4HUGA

Structure of 5-chlorouracil modified a:u base pairs
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
134
structure length
134
Chain Sequence
b'EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
molecule tags Hydrolase/dna
source organism Bacillus halodurans
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
total genus 40
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hugA00
1WSFA 4DU3A 4RW6A 3DM2A 3TAGA 3OYBA 2FC0A 3AVNA 1WSEA 1VSIA 4C8OA 4JS5A 3G10A 2D0BA 3TAPA 1IH7A 4CEBA 5J1EA 3OYFA 1TKDA 3ZSWA 1W0HA 3PO4A 4C8LA 4H4OA 4Z4CA 3OS1A 3G0ZA 4EZ9A 1I3AA 2OPSA 2DFFA 5HP1A 2PYJA 4DU1A 5J2QA 1D9DA 4IFYA 1CXQA 3KLHA 3QINA 1ITGA 5J2NA 4DF4A 4CJQA 4FLWA 4AHUA 4NYFA 3PUFA 4KHQA 4FM2A 3K5MA 4OLAA 3ASMA 1I39A 3MAQA 3AVLA 4JLHA 3QEPA 4CFDA 3TWHA 2ZD1A 4DFKA 4NCBA 1EETA 3M8RA 5KI6A 1S1XA 3CFPA 1YT3A 3UIQA 4AHCA 1KVAA 3NF7A 4N47A 1YTAA 3LWLA 4I7FA 4CJLA 3DOKA 4AH9A 2R7YA 1NKBA 4B8CA 1JLBA 1UWBA 3HPGA 3V9XA 4FJ9A 3DLEA 1L3UA 4FW1A 4MQ3A 5KGWA 4FK4A 4F2SA 2HVHA 4Z4FA 1BIUA 4FXDA 3HVTA 3VQQA 4RW4A 2AJQA 2YHAA 5CZ2A 3IS9A 1TAQA 1ZBFA 1ASWA 4CESA 2XO7A 3CM6A 1BHLA 4YFUA 4K8XA 3AA5X 1UAXA 4OPJA 3TABA 1T05A 3KD5E 4FLVA 1RT3A 3ZT4A 3NFAA 3EY1A 1TAUA 3OYEA 4RW8A 3DOLA 1T8EA 3V1OA 4CIEA 4B08A 3T3FA 1TK0A 3ZT3A 3AVJA 1RBUA 3DLKA 3ZSYA 4LSLA 4CF2A 5KRTA 2YNHA 3DLHA 4FJXA 1TVRA 4W5QA 2KQ2A 4HUFA 3SQ4A 3DLGA 2B5JA 2HNDA 1FKOA 3NH0A 1IKWA 1D5AA 2E6MA 4DTRA 1NK5A 1UA1A 4Q0BA 2O4IA 3LZJA 1LW2A 4E7LA 1RDAA 5C42A 3I8DA 3L8BA 4DTSA 2PYLA 4NCAA 4K8ZA 4CJFA 4E89A 1ZBLA 3VQ6A 3MXJA 2HHQA 1BI4B 1RBTA 4RG8A 4O0IA 1WAJA 4M3RA 3NGIA 3U6FA 3PX6A 3OYCA 1UA0A 1KCFA 2HW3A 4GW6A 1RBRA 4KV8A 4OPKA 3M8SA 4HTUA 5FRMA 4Z4GA 4KREA 4FJ8A 1XHXA 1BIZA 1WAFA 1QS4A 3AA2A 4FM1A 3AVKA 1C0MA 4W5OA 4DFMA 1J54A 3KK3A 4E19A 4E7HA 1JLGA 3SUNA 3QEXA 2Y1IA 1EX4A 4B9UA 3NH2A 4DTXA 4FJ5A 1Y97A 2OZSA 2ZQBA 2ETJA 3ZSZA 4FJLA 3OVNA 2HVIA 2HNZA 3ZCMA 1NK9A 1HYVA 1XHZA 1RNHA 1X1PA 4CGDA 3NGZA 4ZTFA 3V9WA 1TV6A 3F9KA 2DFHA 4CIFA 2G8FA 4HUEA 3QETA 4CEQA 3JSMA 1XC9A 3AVHA 3U3GA 3KJVA 4C8MA 3O4NA 1A5VA 3NHGA 4LSNA 3SUOA 3VQ7A 1L3SA 4B9MA 5KTQA 1IKVA 3V6DA 3V4IA 4FYDA 3K5NA 1QTMA 4UQGA 2KW4A 4FJHA 1DTTA 3DLRA 3TI0A 4CEEA 2A1SA 1WN7A 2JGUA 3ITHA 3LZIA 3HK2A 3EYZA 4BWMA 4KHSA 3CM5A 1C1BA 3MEDA 1RT6A 2OPPA 4CECA 3HYFA 1WSIA 1RTHA 1C1AA 4CGGA 5T7BA 2DY4A 1JL1A 3M8QA 4OVLA 4CJWA 4ELUA 2VWKA 3LP1A 4FJNA 3TAFA 4DU4A 1TL1A 3QLHA 2HHXA 1VSMA 2YNGA 3NH1A 4BE0A 3S3OA 4BDYA 4E7IA 1S1TA 1VSFA 3M8PA 4EP5A 3QIOA 3V1QA 1CXUA 1RT4A 1S6PA 1VSLA 4FLZA 3V9SA 3ZT2A 3H08A 1DLOA 3OYNA 3IRXA 1RT7A 3LP0A 4AHRA 4FW2A 1HRHA 3OYAA 4O5BA 4AHVA 4CEOA 3KK1A 3PX0A 3SUQA 4CF9A 3E01A 1R0AA 1NK0A 3BGRA 3LP2A 5JS1A 4CJKA 3RTVA 1ZYQA 1GOBA 3S3NA 1QSSA 3S9HA 1NJXA 4CE9A 4DLGA 4IDKA 1NKEA 1KRPA 4TSXA 3V9UA 1T7PA 4DSLA 3CQ8A 2KFNA 1G15A 1RTDA 2X74A 3ZSOA 3SI6A 4J2EA 2BANA 2EHGA 1BCOA 1SKSA 4CGHA 2DTUA 3IAYA 4I2QA 1QHTA 3HL8A 4BDPA 1U04A 1SV5A 2RN2A 3OYDA 2F8TA 2HHUA 2WONA 2OPRA 4CJ4A 3PX4A 4CGIA 3K59A 3VQAA 4RW9A 4F2RA 4FZYA 1RT2A 4R5PA 3ALYA 3AO2A 5HRRA 1X9SA 3VQCA 2P51A 2YNIA 3K5LA 5J2PA 1YVUA 4DFPA 3ISNC 5HROA 5EU7A 4KHYA 1DTQA 2JLEA 3L2UA 4F4KA 4FK0A 3K57A 3K58A 3RMBA 3KTQA 2D0AA 1SL2A 3VQ5A 1C0TA 3ZT0A 3LP3A 3MXIA 4CHZA 2D5RA 4B9NA 3AO1A 4IKFA 1WNSA 3K5OA 4CK1A 5I3UA 2GUIA 2RKIA 4OKEA 1LAWA 4CJRA 3KIOA 1Q9YA 3RMAA 4QCLA 1SUQA 3O3FA 4KI4A 2ATQA 4JRPA 1RTJA 1QSLA 3EZ5A 2XY5A 2X6SA 4IG3A 4N56A 2QKKA 4DSKA 4KTQA 3O4QA 4FJKA 1BQMA 3AVBA 3HSTB 5E41A 1D8YA 3I0SA 2OPQA 3LANA 2P1JA 4H4MA 3OYHA 3VA0A 3O3GA 1REVA 3OJSA 3B6OA 5CYQA 3PV8A 3LALA 3RR7A 4KI6A 4DTUA 3HT3A 4KB1A 4GMJB 2IDOA 1RDBA 3CYMA 4DTJA 3TARA 1JKHA 1KSPA 4Q5VA 3QIPA 4CHNA 2FBTA 5SWMA 4I9LA 1HYZA 4N41A 4ELTA 4JRQA 4PQUA 4DQRA 2XRIA 4C8KA 4PUOA 4DG1A 3OYJA 3JYTA 1LWFA 1U4BA 2HHTA 1HMVA 3KLIA 4OJRA 3DYAA 4FLYA 4AILC 1JLEA 4M3TA 3HVRA 1VRUA 3WNGA 4CFCA 2VG5A 2HMIA 1LAVA 1WSGA 2Q3SA 2X6NA 3RMDA 1X9MA 2YKMA 1L3TA 1S5JA 4G1QA 3OJUA 1FXXA 2G8VA 3CG7A 2B4JA 2E6LA 1EKEA 4LY7A 1J5OA 4MFBA 2IC3A 3ZSXA 4LH4A 4N76A 1U48A 3C94A 4EP4A 3L2VA 3T1AA 4CFAA 4BACA 1HNIA 4CK2A 4AHTA 2Z1IA 3ZSQA 4B9SA 3AVIA 1S9GA 3MEGA 4WE1A 4YNQA 4PWDA 5C24A 1JL2A 5K14A 1NK8A 1KLMA 3LAMA 3L3VA 3KK2A 4FJGA 4FCYA 3AO5A 3AA3A 5DMRA 1LWCA 5HRNA 3OYGA 2O4GA 1NOYA 2I5JA 1HPZA 1ZBUA 3TAEA 4KHUA 1C0UA 4CJSA 4O44A 4CHPA 2IAJA 4KAZA 2HHSA 4KHNA 3SPYA 3QNNA 3HPOA 4I2PA 1N6QA 4CEZA 2YNFA 1VSDA 4KKOA 5FROA 2KZMA 3AVGA 3HP9A 2FBYA 4DSFA 4OLBA 3TAQA 4AHSA 1CLQA 3DI6A 3RMCA 3KKSA 2FBXA 1KLNA 4DQIA 3HO1A 3P5JA 1TGOA 1F21A 3DRRA 3KKRA 5HRSA 3VN5A 4OKKA 3KLEA 4OKJA 5J2MA 5HRPA 4CEDA 1B9FA 3ZT1A 1S1UA 3U3YA 1VSJA 5D3GA 2G8UA 4W5NA 1NJYA 4DS4A 1CZBA 1HQUA 3NBPA 3C6TA 4B9LA 3RWUA 4DQPA 1BISA 2G8WA 3AV9A 3RR8A 4CJEA 3AVMA 4M3WA 1EP4A 2Z1HA 2HHWA 4DFJA 1FKPA 1RDCA 4QAGA 3HPHA 3SNNA 1IKXA 1VSEA 4KTWA 4FLTA 1NJZA 1TKZA 1J9AA 1KFSA 3VQPA 3DRSA 3KLFA 4I9QA 4H8KA 1ASUA 4M42A 3NF6A 3SYZA 1L3VA 3CFRA 3MECA 3L2RA 4LH5A 4DTNA 1YTUA 3NE6A 1LV5A 1RDDA 3C6UA 3L3UA 1BI4A 3QEVA 1RTIA 1KVBA 3AO3A 2BDPA 4FZZA 3QEWA 2YV0X 2KFZA 3NCIA 1KVCA 3KD1E 1HNVA 3A2FA 1VSHA 3OYMA 2W42A 4E7JA 3NGYA 1KTQA 3T19A 3TR8A 1U45A 4CGFA 1EXQA 4C8NA 3OS2A 2XY7A 2A1RA 1NJWA 1Q9XA 2X78A 3WNHA 4Z4HA 4HCBA 4E1NA 4CHQA 2HNYA 4DQQA 1WSJA 4LD0A 4CCHA 4DMNA 3SCXA 3SPZA 3DLBA 1LWEA 1WSHA 4O4GA 3SV3A 4M3YA 1TKTA 4IBNA 2G8IA 4CF1A 3VQ9A 4B9TA 4KRFA 1BGXT 2GV9A 3SJJA 4OGEA 1SKRA 2ITGA 1RT1A 4Y1CA 2XHBA 3S3MA 1SL0A 4CJ3A 3AA4A 1VSKA 4O55A 1C6VA 3P83D 3QEIA 3PO5A 4FJJA 3HM9A 4JS4A 4CF8A 3L2WA 3LAKA 3AVAA 3SQ0A 2G8KA 1VK0A 1MU2A 5FRNA 4O0JA 2BGGA 1TK8A 4QOZB 4J2BA 4BE2A 4FLXA 2HB5A 4B3OA 1HQEA 3RRGA 1A5XA 3VQDA 4FK2A 2OZMA 1VRTA 2D0CA 2XY8A 5I42A 3L2QA 4M3XA 1RT5A 5DK5A 4DF8A 3THVA 3K2PA 2KTQA 1N5YA 2PY5A 4DSEA 4E3SA 1JLQA 4B8AB 3LWMA 1S1WA 2IGIA 2E4LA 4CJVA 3F73A 4HUGA 2YHBA 4BE1A 3VA3A 3SZ2A 3QERA 3B6PA 3BDPA 2OYQA 5SZTA 4F3TA 1S6QA 1S9EA 2XY6A 2QK9A 4FJIA 2NUBA 2ZE2A 4KHWA 2GBZA 4KFBA 1C1CA 4BWJA 4ZHRA 1JLFA 3OYKA 4CFBA 2OA8A 3SQ2A 4ZTJA 2P5GA 4HVJA 3VQEA 5KRSA 1QSYA 1JLCA 3TAMA 2QKBA 3D0PA 1W9HA 1RILA 1T03A 2LSNA 3V9ZA 4ICLA 1K6YA 1Z25A 4PA1A 3WNEA 4ELVA 1TKXA 1GOCA 3QO9A 2IS3A 4BDZA 1NK7A 2RPIA 2WOMA 2EX3A 1RBVA 4DTPA 1NKCA 3DRPA 1JXEA 1KFDA 3LPTA 4CJPA 4DS5A 1L5UA 1ZBHA 3SQ1A 4ID5A 4CF0A 