V1RA 4Z4FA 2V7ZA 3VGMA 3PIPL 1LW2A 3EN9A 4JRQA 3DLKA 3IFRA 4Z4HA 1VSEA 4B9TA 4ILJA 3T1AA 3HM9A 3AVKA 1ATSA 4W5TA 4KKOA 5HROA 1TKXA 4JKCA 1XNRK 4JD2A 3V4IA 4CJKA 2AJQA 4BQZA 4CHOA 1NK4A 3L6QA 1RTIA 4CCHA 4E3SA 3ZSZA 1TYQB 3ID8A 2WOMA 1BWFO 3KK7A 3OYGA 2E5LK 4IOAL 3VQCA 1BDGA 3LWMA 3KK3A 4BGBA 2FBVA 2VGNA 2XY7A 4B3SK 3FE1A 4FWQA 1GOAA 3VQAA 4BR0A 4JI6K 3CCJN 2P9KA 2X78A 4CESA 4EFHA 1JLFA 3P4IA 5LJWA 4LF8K 4PQUA 1NLVA 1KQSM 3TAFA 1SKSA 2O8CB 1QVFM 3FZKA 4JS5A 2OANA 4B1VA 2VG5A 3EY1A 4O44A 2YJEA 3OYJA 1HRHA 3AVBA 4JN4A 3GOIA 3I8BA 4Z0UA 4CF2A 3C7NA 1U47A 1K8AO 4OJRA 5BRHA 3QIPA 2HOEA 3JAMO 4CF0A 4DV3K 3KVGA 1S1WA 2P9NB 2Q0RA 1RGIA 3V9SA 4FLYA 4F3TA 4KTQA 3UB5A 3THXB 1RT2A 4V19S 1LW0A 1E4FT 4DSFA 3OJUA 1NJXA 2OPPA 4MLEA 4FJLA 3RMCA 4HTUA 4CJWA 3QNOA 2KHOA 3M8PA 1YJWN 5BN8A 3O1WA 4YDUC 3J7AP 4BRAA 4H5TA 3ZLJA 4CHZA 1R59O 4ISEA 3MEGA 5AFUH 3SUQA 2BANA 2EWSA 5EU7A 3TSUA 3G25A 4J2AA 4IFVA 2G8IA 4DTMA 3D2FB 5HRPA 1VSHA 3CYMA 3V1QA 3P39A 1BG3A 3D2EB 1K8KB 4Z4CA 4FK4A 1I94K 4CVNE 1N5YA 3ITHA 1S1UA 3IUCA 5CYQA 3MMVA 2F9TA 3K5MA 1NBWA 1XMQK 3T1HK 2QWNA 3DAWA 4HVJA 4FWRA 4CFDA 2DFFA 3D45A 3O9UA 5GAEP 1KVAA 3QFPA 2GV9A 3BF1A 1J6ZA 3WNEA 4AHVA 2Z1IA 4NXMK 4MFBA 3O80A 4KB0A 2NUBA 4B1ZA 4B9NA 3VQEA 2FBYA 3BZKA 1YTAA 4OX9K 2PAVA 1EKEA 4CZLA 4KH4A 3SQ4A 3MXJA 1W0HA 2WFBA 1TUUA 3AA4A 4ICLA 2HHHK 4B3OA 4O55A 5TKWA 3LP3A 4FVUA 1T8EA 4CFBA 2OCEA 3AVLA 4KH6A 4JKGB 3LDSA 1VK0A 2XRIA 3CQXA 3PO5A 1JCEA 1RDBA 3P38A 1XHZA 1E4GT 2E88A 4CD3A 2KTQA 1RT5A 3VQBA 5AQZA 3LAMA 1NJIO 3L2VA 2BTFA 3NBPA 4J8FA 4MLHA 1U4BA 4PKHA 3L2RA 1KAZA 2OPQA 3QNNA 3LANA 2YHYA 4Z4EA 2B5JA 1QE1A 3V9ZA 4DWIA 3UKRB 4K42A 3QINA 3OJSA 1U6ZA 4DSKA 1BI4A 3I56N 3H08A 3VF6A 2Z1GA 4YOVA 2A3ZA 1TK0A 2P9IA 4E19A 3EO3A 2DFEA 4HUEA 3IRXA 4H4MA 4Z4GA 1QQOA 2ZJRL 4BQLA 5C42A 1HR0K 1BU6O 1DLOA 4ELVA 4LF7K 1RTDA 3TI0A 4H0XB 4JS4A 4CJTA 3L0QA 5EX5A 2ZGYA 4I2QA 1KTQA 2Y1IA 1QS4A 3J7YP 1BL3A 1O1WA 3A2FA 2PY5A 4OPHA 5CZ1A 3PV8A 3EZ5A 3ZT4A 4EAHD 1ZBUA 2E1YA 4H4OA 2GTDA 4AM6A 4YDUA 2ZD1A 1VSIA 4MQ3A 3ISNC 1S6PA 2VWBA 5DK5A 5BPNA 4NCAA 4GY2B 3VEOA 1IJJA 2OTJN 3MK6A 4CJ7A 5JICA 2W6LA 2B4JA 1LOTB 3K59A 3BP8A 3SCXA 3K5NA 1IH7A 3DXKB 4LF4K 3NF9A 2XHBA 1S22A 3IDHA 4ILHA 4FLXA 1NKEA 4J2BA 1WAFA 5AQJA 1BIZA 2YNGA 4H0PA 2GUIA 2A40A 3AGKA 1C0FA 3SV3A 4QCLA 4DFMA 2I7PA 1WNSA 2RPIA 2I7NA 4FL9A 4FZXC 2GWJA 2QI2A 1NM1A 4KV8A 3JS6A 2YX6A 4AHTA 2WONA 3TPQA 2NNWA 4WQ4C 5I42A 4HCBA 2O8BB 3DRSA 2YV0X 2QXLA 2XO7A 2QA4N 4K41A 3OBWA 1O13A 1W97L 2ZWHA 2QKKA 4WQ5C 1TUYA 5M1FA 1N36K 2ZQBA 1FK9A 3QO9A 1VRTA 1HUXA 3O1BA 4CIEA 4DV2K 5FPNA 1HNIA 3I0RA 5AQKA 3ZSWA 5AQXA 4YOXA 4M42A 3UKUA 2PYJA 1D9DA 2Q97A 2WUSA 4CJLA 3CPEA 2HMIA 3QERA 2VWJA 1OH5A 1QHTA 3M1FA 4GKKK 2CH5A 1C6VA 4BR2A 4BGAA 3VQDA 2D0CA 2D1KA 1KD1O 4XIUA 3RSEA 1D4XA 3F9MA 3TU5A 2F9WA 1X3NA 3ASMA 5J2NA 1NGEA 3MAQA 4C1NK 4N76A 1Q9YA 3U4LA 3HOTA 3CFPA 3PX0A 3OYCA 5FLXO 3THWA 2CGJA 2G8UA 1WBBA 5C24A 4C8NA 2BUPA 4DV1K 3AVMA 1W9HA 4GV3A 4AF1A 3OYKA 3RMAA 4FJ7A 4H0TB 4Z4IA 4CGDA 1NJZA 3QB0A 4K25A 4B1WB 4RWTA 1N34K 1GOCA 3AVJA 4I9QA 3WUHA 2D0PA 4DTJA 4CHNA 5FRNA 1VSDA 1TK5A 1NK6A 2QWMA 4ELUA 4PHTX 1JLBA 2ZJQL 1XUPO 2IVOA 4CGIA 3VOVA 1C0MA 3ZSYA 3QFUA 4DUYK 3ZEUA 3VENA 3G71N 1WSJA 3KZBA 2KQ2A 1ZBHA 2P9LA 3OYMA 4E7IA 1M1KO 1GLJO 3QBWA 4Y1DA 4CZIA 3NFAA 4IXCA 4CZMA 3WEEA 1KFDA 3ZT1A 4A5BA 3MEDA 4JKBA 3G10A 1S5JA 1NWKA 1U48A 2Q31A 4YORA 3AAPA 3DLBA 3HO1A 1UWBA 1IBMK 4JI3K 3K5LA 4DQRA 4KAZA 3AVIA 3MECA 3IS9A 4GV6A 4K0KK 3FZMA 3AGRA 4CGHA 3O9SA 3HXMA 4WQ4A 3GBTA 3EKUA 1VSJA 2ZJPL 4DMNA 1LCUA 3NVMA 1JLEA 2RKIA 3KJVA 3WXMB 4OPKA 2E2NA 2YCHA 3AA5X 3ENHA 4WQ5A 5KRSA 4F4KA 5I9EB 2QWQA 3NHGA 3DRPA 1D8YA 4FJKA 3KLEA 2HBKA 2O8DA 4H0YB 3M6GA 3DLGA 4CW7B 2WBNA 2NRXA 5FRMA 3LP0A 4B9LA 5CE3A 1IV0A 3ULEB 1EX4A 3SV4A 1HYVA 3OYNA 2Y1JA 4GKJK 5GAGP 1S1XA 3DOKA 3KKSA 3MWTA 4CK1A 4O0JA 1Z05A 3V9XA 1YVNA 2HNYA 3HTVA 2ASMA 2W42A 3OS2A 4KI4A 2G8KA 1NNEA 4N56A 5M1QA 3HZ6A 4BVPA 3O3GA 3B6PA 2AA4A 4IKFA 1EP4A 1NGIA 1VSKA 2P1JA 1WSGA 2P9SB 3E9LA 2W40A 4JAXA 2ETJA 2OTLN 3BGRA 3CC4N 2O8FB 2PYLA 1NJYA 3L3VA 4FZZA 4CJQA 3ZSRA 4IJNA 4X65K 1Q86O 5AQLA 1L3VA 3C6UA 3HP9A 1KRPA 4E7JA 3NVKA 4HCCA 4RG8A 4CGFA 4DS4A 4A59A 1U2VA 4FWNA 4B9QA 2PFUA 3NGYA 3VQ9A 2HHSA 4A2BA 4DR4K 3O9QA 1HKBA 1C1BA 1BCMA 3L8BA 1GLAG 2KKZA 4JD2B 3N4QA 2G8VA 5KRTA 1NGJA 1JL2A 1SKWA 1YUWA 1TAUA 4CI6A 1DGKN 2FC0A 1NJWA 3VQ5A 1QSLA 5DM7L 4E7HA 1WSFA 1HNZK 5J2MA 3K9JA 3LP1A 3VEVA 3OYEA 1J5EK 4PKGA 2WTUA 2NRVA 3C95A 4NYFA 2YHXA 3VERA 2BGGA 4YOTA 4LFBK 4IDKA 3VTHA 2P9KB 1Y64A 2HVHA 4DR6K 4LH5A 5FDLA 1QQNA 4O5FA 3TWHA 1A5WA 1Q7YO 1YAGA 3D6RA 3ZSVA 1NGHA 1C0TA 2ITMA 5AQVA 3RR7A 3WXLA 2D0OA 3FR0A 3AARA 3KHYA 4DHYA 3C7NB 1NU0A 5AQTA 3SPYA 2E8AA 1KAXA 4BRDA 4IWVA 3NF7A 1QQMA 2XY8A 5C12A 1TKTA 1RT1A 3QDKA 1WAJA 5D3GA 3KLFA 4M3XA 2A5XA 2UYTA 3A5LC 4CEQA 5SZTA 4O8UA 2NRHA 1J5OA 5EY4A 1T6DA 3HJFA 4XEIA 4XH1A 5K14A 3SAFA 3MX5A 3HPGA 3P5JA 4C1NI 4PUOA 2FSNA 5TKYA 1RBTA 1S3XA 3WNFA 3AY9A 1QTMA 5EOYA 4BRMA 4ILGB 3C0BA 4ZTFA 2VG7A 1I3AA 1VQLN 3L4QA 3EL2A 1JXBA 3FFKB 2YNHA 4AHSA 4CJVA 3DI6A 1OH6A 5JS2A 4YY3K 3E1YA 3F5TA 3OYLA 4GMJB 3FLCO 3G6EN 2YHWA 4DLGA 4KI6A 1YI2N 3H46O 2LSNA 2XY6A 3ZT0A 3OTOK 3M8RA 1WB9A 5E26A 3U9DA 3CF5L 1YXQA 4H5VA 1NK7A 3ENOA 4CF1A 2GX9A 4KBOA 2E1ZA 4JEPA 1DTQA 5AZJA 3ZYYX 1MWKA 2OZMA 5B8HA 4AHRA 4BDPA 3E01A 4BE0A 4JV5K 4BRLA 4YOWA 2HHVA 5HRSA 2E6LA 3A5NC 3CMAN 4K8XA 3AA2A 4CZGA 4I9LA 2UXBK 2JLEA 3VPZA 3N4PA 4YHHK 1N8RO 2F96A 4O0IA 4FK2A 3A8YA 3VEZA 4E89A 4HUGA 3QEVA 4F2SA 4CHQA 4G9ZA 2DY4A 3UE5A 2BDPA 1B9FA 1SS6A 1TL3A 3NDKA 4MO4A 3V6DA 4CECA 4FOIA 4QS9A 3M8QA 4I6MA 3LDOA 4F8RA 3HI0A 1KFSA 1ASUA 5KQDA 4LFCK 4B08A 3CJ7A 3AA3A 5BPMA 3CCLN 1KSPA 4BY9C 4FW1A 4RW4A 4WFNL 4CEZA 3NF6A 1YF5L 1BI4B 5AQWA 5AQOA 4DV4K 1BQNA 1HJOA 5CYMA 1J54A 2P9IB 4DF8A 4BRIA 3R9PA 1Q9XA 4ZHRA 4FJIA 1ZXOA 4BE2A 3DJCA 4AH9A 4W5NA 3WT0A 3VEYA 4FJ9A 3TAPA 4CJ3A 1CZ9A 1OVYA 1MDUB 1B92A 1P90A 4H8KA 3CQ8A 1ATNA 4HUFA 3U8XA 3TSQA 4QS7A 4CEEA 1P8ZA 4W5QA 4FLVA 4JKFA 2OA8A 1VQ8N 1SUQA 4PWDA 1HYSA 4JK8A 4FM1A 1JKHA 4J2DA 1GLDG 3PX6A 3UIQA 1TL1A 3DWLA 4HTLA 4DTPA 5F0XA 3OS1A 1M90O 2A1RA 1CZAN 3KLIA 3PY8A 4DQIA 3RWUA 3L3UA 1RDDA 2EX3A 3F73A 4FLWA 4PKIA 3WXIA 2ASPA 4X64K 3OYFA 3TR8A 5C2DA 1BGXT 3C94A 4OKEA 1WUAA 3C6TA 4IZ9A 3VN5A 4M45A 2P9UA 5HRRA 1ZBIA 4MDAA 2PBDA 3CERA 5BRFA 4JKAA 1WN7A 3MN6A 3VF2A 2HVIA 2FLOA 1HJRA 3O5BA 1Z26A 3CQYA 4CGGA 3ZETA 3K5OA 3OYBA 4KPYA 2GELA 3LALA 5BN9A 3SMSA 1GLEG 2VWKA 4H0VB 3H3NO 3CJ9A 2ZF5O 3VQ8A 2HNDA 5BR8K 4M63C 2VQEK 4BR5A 3O3FA 3QEXA 3VGKA 4CZKA 3LZIA 4ISGA 5IWAK 3U3YA 1GOBA 4LH4A 3BY5A 4CJUA 2UUAK 4KHUA 5ADXA 4N5SA 5GIPA 1S6QA 2VGMA 3L4IA 3OBYA 2QTDA 2NLXA 3V1OA 1BA0A 3S9HA 3ZSXA 1KAYA 3UKUB 3THYA 3LDQA 1DT9A 1WLJA 1VHXA 3K57A 3CCVN 3R8EA 2A6AA 3VTIA 3CC7N 4EHUA 1RBVA 4OLAA 2QM1A 1ILYA 3QICA 3KWIA 1IG9A 2FBTA 2F8SA 1VQMN 2E2PA 4DTRA 1IBLK 1C0UA 3ZX2A 3RSEB 4OGEA 3T3FA 2GBZA 3GDQA 3HP6A 3V9WA 1RDCA 1RDUA 4M3ZA 5M1KA 4CFCA 4BWJA 1UAXA 3THWB 1S9EA 4H5WA 4H03B 3CG7A 1T03A 4B9SA 3J7ZO 4DV7K 1SL1A 5H1SQ 4DF4A 1TV6A 1YITN 4CHYA 4DG1A 3QEWA 4CERA 1RT3A 3P31A 4NYNA 1VQ7N 3T1YK 1WSIA 2Q2RA 5E84A 3AV9A 5C10A 1LWFA 3LL3A 4B9VA 1ESVA 4NB4A 4WFBL 1RDWX 5M1NA 4DV0K 3S3OA 4FVMA 2HMPA 1E3MA 2GUPA 1VQNN 5LJVA 4IBNA 4IG3A 5JMVA 1L5UA 3QEPA 2VQFK 4KREA 2IC3A 2IOCA 2FSKA 4CJEA 2Q36A 3ZEUB 2UU9K 3QETA 4R5PA 4KB1A 1QZ5A 1CZBA 2P9LB 2E2OA 2Q0UA 4WYBA 