4CHYA 4CHOA 3O3HA 4E0DA 1TL3A 3SUPA 1Z26A 4B9VA 4KPYA 2QXFA 3NF8A 1ASVA 3LPUA 4IFVA 3NF9A 3VQ8A 3NAEA 3VQ4A 3C95A 1D9FA 3FFIA 3HXMA 4FZXC 4Y1DA 1NOZA 2VWJA 4CK3A 4F3OA 1B92A 4DTOA 3VQBA 1S1VA 1ZBIA 1XWLA 2VG7A 2VG6A 3ZSRA 1XI1A 1J53A 1HYSA 5CYMA 3V1RA 3QESA 2FBVA 1B9DA 2F8SA 1BQNA 3AVCA 5CY4A 2PZSA 1QQCA 3RRHA 2HHVA 4EZ6A 1CZ9A 1SKWA 4M3UA 1HJRA 1IO2A 4E1MA 3HJFA 1O1WA 4IG0A 3PY8A 2BE2A 3MEEA 2DFEA 4KO0A 3LDSA 4DSIA 4NCGA 1A5WA 5JS2A 4DTMA 1IG9A 4Z4IA 4CEFA 4F8RA 1WLJA 4Z0UA 4DWIA 1TK5A 1NK6A 4E7KA 4CIGA 3SV4A 1QE1A 1IKYA 3ZSVA 2KZZA 3OYLA 2F96A 3DMJA 4GVMA 4CJUA 4J2AA 2B6AA 3QNOA 3IG1A 4CERA 2YKNA 3ULDA 1RBSA 3HP6A 4L8RB 4OGCA 1GOAA 5HBMA 4DLEA 4CJ5A 1NK4A 4DQSA 2Z1JA 1Q8IA 5C25A 1JXBA 1U49A 4NYNA 4CEAA 4HCCA 1BCMA 4FM0A 5FDLA 3OY9A 1SL1A 2Y1JA 4FJMA 2G8HA 3D45A 4FJ7A 3CFOA 1JLAA 3MXMA 1X9WA 4Z4EA 3AO4A 4M41A 3OS0A 3TANA 3I0RA 2P5OA 1BL3A 1LW0A 1U47A 4RW7A 3V81A 2RF2A 4ID1A 4HHTA 1FK9A 4FVMA 4M45A 4W5TA 5HLFA 3AVFA 4FLUA 4CGJA 3P1GA 2IOCA 2Z1GA 4N5SA 4KTZA 3NDKA 4J2DA 4PY5A 4KB0A 5CZ1A 4DSJA 1UOCA 4XIUA 3KLGA 5KGXA 4W5RA 3OYIA 4M3ZA 1RCHA 4CJTA 3WNFA
chains in the Genus database with same CATH superfamily
4DU3A 5AZIA 3UKRA 3AVNA 5TKYA 1WSEA 5AQQA 4JS5A 3TAPA 1TKDA 3UE5A 3ZSWA 5AQWA 3PO4A 4C8LA 4EZ9A 1I3AA 5FPEA 5HP1A 4C1NI 5J2QA 4IFYA 3LDLA 1CXQA 3QINA 2JWLA 4CBUA 1NGEA 3ASMA 3TWHA 4BC4A 4BQZA 4AHCA 4IJAA 4IOAL 2AP1A 2P9IB 4CJLA 3DOKA 5AQFA 1UWBA 2EWSA 3AY9A 1QZ5A 3JXUA 4XH4A 2O8CA 3H46O 4DV1K 5BRFA 2KHOA 4BG8A 3MN5A 1VQKN 2YHAA 1TAQA 1BHLA 3TABA 3CPWM 1T05A 3O9TA 3KD5E 4JKGA 1H1VA 4JEPA 1RT3A 4IFEA 3NFAA 2YHWA 2O8EB 1TK0A 4K43A 3ZT3A 1HX1A 3ZSYA 3SQ4A 2B5JA 1FKOA 1UA1A 1Q7YO 2O4IA 4CBXA 4E7LA 4JI0K 4DTSA 5C42A 4WQ4A 2ASOA 1RBTA 5BREA 1R59O 3P39A 1N34K 5AZJB 4B1WB 4GW6A 2HW3A 3DLLL 2W6LA 2E1YA 2A3ZA 2VCPA 1QS4A 2G8HA 4W5OA 1C0MA 1J54A 3KK3A 1JLGA 3SUNA 3E9PA 4BRIA 2WFBA 1Y97A 4BRDA 4O8KA 2OZSA 2FLOA 3G6EN 3BF1A 1W2BM 4FJLA 2ZM6K 3NGZA 2G8FA 3IMXA 4HUEA 3QETA 2UYTA 4C8MA 3TSQA 2VWBA 2GWKA 3VQ7A 3V4IA 1QTMA 4JKEA 4YOUA 3TI0A 4CEEA 2A1SA 1WN7A 2JGUA 4BWMA 1IV0A 3CM5A 4F9OA 4IXCA 5T7BA 2DY4A 3LDQA 1KAXA 2OTJN 5M1PA 1Q18A 3P38A 3QLHA 2D1KA 4WQ5A 2OANA 1CXUA 1RT4A 1NMDA 2P9LB 3V9SA 3ZT2A 1K73O 1DLOA 4AHRA 1W7AA 1HRHA 4A5AA 3PX0A 3C6HA 3SUQA 1R0AA 3BGRA 3LP2A 5HOOA 1DEJA 3S3NA 4CE9A 4BVOA 1OVQA 4IDKA 1MWMA 1KRPA 4EIAA 1Z05A 1T7PA 1BCOA 3OW2M 4IJNA 1U04A 1SV5A 2RN2A 3OYDA 2HHUA 2WONA 2OPRA 4CJ4A 4DR3K 2E5LK 3BF3A 3K59A 3VQAA 4CJ7A 1RT2A 2P9PB 4JK7A 2GUPA 3O8MA 3ALYA 5HRRA 2Q2RA 3O4WA 5J2PA 4DFPA 4U7BA 5EU7A 4DV0K 4F4KA 4FK0A 4JI7K 1TUUA 2HOEA 3VQ5A 1HNZK 3PSIA 4CHZA 1WNSA 4CK1A 2RKIA 1LAWA 1XMOK 3RMAA 4QCLA 3O3FA 2ATQA 3EZ5A 4KTQA 2X6SA 3MWPA 4FJKA 5B8HA 5AQLA 3O4QA 4XH1A 3T1YK 2OPQA 3LANA 2P1JA 3R6MA 1EQYA 2QWQA 3B6OA 3PV8A 3LALA 3TSPA 4ISEA 3HT3A 4KB1A 4JD2B 3TARA 1RDBA 3H3OB 5SWMA 1HYZA 5C2DA 4XEIA 3K0SA 4PQUA 5CHIA 4DG1A 2UXDK 3EEQA 2HHTA 5GAGP 2KLAA 3E66A 3NVMA 3RMDA 4JKDA 2VYPA 2VGMA 3QMLA 2IVOA 4G1QA 2A40A 4FPBA 1FXXA 5M1OA 2B4JA 2G8VA 2E6LA 1EKEA 3F2KA 4LY7A 3C94A 3T1AA 5C0YA 4GV9A 4YOTA 4B9SA 1HLUA 1S9GA 1W97L 5C24A 5K14A 5BPNA 3KK2A 4FJGA 4FCYA 3AA3A 3J7AP 4JHDB 1HPZA 1KAYA 5AQVA 3CCEN 4KHUA 4KHNA 4I2PA 3PSFA 4KKOA 2PFUA 3TAQA 1CLQA 3DI6A 4LFBK 1KLNA 1X3MA 4B3MK 3P5JA 5JICA 3DRRA 5AQIA 4AF1A 4CI6A 5C12A 5HRSA 4OKKA 4CEDA 5E26A 3U3YA 3BP8A 3PIOL 3QBWA 2WUSA 4BQLA 1BISA 4JKCA 2QWNA 4M3WA 3AVMA 3TPQA 4OPAA 3HPHA 1NJZA 1VSEA 1TKZA 5F1XA 3VQPA 4I9QA 3DXKB 3L2RA 3NE6A 4DV4K 3C6UA 1GLJO 5AFUH 3EO3A 3QEVA 5C10A 3AO3A 1K8KA 3I55N 3NCIA 3THYA 4A57A 1HNVA 2E2QA 3T19A 1EXQA 2XY7A 2X78A 4A2AA 3WNHA 3WXLA 4BR9A 4Z4HA 2Q0RA 3BY5A 4IO9L 3SBGA 3SCXA 1LWEA 3SV3A 4M3YA 4B9TA 3VQ9A 2I7NA 2D0PA 2V7YA 3SJJA 3HTVA 1SKRA 4Y1CA 4BROA 3L2WA 3LAKA 3AVAA 4BY9C 1MU2A 2E88A 4CZLA 4DKWA 4FLXA 3R3LA 1HQEA 3RRGA 2YJFA 4LF8K 5I42A 4M3XA 4DF8A 4BRGA 4YDUA 1N5YA 2PY5A 3E9LA 3EKSA 4O5FA 1JLQA 3TSUA 1X9JA 3LWMA 4DR1K 2QWOA 3R8EA 4CJVA 4BE1A 2YHBA 3VA3A 5SZTA 1XMQK 3HBTA 2ZE2A 4KHWA 2GBZA 3VEOA 1C1CA 3TTFA 1JLFA 3OYKA 4H5WA 3SQ2A 5KRSA 3ULEB 3DXKA 1RILA 5AQKA 4H5VA 3T69A 3V9ZA 3CQYA 3WNEA 4PA1A 1GOCA 2IS3A 4GV6A 1NK7A 3SAFA 4IOCL 4QS9A 2EX3A 4CZJA 4DTPA 4A2BA 3DRPA 4DS5A 4CZKA 4C23A 4MO4A 5JVGL 4CHYA 4E0DA 4CZMA 3EE8A 1Z26A 3CCSN 2BUPA 3NF8A 3C95A 4F3OA 1YITN 5DM7L 3VQBA 2HBKA 3GG4A 4WCEL 3ZSRA 3W3DA 2F8SA 3AVCA 2ASMA 1TYQB 5M1NA 1CZ9A 4BRPA 4NXMK 3WXIA 1HJRA 4E1MA 3SK3A 4PKGA 3PY8A 4NCGA 5JS2A 4PKHA 3OBWA 4F8RA 1WLJA 4E7KA 4CIGA 1QE1A 4JKGB 3DMJA 1K9MO 3IG1A 4JHDA 1ILYA 3CHWA 3Q7BA 3ULDA 2NRZA 3OHRA 3EZWA 4CJ5A 3G4SN 3CIPA 1MWKA 3H1VX 1WB9A 2O8FA 4HCCA 4FM0A 3O1WA 4G9ZA 3OY9A 1SL1A 4FJMA 1IJJA 4IZ9A 4FJ7A 4Z4EA 5TKWA 1NU0A 4CZGA 1U47A 4NLBA 3C65A 4FL9A 4W5TA 1WUAA 3G71N 2HBLA 4N5SA 4PY5A 2Z1GA 4RWTA 3NDKA 1UOCA 4XIUA 1HKCA 2QI2A 4RW6A 3WXMB 3CCJN 5JMVA 3G10A 1P90A 1IH7A 4JAXA 3OYFA 1W0HA 3GE1A 4BC3A 2CGKA 1IG8A 3G0ZA 2PYJA 1D9DA 3VEVA 1SQKA 2ZWHA 1ITGA 3A5OC 4CJQA 1YJ9N 4NYFA 1EWRA 3K5MA 1I39A 4DR6K 3MAQA 3CI5A 3QEPA 4K25A 3S41A 4PL7A 3M8RA 4BRLA 3K9JA 2V52B 1KVAA 4N47A 2R7YA 4AH9A 1JLBA 5BRDA 2NRTA 3DAWA 3G25A 1SZ2A 4H5TA 4F2SA 1NWKA 4FXDA 3VETA 2HMPA 3N4PA 3FZMA 2AJQA 5CZ2A 4CESA 1UAXA 4OPJA 4JK9A 3DWLA 3ZT4A 3MN7A 3HSCA 4ILJA 5JLFA 1OKJA 1T8EA 5BR8K 3T3FA 4B08A 2E20A 2NRXA 3DLHA 1EWQA 4FJXA 1GLDG 4FWKA 3NH0A 1D5AA 1RDAA 1Q81O 3SLCA 3MXJA 1QVFM 3PX6A 1WAJA 3NGIA 1HNXK 4BRHA 3M8SA 5FRMA 4KREA 4FJ8A 1XHXA 3AA2A 3AVKA 4DFMA 2UUCK 3N4QA 4B9UA 4E19A 4E7HA 3QEXA 1EX4A 2ZQBA 4FWLA 3ZSZA 3SBTA 1HYVA 1XHZA 2CH6A 4FWMA 5AQMA 4ZTFA 4CEQA 4CBWA 1XC9A 3O4NA 4LSNA 3CF5L 1L3SA 2UUAK 1KC8O 3O80A 5AQTA 3DLRA 3ITHA 3LZIA 3EYZA 3M3ZA 4CZIA 1C1BA 3MEDA 4JKBA 1RT6A 1VQ4N 2OPPA 4CJWA 1G99A 4KH6A 2IIRA 3LP1A 4FJNA 1EO1A 1TL1A 1N36K 1VSMA 4BR2A 3NH1A 3S3OA 2P9UA 4BDYA 1VSFA 2W41A 2HSTA 1XNQK 3LM2A 3QIOA 3V1QA 4FLZA 1S6PA 1VAZA 3ZX3A 4DR4K 3LP0A 4DFKA 1JJ2M 2YX6A 4FW2A 4JI5K 1NK0A 4FWSA 3O08A 4IEIA 3A8YA 2O8BB 4CJKA 3S9HA 1J5EK 2VQFK 4NB4A 1NKEA 4TSXA 2FSNA 3V9UA 3VF6A 2IVPA 2O8CB 2KFNA 3WUHA 4LC9B 2BANA 4CGHA 3IAYA 2I7PA 3SAGA 1QHTA 3HL8A 1GLBG 2BH1A 1VQ7N 3VQCA 2P51A 2GTDA 4NLCA 2HF3A 5AQXA 1GLCG 3L2UA 3K57A 4DV5K 1GLFO 1NGCA 1QQOA 5LY3A 2D5RA 4B9NA 2FXUA 2GWJA 2PAVA 4B1VA 5I3UA 1V4SA 3KIOA 1Q9YA 