1KCFA 4DV5K 2IVPA 4AHCA 4BR7A 2AP1A 4BRPA 1ZC6A 3CM5A 3WEEB 4CGJA 4B3MK 3M8SA 3QESA 4YNQA 1NOZA 4FJXA 2X6NA 3NE6A 3OS0A 3BEXA 2P9PA 4K8ZA 2ASOA 1QSSA 4M3WA 2HF3A 5LL6Z 2IIRA 2QWLA 3AO3A 4CJPA 2QWPA 1B9DA 2QKBA 3OHRA 3HRGA 1GLCG 1XC9A 4FO0A 4JKDA 4BDZA 3SAGA 1BHLA 3LPUA 1K6YA 4IG0A 3CIPA 3AAQA 1DEJA 5J2PA 4JHDA 3PUFA 3C65A 4CJ5A 3LAKA 2FXUA 3LM9A 4W5OA 1VSFA 4XH4A 2O8DB 5FROA 2RHKA 2UXCK 3PIOL 1ITGA 1EXQA 1RDAA 1RFQA 3MN9A 2UXDK 3T19A 5AQMA 1D5AA 2E20A 1EO1A 4ZTJA 1S9GA 4W5RA 1L3TA 1JLAA 3J81O 3ZCMA 4BRHA 4DQSA 2HHTA 5KGWA 1QVGM 3FZLA 1NK5A 2G8FA 4BC5A 3K58A 2W41A 3BZCA 4CBWA 1JXEA 1BA1A 3HVTA 1EWQA 4A2AA 3G4SN 2H3GX 4E1JA 4H5NA 4BRNA 3O9TA 4CEOA 3CETA 1YT3A 1R0AA 1GLFO 2A41A 2UUBK 4BVOA 5FPDA 1OH8A 2KW4A 4FPAA 3O3HA 4FJHA 1Q8IA 3H1VX 3SMPA 1U2VB 1VSMA 4DV6K 4BC2A 3LPTA 3HSTB 2JGUA 1UOCA 2F8TA 1BCOA 4KTWA 4A57A 4DSEA 4DTSA 2O8EA 3LM2A 1HKCA 3KTQA 2ZGZA 5EVZA 3K2PA 3LDPA 1I39A 2OPRA 3A5OC 2J4RA 3OY9A 3WNGA 2YI1A 1YJNN 2Q3SA 3TSPA 4DUZK 2NRTA 2YKNA 4DR7K 3MEEA 3TANA 4BRQA 3BUZB 4PL8A 4CEFA 4BWMA 2FF6A 5BREA 3HT3A 1FJGK 4JRPA 3NGZA 3FGUA 2HHQA 1JCFA 4BG9A 1VQKN 4ID1A 2P5OA 3OYIA 1NKBA 4EIAA 2WC9A 4Y0WA 4IOCL 1WOQA 4JKHA 2XY5A 4FLTA 5HP1A 4KHYA 3BF3A 3E66A 1XMOK 4M3YA 4NLBA 4HHTA 3E9PA 4C8KA 5GIOA 5F1XA 2QWRA 1U04A 2FF3B 4LF9K 1N6QA 4IFEA 2F7TA 2V51B 4DU4A 4AHUA 1SKRA 1NGDA 4LD0A 4GNIA 3KD1E 4KO0A 4DKWA 3I0SA 3CCMN 1MU2A 3F2KA 4NO7A 4Z94A 4FYDA 4CJRA 3CCSN 1KVCA 1X9MA 4GVMA 1RBUA 3HPHA 3QIOA 1SZ2A 4X66K 2IDOA 3DM2A 3CFRA 4LSNA 1VQPN 4YOUA 2O4IA 2BH1A 1ATRA 3CM6A 5AQSA 3SBGA 2V52B 2ITGA 5AQPA 5AZIA 1IBKK 3ZT3A 1ZBLA 4DR3K 2E2QA 3KLGA 2Z1JA 4OGCA 3NH0A 3RRGA 2R7YA 3DXMA 5I3UA 4FOEA 4ISFA 4RW7A 3CCQN 5AZJB 5LMNK 4B8CA 1U49A 1NG9A 1OVQA 3MN7A 4A61A 1GLLO 3VQ7A 3OVNA 1UA1A 2P51A 3A0IX 2FBXA 1NGGA 4CJSA 1EWRA 3IG1A 4KH5A 1FKOA 4CEBA 3L2UA 5DMRA 4IEEA 4WE1A 2W6KA 3E9OA 4RW8A 2JWLA 3NH1A 4BG8A 3R1XA 4DS5A 3SQ1A 2UUCK 3C6AA 3ATUA 3BDPA 2D0AA 1K73O 1JLCA 1RTHA 4U67L 4BACA 3GE1A 3LZJA 5AQQA 4B9MA 4JYAK 4JLHA 2CGKA 5HOOA 4UY8O 3OW2M 1BO5O 3VQQA 4I6MB 3AO5A 4RTFD 4M7XA 5AQIA 2HHWA 4QAGA 3SJHA 4KHPK 1Y97A 4DFJA 4I7FA 1W2BM 4DQ8A 4E0DA 3NH2A 4FLUA 3EYZA 3EEQA 4N47A 4DU1A 2P5GA 1EETA 4LFAK 2D4WA 3CJCA 3VA0A 1VRUA 5HRNA 5MLCQ 1TVRA 3ZT2A 3OA9A 3IAYA 1N33K 5M1OA 3ZSQA 1HMVA 3MWPA 4LSLA 3PSFA 1T44A 1J53A 1HKGA 1TGOA 2YNIA 3T69A 4EZ9A 1TKZA 4NCGA 4JI5K 3MX2A 5GAHP 3MDQA 1FXXA 4IFYA 4F9OA 1HQUA 3OYHA 2YKMA 3NAEA 1H1VA 1LAWA 4BRKA 4C8LA 1C1AA 1NK8A 4IO9L 1SQKA 3Q7CA 2QWOA 2D0BA 3TABA 2OPSA 4JK9A 1XC3A 1NGFA 1K9MO 1C0GA 4N41A 3HSCA 1J9AA 2HBJA 1IKXA 1SAZA 3H1QA 4O8KA 3KLHA 4BROA 1WBDA 4EP4A 1VQ4N 4CIGA 1RT4A 2VCPA 5JVGL 4L3QA
chains in the Genus database with same CATH topology
1WLJA 1JLBA 3SQ0A 3K57A 4YFUA 1IO2A 1A5XA 4CGIA 4B8AB 4DFPA 1T7PA 1C0MA 1RBVA 1IKYA 3AVGA 3ZSYA 3P1GA 5C25A 3JYTA 4OLAA 4EP5A 4E1NA 1WSJA 4KFBA 4FCYA 2KQ2A 3CFOA 2E6MA 3L2QA 1IG9A 4DSJA 1ZBHA 2FBTA 2F8SA 3OYMA 3TAMA 3D0PA 4E7IA 2KFZA 4L8RB 5KGXA 4Y1DA 4DTRA 2HHTA 1C0UA 3SQ2A 1NK0A 4OGEA 1LWEA 3T3FA 2GBZA 3NFAA 4DSLA 3HP6A 3F9KA 1KFDA 2QK9A 3V9UA 1RDCA 3ZT1A 3JSMA 3V9WA 1HQEA 3MEDA 3S3NA 4M3ZA 5SWMA 3G10A 2YNFA 4CFCA 1S5JA 4BWJA 1UAXA 1U48A 4FK0A 4FM2A 4RW9A 5JS1A 1S9EA 1JL1A 3CG7A 1T03A 4B9SA 3DLBA 1ASWA 3HO1A 1UWBA 3SJJA 1VSLA 3DYAA 3K5LA 4DQRA 1SL1A 4F3OA 4DF4A 3AVIA 1TV6A 3MECA 4KAZA 4M3TA 1RBRA 3IS9A 4CHYA 1YTUA 4DG1A 4DU3A 3QEWA 3O4QA 4CERA 4CGHA 3KKRA 1HYZA 1RNHA 1RT3A 4DTOA 3HXMA 3AO2A 4Y1CA 3AO1A 3OYDA 3V1RA 4Z4FA 2ZE2A 4NYNA 1WSHA 2BE2A 1LW2A 1VSJA 4DMNA 1WSIA 4JRQA 3NGIA 1JLEA 3DLKA 2RKIA 3KJVA 3AV9A 4Z4HA 3MXIA 4OPKA 1LWFA 4G1QA 4B9VA 4FJJA 1VSEA 1ZBFA 4CIFA 4B9TA 3S3MA 3AA5X 3LWLA 5KRSA 3T1AA 4F4KA 3HM9A 3AVKA 4W5TA 3S3OA 3NHGA 4FVMA 3DRPA 4KKOA 5HROA 1D8YA 4FJKA 3KLEA 1TKXA 3V4IA 4IBNA 3DLGA 4IG3A 3AVHA 4CJKA 2AJQA 5FRMA 2KZZA 1L5UA 3LP0A 4B9LA 3QEPA 4CHOA 1LV5A 2IGIA 4KREA 1EX4A 3SV4A 1NK4A 1RTIA 1HYVA 2IC3A 4E3SA 3OYNA 2Y1JA 2IOCA 4CCHA 3ZSZA 4CJEA 1S1XA 2WOMA 3RRHA 3QETA 4R5PA 5HBMA 4KB1A 3DOKA 4AILC 3KKSA 4CK1A 3OYGA 4O0JA 3V9XA 1CZBA 2HNYA 1SL2A 3OYAA 3VQCA 3LWMA 1KCFA 3KK3A 3OS2A 2W42A 4AHCA 2FBVA 4KI4A 1KVBA 4FM0A 1NK9A 2XY7A 1KLNA 4N56A 3CM5A 2G8KA 4CGJA 2QXFA 3O3GA 1GOAA 3B6PA 3VQAA 3M8SA 3QESA 4IKFA 4YNQA 4PY5A 2D5RA 1NOZA 1EP4A 1VSKA 2P1JA 2X78A 1WSGA 2X6NA 1JLFA 4CESA 3NE6A 4FZYA 4KHQA 2DTUA 3OS0A 3THVA 4PQUA 2ETJA 3BGRA 2KFNA 4K8ZA 4M3WA 1QSSA 3TAFA 2PYLA 1NJYA 1SKSA 1L3UA 3L3VA 4FZZA 4JS5A 4CJ4A 3AO3A 4CJQA 4CJPA 3PX4A 3TAQA 4BE1A 3ZSRA 4DLEA 4F2SA 2VG5A 3EY1A 4O44A 3OYJA 1HRHA 1B9DA 3AVBA 2QKBA 1L3VA 4Z0UA 3C6UA 3AO4A 4CF2A 4LY7A 3HP9A 2O4GA 1KRPA 3AVFA 1U47A 4E7JA 4OJRA 3SUOA 1XC9A 3QIPA 4RG8A 4HCCA 4CGFA 2B6AA 4BDZA 4DS4A 1BHLA 4CF0A 3LPUA 1K6YA 4IG0A 5J2PA 2HW3A 3PUFA 1S1WA 4FW2A 3RR8A 3NGYA 3VQ9A 2HHSA 4KTZA 4CEDA 4CJ5A 4FLYA 3LAKA 3V9SA 4NCBA 4KTQA 4GW6A 4ID5A 4C8OA 4F3TA 1C1BA 1RT2A 4W5OA 2PZSA 1BCMA 1VSFA 3L8BA 1LW0A 4DSFA 2HNZA 5FROA 5HLFA 1RT6A 4C8MA 3OJUA 1ITGA 1NJXA 2OPPA 2G8VA 5KRTA 4FJLA 1EXQA 1RDAA 3RMCA 3T19A 4FJGA 4HTUA 1JL2A 4CJWA 1SKWA 1RT7A 1D5AA 3VQPA 3QNOA 1TAUA 3AVCA 3HPOA 3M8PA 4ZTJA 4O5BA 1S9GA 4W5RA 2I5JA 1L3TA 1JLAA 2DFHA 2FC0A 1NJWA 3VQ5A 4I2PA 4F2RA 3ZCMA 4CHZA 4DQSA 2YHAA 4BDYA 5KGWA 1WSFA 3MEGA 4E7HA 3SUQA 2BANA 1QSLA 5EU7A 1RTJA 4UQGA 4DFKA 1NK5A 4J2AA 4IFVA 3DMJA 5J2MA 2G8IA 4DTMA 1SL0A 5HRPA 2G8FA 3LP1A 3OYEA 1VSHA 3CYMA 3V1QA 4OLBA 3K58A 3C95A 4NYFA 1RILA 1JLGA 2BGGA 4IDKA 4Z4CA 2IS3A 4FK4A 1JXEA 2HVHA 4M41A 3HVTA 4LH5A 5FDLA 2HHUA 2HHXA 1N5YA 3ITHA 1S1UA 3TWHA 1A5WA 5CYQA 2OZSA 4KHWA 3V81A 3K5MA 1IKVA 4E7LA 4CEOA 3ZSVA 4KRFA 4HVJA 1C0TA 1YT3A 2RF2A 1R0AA 4CFDA 4QOZB 2DFFA 3D45A 2G8HA 3RR7A 1KVAA 2EHGA 2GV9A 5KI6A 1KLMA 3TAGA 3SPYA 2KW4A 3WNEA 4FJNA 3O3HA 4AHVA 4FJHA 1Q8IA 2XY8A 3NF7A 1TKTA 3DOLA 2Z1IA 1VSMA 1RT1A 4Q5VA 4FJXA 1WAJA 3LPTA 1L3SA 4MFBA 3KLFA 4M3XA 3HSTB 5D3GA 3L2WA 2JGUA 1UOCA 2F8TA 1BCOA 4KTWA 4CEQA 3AVNA 4DSEA 4DTSA 4DTNA 2NUBA 4KB0A 4B9NA 3VQEA 5KTQA 5SZTA 2FBYA 1YTAA 3KTQA 4CFAA 1J5OA 1EKEA 4E7KA 5CY4A 3HJFA 3K2PA 3SQ4A 3RTVA 3MXJA 1W0HA 5K14A 4CK3A 1I39A 2OPRA 3PO4A 3HPGA 3AA4A 3P5JA 4ICLA 4PUOA 3OY9A 3WNGA 4B3OA 1RBTA 3WNFA 1F21A 4O55A 3LP3A 3KK2A 1QTMA 4KHNA 4CK2A 1T8EA 2Q3SA 4CFBA 4ZTFA 3AVLA 2YKNA 4FXDA 2VG7A 1I3AA 3LDSA 4FJMA 1VK0A 2XRIA 3PO5A 1JXBA 2YNHA 4AHSA 4CJVA 3MEEA 3DI6A 1RDBA 3NCIA 3TANA 1XHZA 2X6SA 1T05A 3VA3A 2KTQA 4CEFA 1RT5A 4Q0BA 3VQBA 2KZMA 4ELTA 3LAMA 5JS2A 3L2VA 4BWMA 1QSYA 1U45A 3NBPA 3HT3A 3SNNA 3OYLA 4GMJB 1TKDA 1U4BA 4JRPA 3NGZA 3L2RA 4DLGA 3MXMA 4KI6A 2HB5A 2OPQA 3FFIA 3U3GA 3LANA 3QNNA 2HHQA 4Z4EA 2B5JA 1QE1A 2LSNA 4CF9A 3ZT0A 4ID1A 1DTTA 1S1TA 3V9ZA 3OYIA 4DQQA 2XY6A 1NKBA 3QINA 3OJSA 3M8RA 5T7BA 4C8LA 2XY5A 4DSKA 1NK7A 3SYZA 4FLTA 5HP1A 1BI4A 4CF1A 1ASVA 4KHYA 3KD5E 3H08A 1DTQA 4M3YA 4HHTA 2Z1GA 4C8KA 3HL8A 2OZMA 1U04A 1TK0A 1NKCA 4AHRA 4BDPA 4E19A 1TAQA 1N6QA 2DFEA 4KHSA 3E01A 1RCHA 3HVRA 3IRXA 4HUEA 4BE0A 4DU4A 4H4MA 4AHUA 3SPZA 1SKRA 3DLEA 4Z4GA 4LD0A 3KD1E 4KO0A 2HHVA 5HRSA 2E6LA 5C42A 1DLOA 4ELVA 3I0SA 1YVUA 4K8XA 3HK2A 3AA2A 1MU2A 4OPJA 1FKPA 4I9LA 1RTDA 3TI0A 4JS4A 2JLEA 4CJTA 4FYDA 4CJRA 2F96A 1KVCA 4O0IA 4FK2A 4I2QA 1KTQA 2Y1IA 4FJ5A 1X9MA 2ATQA 1QS4A 3QEVA 4GVMA 1RBUA 3G0ZA 1BL3A 1O1WA 3A2FA 4E89A 4CHQA 4HUGA 2PY5A 2DY4A 2BDPA 3HPHA 3QIOA 1B9FA 1QQCA 5CZ1A 1TL3A 2IAJA 1A5VA 3EZ5A 3NDKA 4CECA 3V6DA 3PV8A 3ZT4A 4DWIA 2IDOA 3DM2A 3CFRA 1ZBUA 3SUNA 4LSNA 4TSXA 4H4OA 3KIOA 2O4IA 2ZD1A 1VSIA 4MQ3A 2YHBA 3ISNC 3LP2A 3CM6A 1S6PA 1S1VA 3M8QA 5DK5A 3TAEA 1BQMA 2G8WA 1NOYA 4NCAA 2ITGA 4CJFA 2RN2A 1RBSA 3ZT3A 3SZ2A 4DTUA 2B4JA 1ZBLA 3K59A 3SCXA 4F8RA 3K5NA 1KFSA 4PA1A 1ASUA 1IH7A 2Z1JA 3KLGA 4OVLA 4OGCA 3NH0A 3RRGA 1ZYQA 2R7YA 3NF9A 4B08A 2XHBA 4OKJA 3SI6A 5I3UA 4FLXA 1NKEA 3AA3A 4J2BA 1WAFA 4O4GA 1BIZA 1KSPA 4FW1A 4RW4A 2YNGA 4CEZA 3NF6A 1UA0A 4EZ6A 2GUIA 4RW7A 1BI4B 4DTXA 3B6OA 1BQNA 3QLHA 4QCLA 1LAVA 3SV3A 5CYMA 1HNVA 4B8CA 1J54A 1U49A 4DFMA 1WNSA 2RPIA 4DF8A 3AVAA 1Q9XA 3VQ7A 4ZHRA 3OVNA 4BE2A 3TARA 3I8DA 1UA1A 3DLHA 4FJIA 4AH9A 4W5NA 2P51A 1XWLA 2FBXA 4FJ9A 3TAPA 4FZXC 4CJ3A 4OKKA 4CJSA 1CZ9A 3NF8A 5E41A 1B92A 1JLQA 4KV8A 4H8KA 4M3RA 3CQ8A 4AHTA 4CHPA 4HUFA 3RMBA 3IG1A 2WONA 1FKOA 4RW6A 4CEBA 1D9FA 4CEEA 5I42A 4HCBA 3L2UA 4W5QA 5DMRA 3VQ4A 3DRSA 2YV0X 1REVA 4FLVA 4WE1A 2OA8A 2XO7A 4RW8A 3NH1A 3SQ1A 4DS5A 1SUQA 4PWDA 1HYSA 1Z25A 3BDPA 2D0AA 2QKKA 1JLCA 4FM1A 1RTHA 1JKHA 4BACA 4J2DA 1BISA 2OYQA 1IKWA 3KK1A 1C1CA 3PX6A 2ZQBA 1FK9A 3UIQA 1TL1A 3QO9A 1VRTA 4DTPA 3LZJA 4B9MA 3OS1A 4JLHA 2E4LA 2A1RA 4CIEA 3VQQA 1HNIA 3I0RA 3AO5A 3KLIA 3PY8A 3ULDA 1XHXA 3ZSWA 4CE9A 2HHWA 3DRRA 2P5OA 4DQIA 3RWUA 3L3UA 4QAGA 1RDDA 2EX3A 3F73A 4FLWA 2PYJA 1CLQA 1D9DA 3HYFA 3WNHA 1G15A 4CJLA 1X1PA 3OYFA 2HMIA 1Y97A 3TR8A 4DFJA 4I7FA 3QERA 2VWJA 1BGXT 3C94A 4OKEA 3P83D 3C6TA 3VN5A 1QHTA 4M45A 4E0DA 3NH2A 4FLUA 4CF8A 3EYZA 5HRRA 4N47A 4DU1A 2P5GA 1ZBIA 1C6VA 1EETA 1SV5A 3VA0A 1VRUA 4M42A 5HRNA 1WN7A 3VQDA 1TVRA 2A1SA 2D0CA 2HVIA 3ZT2A 1HJRA 4XIUA 3IAYA 1Z26A 4M3UA 3ZSQA 3ASMA 5J2NA 1HMVA 3MAQA 4CGGA 3OYBA 3K5OA 4LSLA 4KPYA 4N76A 5J2QA 3LALA 1Q9YA 1J53A 5J1EA 4DSIA 1TK8A 3CFPA 1TGOA 3OYCA 3PX0A 2YNIA 4EZ9A 2G8UA 1TKZA 4NCGA 5C24A 5CZ2A 4C8NA 2VWKA 1FXXA 4DQPA 1WSEA 4IFYA 4FLZA 3AVMA 1W9HA 1HQUA 3VQ8A 1HPZA 2YKMA 2Z1HA 1LAWA 1LWCA 3ALYA 3OYHA 3NAEA 1C1AA 3OYKA 3RMAA 2HNDA 1NK8A 4CEAA 4B9UA 3RMDA 4FJ7A 3ZSOA 4Z4IA 2D0BA 3O3FA 4CGDA 3QEXA 1BIUA 3TABA 1NJZA 2OPSA 2X74A 1X9SA 1X9WA 4J2EA 3LZIA 3U3YA 1GOBA 4N41A 1J9AA 4LH4A 4CJUA 3U6FA 1IKXA 4KHUA 3VQ6A 4FJ8A 3KLHA 1GOCA 2VG6A 3QEIA 3AVJA 1CXQA 4N5SA 4I9QA 3SUPA 1XI1A 1S6QA 4DTJA 4EP4A 4CHNA 5FRNA 3V1OA 3DLRA 4CIGA 1RT4A 1VSDA 3O4NA 1TK5A 3S9HA 3ZSXA 1NK6A 4E1MA 4ELUA 1CXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLJ A;  1JLB A;  3SQ0 A;  3K57 A;  4YFU A;  1IO2 A;  1A5X A;  4CGI A;  4B8A B;  4DFP A;  1T7P A;  1C0M A;  1RBV A;  1IKY A;  3AVG A;  3ZSY A;  3P1G A;  5C25 A;  3JYT A;  4OLA A;  4EP5 A;  4E1N A;  1WSJ A;  4KFB A;  4FCY A;  2KQ2 A;  3CFO A;  2E6M A;  3L2Q A;  1IG9 A;  4DSJ A;  1ZBH A;  2FBT A;  2F8S A;  3OYM A;  3TAM A;  3D0P A;  4E7I A;  2KFZ A;  4L8R B;  5KGX A;  4Y1D A;  4DTR A;  2HHT A;  1C0U A;  3SQ2 A;  1NK0 A;  4OGE A;  1LWE A;  3T3F A;  2GBZ A;  3NFA A;  4DSL A;  3HP6 A;  3F9K A;  1KFD A;  2QK9 A;  3V9U A;  1RDC A;  3ZT1 A;  3JSM A;  3V9W A;  1HQE A;  3MED A;  3S3N A;  4M3Z A;  5SWM A;  3G10 A;  2YNF A;  4CFC A;  1S5J A;  4BWJ A;  1UAX A;  1U48 A;  4FK0 A;  4FM2 A;  4RW9 A;  5JS1 A;  1S9E A;  1JL1 A;  3CG7 A;  1T03 A;  4B9S A;  3DLB A;  1ASW A;  3HO1 A;  1UWB A;  3SJJ A;  1VSL A;  3DYA A;  3K5L A;  4DQR A;  1SL1 A;  4F3O A;  4DF4 A;  3AVI A;  1TV6 A;  3MEC A;  4KAZ A;  4M3T A;  1RBR A;  3IS9 A;  4CHY A;  1YTU A;  4DG1 A;  4DU3 A;  3QEW A;  3O4Q A;  4CER A;  4CGH A;  3KKR A;  1HYZ A;  1RNH A;  1RT3 A;  4DTO A;  3HXM A;  3AO2 A;  4Y1C A;  3AO1 A;  3OYD A;  3V1R A;  4Z4F A;  2ZE2 A;  4NYN A;  1WSH A;  2BE2 A;  1LW2 A;  1VSJ A;  4DMN A;  1WSI A;  4JRQ A;  3NGI A;  1JLE A;  3DLK A;  2RKI A;  3KJV A;  3AV9 A;  4Z4H A;  3MXI A;  4OPK A;  1LWF A;  4G1Q A;  4B9V A;  4FJJ A;  1VSE A;  1ZBF A;  4CIF A;  4B9T A;  3S3M A;  3AA5 X;  3LWL A;  5KRS A;  3T1A A;  4F4K A;  3HM9 A;  3AVK A;  4W5T A;  3S3O A;  3NHG A;  4FVM A;  3DRP A;  4KKO A;  5HRO A;  1D8Y A;  4FJK A;  3KLE A;  1TKX A;  3V4I A;  4IBN A;  3DLG A;  4IG3 A;  3AVH A;  4CJK A;  2AJQ A;  5FRM A;  2KZZ A;  1L5U A;  3LP0 A;  4B9L A;  3QEP A;  4CHO A;  1LV5 A;  2IGI A;  4KRE A;  1EX4 A;  3SV4 A;  1NK4 A;  1RTI A;  1HYV A;  2IC3 A;  4E3S A;  3OYN A;  2Y1J A;  2IOC A;  4CCH A;  3ZSZ A;  4CJE A;  1S1X A;  2WOM A;  3RRH A;  3QET A;  4R5P A;  5HBM A;  4KB1 A;  3DOK A;  4AIL C;  3KKS A;  4CK1 A;  3OYG A;  4O0J A;  3V9X A;  1CZB A;  2HNY A;  1SL2 A;  3OYA A;  3VQC A;  3LWM A;  1KCF A;  3KK3 A;  3OS2 A;  2W42 A;  4AHC A;  2FBV A;  4KI4 A;  1KVB A;  4FM0 A;  1NK9 A;  2XY7 A;  1KLN A;  4N56 A;  3CM5 A;  2G8K A;  4CGJ A;  2QXF A;  3O3G A;  1GOA A;  3B6P A;  3VQA A;  3M8S A;  3QES A;  4IKF A;  4YNQ A;  4PY5 A;  2D5R A;  1NOZ A;  1EP4 A;  1VSK A;  2P1J A;  2X78 A;  1WSG A;  2X6N A;  1JLF A;  4CES A;  3NE6 A;  4FZY A;  4KHQ A;  2DTU A;  3OS0 A;  3THV A;  4PQU A;  2ETJ A;  3BGR A;  2KFN A;  4K8Z A;  4M3W A;  1QSS A;  3TAF A;  2PYL A;  1NJY A;  1SKS A;  1L3U A;  3L3V A;  4FZZ A;  4JS5 A;  4CJ4 A;  3AO3 A;  4CJQ A;  4CJP A;  3PX4 A;  3TAQ A;  4BE1 A;  3ZSR A;  4DLE A;  4F2S A;  2VG5 A;  3EY1 A;  4O44 A;  3OYJ A;  1HRH A;  1B9D A;  3AVB A;  2QKB A;  1L3V A;  4Z0U A;  3C6U A;  3AO4 A;  4CF2 A;  4LY7 A;  3HP9 A;  2O4G A;  1KRP A;  3AVF A;  1U47 A;  4E7J A;  4OJR A;  3SUO A;  1XC9 A;  3QIP A;  4RG8 A;  4HCC A;  4CGF A;  2B6A A;  4BDZ A;  4DS4 A;  1BHL A;  4CF0 A;  3LPU A;  1K6Y A;  4IG0 A;  5J2P A;  2HW3 A;  3PUF A;  1S1W A;  4FW2 A;  3RR8 A;  3NGY A;  3VQ9 A;  2HHS A;  4KTZ A;  4CED A;  4CJ5 A;  4FLY A;  3LAK A;  3V9S A;  4NCB A;  4KTQ A;  4GW6 A;  4ID5 A;  4C8O A;  4F3T A;  1C1B A;  1RT2 A;  4W5O A;  2PZS A;  1BCM A;  1VSF A;  3L8B A;  1LW0 A;  4DSF A;  2HNZ A;  5FRO A;  5HLF A;  1RT6 A;  4C8M A;  3OJU A;  1ITG A;  1NJX A;  2OPP A;  2G8V A;  5KRT A;  4FJL A;  1EXQ A;  1RDA A;  3RMC A;  3T19 A;  4FJG A;  4HTU A;  1JL2 A;  4CJW A;  1SKW A;  1RT7 A;  1D5A A;  3VQP A;  3QNO A;  1TAU A;  3AVC A;  3HPO A;  3M8P A;  4ZTJ A;  4O5B A;  1S9G A;  4W5R A;  2I5J A;  1L3T A;  1JLA A;  2DFH A;  2FC0 A;  1NJW A;  3VQ5 A;  4I2P A;  4F2R A;  3ZCM A;  4CHZ A;  4DQS A;  2YHA A;  4BDY A;  5KGW A;  1WSF A;  3MEG A;  4E7H A;  3SUQ A;  2BAN A;  1QSL A;  5EU7 A;  1RTJ A;  4UQG A;  4DFK A;  1NK5 A;  4J2A A;  4IFV A;  3DMJ A;  5J2M A;  2G8I A;  4DTM A;  1SL0 A;  5HRP A;  2G8F A;  3LP1 A;  3OYE A;  1VSH A;  3CYM A;  3V1Q A;  4OLB A;  3K58 A;  3C95 A;  4NYF A;  1RIL A;  1JLG A;  2BGG A;  4IDK A;  4Z4C A;  2IS3 A;  4FK4 A;  1JXE A;  2HVH A;  4M41 A;  3HVT A;  4LH5 A;  5FDL A;  2HHU A;  2HHX A;  1N5Y A;  3ITH A;  1S1U A;  3TWH A;  1A5W A;  5CYQ A;  2OZS A;  4KHW A;  3V81 A;  3K5M A;  1IKV A;  4E7L A;  4CEO A;  3ZSV A;  4KRF A;  4HVJ A;  1C0T A;  1YT3 A;  2RF2 A;  1R0A A;  4CFD A;  4QOZ B;  2DFF A;  3D45 A;  2G8H A;  3RR7 A;  1KVA A;  2EHG A;  2GV9 A;  5KI6 A;  1KLM A;  3TAG A;  3SPY A;  2KW4 A;  3WNE A;  4FJN A;  3O3H A;  4AHV A;  4FJH A;  1Q8I A;  2XY8 A;  3NF7 A;  1TKT A;  3DOL A;  2Z1I A;  1VSM A;  1RT1 A;  4Q5V A;  4FJX A;  1WAJ A;  3LPT A;  1L3S A;  4MFB A;  3KLF A;  4M3X A;  3HST B;  5D3G A;  3L2W A;  2JGU A;  1UOC A;  2F8T A;  1BCO A;  4KTW A;  4CEQ A;  3AVN A;  4DSE A;  4DTS A;  4DTN A;  2NUB A;  4KB0 A;  4B9N A;  3VQE A;  5KTQ A;  5SZT A;  2FBY A;  1YTA A;  3KTQ A;  4CFA A;  1J5O A;  1EKE A;  4E7K A;  5CY4 A;  3HJF A;  3K2P A;  3SQ4 A;  3RTV A;  3MXJ A;  1W0H A;  5K14 A;  4CK3 A;  1I39 A;  2OPR A;  3PO4 A;  3HPG A;  3AA4 A;  