4JRPA 4FZZA 4OO1J 4PWDA 1BA0A 1BQMA 3AVBA 4MDAA 4JKAA 3RVCA 3VA0A 1REVA 2QW9A 3KWIA 3RR7A 4GMJB 3AAPA 2NRRA 1KSPA 4Q5VA 1M90O 2FBTA 4I9LA 4ELTA 4EAHD 4DQRA 2XRIA 4C8KA 4YOYA 4AILC 2QXLA 3HVRA 1VRUA 3WNGA 4CFCA 3HOSA 2HMIA 4OX9K 3IDHA 1S5JA 3C6AA 3CG7A 1J5OA 3FR0A 4N76A 1U48A 4GY2B 4B9QA 4BACA 4CFAA 2CGJA 3AVIA 3MEGA 1KLMA 3LAMA 3L3VA 2HF4A 4BC5A 1LWCA 1T6CA 2I5JA 3TAEA 4JYAK 1C0UA 2YJEA 5BPLA 3CCRN 3SPYA 4JNEA 3QNNA 4CEZA 2YNFA 3WQTA 4DSFA 4Z94A 3CC7N 4AHSA 3CPEA 5LMUK 4DQIA 4X65K 3B8AX 3KKRA 3VENA 2QM1A 3ID6A 1E4GT 5ADXA 3TTDA 2Q0UA 1B9FA 1S1UA 1VQNN 1VSJA 5EXWA 4CVNE 4BC2A 2ZJRL 3BEXA 1CZBA 1HQUA 3J80O 3RWUA 3R1XA 4NXNK 4CJEA 1BO5O 3TTCA 4DFJA 2P9LA 3SNNA 3H6EA 1IKXA 2HBJA 2FF3B 1J9AA 3DRSA 1ASUA 4FWRA 4DQ8A 3BUZB 3SYZA 3MECA 4DTNA 4LH5A 3QB0A 1LV5A 3GDQA 1RDDA 1VQPN 3L3UA 4WQ4C 2BDPA 2YV0X 2H3GX 2E2PA 1KVCA 3O5BA 3O6WA 3KD1E 1OH6A 3A2FA 4H0VB 3OYMA 2W42A 4E7JA 1KTQA 3DJCA 4CGFA 2F9TA 3ZETA 3WXKA 3OS2A 2A1RA 3CXCM 3A5LC 4E1NA 4CHQA 4DQQA 3CJ7A 4DMNA 4PL8A 1WSHA 2G8IA 1DT9A 4CF1A 2E1ZA 1JCFA 1BGXT 2ASPA 2NLXA 3VTHA 5LL6Z 3SMPA 4CJ3A 4O55A 1C6VA 1K8AO 3HM9A 2ZJPL 4JS4A 1GLAG 3SQ0A 2G8KA 4QOZB 2RHKA 4B3OA 1ZXOA 3VQDA 2OZMA 3L6QA 3L2QA 1YI2N 5DK5A 5KPTA 4B8AB 4HUGA 1S1WA 3QERA 1FW6A 5FLXO 1RDWX 4CD1A 1KXPA 1K8KB 4BRKA 2BTFA 3VEWA 4CFBA 4RCHA 1YIJN 1QSYA 2QKBA 1OH7A 3TU5A 3ZEUB 3GOIA 5M1KA 1Z25A 1KQSM 2QEXN 2RPIA 1T44A 4DR5K 1NM1A 3VGMA 3LPTA 3U4LA 5EY4A 2O8DB 3C0BA 3SUPA 4KPYA 3LDOA 3E1YA 3VQ8A 4FZXC 1NOZA 4CK3A 4DTOA 1S1VA 4JI6K 2VG7A 1XI1A 3LL3A 1J53A 1HYSA 3J7ZO 3KWGA 3V1RA 2FBVA 4ISFA 2FSJA 1BQNA 3THYB 2PZSA 1QQCA 4U67L 4EZ6A 3SJHA 2P9IA 4BR5A 1O1WA 3GBTA 3MEEA 3J7YP 1NGIA 1IG9A 4DTMA 4B1YB 4CEFA 2P9NA 1TK5A 3KZBA 1NK6A 2KZZA 3ZSVA 5LMNK 3UKRB 2F96A 3OYLA 4J2AA 2VQEK 3D6RA 2YKNA 1RBSA 2Q97A 5CE3A 4OGCA 4L8RB 1GOAA 3PLAA 4DLEA 1CZAN 1V4TA 1HR0K 5C25A 3FZHA 1E4FT 1IBLK 1OVYA 1BCMA 2E2NA 1Q86O 5M1QA 3U9DA 4KH4A 5GINA 3MXMA 3F5TA 3OS0A 3I0RA 1KD1O 2QWLA 4RW7A 3SAHA 4FVMA 3CCVN 3AVFA 1OH5A 2ZGZA 3P1GA 4CGJA 2CGLA 5CZ1A 4DSJA 5JLHA 5KGXA 4W5RA 3WNFA 1OH8A 3OYBA 2FC0A 4C8OA 1VSIA 5J1EA 4DUZK 3MCAB 4H4OA 4Z4CA 4DU1A 3K9KA 4DF4A 3I33A 1TYQA 1BOTO 4KHQA 2OCEA 2NRWA 4JLHA 2ZD1A 5KI6A 1S1XA 3UIQA 1YT3A 1NJIO 3AGKA 4ILGB 3LWLA 1YTAA 4I7FA 3E9OA 3HPGA 2E8AA 1L3UA 1ESVA 1VQON 2HVHA 1HKGA 2V7ZA 1BIUA 4RW4A 3F9MA 4JI2K 2D4WA 3IS9A 1ASWA 4YFUA 4K8XA 4M63C 4YY3K 3ZX2A 4MLHA 1TAUA 4K42A 4CIEA 4BRFA 4B3RK 1RBUA 4LSLA 2YNHA 1TVRA 4A5BA 4W5QA 4HUFA 4EHUA 4H0PA 1IKWA 1NK5A 4DTRA 4YHHK 3THXB 4QS7A 4CJFA 4E89A 3ZEUA 1BI4B 4O0IA 4M3RA 1UA0A 1KCFA 3NVKA 3VESA 4KV8A 4OPKA 4Z4GA 3O9UA 5AJ3K 1WAFA 4FM1A 1Q82O 4PHTX 2Y1IA 2CH5A 3NH2A 3ZETB 2ETJA 3O1BA 3WQUA 1NK9A 1X1PA 3V9WA 1TV6A 5EOYA 3BZKA 3JSMA 4J8FA 3AVHA 3U3GA 3EKUA 1A5VA 1JCEA 3NHGA 3CERA 5KTQA 1IKVA 4FYDA 5LJVA 4UQGA 2KW4A 4FWPA 3HK2A 3CMAN 3CD6N 1WSIA 5AQZA 1JL1A 4WQ5C 5EX5A 1ATSA 2VWKA 3EL2A 4DU4A 1IBKK 3L4QA 2HHXA 3EN9A 4E7IA 4FO0A 4IDHA 3M8PA 4DV3K 1VSLA 1VQ8N 4B3TK 3IRXA 4O5BA 4AHVA 4CEOA 4CF9A 5AQGA 4V19S 4LF7K 3RTVA 1GOBA 3DXMA 1C0GA 4DSLA 3ATUA 2X74A 3ZSOA 4J2EA 2EHGA 4DV6K 1NG9A 4JI4K 2J4RA 4RW9A 4R5PA 3AO2A 1X9SA 3JS6A 4YOWA 2DPNA 4M7XA 3K5LA 1YVUA 3P4IA 1HKBA 1S72N 3M5RA 5HROA 4KHYA 1DTQA 1TUYA 2JLEA 3K58A 3RMBA 3KTQA 2D0AA 1SL2A 3GL1A 5F2RA 2UXBK 3MXIA 3D7EO 4WFBL 3AO1A 4IKFA 3K5OA 2GUIA 1SUQA 1LCUA 4JI1K 3I8BA 1D8YA 3IFRA 4H4MA 3VOVA 3OJSA 4KI6A 4DTUA 2IDOA 1JKHA 3LDNA 3FE1A 3AARA 3QIPA 4CHNA 5MLCQ 4N41A 5KQ8A 4JRQA 1VQ6N 3OYJA 1U4BA 4FWNA 1LWFA 1HMVA 4M3TA 3DYAA 2O8FB 1JLEA 5FPDA 4LF9K 1LAVA 2P9SA 3L4IA 2X6NA 3WT0A 2YKMA 1L3TA 3OJUA 4PKIA 5GIPA 4FWOA 3VGKA 1WBBA 4I6MA 4MFBA 3ZSXA 4EP4A 3L2VA 1HNIA 3FGUA 3CJCA 4CZHA 4WFNL 3ZSQA 4WE1A 3D2FA 4YNQA 4AM6A 1JL2A 5ADXH 1NK8A 3KVGA 1VHXA 5FPMA 5HRNA 3OYGA 5DMRA 1NOYA 1BU6O 1YJNN 4H0YB 3OBYA 4CJSA 4O44A 4CHPA 4DHYA 4KAZA 3FZKA 5M1FA 3BZCA 1JCGA 2HHSA 5I9EB 2O8BA 1VSDA 5FROA 4H5RA 3AVGA 4OLBA 5AQYA 1YAGA 3KKSA 3QBXA 3HO1A 4JD2A 1F21A 5HL7L 3VN5A 3KLEA 3JAMO 5HRPA 4WYBA 2IVNA 3ZT1A 5D3GA 2A42A 3C6TA 2F9WA 4DQPA 3CCUN 3AV9A 3RR8A 2HHWA 2Z1HA 1FKPA 4QAGA 4KTWA 4AM7A 4FLTA 1KFSA 4H8KA 1XC3A 4M42A 3NF6A 1L3VA 1YTUA 3CFRA 4LFAK 4CZFA 2O8EA 1BI4A 1RTIA 1RGIA 3VGLA 2NNWA 1NGHA 3QEWA 2KFZA 1NGGA 3THXA 3AGRA 4LF5K 2QWPA 3TR8A 1U45A 3UKUA 3T7ZA 4DR7K 4CCHA 3DLBA 3SPZA 4CW7B 3CCLN 4IBNA 3HOTA 4IEEA 4GNIA 2O8DA 4YOXA 4JN4A 4OGEA 2ITGA 1RT1A 3S3MA 2WC9A 2XHBA 1SL0A 3AA4A 2UU9K 3P83D 4FJJA 4CF8A 3W0LA 1VQMN 1VK0A 2BGGA 1TK8A 4J2BA 4BE2A 2HB5A 1GLLO 1A5XA 4BR4A 4FK2A 4EHTA 4HWIA 1NNEA 4E1JA 3THVA 3K2PA 1LOTB 4E3SA 1N33K 2IGIA 2E4LA 3F73A 3BDPA 3SZ2A 3B6PA 4A62A 3OTOK 5AZIB 2F7TA 4F3TA 2ZGYA 2XY6A 2QK9A 4KFBA 4ZHRA 2OA8A 3M1FA 1JLCA 5GAEP 1S22A 3QFUA 1YUWA 2OTLN 1T03A 2HBMA 1N32K 2FSKA 4ICLA 3ENBA 1TKXA 1Y64A 3QO9A 2D0OA 4Y0WA 4BRNA 2WOMA 1N8RO 1RBVA 3VERA 1NKCA 1KFDA 1O13A 2GX9A 3MWTA 5DM6L 1BDGA 3O3HA 3MX2A 5AQJA 2QXFA 1YJWN 1ASVA 2YHYA 3P31A 4IFVA 4MO5A 3NAEA 3VEZA 3CCQN 3HXMA 1E3MA 1BG3A 3L0QA 2VWJA 5KQDA 1T3VA 2VG6A 3MCPA 2WBNA 3Q7CA 3QESA 4LFCK 1B9DA 2NZTA 3RRHA 4RTFD 1SKWA 3QICA 4BVPA 4JK8A 3HJFA 2BE2A 2DFEA 3U9ZA 1A5WA 2P9KB 4DWIA 1I94K 3SV4A 1U2VB 4BRCA 4GVMA 3FZLA 4CERA 3C7NA 1NK4A 1WBDA 4FOIA 4DQSA 2Z1JA 5KPRA 3DXMB 1U49A 3J81O 3MDQA 5FDLA 5AR0A 3R9PA 2HHHK 2QWRA 3CCMN 2UXCK 3AO4A 3TANA 2P5OA 1BL3A 1LW0A 3V81A 1HNWK 3KK7A 3IKMA 5GADP 4OPHA 4M45A 2YHXA 3C7NB 4FLUA 4J2DA 1C0FA 5F0XA 5AQRA 1RCHA 4CJTA 1U6ZA 1WSFA 3DM2A 4X66K 5FPNA 3TAGA 4H03B 4X62K 2D0BA 3O9SA 4CEBA 5E84A 4FWQA 2V51B 3OS1A 1NGFA 2OPSA 2DFFA 4GV3A 3KLHA 5J2NA 4BRQA 4FLWA 4A59A 4MLEA 4AHUA 4GKKK 3O9RA 3PUFA 4FM2A 4OLAA 2P9PA 3ENHA 3CJAA 5AQHA 3AVLA 4CFDA 2P9KA 4NCBA 1EETA 3CFPA 3THWA 3NF7A 3VTIA 1NKBA 4B8CA 3V9XA 4FJ9A 3DLEA 4FW1A 4MQ3A 1SAZA 5KGWA 4FK4A 4Z4FA 1NMNA 3HVTA 3VQQA 4BG9A 2YCHA 4AQYK 1NLVA 1ZBFA 2XO7A 3CM6A 3AA5X 3J8AA 3A0IX 2A5XA 1MA9B 3KHYA 4FLVA 3EY1A 3OYEA 3VMFB 2P9NB 1QHAA 4RW8A 3DOLA 3V1OA 1DKGD 1IBMK 3LM9A 3AVJA 3DLKA 5KRTA 4CF2A 3IUCA 2KQ2A 3DLGA 4DCHA 2HNDA 3MK6A 2WTUA 2E6MA 5C15A 4Q0BA 3LZJA 1LW2A 2PYLA 3MN6A 3I8DA 3L8BA 4NCAA 4K8ZA 1ZBLA 1YXQA 3VQ6A 2HHQA 4RG8A 3ATVA 3U6FA 3OYCA 4BREA 1RBRA 3ULEA 4HTUA 2ZJQL 1BIZA 1ZC6A 3HM8A 4DTXA 4FJ5A 5IT9O 4KHPK 3OVNA 2HVIA 2HNZA 3ZCMA 2NRHA 1RNHA 