3P5J A;  4ICL A;  4PUO A;  3OY9 A;  3WNG A;  4B3O A;  1RBT A;  3WNF A;  1F21 A;  4O55 A;  3LP3 A;  3KK2 A;  1QTM A;  4KHN A;  4CK2 A;  1T8E A;  2Q3S A;  4CFB A;  4ZTF A;  3AVL A;  2YKN A;  4FXD A;  2VG7 A;  1I3A A;  3LDS A;  4FJM A;  1VK0 A;  2XRI A;  3PO5 A;  1JXB A;  2YNH A;  4AHS A;  4CJV A;  3MEE A;  3DI6 A;  1RDB A;  3NCI A;  3TAN A;  1XHZ A;  2X6S A;  1T05 A;  3VA3 A;  2KTQ A;  4CEF A;  1RT5 A;  4Q0B A;  3VQB A;  2KZM A;  4ELT A;  3LAM A;  5JS2 A;  3L2V A;  4BWM A;  1QSY A;  1U45 A;  3NBP A;  3HT3 A;  3SNN A;  3OYL A;  4GMJ B;  1TKD A;  1U4B A;  4JRP A;  3NGZ A;  3L2R A;  4DLG A;  3MXM A;  4KI6 A;  2HB5 A;  2OPQ A;  3FFI A;  3U3G A;  3LAN A;  3QNN A;  2HHQ A;  4Z4E A;  2B5J A;  1QE1 A;  2LSN A;  4CF9 A;  3ZT0 A;  4ID1 A;  1DTT A;  1S1T A;  3V9Z A;  3OYI A;  4DQQ A;  2XY6 A;  1NKB A;  3QIN A;  3OJS A;  3M8R A;  5T7B A;  4C8L A;  2XY5 A;  4DSK A;  1NK7 A;  3SYZ A;  4FLT A;  5HP1 A;  1BI4 A;  4CF1 A;  1ASV A;  4KHY A;  3KD5 E;  3H08 A;  1DTQ A;  4M3Y A;  4HHT A;  2Z1G A;  4C8K A;  3HL8 A;  2OZM A;  1U04 A;  1TK0 A;  1NKC A;  4AHR A;  4BDP A;  4E19 A;  1TAQ A;  1N6Q A;  2DFE A;  4KHS A;  3E01 A;  1RCH A;  3HVR A;  3IRX A;  4HUE A;  4BE0 A;  4DU4 A;  4H4M A;  4AHU A;  3SPZ A;  1SKR A;  3DLE A;  4Z4G A;  4LD0 A;  3KD1 E;  4KO0 A;  2HHV A;  5HRS A;  2E6L A;  5C42 A;  1DLO A;  4ELV A;  3I0S A;  1YVU A;  4K8X A;  3HK2 A;  3AA2 A;  1MU2 A;  4OPJ A;  1FKP A;  4I9L A;  1RTD A;  3TI0 A;  4JS4 A;  2JLE A;  4CJT A;  4FYD A;  4CJR A;  2F96 A;  1KVC A;  4O0I A;  4FK2 A;  4I2Q A;  1KTQ A;  2Y1I A;  4FJ5 A;  1X9M A;  2ATQ A;  1QS4 A;  3QEV A;  4GVM A;  1RBU A;  3G0Z A;  1BL3 A;  1O1W A;  3A2F A;  4E89 A;  4CHQ A;  4HUG A;  2PY5 A;  2DY4 A;  2BDP A;  3HPH A;  3QIO A;  1B9F A;  1QQC A;  5CZ1 A;  1TL3 A;  2IAJ A;  1A5V A;  3EZ5 A;  3NDK A;  4CEC A;  3V6D A;  3PV8 A;  3ZT4 A;  4DWI A;  2IDO A;  3DM2 A;  3CFR A;  1ZBU A;  3SUN A;  4LSN A;  4TSX A;  4H4O A;  3KIO A;  2O4I A;  2ZD1 A;  1VSI A;  4MQ3 A;  2YHB A;  3ISN C;  3LP2 A;  3CM6 A;  1S6P A;  1S1V A;  3M8Q A;  5DK5 A;  3TAE A;  1BQM A;  2G8W A;  1NOY A;  4NCA A;  2ITG A;  4CJF A;  2RN2 A;  1RBS A;  3ZT3 A;  3SZ2 A;  4DTU A;  2B4J A;  1ZBL A;  3K59 A;  3SCX A;  4F8R A;  3K5N A;  1KFS A;  4PA1 A;  1ASU A;  1IH7 A;  2Z1J A;  3KLG A;  4OVL A;  4OGC A;  3NH0 A;  3RRG A;  1ZYQ A;  2R7Y A;  3NF9 A;  4B08 A;  2XHB A;  4OKJ A;  3SI6 A;  5I3U A;  4FLX A;  1NKE A;  3AA3 A;  4J2B A;  1WAF A;  4O4G A;  1BIZ A;  1KSP A;  4FW1 A;  4RW4 A;  2YNG A;  4CEZ A;  3NF6 A;  1UA0 A;  4EZ6 A;  2GUI A;  4RW7 A;  1BI4 B;  4DTX A;  3B6O A;  1BQN A;  3QLH A;  4QCL A;  1LAV A;  3SV3 A;  5CYM A;  1HNV A;  4B8C A;  1J54 A;  1U49 A;  4DFM A;  1WNS A;  2RPI A;  4DF8 A;  3AVA A;  1Q9X A;  3VQ7 A;  4ZHR A;  3OVN A;  4BE2 A;  3TAR A;  3I8D A;  1UA1 A;  3DLH A;  4FJI A;  4AH9 A;  4W5N A;  2P51 A;  1XWL A;  2FBX A;  4FJ9 A;  3TAP A;  4FZX C;  4CJ3 A;  4OKK A;  4CJS A;  1CZ9 A;  3NF8 A;  5E41 A;  1B92 A;  1JLQ A;  4KV8 A;  4H8K A;  4M3R A;  3CQ8 A;  4AHT A;  4CHP A;  4HUF A;  3RMB A;  3IG1 A;  2WON A;  1FKO A;  4RW6 A;  4CEB A;  1D9F A;  4CEE A;  5I42 A;  4HCB A;  3L2U A;  4W5Q A;  5DMR A;  3VQ4 A;  3DRS A;  2YV0 X;  1REV A;  4FLV A;  4WE1 A;  2OA8 A;  2XO7 A;  4RW8 A;  3NH1 A;  3SQ1 A;  4DS5 A;  1SUQ A;  4PWD A;  1HYS A;  1Z25 A;  3BDP A;  2D0A A;  2QKK A;  1JLC A;  4FM1 A;  1RTH A;  1JKH A;  4BAC A;  4J2D A;  1BIS A;  2OYQ A;  1IKW A;  3KK1 A;  1C1C A;  3PX6 A;  2ZQB A;  1FK9 A;  3UIQ A;  1TL1 A;  3QO9 A;  1VRT A;  4DTP A;  3LZJ A;  4B9M A;  3OS1 A;  4JLH A;  2E4L A;  2A1R A;  4CIE A;  3VQQ A;  1HNI A;  3I0R A;  3AO5 A;  3KLI A;  3PY8 A;  3ULD A;  1XHX A;  3ZSW A;  4CE9 A;  2HHW A;  3DRR A;  2P5O A;  4DQI A;  3RWU A;  3L3U A;  4QAG A;  1RDD A;  2EX3 A;  3F73 A;  4FLW A;  2PYJ A;  1CLQ A;  1D9D A;  3HYF A;  3WNH A;  1G15 A;  4CJL A;  1X1P A;  3OYF A;  2HMI A;  1Y97 A;  3TR8 A;  4DFJ A;  4I7F A;  3QER A;  2VWJ A;  1BGX T;  3C94 A;  4OKE A;  3P83 D;  3C6T A;  3VN5 A;  1QHT A;  4M45 A;  4E0D A;  3NH2 A;  4FLU A;  4CF8 A;  3EYZ A;  5HRR A;  4N47 A;  4DU1 A;  2P5G A;  1ZBI A;  1C6V A;  1EET A;  1SV5 A;  3VA0 A;  1VRU A;  4M42 A;  5HRN A;  1WN7 A;  3VQD A;  1TVR A;  2A1S A;  2D0C A;  2HVI A;  3ZT2 A;  1HJR A;  4XIU A;  3IAY A;  1Z26 A;  4M3U A;  3ZSQ A;  3ASM A;  5J2N A;  1HMV A;  3MAQ A;  4CGG A;  3OYB A;  3K5O A;  4LSL A;  4KPY A;  4N76 A;  5J2Q A;  3LAL A;  1Q9Y A;  1J53 A;  5J1E A;  4DSI A;  1TK8 A;  3CFP A;  1TGO A;  3OYC A;  3PX0 A;  2YNI A;  4EZ9 A;  2G8U A;  1TKZ A;  4NCG A;  5C24 A;  5CZ2 A;  4C8N A;  2VWK A;  1FXX A;  4DQP A;  1WSE A;  4IFY A;  4FLZ A;  3AVM A;  1W9H A;  1HQU A;  3VQ8 A;  1HPZ A;  2YKM A;  2Z1H A;  1LAW A;  1LWC A;  3ALY A;  3OYH A;  3NAE A;  1C1A A;  3OYK A;  3RMA A;  2HND A;  1NK8 A;  4CEA A;  4B9U A;  3RMD A;  4FJ7 A;  3ZSO A;  4Z4I A;  2D0B A;  3O3F A;  4CGD A;  3QEX A;  1BIU A;  3TAB A;  1NJZ A;  2OPS A;  2X74 A;  1X9S A;  1X9W A;  4J2E A;  3LZI A;  3U3Y A;  1GOB A;  4N41 A;  1J9A A;  4LH4 A;  4CJU A;  3U6F A;  1IKX A;  4KHU A;  3VQ6 A;  4FJ8 A;  3KLH A;  1GOC A;  2VG6 A;  3QEI A;  3AVJ A;  1CXQ A;  4N5S A;  4I9Q A;  3SUP A;  1XI1 A;  1S6Q A;  4DTJ A;  4EP4 A;  4CHN A;  5FRN A;  3V1O A;  3DLR A;  4CIG A;  1RT4 A;  1VSD A;  3O4N A;  1TK5 A;  3S9H A;  3ZSX A;  1NK6 A;  4E1M A;  4ELU A;  1CXU A; 
#chains in the Genus database with same CATH topology
 3SQ0 A;  4FWM A;  4H5R A;  4IDH A;  2CGL A;  4JKE A;  1IO2 A;  1A5X A;  2RE2 A;  5KPR A;  4DFP A;  3AVG A;  1IKY A;  3VGL A;  1TYQ A;  1DKG D;  2P9U B;  1OKJ A;  3HM8 A;  3SBT A;  4FCY A;  3L2Q A;  3QML A;  3HOS A;  5AQF A;  3H6E A;  3TAM A;  4JI1 K;  5KGX A;  2YJF A;  3QBX A;  3K0S A;  4DSL A;  1YHQ N;  4BC4 A;  2QK9 A;  3ZET B;  4FWP A;  3V9U A;  3S3N A;  3WQU A;  3M3Z A;  1FW6 A;  5SWM A;  2YNF A;  4BRG A;  3PSI A;  4FM2 A;  4FK0 A;  4RW9 A;  4B1Y B;  5JS1 A;  1JL1 A;  1ASW A;  4BRE A;  2O8C A;  4YOY A;  4FWL A;  4M7Y A;  4CBU A;  1QZ6 A;  4JI8 K;  3VET A;  4DU3 A;  3O4Q A;  4H0O A;  4U7B A;  1RNH A;  4DTO A;  4Y1C A;  3AO1 A;  4BC3 A;  1X3M A;  3OYD A;  1NGC A;  2ZE2 A;  1WSH A;  2BE2 A;  3NGI A;  3MXI A;  1Z6R A;  4GVE A;  1KXP A;  3EE8 A;  2P9N A;  4G1Q A;  3R6M A;  4FJJ A;  1ZBF A;  4CIF A;  5AQN A;  3S3M A;  3LWL A;  4JK7 A;  3THX A;  4CD1 A;  1KC8 O;  3THY B;  1MA9 B;  3AVH A;  3ZX0 A;  4DB3 A;  3WXK A;  2KZZ A;  3EKS A;  4CZF A;  1LV5 A;  2IGI A;  3VES A;  4GV9 A;  4QS8 A;  1VQ5 N;  3RRH A;  5AQR A;  5HBM A;  4AIL C;  3W3D A;  4FWO A;  3EE9 A;  2VYP A;  1SL2 A;  3OYA A;  3VMF B;  4LC9 B;  3D2F A;  1KVB A;  4FM0 A;  1NK9 A;  1KLN A;  4FWK A;  2QXF A;  2IVN A;  3D2E A;  1K8K A;  4PY5 A;  2D5R A;  3Q7B A;  3J8A A;  4KHQ A;  4JI2 K;  3CME N;  4FZY A;  2V7Y A;  2DTU A;  5ELZ A;  3THV A;  3O4W A;  3EZW A;  1EQY A;  2KFN A;  1MWM A;  1L3U A;  1V4T A;  3WXJ A;  3C6H A;  3SK3 A;  4CJ4 A;  3PX4 A;  3TAQ A;  3T7Z A;  4BE1 A;  4DLE A;  1HLU A;  3AO4 A;  4LY7 A;  1Q82 O;  2O4G A;  3AVF A;  5C2F A;  3SUO A;  2B6A A;  2KLA A;  2HW3 A;  3RR8 A;  4FW2 A;  4KTZ A;  4CED A;  4NCB A;  4GW6 A;  4ID5 A;  4C8O A;  4FSV A;  2PZS A;  2QEX N;  5HLF A;  2HNZ A;  1RT6 A;  4C8M A;  5JLF A;  3DLL L;  2NRZ A;  4FJG A;  3CXC M;  3HBT A;  1RT7 A;  3VQP A;  3AVC A;  4IO8 A;  3HPO A;  4O5B A;  2I5J A;  2DFH A;  4I2P A;  4F2R A;  2YHA A;  5KPZ A;  5BR9 A;  1NGA A;  4BDY