4CGDA 5BRHA 3QFPA 4LF4K 4CIFA 3F9KA 2DFHA 3RSEB 4CZEA 5BN8A 3KJVA 4BGAA 4ILHA 1HPMA 3SUOA 1VQ5N 4B9MA 3V6DA 3HRGA 3K5NA 4X64K 4FJHA 1DTTA 4WFAL 4KHSA 3CC2N 3A5NC 4CECA 3HYFA 1RTHA 1C1AA 4CGGA 3M8QA 4OVLA 4ELUA 3CJ1A 3TAFA 4JI8K 3H1QA 3VEYA 2YNGA 4L3QA 4BE0A 1S1TA 4EP5A 3QDKA 4CD3A 2ZF5O 3H08A 3OYNA 1RT7A 3OYAA 3H45C 4YDUC 3KK1A 3RSEA 3E01A 1BA1A 3T1HK 3CQXA 3I56N 5JS1A 2Q1NA 1RFQA 3SMSA 1ZYQA 3AAQA 3PIPL 1QSSA 1NJXA 4DLGA 3VEXA 3H3NO 3CQ8A 1G15A 1RTDA 3SI6A 4QS8A 2NRVA 1SKSA 5KPZA 2DTUA 1XNRK 1NBWA 4I2QA 4BDPA 4H0OA 3MMVA 4IO8A 1XQSC 3ENOA 2F8TA 3CETA 3CJ9A 3PX4A 4CGIA 4F2RA 4FZYA 4I6MB 1NGBA 5EVZA 2YNIA 4H5NA 3ISNC 2P9SB 5AQPA 4JV5K 1C0TA 3ZT0A 3LP3A 5BN9A 4OKEA 4FSVA 3VF4A 4CJRA 4IOXA 4H0XB 5IWAK 4KI4A 1QSLA 1RTJA 2XY5A 4N56A 4IG3A 2QKKA 4DSKA 3HSTB 4DV7K 5E41A 3I0SA 4HTLA 3OYHA 2AA4A 3A5MC 3O3GA 5CYQA 3CYMA 4DTJA 2QA4N 2FF6A 3CC4N 4PUOA 3JYTA 4M7YA 4A61A 3KLIA 4OJRA 1MDUB 4FLYA 2VG5A 1WSGA 2Q3SA 4WF9L 1X9MA 4XH5A 5BR9A 3D2EA 2ITMA 2KKZA 1YF5L 2QWMA 2IC3A 4LH4A 2YI1A 4CK2A 5LJWA 4AHTA 2Z1IA 1FJGK 5GAHP 5ELZA 4O8UA 1QQNA 3AO5A 4EFHA 4B1XB 2O4GA 5GIOA 1ZBUA 3D2FB 4JI3K 2IAJA 4BR7A 1N6QA 3HPOA 2KZMA 3HP9A 2FBYA 3RMCA 2FBXA 4GVEA 3WXJA 1TGOA 4YORA 4K0KK 5A2QO 2A6AA 4OKJA 5J2MA 4KH5A 2G8UA 4W5NA 1NJYA 4DS4A 2A41A 4JKHA 3NBPA 4B9LA 4B1ZA 2G8WA 5CR4A 3EE9A 5H1SQ 1EP4A 3O9QA 1SS6A 1YHQN 1RDCA 3U8XA 3KLFA 2W6KA 1GLEG 4FOEA 3FZFA 1QQMA 2P9UB 5AQUA 1BUPA 1ZBSA 4GKJK 1NGDA 3ZX0A 4FVUA 1KVBA 5AQNA 1NGAA 1YVNA 1ATNA 4BRAA 2GELA 2PBDA 1VSHA 2Q31A 3NGYA 1VQ9N 1RDUA 2Q36A 1BWFO 3ZLJA 4UY8O 4C8NA 1Q9XA 1NJWA 4HCBA 1Z6RA 1DGKN 2HNYA 1WSJA 4LD0A 4O4GA 1TKTA 5AFUA 3CJBA 4KRFA 2GV9A 4NO7A 1VQLN 1VSKA 3QEIA 3PO5A 4BR0A 1J6ZA 2QTDA 4C1NK 5FRNA 4O0JA 3HZ6A 1KAZA 3MN9A 3VF2A 3NMUA 1VRTA 2D0CA 2XY8A 1RT5A 2KTQA 5AQSA 4DSEA 4B3SK 2OYQA 3OA9A 1S6QA 1S9EA 4FJIA 2NUBA 4DV2K 4BWJA 5AQOA 4ZTJA 2P5GA 4HVJA 3VQEA 2F4VK 3TAMA 2RE2A 3D0PA 1W9HA 4FPAA 3FLCO 2LSNA 1K6YA 4ELVA 4BDZA 4BRMA 1JXEA 4CJPA 2VGNA 1HJOA 1L5UA 1ZBHA 3SQ1A 4ID5A 4CF0A 1D4XA 4CHOA 1TL3A 1QVGM 4B9VA 3LDPA 3LPUA 3NF9A 1D9FA 3VQ4A 4R79A 3FFIA 1M1KO 3FFKB 4Y1DA 2JWKA 4ISGA 1B92A 1U2VA 3THWB 1ZBIA 1XWLA 4DUYK 3CMEN 3UB5A 3M6GA 5CYMA 3D2EB 1HUXA 5CY4A 2HHVA 4KBOA 4M3UA 1IO2A 2GEMA 4IG0A 4KO0A 3LDSA 4H0TB 5BPMA 5AZJA 4DSIA 4Z4IA 3UKUB 4BGBA 4Z0UA 4B1UB 4K41A 4YOVA 1IKYA 4MDBA 3WEEA 4CJUA 2B6AA 3QNOA 4JKFA 1XUPO 2W40A 1T6DA 3VPZA 1WOQA 3HP6A 1S3XA 5HBMA 1QZ6A 1Q8IA 3ID8A 1JXBA 4NYNA 4CEAA 1X3NA 2E2OA 4DB3A 2Y1JA 3D45A 1P8ZA 3CFOA 1JLAA 1NGJA 1X9WA 3HI0A 1ATRA 3WEEB 5JVHL 4M41A 5C2FA 4LF6K 2RF2A 4ID1A 3ZYYX 1FK9A 4IWVA 4HHTA 5HLFA 2IOCA 4KTZA 4DR2K 4KB0A 3KLGA 3OYIA 2UUBK 3MX5A 4M3ZA
chains in the Genus database with same CATH topology
1WSFA 4DU3A 4RW6A 3DM2A 3TAGA 3OYBA 2FC0A 3AVNA 1WSEA 1VSIA 4C8OA 4JS5A 3G10A 2D0BA 3TAPA 1IH7A 4CEBA 5J1EA 3OYFA 1TKDA 3ZSWA 1W0HA 3PO4A 4C8LA 4H4OA 4Z4CA 3OS1A 3G0ZA 4EZ9A 1I3AA 2OPSA 2DFFA 5HP1A 2PYJA 4DU1A 5J2QA 1D9DA 4IFYA 1CXQA 3KLHA 3QINA 1ITGA 5J2NA 4DF4A 4CJQA 4FLWA 4AHUA 4NYFA 3PUFA 4KHQA 4FM2A 3K5MA 4OLAA 3ASMA 1I39A 3MAQA 3AVLA 4JLHA 3QEPA 4CFDA 3TWHA 2ZD1A 4DFKA 4NCBA 1EETA 3M8RA 5KI6A 1S1XA 3CFPA 1YT3A 3UIQA 4AHCA 1KVAA 3NF7A 4N47A 1YTAA 3LWLA 4I7FA 4CJLA 3DOKA 4AH9A 2R7YA 1NKBA 4B8CA 1JLBA 1UWBA 3HPGA 3V9XA 4FJ9A 3DLEA 1L3UA 4FW1A 4MQ3A 5KGWA 4FK4A 4F2SA 2HVHA 4Z4FA 1BIUA 4FXDA 3HVTA 3VQQA 4RW4A 2AJQA 2YHAA 5CZ2A 3IS9A 1TAQA 1ZBFA 1ASWA 4CESA 2XO7A 3CM6A 1BHLA 4YFUA 4K8XA 3AA5X 1UAXA 4OPJA 3TABA 1T05A 3KD5E 4FLVA 1RT3A 3ZT4A 3NFAA 3EY1A 1TAUA 3OYEA 4RW8A 3DOLA 1T8EA 3V1OA 4CIEA 4B08A 3T3FA 1TK0A 3ZT3A 3AVJA 1RBUA 3DLKA 3ZSYA 4LSLA 4CF2A 5KRTA 2YNHA 3DLHA 4FJXA 1TVRA 4W5QA 2KQ2A 4HUFA 3SQ4A 3DLGA 2B5JA 2HNDA 1FKOA 3NH0A 1IKWA 1D5AA 2E6MA 4DTRA 1NK5A 1UA1A 4Q0BA 2O4IA 3LZJA 1LW2A 4E7LA 1RDAA 5C42A 3I8DA 3L8BA 4DTSA 2PYLA 4NCAA 4K8ZA 4CJFA 4E89A 1ZBLA 3VQ6A 3MXJA 2HHQA 1BI4B 1RBTA 4RG8A 4O0IA 1WAJA 4M3RA 3NGIA 3U6FA 3PX6A 3OYCA 1UA0A 1KCFA 2HW3A 4GW6A 1RBRA 4KV8A 4OPKA 3M8SA 4HTUA 5FRMA 4Z4GA 4KREA 4FJ8A 1XHXA 1BIZA 1WAFA 1QS4A 3AA2A 4FM1A 3AVKA 1C0MA 4W5OA 4DFMA 1J54A 3KK3A 4E19A 4E7HA 1JLGA 3SUNA 3QEXA 2Y1IA 1EX4A 4B9UA 3NH2A 4DTXA 4FJ5A 1Y97A 2OZSA 2ZQBA 2ETJA 3ZSZA 4FJLA 3OVNA 2HVIA 2HNZA 3ZCMA 1NK9A 1HYVA 1XHZA 1RNHA 1X1PA 4CGDA 3NGZA 4ZTFA 3V9WA 1TV6A 3F9KA 2DFHA 4CIFA 2G8FA 4HUEA 3QETA 4CEQA 3JSMA 1XC9A 3AVHA 3U3GA 3KJVA 4C8MA 3O4NA 1A5VA 3NHGA 4LSNA 3SUOA 3VQ7A 1L3SA 4B9MA 5KTQA 1IKVA 3V6DA 3V4IA 4FYDA 3K5NA 1QTMA 4UQGA 2KW4A 4FJHA 1DTTA 3DLRA 3TI0A 4CEEA 2A1SA 1WN7A 2JGUA 3ITHA 3LZIA 3HK2A 3EYZA 4BWMA 4KHSA 3CM5A 1C1BA 3MEDA 1RT6A 2OPPA 4CECA 3HYFA 1WSIA 1RTHA 1C1AA 4CGGA 5T7BA 2DY4A 1JL1A 3M8QA 4OVLA 4CJWA 4ELUA 2VWKA 3LP1A 4FJNA 3TAFA 4DU4A 1TL1A 3QLHA 2HHXA 1VSMA 2YNGA 3NH1A 4BE0A 3S3OA 4BDYA 4E7IA 1S1TA 1VSFA 3M8PA 4EP5A 3QIOA 3V1QA 1CXUA 1RT4A 1S6PA 1VSLA 4FLZA 3V9SA 3ZT2A 3H08A 1DLOA 3OYNA 3IRXA 1RT7A 3LP0A 4AHRA 4FW2A 1HRHA 3OYAA 4O5BA 4AHVA 4CEOA 3KK1A 3PX0A 3SUQA 4CF9A 3E01A 1R0AA 1NK0A 3BGRA 3LP2A 5JS1A 4CJKA 3RTVA 1ZYQA 1GOBA 3S3NA 1QSSA 3S9HA 1NJXA 4CE9A 4DLGA 4IDKA 1NKEA 1KRPA 4TSXA 3V9UA 1T7PA 4DSLA 3CQ8A 2KFNA 1G15A 1RTDA 2X74A 3ZSOA 3SI6A 4J2EA 2BANA 2EHGA 1BCOA 1SKSA 4CGHA 2DTUA 3IAYA 4I2QA 1QHTA 3HL8A 4BDPA 1U04A 1SV5A 2RN2A 3OYDA 2F8TA 2HHUA 2WONA 2OPRA 4CJ4A 3PX4A 4CGIA 3K59A 3VQAA 4RW9A 4F2RA 4FZYA 1RT2A 4R5PA 3ALYA 3AO2A 5HRRA 1X9SA 3VQCA 2P51A 2YNIA 3K5LA 5J2PA 1YVUA 4DFPA 3ISNC 5HROA 5EU7A 4KHYA 1DTQA 2JLEA 3L2UA 4F4KA 4FK0A 3K57A 3K58A 3RMBA 3KTQA 2D0AA 1SL2A 3VQ5A 1C0TA 3ZT0A 3LP3A 3MXIA 4CHZA 2D5RA 4B9NA 3AO1A 4IKFA 1WNSA 3K5OA 4CK1A 5I3UA 2GUIA 2RKIA 4OKEA 1LAWA 4CJRA 3KIOA 1Q9YA 3RMAA 4QCLA 1SUQA 3O3FA 4KI4A 2ATQA 4JRPA 1RTJA 1QSLA 3EZ5A 2XY5A 2X6SA 4IG3A 4N56A 2QKKA 4DSKA 4KTQA 3O4QA 4FJKA 1BQMA 3AVBA 3HSTB 5E41A 1D8YA 3I0SA 2OPQA 3LANA 2P1JA 4H4MA 3OYHA 3VA0A 3O3GA 1REVA 3OJSA 3B6OA 5CYQA 3PV8A 3LALA 3RR7A 4KI6A 4DTUA 3HT3A 4KB1A 4GMJB 2IDOA 1RDBA 3CYMA 4DTJA 3TARA 1JKHA 1KSPA 4Q5VA 3QIPA 4CHNA 2FBTA 5SWMA 4I9LA 1HYZA 4N41A 4ELTA 4JRQA 4PQUA 4DQRA 2XRIA 4C8KA 4PUOA 4DG1A 3OYJA 3JYTA 1LWFA 1U4BA 2HHTA 1HMVA 3KLIA 4OJRA 3DYAA 4FLYA 4AILC 1JLEA 4M3TA 3HVRA 1VRUA 3WNGA 4CFCA 2VG5A 2HMIA 1LAVA 1WSGA 2Q3SA 2X6NA 3RMDA 1X9MA 2YKMA 1L3TA 1S5JA 4G1QA 3OJUA 1FXXA 2G8VA 3CG7A 2B4JA 2E6LA 1EKEA 4LY7A 1J5OA 4MFBA 2IC3A 3ZSXA 4LH4A 4N76A 1U48A 3C94A 4EP4A 3L2VA 3T1AA 4CFAA 4BACA 1HNIA 4CK2A 4AHTA 2Z1IA 3ZSQA 4B9SA 3AVIA 1S9GA 3MEGA 4WE1A 4YNQA 4PWDA 5C24A 1JL2A 5K14A 1NK8A 1KLMA 3LAMA 3L3VA 3KK2A 4FJGA 4FCYA 3AO5A 3AA3A 5DMRA 1LWCA 5HRNA 3OYGA 2O4GA 1NOYA 2I5JA 1HPZA 1ZBUA 3TAEA 4KHUA 1C0UA 4CJSA 4O44A 4CHPA 2IAJA 4KAZA 2HHSA 4KHNA 3SPYA 3QNNA 3HPOA 4I2PA 1N6QA 4CEZA 2YNFA 1VSDA 4KKOA 5FROA 2KZMA 3AVGA 3HP9A 2FBYA 4DSFA 4OLBA 3TAQA 4AHSA 1CLQA 3DI6A 3RMCA 3KKSA 2FBXA 1KLNA 4DQIA 3HO1A 3P5JA 1TGOA 1F21A 3DRRA 3KKRA 5HRSA 3VN5A 4OKKA 3KLEA 4OKJA 5J2MA 5HRPA 4CEDA 1B9FA 3ZT1A 1S1UA 3U3YA 1VSJA 5D3GA 2G8UA 4W5NA 1NJYA 4DS4A 1CZBA 1HQUA 3NBPA 3C6TA 4B9LA 3RWUA 4DQPA 1BISA 2G8WA 3AV9A 3RR8A 4CJEA 3AVMA 4M3WA 1EP4A 2Z1HA 2HHWA 4DFJA 1FKPA 1RDCA 4QAGA 3HPHA 3SNNA 1IKXA 1VSEA 4KTWA 4FLTA 1NJZA 1TKZA 1J9AA 1KFSA 3VQPA 3DRSA 3KLFA 4I9QA 4H8KA 1ASUA 4M42A 3NF6A 3SYZA 1L3VA 3CFRA 3MECA 3L2RA 4LH5A 4DTNA 1YTUA 3NE6A 1LV5A 1RDDA 3C6UA 3L3UA 1BI4A 3QEVA 1RTIA 1KVBA 3AO3A 2BDPA 4FZZA 3QEWA 2YV0X 2KFZA 3NCIA 1KVCA 3KD1E 1HNVA 3A2FA 1VSHA 3OYMA 2W42A 4E7JA 3NGYA 1KTQA 3T19A 3TR8A 1U45A 4CGFA 1EXQA 4C8NA 3OS2A 2XY7A 2A1RA 1NJWA 1Q9XA 2X78A 3WNHA 4Z4HA 4HCBA 4E1NA 4CHQA 2HNYA 4DQQA 1WSJA 4LD0A 4CCHA 4DMNA 3SCXA 3SPZA 3DLBA 1LWEA 1WSHA 4O4GA 3SV3A 4M3YA 1TKTA 4IBNA 2G8IA 4CF1A 3VQ9A 4B9TA 4KRFA 1BGXT 2GV9A 3SJJA 4OGEA 1SKRA 2ITGA 1RT1A 4Y1CA 2XHBA 3S3MA 1SL0A 4CJ3A 3AA4A 1VSKA 4O55A 1C6VA 3P83D 3QEIA 3PO5A 4FJJA 3HM9A 4JS4A 4CF8A 3L2WA 3LAKA 3AVAA 3SQ0A 2G8KA 1VK0A 1MU2A 5FRNA 4O0JA 2BGGA 1TK8A 4QOZB 4J2BA 4BE2A 4FLXA 2HB5A 4B3OA 1HQEA 3RRGA 1A5XA 3VQDA 4FK2A 2OZMA 1VRTA 2D0CA 2XY8A 5I42A 3L2QA 4M3XA 1RT5A 5DK5A 4DF8A 3THVA 3K2PA 2KTQA 1N5YA 2PY5A 4DSEA 4E3SA 1JLQA 4B8AB 3LWMA 1S1WA 2IGIA 2E4LA 4CJVA 3F73A 4HUGA 2YHBA 4BE1A 3VA3A 3SZ2A 3QERA 3B6PA 3BDPA 2OYQA 5SZTA 4F3TA 1S6QA 1S9EA 2XY6A 2QK9A 4FJIA 2NUBA 2ZE2A 4KHWA 2GBZA 4KFBA 1C1CA 4BWJA 4ZHRA 1JLFA 3OYKA 4CFBA 2OA8A 3SQ2A 4ZTJA 2P5GA 4HVJA 3VQEA 5KRSA 1QSYA 1JLCA 3TAMA 2QKBA 3D0PA 1W9HA 1RILA 1T03A 2LSNA 3V9ZA 4ICLA 1K6YA 1Z25A 4PA1A 3WNEA 4ELVA 1TKXA 1GOCA 3QO9A 2IS3A 4BDZA 1NK7A 2RPIA 2WOMA 2EX3A 1RBVA 4DTPA 1NKCA 3DRPA 1JXEA 1KFDA 3LPTA 4CJPA 4DS5A 1L5UA 1ZBHA 3SQ1A 4ID5A 4CF0A 4CHYA 4CHOA 3O3HA 4E0DA 1TL3A 3SUPA 1Z26A 4B9VA 4KPYA 2QXFA 3NF8A 1ASVA 3LPUA 4IFVA 3NF9A 3VQ8A 3NAEA 3VQ4A 3C95A 1D9FA 3FFIA 3HXMA 4FZXC 4Y1DA 1NOZA 2VWJA 4CK3A 4F3OA 1B92A 4DTOA 3VQBA 1S1VA 1ZBIA 1XWLA 2VG7A 2VG6A 3ZSRA 1XI1A 1J53A 1HYSA 5CYMA 3V1RA 3QESA 2FBVA 1B9DA 2F8SA 1BQNA 3AVCA 5CY4A 2PZSA 1QQCA 3RRHA 2HHVA 4EZ6A 1CZ9A 1SKWA 4M3UA 1HJRA 1IO2A 4E1MA 3HJFA 1O1WA 4IG0A 3PY8A 2BE2A 3MEEA 2DFEA 4KO0A 3LDSA 4DSIA 4NCGA 1A5WA 5JS2A 4DTMA 1IG9A 4Z4IA 4CEFA 4F8RA 1WLJA 4Z0UA 4DWIA 1TK5A 1NK6A 4E7KA 4CIGA 3SV4A 1QE1A 1IKYA 3ZSVA 2KZZA 3OYLA 2F96A 3DMJA 4GVMA 4CJUA 4J2AA 2B6AA 3QNOA 3IG1A 4CERA 2YKNA 3ULDA 1RBSA 3HP6A 4L8RB 4OGCA 1GOAA 5HBMA 4DLEA 4CJ5A 1NK4A 4DQSA 2Z1JA 1Q8IA 5C25A 1JXBA 1U49A 4NYNA 4CEAA 4HCCA 1BCMA 4FM0A 5FDLA 3OY9A 1SL1A 2Y1JA 4FJMA 2G8HA 3D45A 4FJ7A 3CFOA 1JLAA 3MXMA 1X9WA 4Z4EA 3AO4A 4M41A 3OS0A 3TANA 3I0RA 2P5OA 1BL3A 1LW0A 1U47A 4RW7A 3V81A 2RF2A 4ID1A 4HHTA 1FK9A 4FVMA 4M45A 4W5TA 5HLFA 3AVFA 4FLUA 4CGJA 3P1GA 2IOCA 2Z1GA 4N5SA 4KTZA 3NDKA 4J2DA 4PY5A 4KB0A 5CZ1A 4DSJA 1UOCA 4XIUA 3KLGA 5KGXA 4W5RA 3OYIA 4M3ZA 1RCHA 4CJTA 3WNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSF A;  4DU3 A;  4RW6 A;  3DM2 A;  3TAG A;  3OYB A;  2FC0 A;  3AVN A;  1WSE A;  1VSI A;  4C8O A;  4JS5 A;  3G10 A;  2D0B A;  3TAP A;  1IH7 A;  4CEB A;  5J1E A;  3OYF A;  1TKD A;  3ZSW A;  1W0H A;  3PO4 A;  4C8L A;  4H4O A;  4Z4C A;  3OS1 A;  3G0Z A;  4EZ9 A;  1I3A A;  2OPS A;  2DFF A;  5HP1 A;  2PYJ A;  4DU1 A;  5J2Q A;  1D9D A;  4IFY A;  1CXQ A;  3KLH A;  3QIN A;  1ITG A;  5J2N A;  4DF4 A;  4CJQ A;  4FLW A;  4AHU A;  4NYF A;  3PUF A;  4KHQ A;  4FM2 A;  3K5M A;  4OLA A;  3ASM A;  1I39 A;  3MAQ A;  3AVL A;  4JLH A;  3QEP A;  4CFD A;  3TWH A;  2ZD1 A;  4DFK A;  4NCB A;  1EET A;  3M8R A;  5KI6 A;  1S1X A;  3CFP A;  1YT3 A;  3UIQ A;  4AHC A;  1KVA A;  3NF7 A;  4N47 A;  1YTA A;  3LWL A;  4I7F A;  4CJL A;  3DOK A;  4AH9 A;  2R7Y A;  1NKB A;  4B8C A;  1JLB A;  1UWB A;  3HPG A;  3V9X A;  4FJ9 A;  3DLE A;  1L3U A;  4FW1 A;  4MQ3 A;  5KGW A;  4FK4 A;  4F2S A;  2HVH A;  4Z4F A;  1BIU A;  4FXD A;  3HVT A;  3VQQ A;  4RW4 A;  2AJQ A;  2YHA A;  5CZ2 A;  3IS9 A;  1TAQ A;  1ZBF A;  1ASW A;  4CES A;  2XO7 A;  3CM6 A;  1BHL A;  4YFU A;  4K8X A;  3AA5 X;  1UAX A;  4OPJ A;  3TAB A;  1T05 A;  3KD5 E;  4FLV A;  1RT3 A;  3ZT4 A;  3NFA A;  3EY1 A;  1TAU A;  3OYE A;  4RW8 A;  3DOL A;  1T8E A;  3V1O A;  4CIE A;  4B08 A;  3T3F A;  1TK0 A;  3ZT3 A;  3AVJ A;  1RBU A;  3DLK A;  3ZSY A;  4LSL A;  4CF2 A;  5KRT A;  2YNH A;  3DLH A;  4FJX A;  1TVR A;  4W5Q A;  2KQ2 A;  4HUF A;  3SQ4 A;  3DLG A;  2B5J A;  2HND A;  1FKO A;  3NH0 A;  1IKW A;  1D5A A;  2E6M A;  4DTR A;  1NK5 A;  1UA1 A;  4Q0B A;  2O4I A;  3LZJ A;  1LW2 A;  4E7L A;  1RDA A;  5C42 A;  3I8D A;  3L8B A;  4DTS A;  2PYL A;  4NCA A;  4K8Z A;  4CJF A;  4E89 A;  1ZBL A;  3VQ6 A;  3MXJ A;  2HHQ A;  1BI4 B;  1RBT A;  4RG8 A;  4O0I A;  1WAJ A;  4M3R A;  3NGI A;  3U6F A;  3PX6 A;  3OYC A;  1UA0 A;  1KCF A;  2HW3 A;  4GW6 A;  1RBR A;  4KV8 A;  4OPK A;  3M8S A;  4HTU A;  5FRM A;  4Z4G A;  4KRE A;  4FJ8 A;  1XHX A;  1BIZ A;  1WAF A;  1QS4 A;  3AA2 A;  4FM1 A;  3AVK A;  1C0M A;  4W5O A;  4DFM A;  1J54 A;  3KK3 A;  4E19 A;  4E7H A;  1JLG A;  3SUN A;  3QEX A;  2Y1I A;  1EX4 A;  4B9U A;  3NH2 A;  4DTX A;  4FJ5 A;  1Y97 A;  2OZS A;  2ZQB A;  2ETJ A;  3ZSZ A;  4FJL A;  3OVN A;  2HVI A;  2HNZ A;  3ZCM A;  1NK9 A;  1HYV A;  1XHZ A;  1RNH A;  1X1P A;  4CGD A;  3NGZ A;  4ZTF A;  3V9W A;  1TV6 A;  3F9K A;  2DFH A;  4CIF A;  2G8F A;  4HUE A;  3QET A;  4CEQ A;  3JSM A;  1XC9 A;  3AVH A;  3U3G A;  3KJV A;  4C8M A;  3O4N A;  1A5V A;  3NHG A;  4LSN A;  3SUO A;  3VQ7 A;  1L3S A;  4B9M A;  5KTQ A;  1IKV A;  3V6D A;  3V4I A;  4FYD A;  3K5N A;  1QTM A;  4UQG A;  2KW4 A;  4FJH A;  1DTT A;  3DLR A;  3TI0 A;  4CEE A;  2A1S A;  1WN7 A;  2JGU A;  3ITH A;  3LZI A;  3HK2 A;  3EYZ A;  4BWM A;  4KHS