A;  4DFK A;  1RTJ A;  4UQG A;  4JKG A;  3H45 C;  3DMJ A;  4DR2 K;  1SL0 A;  2Q1N A;  4OLB A;  4NLC A;  1RIL A;  1JLG A;  3MCP A;  1XQS C;  2IS3 A;  4M41 A;  2HHU A;  2HHX A;  3CHW A;  2P9P B;  4CZH A;  2OZS A;  3I33 A;  4KHW A;  3V81 A;  1IKV A;  1GLB G;  4E7L A;  5F2R A;  4R79 A;  4KRF A;  2A42 A;  4CZE A;  3UKR A;  2RF2 A;  4QOZ B;  5CR4 A;  2G8H A;  2EHG A;  1VQO N;  5KI6 A;  1KLM A;  3TAG A;  4FJN A;  4HWI A;  4B1X B;  3DOL A;  3M5R A;  4Q5V A;  4JHD B;  1L3S A;  3L2W A;  3I55 N;  3AVN A;  2HF4 A;  4DTN A;  3ID6 A;  5KTQ A;  3CJB A;  4CFA A;  4E7K A;  4BR4 A;  5CY4 A;  5A2Q O;  3RTV A;  4CK3 A;  1VQ6 N;  3PO4 A;  4FPB A;  2DPN A;  5BPL A;  4DR5 K;  3KK2 A;  1F21 A;  4KHN A;  4CK2 A;  4LF5 K;  3CCR N;  4FXD A;  3RVC A;  3CI5 A;  1CXU A;  3FZH A;  4A62 A;  4WFA L;  4FJM A;  4DCH A;  3NCI A;  2X6S A;  1G99 A;  5AQY A;  1T05 A;  3A5M C;  3VA3 A;  4Q0B A;  2KZM A;  4ELT A;  1QSY A;  3CC2 N;  1U45 A;  3ATV A;  5KPT A;  3SNN A;  1TKD A;  3MXM A;  2HB5 A;  4OO1 J;  3FFI A;  3U3G A;  3DXK A;  3HK2 A;  4CF9 A;  1DTT A;  1S1T A;  5AQG A;  3NMU A;  4DQQ A;  4B3T K;  5T7B A;  1YJ9 N;  3IKM A;  1ZBS A;  5GAD P;  3CD6 N;  3VEW A;  3VF4 A;  1Q81 O;  3SYZ A;  1NMN A;  1ASV A;  2HST A;  3KD5 E;  1YIJ N;  3O6W A;  5DM6 L;  3VEX A;  5LY3 A;  3HL8 A;  3CCE N;  1NKC A;  1TAQ A;  1VQ9 N;  4KHS A;  1RCH A;  5AJ3 K;  3HVR A;  3SPZ A;  3SLC A;  3DLE A;  2O8E B;  5AR0 A;  5M1P A;  1YVU A;  5GIN A;  4OPJ A;  1FKP A;  2NRW A;  3R3L A;  4A5A A;  4AM7 A;  5C15 A;  5AFU A;  3CCU N;  4MDB A;  2O8B A;  4FJ5 A;  1BOT O;  5C0Y A;  2ATQ A;  4B9U A;  3G0Z A;  3W0L A;  1HNX K;  5FPM A;  4NXN K;  1QQC A;  2IAJ A;  1A5V A;  4OPA A;  3SUN A;  3ENB A;  4TSX A;  3TTF A;  4JI4 K;  3KIO A;  2YHB A;  4DR1 K;  3LP2 A;  1S1V A;  3TAE A;  2G8W A;  1BQM A;  1NOY A;  5JLH A;  3GL1 A;  4BRF A;  3TTC A;  3S41 A;  4CJF A;  4JI7 K;  2RN2 A;  1RBS A;  3SZ2 A;  4DTU A;  1W7A A;  4JI0 K;  4PA1 A;  1S72 N;  4OVL A;  1ZYQ A;  3SI6 A;  4OKJ A;  5JVH L;  4O4G A;  2CH6 A;  1VAZ A;  1UA0 A;  4EZ6 A;  4MO5 A;  3CJA A;  4DTX A;  1T6C A;  3J80 O;  3TTD A;  3B6O A;  3QLH A;  1LAV A;  1HNV A;  3AVA A;  4RCH A;  3PLA A;  3TAR A;  3I8D A;  3DLH A;  5EXW A;  1XWL A;  2FSJ A;  4WF9 L;  4OKK A;  3NF8 A;  5E41 A;  1JLQ A;  3CPW M;  4M3R A;  1T3V A;  4CHP A;  3RMB A;  4RW6 A;  1D9F A;  3D7E O;  4CZJ A;  4B3R K;  3VQ4 A;  1XNQ K;  1REV A;  1Z25 A;  1HNW K;  1NGB A;  1X9J A;  4AQY K;  1HPM A;  1BIS A;  2OYQ A;  1IKW A;  3O08 A;  1C1C A;  4K43 A;  5AQU A;  3KK1 A;  4IEI A;  2E4L A;  5AZI B;  1QHA A;  3ZX3 A;  3ULD A;  1XHX A;  4CE9 A;  3U9Z A;  3DRR A;  1BUP A;  1CLQ A;  4EHT A;  3HYF A;  3WNH A;  3DXM B;  1G15 A;  1X1P A;  4LF6 K;  4IJA A;  3P83 D;  1V4S A;  5CHI A;  4CF8 A;  2JWK A;  1SV5 A;  2A1S A;  3MCA B;  4M3U A;  5IT9 O;  5J2Q A;  4FWS A;  5J1E A;  4DSI A;  1TK8 A;  1OH7 A;  3MN5 A;  3O9R A;  5KQ8 A;  1N32 K;  4X62 K;  5CZ2 A;  1JJ2 M;  3SAH A;  4DQP A;  1WSE A;  5LMU K;  3K9K A;  4FLZ A;  1HPZ A;  2Z1H A;  1LWC A;  3ALY A;  2HBL A;  2NZT A;  4CEA A;  3RMD A;  3ZSO A;  3O8M A;  1BIU A;  2GEM A;  1X9S A;  2X74 A;  3CJ1 A;  3WQT A;  1X9W A;  4J2E A;  2HBM A;  5BRD A;  3U6F A;  3VQ6 A;  4FJ8 A;  3QEI A;  2VG6 A;  1CXQ A;  3SUP A;  1XI1 A;  3B8A X;  2F4V K;  3DLR A;  3O4N A;  4BRC A;  1Q18 A;  3GG4 A;  4E1M A;  4C23 A;  5ADX H;  2ZM6 K;  4YFU A;  5AQH A;  4B8A B;  3ULE A;  1T7P A;  4WCE L;  5C25 A;  3JYT A;  3P1G A;  2NRR A;  3IMX A;  4EP5 A;  4E1N A;  4KFB A;  3CFO A;  3KWG A;  2E6M A;  4DSJ A;  3D0P A;  5FPE A;  2KFZ A;  3LDL A;  4L8R B;  4CBX A;  4B1U B;  4JNE A;  4PL7 A;  3SQ2 A;  1NK0 A;  1LWE A;  3F9K A;  3LDN A;  1HX1 A;  4BR9 A;  1IG8 A;  1NMD A;  4IOX A;  3JSM A;  1HQE A;  2P9S A;  4XH5 A;  2O8F A;  5HL7 L;  3SJJ A;  1VSL A;  3DYA A;  4F3O A;  4M3T A;  1RBR A;  1YTU A;  3JXU A;  3FZF A;  2GWK A;  2QW9 A;  3H3O B;  3KKR A;  1HYZ A;  1JCG A;  3AO2 A;  3V1R A;  4Z4F A;  2V7Z A;  3VGM A;  3PIP L;  1LW2 A;  3EN9 A;  4JRQ A;  3DLK A;  3IFR A;  4Z4H A;  1VSE A;  4B9T A;  4ILJ A;  3T1A A;  3HM9 A;  3AVK A;  1ATS A;  4W5T A;  4KKO A;  5HRO A;  1TKX A;  4JKC A;  1XNR K;  4JD2 A;  3V4I A;  4CJK A;  2AJQ A;  4BQZ A;  4CHO A;  1NK4 A;  3L6Q A;  1RTI A;  4CCH A;  4E3S A;  3ZSZ A;  1TYQ B;  3ID8 A;  2WOM A;  1BWF O;  3KK7 A;  3OYG A;  2E5L K;  4IOA L;  3VQC A;  1BDG A;  3LWM A;  3KK3 A;  4BGB A;  2FBV A;  2VGN A;  2XY7 A;  4B3S K;  3FE1 A;  4FWQ A;  1GOA A;  3VQA A;  4BR0 A;  4JI6 K;  3CCJ N;  2P9K A;  2X78 A;  4CES A;  4EFH A;  1JLF A;  3P4I A;  5LJW A;  4LF8 K;  4PQU A;  1NLV A;  1KQS M;  3TAF A;  1SKS A;  2O8C B;  1QVF M;  3FZK A;  4JS5 A;  2OAN A;  4B1V A;  2VG5 A;  3EY1 A;  4O44 A;  2YJE A;  3OYJ A;  1HRH A;  3AVB A;  4JN4 A;  3GOI A;  3I8B A;  4Z0U A;  4CF2 A;  3C7N A;  1U47 A;  1K8A O;  4OJR A;  5BRH A;  3QIP A;  2HOE A;  3JAM O;  4CF0 A;  4DV3 K;  3KVG A;  1S1W A;  2P9N B;  2Q0R A;  1RGI A;  3V9S A;  4FLY A;  4F3T A;  4KTQ A;  3UB5 A;  3THX B;  1RT2 A;  4V19 S;  1LW0 A;  1E4F T;  4DSF A;  3OJU A;  1NJX A;  2OPP A;  4MLE A;  4FJL A;  3RMC A;  4HTU A;  4CJW A;  3QNO A;  2KHO A;  3M8P A;  1YJW N;  5BN8 A;  3O1W A;  4YDU C;  3J7A P;  4BRA A;  4H5T A;  3ZLJ A;  4CHZ A;  1R59 O;  4ISE A;  3MEG A;  5AFU H;  3SUQ A;  2BAN A;  2EWS A;  5EU7 A;  3TSU A;  3G25 A;  4J2A A;  4IFV A;  2G8I A;  4DTM A;  3D2F B;  5HRP A;  1VSH A;  3CYM A;  3V1Q A;  3P39 A;  1BG3 A;  3D2E B;  1K8K B;  4Z4C A;  4FK4 A;  1I94 K;  4CVN E;  1N5Y A;  3ITH A;  1S1U A;  3IUC A;  5CYQ A;  3MMV A;  2F9T A;  3K5M A;  1NBW A;  1XMQ K;  3T1H K;  2QWN A;  3DAW A;  4HVJ A;  4FWR A;  4CFD A;  2DFF A;  3D45 A;  3O9U A;  5GAE P;  1KVA A;  3QFP A;  2GV9 A;  3BF1 A;  1J6Z A;  3WNE A;  4AHV A;  2Z1I A;  4NXM K;  4MFB A;  3O80 A;  4KB0 A;  2NUB A;  4B1Z A;  4B9N A;  3VQE A;  2FBY A;  3BZK A;  1YTA A;  4OX9 K;  2PAV A;  1EKE A;  4CZL A;  4KH4 A;  3SQ4 A;  3MXJ A;  1W0H A;  2WFB A;  1TUU A;  3AA4 A;  4ICL A;  2HHH K;  4B3O A;  4O55 A;  5TKW A;  3LP3 A;  4FVU A;  1T8E A;  4CFB A;  2OCE A;  3AVL A;  4KH6 A;  4JKG B;  3LDS A;  1VK0 A;  2XRI A;  3CQX A;  3PO5 A;  1JCE A;  1RDB A;  3P38 A;  1XHZ A;  1E4G T;  2E88 A;  4CD3 A;  2KTQ A;  1RT5 A;  3VQB A;  5AQZ A;  3LAM A;  1NJI O;  3L2V A;  2BTF A;  3NBP A;  4J8F A;  4MLH A;  1U4B A;  4PKH A;  3L2R A;  1KAZ A;  2OPQ A;  3QNN A;  3LAN A;  2YHY A;  4Z4E A;  2B5J A;  1QE1 A;  3V9Z A;  4DWI A;  3UKR B;  4K42 A;  3QIN A;  3OJS A;  1U6Z A;  4DSK A;  1BI4 A;  3I56 N;  3H08 A;  3VF6 A;  2Z1G A;  4YOV A;  2A3Z A;  1TK0 A;  2P9I A;  4E19 A;  3EO3 A;  2DFE A;  4HUE A;  3IRX A;  4H4M A;  4Z4G A;  1QQO A;  2ZJR L;  4BQL A;  5C42 A;  1HR0 K;  1BU6 O;  1DLO A;  4ELV A;  4LF7 K;  1RTD A;  3TI0 A;  4H0X B;  4JS4 A;  4CJT A;  3L0Q A;  5EX5 A;  2ZGY A;  4I2Q A;  1KTQ A;  2Y1I A;  1QS4 A;  3J7Y P;  1BL3 A;  1O1W A;  3A2F A;  2PY5 A;  4OPH A;  5CZ1 A;  3PV8 A;  3EZ5 A;  3ZT4 A;  4EAH D;  1ZBU A;  2E1Y A;  4H4O A;  2GTD A;  4AM6 A;  4YDU A;  2ZD1 A;  1VSI A;  4MQ3 A;  3ISN C;  1S6P A;  2VWB A;  5DK5 A;  5BPN A;  4NCA A;  4GY2 B;  3VEO A;  1IJJ A;  2OTJ N;  3MK6 A;  4CJ7 A;  5JIC A;  2W6L A;  2B4J A;  1LOT B;  3K59 A;  3BP8 A;  3SCX A;  3K5N A;  1IH7 A;  3DXK B;  4LF4 K;  3NF9 A;  2XHB A;  1S22 A;  3IDH A;  4ILH A;  4FLX A;  1NKE A;  4J2B A;  1WAF A;  5AQJ A;  1BIZ A;  2YNG A;  4H0P A;  2GUI A;  2A40 A;  3AGK A;  1C0F