A;  3CM5 A;  1C1B A;  3MED A;  1RT6 A;  2OPP A;  4CEC A;  3HYF A;  1WSI A;  1RTH A;  1C1A A;  4CGG A;  5T7B A;  2DY4 A;  1JL1 A;  3M8Q A;  4OVL A;  4CJW A;  4ELU A;  2VWK A;  3LP1 A;  4FJN A;  3TAF A;  4DU4 A;  1TL1 A;  3QLH A;  2HHX A;  1VSM A;  2YNG A;  3NH1 A;  4BE0 A;  3S3O A;  4BDY A;  4E7I A;  1S1T A;  1VSF A;  3M8P A;  4EP5 A;  3QIO A;  3V1Q A;  1CXU A;  1RT4 A;  1S6P A;  1VSL A;  4FLZ A;  3V9S A;  3ZT2 A;  3H08 A;  1DLO A;  3OYN A;  3IRX A;  1RT7 A;  3LP0 A;  4AHR A;  4FW2 A;  1HRH A;  3OYA A;  4O5B A;  4AHV A;  4CEO A;  3KK1 A;  3PX0 A;  3SUQ A;  4CF9 A;  3E01 A;  1R0A A;  1NK0 A;  3BGR A;  3LP2 A;  5JS1 A;  4CJK A;  3RTV A;  1ZYQ A;  1GOB A;  3S3N A;  1QSS A;  3S9H A;  1NJX A;  4CE9 A;  4DLG A;  4IDK A;  1NKE A;  1KRP A;  4TSX A;  3V9U A;  1T7P A;  4DSL A;  3CQ8 A;  2KFN A;  1G15 A;  1RTD A;  2X74 A;  3ZSO A;  3SI6 A;  4J2E A;  2BAN A;  2EHG A;  1BCO A;  1SKS A;  4CGH A;  2DTU A;  3IAY A;  4I2Q A;  1QHT A;  3HL8 A;  4BDP A;  1U04 A;  1SV5 A;  2RN2 A;  3OYD A;  2F8T A;  2HHU A;  2WON A;  2OPR A;  4CJ4 A;  3PX4 A;  4CGI A;  3K59 A;  3VQA A;  4RW9 A;  4F2R A;  4FZY A;  1RT2 A;  4R5P A;  3ALY A;  3AO2 A;  5HRR A;  1X9S A;  3VQC A;  2P51 A;  2YNI A;  3K5L A;  5J2P A;  1YVU A;  4DFP A;  3ISN C;  5HRO A;  5EU7 A;  4KHY A;  1DTQ A;  2JLE A;  3L2U A;  4F4K A;  4FK0 A;  3K57 A;  3K58 A;  3RMB A;  3KTQ A;  2D0A A;  1SL2 A;  3VQ5 A;  1C0T A;  3ZT0 A;  3LP3 A;  3MXI A;  4CHZ A;  2D5R A;  4B9N A;  3AO1 A;  4IKF A;  1WNS A;  3K5O A;  4CK1 A;  5I3U A;  2GUI A;  2RKI A;  4OKE A;  1LAW A;  4CJR A;  3KIO A;  1Q9Y A;  3RMA A;  4QCL A;  1SUQ A;  3O3F A;  4KI4 A;  2ATQ A;  4JRP A;  1RTJ A;  1QSL A;  3EZ5 A;  2XY5 A;  2X6S A;  4IG3 A;  4N56 A;  2QKK A;  4DSK A;  4KTQ A;  3O4Q A;  4FJK A;  1BQM A;  3AVB A;  3HST B;  5E41 A;  1D8Y A;  3I0S A;  2OPQ A;  3LAN A;  2P1J A;  4H4M A;  3OYH A;  3VA0 A;  3O3G A;  1REV A;  3OJS A;  3B6O A;  5CYQ A;  3PV8 A;  3LAL A;  3RR7 A;  4KI6 A;  4DTU A;  3HT3 A;  4KB1 A;  4GMJ B;  2IDO A;  1RDB A;  3CYM A;  4DTJ A;  3TAR A;  1JKH A;  1KSP A;  4Q5V A;  3QIP A;  4CHN A;  2FBT A;  5SWM A;  4I9L A;  1HYZ A;  4N41 A;  4ELT A;  4JRQ A;  4PQU A;  4DQR A;  2XRI A;  4C8K A;  4PUO A;  4DG1 A;  3OYJ A;  3JYT A;  1LWF A;  1U4B A;  2HHT A;  1HMV A;  3KLI A;  4OJR A;  3DYA A;  4FLY A;  4AIL C;  1JLE A;  4M3T A;  3HVR A;  1VRU A;  3WNG A;  4CFC A;  2VG5 A;  2HMI A;  1LAV A;  1WSG A;  2Q3S A;  2X6N A;  3RMD A;  1X9M A;  2YKM A;  1L3T A;  1S5J A;  4G1Q A;  3OJU A;  1FXX A;  2G8V A;  3CG7 A;  2B4J A;  2E6L A;  1EKE A;  4LY7 A;  1J5O A;  4MFB A;  2IC3 A;  3ZSX A;  4LH4 A;  4N76 A;  1U48 A;  3C94 A;  4EP4 A;  3L2V A;  3T1A A;  4CFA A;  4BAC A;  1HNI A;  4CK2 A;  4AHT A;  2Z1I A;  3ZSQ A;  4B9S A;  3AVI A;  1S9G A;  3MEG A;  4WE1 A;  4YNQ A;  4PWD A;  5C24 A;  1JL2 A;  5K14 A;  1NK8 A;  1KLM A;  3LAM A;  3L3V A;  3KK2 A;  4FJG A;  4FCY A;  3AO5 A;  3AA3 A;  5DMR A;  1LWC A;  5HRN A;  3OYG A;  2O4G A;  1NOY A;  2I5J A;  1HPZ A;  1ZBU A;  3TAE A;  4KHU A;  1C0U A;  4CJS A;  4O44 A;  4CHP A;  2IAJ A;  4KAZ A;  2HHS A;  4KHN A;  3SPY A;  3QNN A;  3HPO A;  4I2P A;  1N6Q A;  4CEZ A;  2YNF A;  1VSD A;  4KKO A;  5FRO A;  2KZM A;  3AVG A;  3HP9 A;  2FBY A;  4DSF A;  4OLB A;  3TAQ A;  4AHS A;  1CLQ A;  3DI6 A;  3RMC A;  3KKS A;  2FBX A;  1KLN A;  4DQI A;  3HO1 A;  3P5J A;  1TGO A;  1F21 A;  3DRR A;  3KKR A;  5HRS A;  3VN5 A;  4OKK A;  3KLE A;  4OKJ A;  5J2M A;  5HRP A;  4CED A;  1B9F A;  3ZT1 A;  1S1U A;  3U3Y A;  1VSJ A;  5D3G A;  2G8U A;  4W5N A;  1NJY A;  4DS4 A;  1CZB A;  1HQU A;  3NBP A;  3C6T A;  4B9L A;  3RWU A;  4DQP A;  1BIS A;  2G8W A;  3AV9 A;  3RR8 A;  4CJE A;  3AVM A;  4M3W A;  1EP4 A;  2Z1H A;  2HHW A;  4DFJ A;  1FKP A;  1RDC A;  4QAG A;  3HPH A;  3SNN A;  1IKX A;  1VSE A;  4KTW A;  4FLT A;  1NJZ A;  1TKZ A;  1J9A A;  1KFS A;  3VQP A;  3DRS A;  3KLF A;  4I9Q A;  4H8K A;  1ASU A;  4M42 A;  3NF6 A;  3SYZ A;  1L3V A;  3CFR A;  3MEC A;  3L2R A;  4LH5 A;  4DTN A;  1YTU A;  3NE6 A;  1LV5 A;  1RDD A;  3C6U A;  3L3U A;  1BI4 A;  3QEV A;  1RTI A;  1KVB A;  3AO3 A;  2BDP A;  4FZZ A;  3QEW A;  2YV0 X;  2KFZ A;  3NCI A;  1KVC A;  3KD1 E;  1HNV A;  3A2F A;  1VSH A;  3OYM A;  2W42 A;  4E7J A;  3NGY A;  1KTQ A;  3T19 A;  3TR8 A;  1U45 A;  4CGF A;  1EXQ A;  4C8N A;  3OS2 A;  2XY7 A;  2A1R A;  1NJW A;  1Q9X A;  2X78 A;  3WNH A;  4Z4H A;  4HCB A;  4E1N A;  4CHQ A;  2HNY A;  4DQQ A;  1WSJ A;  4LD0 A;  4CCH A;  4DMN A;  3SCX A;  3SPZ A;  3DLB A;  1LWE A;  1WSH A;  4O4G A;  3SV3 A;  4M3Y A;  1TKT A;  4IBN A;  2G8I A;  4CF1 A;  3VQ9 A;  4B9T A;  4KRF A;  1BGX T;  2GV9 A;  3SJJ A;  4OGE A;  1SKR A;  2ITG A;  1RT1 A;  4Y1C A;  2XHB A;  3S3M A;  1SL0 A;  4CJ3 A;  3AA4 A;  1VSK A;  4O55 A;  1C6V A;  3P83 D;  3QEI A;  3PO5 A;  4FJJ A;  3HM9 A;  4JS4 A;  4CF8 A;  3L2W A;  3LAK A;  3AVA A;  3SQ0 A;  2G8K A;  1VK0 A;  1MU2 A;  5FRN A;  4O0J A;  2BGG A;  1TK8 A;  4QOZ B;  4J2B A;  4BE2 A;  4FLX A;  2HB5 A;  4B3O A;  1HQE A;  3RRG A;  1A5X A;  3VQD A;  4FK2 A;  2OZM A;  1VRT A;  2D0C A;  2XY8 A;  5I42 A;  3L2Q A;  4M3X A;  1RT5 A;  5DK5 A;  4DF8 A;  3THV A;  3K2P A;  2KTQ A;  1N5Y A;  2PY5 A;  4DSE A;  4E3S A;  1JLQ A;  4B8A B;  3LWM A;  1S1W A;  2IGI A;  2E4L A;  4CJV A;  3F73 A;  4HUG A;  2YHB A;  4BE1 A;  3VA3 A;  3SZ2 A;  3QER A;  3B6P A;  3BDP A;  2OYQ A;  5SZT A;  4F3T A;  1S6Q A;  1S9E A;  2XY6 A;  2QK9 A;  4FJI A;  2NUB A;  2ZE2 A;  4KHW A;  2GBZ A;  4KFB A;  1C1C A;  4BWJ A;  4ZHR A;  1JLF A;  3OYK A;  4CFB A;  2OA8 A;  3SQ2 A;  4ZTJ A;  2P5G A;  4HVJ A;  3VQE A;  5KRS A;  1QSY A;  1JLC A;  3TAM A;  2QKB A;  3D0P A;  1W9H A;  1RIL A;  1T03 A;  2LSN A;  3V9Z A;  4ICL A;  1K6Y A;  1Z25 A;  4PA1 A;  3WNE A;  4ELV A;  1TKX A;  1GOC A;  3QO9 A;  2IS3 A;  4BDZ A;  1NK7 A;  2RPI A;  2WOM A;  2EX3 A;  1RBV A;  4DTP A;  1NKC A;  3DRP A;  1JXE A;  1KFD A;  3LPT A;  4CJP A;  4DS5 A;  1L5U A;  1ZBH A;  3SQ1 A;  4ID5 A;  4CF0 A;  4CHY A;  4CHO A;  3O3H A;  4E0D A;  1TL3 A;  3SUP A;  1Z26 A;  4B9V A;  4KPY A;  2QXF A;  3NF8 A;  1ASV A;  3LPU A;  4IFV A;  3NF9 A;  3VQ8 A;  3NAE A;  3VQ4 A;  3C95 A;  1D9F A;  3FFI A;  3HXM A;  4FZX C;  4Y1D A;  1NOZ A;  2VWJ A;  4CK3 A;  4F3O A;  1B92 A;  4DTO A;  3VQB A;  1S1V A;  1ZBI A;  1XWL A;  2VG7 A;  2VG6 A;  3ZSR A;  1XI1 A;  1J53 A;  1HYS A;  5CYM A;  3V1R A;  3QES A;  2FBV A;  1B9D A;  2F8S A;  1BQN A;  3AVC A;  5CY4 A;  2PZS A;  1QQC A;  3RRH A;  2HHV A;  4EZ6 A;  1CZ9 A;  1SKW A;  4M3U A;  1HJR A;  1IO2 A;  4E1M A;  3HJF A;  1O1W A;  4IG0 A;  3PY8 A;  2BE2 A;  3MEE A;  2DFE A;  4KO0 A;  3LDS A;  4DSI A;  4NCG A;  1A5W A;  5JS2 A;  4DTM A;  1IG9 A;  4Z4I A;  4CEF A;  4F8R A;  1WLJ A;  4Z0U A;  4DWI A;  1TK5 A;  1NK6 A;  4E7K A;  4CIG A;  3SV4 A;  1QE1 A;  1IKY A;  3ZSV A;  2KZZ A;  3OYL A;  2F96 A;  3DMJ A;  4GVM A;  4CJU A;  4J2A A;  2B6A A;  3QNO A;  3IG1 A;  4CER A;  2YKN A;  3ULD A;  1RBS A;  3HP6 A;  4L8R B;  4OGC A;  1GOA A;  5HBM A;  4DLE A;  4CJ5 A;  1NK4 A;  4DQS A;  2Z1J A;  1Q8I A;  5C25 A;  1JXB A;  1U49 A;  4NYN A;  4CEA A;  4HCC A;  1BCM A;  4FM0 A;  5FDL A;  3OY9 A;  1SL1 A;  2Y1J A;  4FJM A;  2G8H A;  3D45 A;  4FJ7 A;  3CFO A;  1JLA A;  3MXM A;  1X9W A;  4Z4E A;  3AO4 A;  4M41 A;  3OS0 A;  3TAN A;  3I0R A;  2P5O A;  1BL3 A;  1LW0 A;  1U47 A;  4RW7 A;  3V81 A;  2RF2 A;  4ID1 A;  4HHT A;  1FK9 A;  4FVM A;  4M45 A;  4W5T A;  5HLF A;  3AVF A;  4FLU A;  4CGJ A;  3P1G A;  2IOC A;  2Z1G A;  4N5S A;  4KTZ A;  3NDK A;  4J2D A;  4PY5 A;  4KB0 A;  5CZ1 A;  4DSJ A;  1UOC A;  4XIU A;  3KLG A;  5KGX A;  4W5R A;  3OYI A;  4M3Z A;  1RCH A;  4CJT A;  3WNF A; 
#chains in the Genus database with same CATH topology
 4DU3 A;  5AZI A;  3UKR A;  3AVN A;  5TKY A;  1WSE A;  5AQQ A;  4JS5 A;  3TAP A;  1TKD A;  3UE5 A;  3ZSW A;  5AQW A;  3PO4 A;  4C8L A;  4EZ9 A;  1I3A A;  5FPE A;  5HP1 A;  4C1N I;  5J2Q A;  4IFY A;  3LDL A;  1CXQ A;  3QIN A;  2JWL A;  4CBU A;  1NGE A;  3ASM A;  3TWH A;  4BC4 A;  4BQZ A;  4AHC A;  4IJA A;  4IOA L;  2AP1 A;  2P9I B;  4CJL A;  3DOK A;  5AQF A;  1UWB A;  2EWS A;  3AY9 A;  1QZ5 A;  3JXU A;  4XH4 A;  2O8C A;  3H46 O;  4DV1 K;  5BRF A;  2KHO A;  4BG8 A;  3MN5 A;  1VQK N;  2YHA A;  1TAQ A;  1BHL A;  3TAB A;  3CPW M;  1T05 A;  3O9T A;  3KD5 E;  4JKG A;  1H1V A;  4JEP A;  1RT3 A;  4IFE A;  3NFA A;  2YHW A;  2O8E B;  1TK0 A;  4K43 A;  3ZT3 A;  1HX1 A;  3ZSY A;  3SQ4 A;  2B5J A;  1FKO A;  1UA1 A;  1Q7Y O;  2O4I A;  4CBX A;  4E7L A;  4JI0 K;  4DTS A;  5C42 A;  4WQ4 A;  2ASO A;  1RBT A;  5BRE A;  1R59 O;  3P39 A;  1N34 K;  5AZJ B;  4B1W B;  4GW6 A;  2HW3 A;  3DLL L;  2W6L A;  2E1Y A;  2A3Z A;  2VCP A;  1QS4 A;  2G8H A;  4W5O A;  1C0M A;  1J54 A;  3KK3 A;  1JLG A;  3SUN A;  3E9P A;  4BRI A;  2WFB A;  1Y97 A;  4BRD A;  4O8K A;  2OZS A;  2FLO A;  3G6E N;  3BF1 A;  1W2B M;  4FJL A;  2ZM6 K;  3NGZ A;  2G8F A;  3IMX A;  4HUE A;  3QET A;  2UYT A;  4C8M A;  3TSQ A;  2VWB A;  2GWK A;  3VQ7 A;  3V4I A;  1QTM A;  4JKE A;  4YOU A;  3TI0 A;  4CEE A;  2A1S A;  1WN7 A;  2JGU A;  4BWM A;  1IV0 A;  3CM5 A;  4F9O A;  4IXC A;  5T7B A;  2DY4 A;  3LDQ A;  1KAX A;  2OTJ N;  5M1P A;  1Q18 A;  3P38 A;  3QLH A;  2D1K A;  4WQ5 A;  2OAN A;  1CXU A;  1RT4 A;  1NMD A;  2P9L B;  3V9S A;  3ZT2 A;  1K73 O;  1DLO A;  4AHR A;  1W7A A;  1HRH A;  4A5A A;  3PX0 A;  3C6H A;  3SUQ A;  1R0A A;  3BGR A;  3LP2 A;  5HOO A;  1DEJ A;  3S3N A;  4CE9 A;  4BVO A;  1OVQ A;  4IDK A;  1MWM A;  1KRP A;  4EIA A;  1Z05 A;  1T7P A;  1BCO A;  3OW2 M;  4IJN A;  1U04 A;  1SV5 A;  2RN2 A;  3OYD A;  2HHU A;  2WON A;  2OPR A;  4CJ4 A;  4DR3 K;  2E5L K;  3BF3 A;  3K59 A;  3VQA A;  4CJ7 A;  1RT2 A;  2P9P B;  4JK7 A;  2GUP A;  3O8M A;  3ALY A;  5HRR A;  2Q2R A;  3O4W A;  5J2P A;  4DFP A;  4U7B A;  5EU7 A;  4DV0 K;  4F4K A;  4FK0 A;  4JI7 K;  1TUU A;  2HOE A;  3VQ5 A;  1HNZ K;  3PSI A;  4CHZ A;  1WNS A;  4CK1 A;  2RKI A;  1LAW A;  1XMO K;  3RMA A;  4QCL A;  3O3F A;  2ATQ A;  3EZ5 A;  4KTQ A;  2X6S A;  3MWP A;  4FJK A;  5B8H A;  5AQL A;  3O4Q A;  4XH1 A;  3T1Y K;  2OPQ A;  3LAN A;  2P1J A;  3R6M A;  1EQY A;  2QWQ A;  3B6O A;  3PV8 A;  3LAL A;  3TSP A;  4ISE A;  3HT3 A;  4KB1 A;  4JD2 B;  3TAR A;  1RDB A;  3H3O B;  5SWM A;  1HYZ A;  5C2D A;  4XEI A;  3K0S A;  4PQU A;  5CHI A;  4DG1 A;  2UXD K;  3EEQ A;  2HHT A;  5GAG P;  2KLA A;  3E66 A;  3NVM A;  3RMD A;  4JKD A;  2VYP A;  2VGM A;  3QML A;  2IVO A;  4G1Q A;  2A40 A;  4FPB A;  1FXX A;  5M1O A;  2B4J A;  2G8V A;  2E6L A;  1EKE A;  3F2K A;  4LY7 A;  3C94 A;  3T1A A;  5C0Y A;  4GV9 A;  4YOT A;  4B9S A;  1HLU A;  1S9G A;  1W97 L;  5C24 A;  5K14 A;  5BPN A;  3KK2 A;  4FJG A;  4FCY A;  3AA3 A;  3J7A P;  4JHD B;  1HPZ A;  1KAY A;  5AQV A;  3CCE N;  4KHU A;  4KHN A;  4I2P A;  3PSF A;  4KKO A;  2PFU A;  3TAQ A;  1CLQ A;  3DI6 A;  4LFB K;  1KLN A;  1X3M A;  4B3M K;  3P5J A;  5JIC A;  3DRR A;  5AQI A;  4AF1 A;  4CI6 A;  5C12 A;  5HRS A;  4OKK A;  4CED A;  5E26 A;  3U3Y A;  3BP8 A;  3PIO L;  3QBW A;  2WUS A;  4BQL A;  1BIS A;  4JKC A;  2QWN A;  4M3W A;  3AVM A;  3TPQ A;  4OPA A;  3HPH A;  1NJZ A;  1VSE A;  1TKZ A;  5F1X A;  3VQP A;  4I9Q A;  3DXK B;  3L2R A;  3NE6 A;  4DV4 K;  3C6U A;  1GLJ O;  5AFU H;  3EO3 A;  3QEV A;  5C10 A;  3AO3 A;  1K8K A;  3I55 N;  3NCI A;  3THY A;  4A57 A;  1HNV A;  2E2Q A;  3T19 A;  1EXQ A;  2XY7 A;  2X78 A;  4A2A A;  3WNH A;  3WXL A;  4BR9 A;  4Z4H A;  2Q0R A;  3BY5 A;  4IO9 L;  3SBG A;  3SCX A;  1LWE A;  3SV3 A;  4M3Y A;  4B9T A;  3VQ9 A;  2I7N A;  2D0P A;  2V7Y A;  3SJJ A;  3HTV A;  1SKR A;  4Y1C A;  4BRO A;  3L2W A;  3LAK A;  3AVA A;  4BY9 C;  1MU2 A;  2E88 A;  4CZL A;  4DKW A;  4FLX A;  3R3L A;  1HQE A;  3RRG A;  2YJF A;  4LF8 K;  5I42 A;  4M3X A;  4DF8 A;  4BRG A;  4YDU A;  1N5Y A;  2PY5 A;  3E9L A;  3EKS A;  4O5F A;  1JLQ A;  3TSU A;  1X9J A;  3LWM A;  4DR1 K;  2QWO A;  3R8E A;  4CJV A;  4BE1 A;  2YHB A;  3VA3 A;  5SZT A;  1XMQ K;  3HBT A;  2ZE2 A;  4KHW A;  2GBZ A;  3VEO A;  1C1C A;  3TTF A;  1JLF A;  3OYK A;  4H5W A;  3SQ2 A;  5KRS A;  3ULE B;  3DXK A;  1RIL A;  5AQK A;  4H5V A;  3T69 A;  3V9Z A;  3CQY A;  3WNE A;  4PA1 A;  1GOC A;  2IS3 A;  4GV6 A;  1NK7 A;  3SAF A;  4IOC L;  4QS9 A;  2EX3 A;  4CZJ A;  4DTP A;  4A2B A;  3DRP A;  4DS5 A;  4CZK A;  4C23 A;  4MO4 A;  5JVG L;  4CHY A;  4E0D A;  4CZM A;  3EE8 A;  1Z26 A;  3CCS N;  2BUP A;  3NF8 A;  3C95 A;  4F3O A;  1YIT N;  5DM7 L;  3VQB A;  2HBK A;  3GG4 A;  4WCE L;  3ZSR A;  3W3D A;  2F8S A;  3AVC A;  2ASM A;  