A;  3SV3 A;  4QCL A;  4DFM A;  2I7P A;  1WNS A;  2RPI A;  2I7N A;  4FL9 A;  4FZX C;  2GWJ A;  2QI2 A;  1NM1 A;  4KV8 A;  3JS6 A;  2YX6 A;  4AHT A;  2WON A;  3TPQ A;  2NNW A;  4WQ4 C;  5I42 A;  4HCB A;  2O8B B;  3DRS A;  2YV0 X;  2QXL A;  2XO7 A;  2QA4 N;  4K41 A;  3OBW A;  1O13 A;  1W97 L;  2ZWH A;  2QKK A;  4WQ5 C;  1TUY A;  5M1F A;  1N36 K;  2ZQB A;  1FK9 A;  3QO9 A;  1VRT A;  1HUX A;  3O1B A;  4CIE A;  4DV2 K;  5FPN A;  1HNI A;  3I0R A;  5AQK A;  3ZSW A;  5AQX A;  4YOX A;  4M42 A;  3UKU A;  2PYJ A;  1D9D A;  2Q97 A;  2WUS A;  4CJL A;  3CPE A;  2HMI A;  3QER A;  2VWJ A;  1OH5 A;  1QHT A;  3M1F A;  4GKK K;  2CH5 A;  1C6V A;  4BR2 A;  4BGA A;  3VQD A;  2D0C A;  2D1K A;  1KD1 O;  4XIU A;  3RSE A;  1D4X A;  3F9M A;  3TU5 A;  2F9W A;  1X3N A;  3ASM A;  5J2N A;  1NGE A;  3MAQ A;  4C1N K;  4N76 A;  1Q9Y A;  3U4L A;  3HOT A;  3CFP A;  3PX0 A;  3OYC A;  5FLX O;  3THW A;  2CGJ A;  2G8U A;  1WBB A;  5C24 A;  4C8N A;  2BUP A;  4DV1 K;  3AVM A;  1W9H A;  4GV3 A;  4AF1 A;  3OYK A;  3RMA A;  4FJ7 A;  4H0T B;  4Z4I A;  4CGD A;  1NJZ A;  3QB0 A;  4K25 A;  4B1W B;  4RWT A;  1N34 K;  1GOC A;  3AVJ A;  4I9Q A;  3WUH A;  2D0P A;  4DTJ A;  4CHN A;  5FRN A;  1VSD A;  1TK5 A;  1NK6 A;  2QWM A;  4ELU A;  4PHT X;  1JLB A;  2ZJQ L;  1XUP O;  2IVO A;  4CGI A;  3VOV A;  1C0M A;  3ZSY A;  3QFU A;  4DUY K;  3ZEU A;  3VEN A;  3G71 N;  1WSJ A;  3KZB A;  2KQ2 A;  1ZBH A;  2P9L A;  3OYM A;  4E7I A;  1M1K O;  1GLJ O;  3QBW A;  4Y1D A;  4CZI A;  3NFA A;  4IXC A;  4CZM A;  3WEE A;  1KFD A;  3ZT1 A;  4A5B A;  3MED A;  4JKB A;  3G10 A;  1S5J A;  1NWK A;  1U48 A;  2Q31 A;  4YOR A;  3AAP A;  3DLB A;  3HO1 A;  1UWB A;  1IBM K;  4JI3 K;  3K5L A;  4DQR A;  4KAZ A;  3AVI A;  3MEC A;  3IS9 A;  4GV6 A;  4K0K K;  3FZM A;  3AGR A;  4CGH A;  3O9S A;  3HXM A;  4WQ4 A;  3GBT A;  3EKU A;  1VSJ A;  2ZJP L;  4DMN A;  1LCU A;  3NVM A;  1JLE A;  2RKI A;  3KJV A;  3WXM B;  4OPK A;  2E2N A;  2YCH A;  3AA5 X;  3ENH A;  4WQ5 A;  5KRS A;  4F4K A;  5I9E B;  2QWQ A;  3NHG A;  3DRP A;  1D8Y A;  4FJK A;  3KLE A;  2HBK A;  2O8D A;  4H0Y B;  3M6G A;  3DLG A;  4CW7 B;  2WBN A;  2NRX A;  5FRM A;  3LP0 A;  4B9L A;  5CE3 A;  1IV0 A;  3ULE B;  1EX4 A;  3SV4 A;  1HYV A;  3OYN A;  2Y1J A;  4GKJ K;  5GAG P;  1S1X A;  3DOK A;  3KKS A;  3MWT A;  4CK1 A;  4O0J A;  1Z05 A;  3V9X A;  1YVN A;  2HNY A;  3HTV A;  2ASM A;  2W42 A;  3OS2 A;  4KI4 A;  2G8K A;  1NNE A;  4N56 A;  5M1Q A;  3HZ6 A;  4BVP A;  3O3G A;  3B6P A;  2AA4 A;  4IKF A;  1EP4 A;  1NGI A;  1VSK A;  2P1J A;  1WSG A;  2P9S B;  3E9L A;  2W40 A;  4JAX A;  2ETJ A;  2OTL N;  3BGR A;  3CC4 N;  2O8F B;  2PYL A;  1NJY A;  3L3V A;  4FZZ A;  4CJQ A;  3ZSR A;  4IJN A;  4X65 K;  1Q86 O;  5AQL A;  1L3V A;  3C6U A;  3HP9 A;  1KRP A;  4E7J A;  3NVK A;  4HCC A;  4RG8 A;  4CGF A;  4DS4 A;  4A59 A;  1U2V A;  4FWN A;  4B9Q A;  2PFU A;  3NGY A;  3VQ9 A;  2HHS A;  4A2B A;  4DR4 K;  3O9Q A;  1HKB A;  1C1B A;  1BCM A;  3L8B A;  1GLA G;  2KKZ A;  4JD2 B;  3N4Q A;  2G8V A;  5KRT A;  1NGJ A;  1JL2 A;  1SKW A;  1YUW A;  1TAU A;  4CI6 A;  1DGK N;  2FC0 A;  1NJW A;  3VQ5 A;  1QSL A;  5DM7 L;  4E7H A;  1WSF A;  1HNZ K;  5J2M A;  3K9J A;  3LP1 A;  3VEV A;  3OYE A;  1J5E K;  4PKG A;  2WTU A;  2NRV A;  3C95 A;  4NYF A;  2YHX A;  3VER A;  2BGG A;  4YOT A;  4LFB K;  4IDK A;  3VTH A;  2P9K B;  1Y64 A;  2HVH A;  4DR6 K;  4LH5 A;  5FDL A;  1QQN A;  4O5F A;  3TWH A;  1A5W A;  1Q7Y O;  1YAG A;  3D6R A;  3ZSV A;  1NGH A;  1C0T A;  2ITM A;  5AQV A;  3RR7 A;  3WXL A;  2D0O A;  3FR0 A;  3AAR A;  3KHY A;  4DHY A;  3C7N B;  1NU0 A;  5AQT A;  3SPY A;  2E8A A;  1KAX A;  4BRD A;  4IWV A;  3NF7 A;  1QQM A;  2XY8 A;  5C12 A;  1TKT A;  1RT1 A;  3QDK A;  1WAJ A;  5D3G A;  3KLF A;  4M3X A;  2A5X A;  2UYT A;  3A5L C;  4CEQ A;  5SZT A;  4O8U A;  2NRH A;  1J5O A;  5EY4 A;  1T6D A;  3HJF A;  4XEI A;  4XH1 A;  5K14 A;  3SAF A;  3MX5 A;  3HPG A;  3P5J A;  4C1N I;  4PUO A;  2FSN A;  5TKY A;  1RBT A;  1S3X A;  3WNF A;  3AY9 A;  1QTM A;  5EOY A;  4BRM A;  4ILG B;  3C0B A;  4ZTF A;  2VG7 A;  1I3A A;  1VQL N;  3L4Q A;  3EL2 A;  1JXB A;  3FFK B;  2YNH A;  4AHS A;  4CJV A;  3DI6 A;  1OH6 A;  5JS2 A;  4YY3 K;  3E1Y A;  3F5T A;  3OYL A;  4GMJ B;  3FLC O;  3G6E N;  2YHW A;  4DLG A;  4KI6 A;  1YI2 N;  3H46 O;  2LSN A;  2XY6 A;  3ZT0 A;  3OTO K;  3M8R A;  1WB9 A;  5E26 A;  3U9D A;  3CF5 L;  1YXQ A;  4H5V A;  1NK7 A;  3ENO A;  4CF1 A;  2GX9 A;  4KBO A;  2E1Z A;  4JEP A;  1DTQ A;  5AZJ A;  3ZYY X;  1MWK A;  2OZM A;  5B8H A;  4AHR A;  4BDP A;  3E01 A;  4BE0 A;  4JV5 K;  4BRL A;  4YOW A;  2HHV A;  5HRS A;  2E6L A;  3A5N C;  3CMA N;  4K8X A;  3AA2 A;  4CZG A;  4I9L A;  2UXB K;  2JLE A;  3VPZ A;  3N4P A;  4YHH K;  1N8R O;  2F96 A;  4O0I A;  4FK2 A;  3A8Y A;  3VEZ A;  4E89 A;  4HUG A;  3QEV A;  4F2S A;  4CHQ A;  4G9Z A;  2DY4 A;  3UE5 A;  2BDP A;  1B9F A;  1SS6 A;  1TL3 A;  3NDK A;  4MO4 A;  3V6D A;  4CEC A;  4FOI A;  4QS9 A;  3M8Q A;  4I6M A;  3LDO A;  4F8R A;  3HI0 A;  1KFS A;  1ASU A;  5KQD A;  4LFC K;  4B08 A;  3CJ7 A;  3AA3 A;  5BPM A;  3CCL N;  1KSP A;  4BY9 C;  4FW1 A;  4RW4 A;  4WFN L;  4CEZ A;  3NF6 A;  1YF5 L;  1BI4 B;  5AQW A;  5AQO A;  4DV4 K;  1BQN A;  1HJO A;  5CYM A;  1J54 A;  2P9I B;  4DF8 A;  4BRI A;  3R9P A;  1Q9X A;  4ZHR A;  4FJI A;  1ZXO A;  4BE2 A;  3DJC A;  4AH9 A;  4W5N A;  3WT0 A;  3VEY A;  4FJ9 A;  3TAP A;  4CJ3 A;  1CZ9 A;  1OVY A;  1MDU B;  1B92 A;  1P90 A;  4H8K A;  3CQ8 A;  1ATN A;  4HUF A;  3U8X A;  3TSQ A;  4QS7 A;  4CEE A;  1P8Z A;  4W5Q A;  4FLV A;  4JKF A;  2OA8 A;  1VQ8 N;  1SUQ A;  4PWD A;  1HYS A;  4JK8 A;  4FM1 A;  1JKH A;  4J2D A;  1GLD G;  3PX6 A;  3UIQ A;  1TL1 A;  3DWL A;  4HTL A;  4DTP A;  5F0X A;  3OS1 A;  1M90 O;  2A1R A;  1CZA N;  3KLI A;  3PY8 A;  4DQI A;  3RWU A;  3L3U A;  1RDD A;  2EX3 A;  3F73 A;  4FLW A;  4PKI A;  3WXI A;  2ASP A;  4X64 K;  3OYF A;  3TR8 A;  5C2D A;  1BGX T;  3C94 A;  4OKE A;  1WUA A;  3C6T A;  4IZ9 A;  3VN5 A;  4M45 A;  2P9U A;  5HRR A;  1ZBI A;  4MDA A;  2PBD A;  3CER A;  5BRF A;  4JKA A;  1WN7 A;  3MN6 A;  3VF2 A;  2HVI A;  2FLO A;  1HJR A;  3O5B A;  1Z26 A;  3CQY A;  4CGG A;  3ZET A;  3K5O A;  3OYB A;  4KPY A;  2GEL A;  3LAL A;  5BN9 A;  3SMS A;  1GLE G;  2VWK A;  4H0V B;  3H3N O;  3CJ9 A;  2ZF5 O;  3VQ8 A;  2HND A;  5BR8 K;  4M63 C;  2VQE K;  4BR5 A;  3O3F A;  3QEX A;  3VGK A;  4CZK A;  3LZI A;  4ISG A;  5IWA K;  3U3Y A;  1GOB A;  4LH4 A;  3BY5 A;  4CJU A;  2UUA K;  4KHU A;  5ADX A;  4N5S A;  5GIP A;  1S6Q A;  2VGM A;  3L4I A;  3OBY A;  2QTD A;  2NLX A;  3V1O A;  1BA0 A;  3S9H A;  3ZSX A;  1KAY A;  3UKU B;  3THY A;  3LDQ A;  1DT9 A;  1WLJ A;  1VHX A;  3K57 A;  3CCV N;  3R8E A;  2A6A A;  3VTI A;  3CC7 N;  4EHU A;  1RBV A;  4OLA A;  2QM1 A;  1ILY A;  3QIC A;  3KWI A;  1IG9 A;  2FBT A;  2F8S A;  1VQM N;  2E2P A;  4DTR A;  1IBL K;  1C0U A;  3ZX2 A;  3RSE B;  4OGE A;  3T3F A;  2GBZ A;  3GDQ A;  3HP6 A;  3V9W A;  1RDC A;  1RDU A;  4M3Z A;  5M1K A;  4CFC A;  4BWJ A;  1UAX A;  3THW B;  1S9E A;  4H5W A;  4H03 B;  3CG7 A;  1T03 A;  4B9S A;  3J7Z O;  4DV7 K;  1SL1 A;  5H1S Q;  4DF4 A;  1TV6 A;  1YIT N;  4CHY A;  4DG1 A;  3QEW A;  4CER A;  1RT3 A;  3P31 A;  4NYN A;  1VQ7 N;  3T1Y K;  1WSI A;  2Q2R A;  5E84 A;  3AV9 A;  5C10 A;  1LWF A;  3LL3 A;  4B9V A;  1ESV A;  4NB4 A;  4WFB L;  1RDW X;  5M1N A;  4DV0 K;  3S3O A;  4FVM A;  2HMP A;  1E3M A;  2GUP A;  1VQN N;  5LJV A;  4IBN A;  4IG3 A;  5JMV A;  1L5U A;  3QEP A;  2VQF K;  4KRE A;  2IC3 A;  2IOC A;  2FSK A;  4CJE A;  2Q36 A;  3ZEU B;  2UU9 K;  3QET A;  4R5P A;  4KB1 A;  1QZ5 A;  1CZB A;  2P9L B;  2E2O A;  2Q0U A;  4WYB A;  1KCF A;  4DV5 K;  2IVP A;  4AHC A;  4BR7 A;  2AP1 A;  4BRP A;  1ZC6 A;  3CM5 A;  3WEE B;  4CGJ A;  4B3M K;  3M8S A;  3QES A;  4YNQ A;  1NOZ A;  4FJX A;  2X6N A;  3NE6 A;  3OS0 A;  3BEX A;  2P9P A;  4K8Z A;  2ASO A;  1QSS A;  4M3W A;  2HF3 A;  5LL6 Z;  2IIR A;  2QWL A;  3AO3 A;  4CJP A;  2QWP A;  1B9D A;  2QKB A;  3OHR A;  3HRG A;  1GLC G;  1XC9 A;  4FO0 A;  4JKD A;  4BDZ A;  3SAG A;  1BHL A;  3LPU A;  1K6Y A;  4IG0 A;  3CIP A;  3AAQ A;  1DEJ A;  5J2P A;  4JHD A;  3PUF A;  3C65 A;  4CJ5 A;  3LAK A;  2FXU A;  3LM9 A;  4W5O A;  1VSF A;  4XH4 A;  2O8D B;  5FRO A;  2RHK A;  2UXC K;  3PIO L;  1ITG A;  1EXQ A;  1RDA A;  1RFQ A;  3MN9 A;  2UXD K;  3T19 A;  5AQM A;  1D5A A;  2E20 A;  1EO1 A;  4ZTJ A;  1S9G A;  4W5R A;  1L3T A;  1JLA A;  3J81 O;  3ZCM A;  4BRH A;  4DQS A;  2HHT A;  5KGW A;  1QVG M;  3FZL A;  1NK5 A;  2G8F A;  4BC5 A;  3K58 A;  2W41 A;  3BZC A;  4CBW A;  1JXE A;  1BA1 A;  3HVT A;  1EWQ A;  4A2A A;  3G4S N;  2H3G X;  4E1J A;  4H5N A;  4BRN A;  3O9T A;  4CEO A;  3CET A;  1YT3 A;  1R0A A;  1GLF O;  2A41 A;  2UUB K;  4BVO A;  5FPD A;  1OH8 A;  2KW4 A;  4FPA A;  3O3H A;  4FJH A;  1Q8I A;  3H1V X;  3SMP A;  1U2V B;  1VSM A;  4DV6 K;  4BC2 A;  3LPT A;  3HST B;  2JGU A;  1UOC A;  2F8T A;  1BCO A;  4KTW A;  4A57 A;  4DSE A;  4DTS A;  2O8E A;  3LM2 A;  1HKC A;  3KTQ A;  2ZGZ A;  5EVZ A;  3K2P A;  3LDP A;  1I39 A;  2OPR A;  3A5O C;  2J4R A;  3OY9 A;  3WNG A;  2YI1 A;  1YJN N;  2Q3S A;  3TSP A;  4DUZ K;  2NRT A;  2YKN A;  4DR7 K;  3MEE A;  3TAN A;  4BRQ A;  3BUZ B;  4PL8 A;  4CEF A;  4BWM A;  2FF6 A;  5BRE A;  3HT3 A;  1FJG K;  4JRP A;  3NGZ A;  3FGU A;  2HHQ A;  1JCF A;  4BG9 A;  1VQK N;  4ID1 A;  2P5O A;  3OYI A;  1NKB A;  4EIA A;  2WC9 A;  4Y0W A;  4IOC L;  1WOQ A;  4JKH A;  2XY5 A;  4FLT A;  5HP1 A;  4KHY A;  3BF3 A;  3E66 A;  1XMO K;  4M3Y A;  4NLB A;  4HHT A;  3E9P A;  4C8K A;  5GIO A;  5F1X A;  2QWR A;  1U04 A;  2FF3 B;  4LF9 K;  1N6Q A;  4IFE A;  2F7T A;  2V51 B;  4DU4 A;  4AHU A;  1SKR A;  1NGD A;  4LD0 A;  4GNI A;  3KD1 E;  4KO0 A;  4DKW A;  3I0S A;  3CCM N;  1MU2 A;  3F2K A;  4NO7 A;  4Z94 A;  4FYD A;  4CJR A;  3CCS N;  1KVC A;  1X9M A;  4GVM A;  1RBU A;  3HPH A;  3QIO A;  1SZ2 A;  4X66 K;  2IDO A;  3DM2 A;  3CFR A;  4LSN A;  1VQP N;  4YOU A;  2O4I A;  2BH1 A;  1ATR A;  3CM6 A;  5AQS A;  3SBG A;  2V52 B;  2ITG A;  5AQP A;  5AZI A;  1IBK K;  3ZT3 A;  1ZBL A;  4DR3 K;  2E2Q A;  3KLG A;  2Z1J A;  4OGC A;  3NH0 A;  3RRG A;  2R7Y A;  3DXM A;  5I3U A;  4FOE A;  4ISF A;  4RW7 A;  3CCQ N;  5AZJ B;  5LMN K;  4B8C A;  1U49 A;  1NG9 A;  1OVQ A;  3MN7 A;  4A61 A;  1GLL O;  3VQ7 A;  3OVN A;  1UA1 A;  2P51 A;  3A0I X;  2FBX A;  1NGG A;  4CJS A;  1EWR A;  3IG1 A;  4KH5 A;  1FKO A;  4CEB A;  3L2U A;  5DMR A;  4IEE A;  4WE1 A;  2W6K A;  3E9O A;  4RW8 A;  2JWL A;  3NH1 A;  4BG8 A;  3R1X A;  4DS5 A;  3SQ1 A;  2UUC K;  3C6A A;  3ATU A;  3BDP A;  2D0A A;  1K73 O;  1JLC A;  1RTH A;  4U67 L;  4BAC A;  3GE1 A;  3LZJ A;  5AQQ A;  4B9M A;  4JYA K;  4JLH A;  2CGK A;  5HOO A;  4UY8 O;  3OW2 M;  1BO5 O;  3VQQ A;  4I6M B;  3AO5 A;  4RTF D;  4M7X A;  5AQI A;  2HHW A;  4QAG A;  3SJH A;  4KHP K;  1Y97 A;  4DFJ A;  4I7F A;  1W2B M;  4DQ8 A;  4E0D A;  3NH2 A;  4FLU A;  3EYZ A;  3EEQ A;  4N47 A;  4DU1 A;  2P5G A;  1EET A;  4LFA K;  2D4W A;  3CJC A;  3VA0 A;  1VRU A;  5HRN A;  5MLC Q;  1TVR A;  3ZT2 A;  3OA9 A;  3IAY A;  1N33 K;  5M1O A;  3ZSQ A;  1HMV A;  3MWP A;  4LSL A;  3PSF A;  1T44 A;  1J53 A;  1HKG A;  1TGO A;  2YNI A;  3T69 A;  4EZ9 A;  1TKZ A;  4NCG A;  4JI5 K;  3MX2 A;  5GAH P;  3MDQ A;  1FXX A;  4IFY A;  4F9O A;  1HQU A;  3OYH A;  2YKM A;  3NAE A;  1H1V A;  1LAW A;  4BRK A;  4C8L A;  1C1A A;  1NK8 A;  4IO9 L;  1SQK A;  3Q7C A;  2QWO A;  2D0B A;  3TAB A;  2OPS A;  4JK9 A;  1XC3 A;  1NGF A;  1K9M O;  1C0G A;  4N41 A;  3HSC A;  1J9A A;  2HBJ A;  1IKX A;  1SAZ A;  3H1Q A;  4O8K A;  3KLH A;  4BRO A;  1WBD A;  4EP4 A;  1VQ4 N;  4CIG A;  1RT4 A;  2VCP A;  5JVG L;  4L3Q A; 
#chains in the Genus database with same CATH homology
 1WLJ A;  1JLB A;  3SQ0 A;  3K57 A;  4YFU A;  1IO2 A;  1A5X A;  4CGI A;  4B8A B;  4DFP A;  1T7P A;  1C0M A;  1RBV A;  1IKY A;  3AVG A;  3ZSY A;  3P1G A;  5C25 A;  3JYT A;  4OLA A;  4EP5 A;  4E1N A;  1WSJ A;  4KFB A;  4FCY A;  2KQ2 A;  3CFO A;  2E6M A;  3L2Q A;  1IG9 A;  4DSJ A;  1ZBH A;  2FBT A;  2F8S A;  3OYM A;  3TAM A;  3D0P A;  4E7I A;  2KFZ A;  4L8R B;  5KGX A;  4Y1D A;  4DTR A;  2HHT A;  1C0U A;  3SQ2 A;  1NK0 A;  4OGE A;  1LWE A;  3T3F A;  2GBZ A;  3NFA A;  4DSL A;  3HP6 A;  3F9K A;  1KFD A;  2QK9 A;  3V9U A;  1RDC A;  3ZT1 A;  3JSM A;  3V9W A;  1HQE A;  3MED A;  3S3N A;  4M3Z A;  5SWM A;  3G10 A;  2YNF A;  4CFC A;  1S5J A;  4BWJ A;  1UAX A;  1U48 A;  4FK0 A;  4FM2 A;  4RW9 A;  5JS1 A;  1S9E A;  1JL1 A;  3CG7 A;  1T03 A;  4B9S A;  3DLB A;  1ASW A;  3HO1 A;  1UWB A;  3SJJ A;  1VSL A;  3DYA A;  3K5L A;  4DQR A;  1SL1 A;  4F3O A;  4DF4 A;  3AVI A;  1TV6 A;  3MEC A;  4KAZ A;  4M3T A;  1RBR A;  3IS9 A;  4CHY A;  1YTU A;  4DG1 A;  4DU3 A;  3QEW A;  3O4Q A;  4CER A;  4CGH A;  3KKR A;  1HYZ A;  1RNH A;  1RT3 A;  4DTO A;  3HXM A;  3AO2 A;  4Y1C A;  3AO1 A;  3OYD A;  3V1R A;  4Z4F A;  2ZE2 A;  4NYN A;  1WSH A;  2BE2 A;  1LW2 A;  1VSJ A;  4DMN A;  1WSI A;  4JRQ A;  3NGI A;  1JLE A;  3DLK A;  2RKI A;  3KJV A;  3AV9 A;  4Z4H A;  3MXI A;  4OPK A;  1LWF A;  4G1Q A;  4B9V A;  4FJJ A;  1VSE A;  1ZBF A;  4CIF A;  4B9T A;  3S3M A;  3AA5 X;  3LWL A;  5KRS A;  3T1A A;  4F4K A;  3HM9 A;  3AVK A;  4W5T A;  3S3O A;  3NHG A;  4FVM A;  3DRP A;  4KKO A;  5HRO A;  1D8Y A;  4FJK A;  3KLE A;  1TKX A;  3V4I A;  4IBN A;  3DLG A;  4IG3 A;  3AVH A;  4CJK A;  2AJQ A;  5FRM A;  2KZZ A;  1L5U A;  3LP0 A;  4B9L A;  3QEP A;  4CHO A;  1LV5 A;  2IGI A;  4KRE A;  1EX4 A;  3SV4 A;  1NK4 A;  1RTI A;  1HYV A;  2IC3 A;  4E3S A;  3OYN A;  2Y1J A;  2IOC A;  4CCH A;  3ZSZ A;  4CJE A;  1S1X A;  2WOM A;  3RRH A;  3QET A;  4R5P A;  5HBM A;  4KB1 A;  3DOK A;  4AIL C;  3KKS A;  4CK1 A;  3OYG A;  4O0J A;  3V9X A;  1CZB A;  2HNY A;  1SL2 A;  3OYA A;  3VQC A;  3LWM A;  1KCF A;  3KK3 A;  3OS2 A;  2W42 A;  4AHC A;  2FBV A;  4KI4 A;  1KVB A;  4FM0 A;  1NK9 A;  2XY7 A;  1KLN A;  4N56 A;  3CM5 A;  2G8K A;  4CGJ A;  2QXF A;  3O3G A;  1GOA A;  3B6P A;  3VQA A;  3M8S A;  3QES A;  4IKF A;  4YNQ A;  4PY5 A;  2D5R A;  1NOZ A;  1EP4 A;  1VSK A;  2P1J A;  2X78 A;  1WSG A;  2X6N A;  1JLF A;  4CES A;  3NE6 A;  4FZY A;  4KHQ A;  2DTU A;  3OS0 A;  3THV A;  4PQU A;  2ETJ A;  3BGR A;  2KFN A;  4K8Z A;  4M3W A;  1QSS A;  3TAF A;  2PYL A;  1NJY A;  1SKS A;  1L3U A;  3L3V A;  4FZZ A;  4JS5 A;  4CJ4 A;  3AO3 A;  4CJQ A;  4CJP A;  3PX4 A;  3TAQ A;  4BE1 A;  3ZSR A;  4DLE A;  4F2S A;  2VG5 A;  3EY1 A;  4O44 A;  3OYJ A;  1HRH A;  1B9D A;  3AVB A;  2QKB A;  1L3V A;  4Z0U A;  3C6U A;  3AO4 A;  4CF2 A;  4LY7 A;  3HP9 A;  2O4G A;  1KRP A;  3AVF A;  1U47 A;  4E7J A;  4OJR A;  3SUO A;  1XC9 A;  3QIP A;  4RG8 A;  4HCC A;  4CGF A;  2B6A A;  4BDZ A;  4DS4 A;  1BHL A;  4CF0 A;  3LPU A;  1K6Y A;  4IG0 A;  5J2P A;  2HW3 A;  3PUF A;  1S1W A;  4FW2 A;  3RR8 A;  3NGY A;  3VQ9 A;  2HHS A;  4KTZ A;  4CED A;  4CJ5 A;  4FLY A;  3LAK A;  3V9S A;  4NCB A;  4KTQ A;  4GW6 A;  4ID5 A;  4C8O A;  4F3T A;  1C1B A;  1RT2 A;  4W5O A;  2PZS A;  1BCM A;  1VSF A;  3L8B A;  1LW0 A;  4DSF A;  2HNZ A;  5FRO A;  5HLF A;  1RT6 A;  4C8M A;  3OJU A;  1ITG A;  1NJX A;  2OPP A;  2G8V A;  5KRT A;  4FJL A;  1EXQ A;  1RDA A;  3RMC A;  3T19 A;  4FJG A;  4HTU A;  1JL2 A;  4CJW A;  1SKW A;  1RT7 A;  1D5A A;  3VQP A;  3QNO A;  1TAU A;  3AVC A;  3HPO A;  3M8P A;  4ZTJ A;  4O5B A;  1S9G A;  4W5R A;  2I5J A;  1L3T A;  1JLA A;  2DFH A;  2FC0 A;  1NJW A;  3VQ5 A;  4I2P A;  4F2R A;  3ZCM A;  4CHZ A;  4DQS A;  2YHA A;  4BDY A;  5KGW A;  1WSF A;  3MEG A;  4E7H A;  3SUQ A;  2BAN A;  1QSL A;  5EU7 A;  1RTJ A;  4UQG A;  4DFK A;  1NK5 A;  4J2A A;  4IFV A;  3DMJ A;  5J2M A;  2G8I A;  4DTM A;  1SL0 A;  5HRP A;  2G8F A;  3LP1 A;  3OYE A;  1VSH A;  3CYM A;  3V1Q A;  4OLB A;  3K58 A;  3C95 A;  4NYF A;  1RIL A;  1JLG A;  2BGG A;  4IDK A;  4Z4C A;  2IS3 A;  4FK4 A;  1JXE A;  2HVH A;  4M41 A;  3HVT A;  4LH5 A;  5FDL A;  2HHU A;  2HHX A;  1N5Y A;  3ITH A;  1S1U A;  3TWH A;  1A5W A;  5CYQ A;  2OZS A;  4KHW A;  3V81 A;  3K5M A;  1IKV A;  4E7L A;  4CEO A;  3ZSV A;  4KRF A;  4HVJ A;  1C0T A;  1YT3 A;  2RF2 A;  1R0A A;  4CFD A;  4QOZ B;  2DFF A;  3D45 A;  2G8H A;  3RR7 A;  1KVA A;  2EHG A;  2GV9 A;  5KI6 A;  1KLM A;  3TAG A;  3SPY A;  2KW4 A;  3WNE A;  4FJN A;  3O3H A;  4AHV A;  4FJH A;  1Q8I A;  2XY8 A;  3NF7 A;  1TKT A;  3DOL A;  2Z1I A;  1VSM A;  1RT1 A;  4Q5V A;  4FJX A;  1WAJ A;  3LPT A;  1L3S A;  4MFB A;  3KLF A;  4M3X A;  3HST B;  5D3G A;  3L2W A;  2JGU A;  1UOC A;  2F8T A;  1BCO A;  4KTW A;  4CEQ A;  3AVN A;  4DSE A;  4DTS A;  4DTN A;  2NUB A;  4KB0 A;  4B9N A;  3VQE A;  5KTQ A;  5SZT A;  2FBY A;  1YTA A;  3KTQ A;  4CFA A;  1J5O A;  1EKE A;  4E7K A;  5CY4 A;  3HJF A;  3K2P A;  3SQ4 A;  3RTV A;  3MXJ A;  1W0H A;  5K14 A;  4CK3 A;  1I39 A;  2OPR A;  3PO4 A;  3HPG A;  3AA4 A;  3P5J A;  4ICL A;  4PUO A;  3OY9 A;  3WNG A;  4B3O A;  1RBT A;  3WNF A;  1F21 A;  4O55 A;  3LP3 A;  3KK2 A;  1QTM A;  4KHN A;  4CK2 A;  1T8E A;  2Q3S A;  4CFB A;  4ZTF A;  3AVL A;  2YKN A;  4FXD A;  2VG7 A;  1I3A A;  3LDS A;  4FJM A;  1VK0 A;  2XRI A;  3PO5 A;  1JXB A;  2YNH A;  4AHS A;  4CJV A;  3MEE A;  3DI6 A;  1RDB A;  3NCI A;  3TAN A;  1XHZ A;  2X6S A;  1T05 A;  3VA3 A;  2KTQ A;  4CEF A;  1RT5 A;  4Q0B A;  3VQB A;  2KZM A;  4ELT A;  3LAM A;  5JS2 A;  3L2V A;  4BWM A;  1QSY A;  1U45 A;  3NBP A;  3HT3 A;  3SNN A;  3OYL A;  4GMJ B;  1TKD A;  1U4B A;  4JRP A;  3NGZ A;  3L2R A;  4DLG A;  3MXM A;  4KI6 A;  2HB5 A;  2OPQ A;  3FFI A;  3U3G A;  3LAN A;  3QNN A;  2HHQ A;  4Z4E A;  2B5J A;  1QE1 A;  2LSN A;  4CF9 A;  3ZT0 A;  4ID1 A;  1DTT A;  1S1T A;  3V9Z A;  3OYI A;  4DQQ A;  2XY6 A;  1NKB A;  3QIN A;  3OJS A;  3M8R A;  5T7B A;  4C8L A;  2XY5 A;  4DSK A;  1NK7 A;  3SYZ A;  4FLT A;  5HP1 A;  1BI4 A;  4CF1 A;  1ASV A;  4KHY A;  3KD5 E;  3H08 A;  1DTQ A;  4M3Y A;  4HHT A;  2Z1G A;  4C8K A;  3HL8 A;  2OZM A;  1U04 A;  1TK0 A;  1NKC A;  4AHR A;  4BDP A;  4E19 A;  1TAQ A;  1N6Q A;  2DFE A;  4KHS A;  3E01 A;  1RCH A;  3HVR A;  3IRX A;  4HUE A;  4BE0 A;  4DU4 A;  4H4M A;  4AHU A;  3SPZ A;  1SKR A;  3DLE A;  4Z4G A;  4LD0 A;  3KD1 E;  4KO0 A;  2HHV A;  5HRS A;  2E6L A;  5C42 A;  1DLO A;  4ELV A;  3I0S A;  1YVU A;  4K8X A;  3HK2 A;  3AA2 A;  1MU2 A;  4OPJ A;  1FKP A;  4I9L A;  1RTD A;  3TI0 A;  4JS4 A;  2JLE A;  4CJT A;  4FYD A;  4CJR A;  2F96 A;  1KVC A;  4O0I A;  4FK2 A;  4I2Q A;  1KTQ A;  2Y1I A;  4FJ5 A;  1X9M A;  2ATQ A;  1QS4 A;  3QEV A;  4GVM A;  1RBU A;  3G0Z A;  1BL3 A;  1O1W A;  3A2F A;  4E89 A;  4CHQ A;  4HUG A;  2PY5 A;  2DY4 A;  2BDP A;  3HPH A;  3QIO A;  1B9F A;  1QQC A;  5CZ1 A;  1TL3 A;  2IAJ A;  1A5V A;  3EZ5 A;  3NDK A;  4CEC A;  3V6D A;  3PV8 A;  3ZT4 A;  4DWI A;  2IDO A;  3DM2 A;  3CFR A;  1ZBU A;  3SUN A;  4LSN A;  4TSX A;  4H4O A;  3KIO A;  2O4I A;  2ZD1 A;  1VSI A;  4MQ3 A;  2YHB A;  3ISN C;  3LP2 A;  3CM6 A;  1S6P A;  1S1V A;  3M8Q A;  5DK5 A;  3TAE A;  1BQM A;  2G8W A;  1NOY A;  4NCA A;  2ITG A;  4CJF A;  2RN2 A;  1RBS A;  3ZT3 A;  3SZ2 A;  4DTU A;  2B4J A;  1ZBL A;  3K59 A;  3SCX A;  4F8R A;  3K5N A;  1KFS A;  4PA1 A;  1ASU A;  1IH7 A;  2Z1J A;  3KLG A;  4OVL A;  4OGC A;  3NH0 A;  3RRG A;  1ZYQ A;  2R7Y A;  3NF9 A;  4B08 A;  2XHB A;  4OKJ A;  3SI6 A;  5I3U A;  4FLX A;  1NKE A;  3AA3 A;  4J2B A;  1WAF A;  4O4G A;  1BIZ A;  1KSP A;  4FW1 A;  4RW4 A;  2YNG A;  4CEZ A;  3NF6 A;  1UA0 A;  4EZ6 A;  2GUI A;  4RW7 A;  1BI4 B;  4DTX A;  3B6O A;  1BQN A;  3QLH A;  4QCL A;  1LAV A;  3SV3 A;  5CYM A;  1HNV A;  4B8C A;  1J54 A;  1U49 A;  4DFM A;  1WNS A;  2RPI A;  4DF8 A;  3AVA A;  1Q9X A;  3VQ7 A;  4ZHR A;  3OVN A;  4BE2 A;  3TAR A;  3I8D A;  1UA1 A;  3DLH A;  4FJI A;  4AH9 A;  4W5N A;  2P51 A;  1XWL A;  2FBX A;  4FJ9 A;  3TAP A;  4FZX C;  4CJ3 A;  4OKK A;  4CJS A;  1CZ9 A;  3NF8 A;  5E41 A;  1B92 A;  1JLQ A;  4KV8 A;  4H8K A;  4M3R A;  3CQ8 A;  4AHT A;  4CHP A;  4HUF A;  3RMB A;  3IG1 A;  2WON A;  1FKO A;  4RW6 A;  4CEB A;  1D9F A;  4CEE A;  5I42 A;  4HCB A;  3L2U A;  4W5Q A;  5DMR A;  3VQ4 A;  3DRS A;  2YV0 X;  1REV A;  4FLV A;  4WE1 A;  2OA8 A;  2XO7 A;  4RW8 A;  3NH1 A;  3SQ1 A;  4DS5 A;  1SUQ A;  4PWD A;  1HYS A;  1Z25 A;  3BDP A;  2D0A A;  2QKK A;  1JLC A;  4FM1 A;  1RTH A;  1JKH A;  4BAC A;  4J2D A;  1BIS A;  2OYQ A;  1IKW A;  3KK1 A;  1C1C A;  3PX6 A;  2ZQB A;  1FK9 A;  3UIQ A;  1TL1 A;  3QO9 A;  1VRT A;  4DTP A;  3LZJ A;  4B9M A;  3OS1 A;  4JLH A;  2E4L A;  2A1R A;  4CIE A;  3VQQ A;  1HNI A;  3I0R A;  3AO5 A;  3KLI A;  3PY8 A;  3ULD A;  1XHX A;  3ZSW A;  4CE9 A;  2HHW A;  3DRR A;  2P5O A;  4DQI A;  3RWU A;  3L3U A;  4QAG A;  1RDD A;  2EX3 A;  3F73 A;  4FLW A;  2PYJ A;  1CLQ A;  1D9D A;  3HYF A;  3WNH A;  1G15 A;  4CJL A;  1X1P A;  3OYF A;  2HMI A;  1Y97 A;  3TR8 A;  4DFJ A;  4I7F A;  3QER A;  2VWJ A;  1BGX T;  3C94 A;  4OKE A;  3P83 D;  3C6T A;  3VN5 A;  1QHT A;  4M45 A;  4E0D A;  3NH2 A;  4FLU A;  4CF8 A;  3EYZ A;  5HRR A;  4N47 A;  4DU1 A;  2P5G A;  1ZBI A;  1C6V A;  1EET A;  1SV5 A;  3VA0 A;  1VRU A;  4M42 A;  5HRN A;  1WN7 A;  3VQD A;  1TVR A;  2A1S A;  2D0C A;  2HVI A;  3ZT2 A;  1HJR A;  4XIU A;  3IAY A;  1Z26 A;  4M3U A;  3ZSQ A;  3ASM A;  5J2N A;  1HMV A;  3MAQ A;  4CGG A;  3OYB A;  3K5O A;  4LSL A;  4KPY A;  4N76 A;  5J2Q A;  3LAL A;  1Q9Y A;  1J53 A;  5J1E A;  4DSI A;  1TK8 A;  3CFP A;  1TGO A;  3OYC A;  3PX0 A;  2YNI A;  4EZ9 A;  2G8U A;  1TKZ A;  4NCG A;  5C24 A;  5CZ2 A;  4C8N A;  2VWK A;  1FXX A;  4DQP A;  1WSE A;  4IFY A;  4FLZ A;  3AVM A;  1W9H A;  1HQU A;  3VQ8 A;  1HPZ A;  2YKM A;  2Z1H A;  1LAW A;  1LWC A;  3ALY A;  3OYH A;  3NAE A;  1C1A A;  3OYK A;  3RMA A;  2HND A;  1NK8 A;  4CEA A;  4B9U A;  3RMD A;  4FJ7 A;  3ZSO A;  4Z4I A;  2D0B A;  3O3F A;  4CGD A;  3QEX A;  1BIU A;  3TAB A;  1NJZ A;  2OPS A;  2X74 A;  1X9S A;  1X9W A;  4J2E A;  3LZI A;  3U3Y A;  1GOB A;  4N41 A;  1J9A A;  4LH4 A;  4CJU A;  3U6F A;  1IKX A;  4KHU A;  3VQ6 A;  4FJ8 A;  3KLH A;  1GOC A;  2VG6 A;  3QEI A;  3AVJ A;  1CXQ A;  4N5S A;  4I9Q A;  3SUP A;  1XI1 A;  1S6Q A;  4DTJ A;  4EP4 A;  4CHN A;  5FRN A;  3V1O A;  3DLR A;  4CIG A;  1RT4 A;  1VSD A;  3O4N A;  1TK5 A;  3S9H A;  3ZSX A;  1NK6 A;  4E1M A;  4ELU A;  1CXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...