1TYQ B;  5M1N A;  1CZ9 A;  4BRP A;  4NXM K;  3WXI A;  1HJR A;  4E1M A;  3SK3 A;  4PKG A;  3PY8 A;  4NCG A;  5JS2 A;  4PKH A;  3OBW A;  4F8R A;  1WLJ A;  4E7K A;  4CIG A;  1QE1 A;  4JKG B;  3DMJ A;  1K9M O;  3IG1 A;  4JHD A;  1ILY A;  3CHW A;  3Q7B A;  3ULD A;  2NRZ A;  3OHR A;  3EZW A;  4CJ5 A;  3G4S N;  3CIP A;  1MWK A;  3H1V X;  1WB9 A;  2O8F A;  4HCC A;  4FM0 A;  3O1W A;  4G9Z A;  3OY9 A;  1SL1 A;  4FJM A;  1IJJ A;  4IZ9 A;  4FJ7 A;  4Z4E A;  5TKW A;  1NU0 A;  4CZG A;  1U47 A;  4NLB A;  3C65 A;  4FL9 A;  4W5T A;  1WUA A;  3G71 N;  2HBL A;  4N5S A;  4PY5 A;  2Z1G A;  4RWT A;  3NDK A;  1UOC A;  4XIU A;  1HKC A;  2QI2 A;  4RW6 A;  3WXM B;  3CCJ N;  5JMV A;  3G10 A;  1P90 A;  1IH7 A;  4JAX A;  3OYF A;  1W0H A;  3GE1 A;  4BC3 A;  2CGK A;  1IG8 A;  3G0Z A;  2PYJ A;  1D9D A;  3VEV A;  1SQK A;  2ZWH A;  1ITG A;  3A5O C;  4CJQ A;  1YJ9 N;  4NYF A;  1EWR A;  3K5M A;  1I39 A;  4DR6 K;  3MAQ A;  3CI5 A;  3QEP A;  4K25 A;  3S41 A;  4PL7 A;  3M8R A;  4BRL A;  3K9J A;  2V52 B;  1KVA A;  4N47 A;  2R7Y A;  4AH9 A;  1JLB A;  5BRD A;  2NRT A;  3DAW A;  3G25 A;  1SZ2 A;  4H5T A;  4F2S A;  1NWK A;  4FXD A;  3VET A;  2HMP A;  3N4P A;  3FZM A;  2AJQ A;  5CZ2 A;  4CES A;  1UAX A;  4OPJ A;  4JK9 A;  3DWL A;  3ZT4 A;  3MN7 A;  3HSC A;  4ILJ A;  5JLF A;  1OKJ A;  1T8E A;  5BR8 K;  3T3F A;  4B08 A;  2E20 A;  2NRX A;  3DLH A;  1EWQ A;  4FJX A;  1GLD G;  4FWK A;  3NH0 A;  1D5A A;  1RDA A;  1Q81 O;  3SLC A;  3MXJ A;  1QVF M;  3PX6 A;  1WAJ A;  3NGI A;  1HNX K;  4BRH A;  3M8S A;  5FRM A;  4KRE A;  4FJ8 A;  1XHX A;  3AA2 A;  3AVK A;  4DFM A;  2UUC K;  3N4Q A;  4B9U A;  4E19 A;  4E7H A;  3QEX A;  1EX4 A;  2ZQB A;  4FWL A;  3ZSZ A;  3SBT A;  1HYV A;  1XHZ A;  2CH6 A;  4FWM A;  5AQM A;  4ZTF A;  4CEQ A;  4CBW A;  1XC9 A;  3O4N A;  4LSN A;  3CF5 L;  1L3S A;  2UUA K;  1KC8 O;  3O80 A;  5AQT A;  3DLR A;  3ITH A;  3LZI A;  3EYZ A;  3M3Z A;  4CZI A;  1C1B A;  3MED A;  4JKB A;  1RT6 A;  1VQ4 N;  2OPP A;  4CJW A;  1G99 A;  4KH6 A;  2IIR A;  3LP1 A;  4FJN A;  1EO1 A;  1TL1 A;  1N36 K;  1VSM A;  4BR2 A;  3NH1 A;  3S3O A;  2P9U A;  4BDY A;  1VSF A;  2W41 A;  2HST A;  1XNQ K;  3LM2 A;  3QIO A;  3V1Q A;  4FLZ A;  1S6P A;  1VAZ A;  3ZX3 A;  4DR4 K;  3LP0 A;  4DFK A;  1JJ2 M;  2YX6 A;  4FW2 A;  4JI5 K;  1NK0 A;  4FWS A;  3O08 A;  4IEI A;  3A8Y A;  2O8B B;  4CJK A;  3S9H A;  1J5E K;  2VQF K;  4NB4 A;  1NKE A;  4TSX A;  2FSN A;  3V9U A;  3VF6 A;  2IVP A;  2O8C B;  2KFN A;  3WUH A;  4LC9 B;  2BAN A;  4CGH A;  3IAY A;  2I7P A;  3SAG A;  1QHT A;  3HL8 A;  1GLB G;  2BH1 A;  1VQ7 N;  3VQC A;  2P51 A;  2GTD A;  4NLC A;  2HF3 A;  5AQX A;  1GLC G;  3L2U A;  3K57 A;  4DV5 K;  1GLF O;  1NGC A;  1QQO A;  5LY3 A;  2D5R A;  4B9N A;  2FXU A;  2GWJ A;  2PAV A;  4B1V A;  5I3U A;  1V4S A;  3KIO A;  1Q9Y A;  4JRP A;  4FZZ A;  4OO1 J;  4PWD A;  1BA0 A;  1BQM A;  3AVB A;  4MDA A;  4JKA A;  3RVC A;  3VA0 A;  1REV A;  2QW9 A;  3KWI A;  3RR7 A;  4GMJ B;  3AAP A;  2NRR A;  1KSP A;  4Q5V A;  1M90 O;  2FBT A;  4I9L A;  4ELT A;  4EAH D;  4DQR A;  2XRI A;  4C8K A;  4YOY A;  4AIL C;  2QXL A;  3HVR A;  1VRU A;  3WNG A;  4CFC A;  3HOS A;  2HMI A;  4OX9 K;  3IDH A;  1S5J A;  3C6A A;  3CG7 A;  1J5O A;  3FR0 A;  4N76 A;  1U48 A;  4GY2 B;  4B9Q A;  4BAC A;  4CFA A;  2CGJ A;  3AVI A;  3MEG A;  1KLM A;  3LAM A;  3L3V A;  2HF4 A;  4BC5 A;  1LWC A;  1T6C A;  2I5J A;  3TAE A;  4JYA K;  1C0U A;  2YJE A;  5BPL A;  3CCR N;  3SPY A;  4JNE A;  3QNN A;  4CEZ A;  2YNF A;  3WQT A;  4DSF A;  4Z94 A;  3CC7 N;  4AHS A;  3CPE A;  5LMU K;  4DQI A;  4X65 K;  3B8A X;  3KKR A;  3VEN A;  2QM1 A;  3ID6 A;  1E4G T;  5ADX A;  3TTD A;  2Q0U A;  1B9F A;  1S1U A;  1VQN N;  1VSJ A;  5EXW A;  4CVN E;  4BC2 A;  2ZJR L;  3BEX A;  1CZB A;  1HQU A;  3J80 O;  3RWU A;  3R1X A;  4NXN K;  4CJE A;  1BO5 O;  3TTC A;  4DFJ A;  2P9L A;  3SNN A;  3H6E A;  1IKX A;  2HBJ A;  2FF3 B;  1J9A A;  3DRS A;  1ASU A;  4FWR A;  4DQ8 A;  3BUZ B;  3SYZ A;  3MEC A;  4DTN A;  4LH5 A;  3QB0 A;  1LV5 A;  3GDQ A;  1RDD A;  1VQP N;  3L3U A;  4WQ4 C;  2BDP A;  2YV0 X;  2H3G X;  2E2P A;  1KVC A;  3O5B A;  3O6W A;  3KD1 E;  1OH6 A;  3A2F A;  4H0V B;  3OYM A;  2W42 A;  4E7J A;  1KTQ A;  3DJC A;  4CGF A;  2F9T A;  3ZET A;  3WXK A;  3OS2 A;  2A1R A;  3CXC M;  3A5L C;  4E1N A;  4CHQ A;  4DQQ A;  3CJ7 A;  4DMN A;  4PL8 A;  1WSH A;  2G8I A;  1DT9 A;  4CF1 A;  2E1Z A;  1JCF A;  1BGX T;  2ASP A;  2NLX A;  3VTH A;  5LL6 Z;  3SMP A;  4CJ3 A;  4O55 A;  1C6V A;  1K8A O;  3HM9 A;  2ZJP L;  4JS4 A;  1GLA G;  3SQ0 A;  2G8K A;  4QOZ B;  2RHK A;  4B3O A;  1ZXO A;  3VQD A;  2OZM A;  3L6Q A;  3L2Q A;  1YI2 N;  5DK5 A;  5KPT A;  4B8A B;  4HUG A;  1S1W A;  3QER A;  1FW6 A;  5FLX O;  1RDW X;  4CD1 A;  1KXP A;  1K8K B;  4BRK A;  2BTF A;  3VEW A;  4CFB A;  4RCH A;  1YIJ N;  1QSY A;  2QKB A;  1OH7 A;  3TU5 A;  3ZEU B;  3GOI A;  5M1K A;  1Z25 A;  1KQS M;  2QEX N;  2RPI A;  1T44 A;  4DR5 K;  1NM1 A;  3VGM A;  3LPT A;  3U4L A;  5EY4 A;  2O8D B;  3C0B A;  3SUP A;  4KPY A;  3LDO A;  3E1Y A;  3VQ8 A;  4FZX C;  1NOZ A;  4CK3 A;  4DTO A;  1S1V A;  4JI6 K;  2VG7 A;  1XI1 A;  3LL3 A;  1J53 A;  1HYS A;  3J7Z O;  3KWG A;  3V1R A;  2FBV A;  4ISF A;  2FSJ A;  1BQN A;  3THY B;  2PZS A;  1QQC A;  4U67 L;  4EZ6 A;  3SJH A;  2P9I A;  4BR5 A;  1O1W A;  3GBT A;  3MEE A;  3J7Y P;  1NGI A;  1IG9 A;  4DTM A;  4B1Y B;  4CEF A;  2P9N A;  1TK5 A;  3KZB A;  1NK6 A;  2KZZ A;  3ZSV A;  5LMN K;  3UKR B;  2F96 A;  3OYL A;  4J2A A;  2VQE K;  3D6R A;  2YKN A;  1RBS A;  2Q97 A;  5CE3 A;  4OGC A;  4L8R B;  1GOA A;  3PLA A;  4DLE A;  1CZA N;  1V4T A;  1HR0 K;  5C25 A;  3FZH A;  1E4F T;  1IBL K;  1OVY A;  1BCM A;  2E2N A;  1Q86 O;  5M1Q A;  3U9D A;  4KH4 A;  5GIN A;  3MXM A;  3F5T A;  3OS0 A;  3I0R A;  1KD1 O;  2QWL A;  4RW7 A;  3SAH A;  4FVM A;  3CCV N;  3AVF A;  1OH5 A;  2ZGZ A;  3P1G A;  4CGJ A;  2CGL A;  5CZ1 A;  4DSJ A;  5JLH A;  5KGX A;  4W5R A;  3WNF A;  1OH8 A;  3OYB A;  2FC0 A;  4C8O A;  1VSI A;  5J1E A;  4DUZ K;  3MCA B;  4H4O A;  4Z4C A;  4DU1 A;  3K9K A;  4DF4 A;  3I33 A;  1TYQ A;  1BOT O;  4KHQ A;  2OCE A;  2NRW A;  4JLH A;  2ZD1 A;  5KI6 A;  1S1X A;  3UIQ A;  1YT3 A;  1NJI O;  3AGK A;  4ILG B;  3LWL A;  1YTA A;  4I7F A;  3E9O A;  3HPG A;  2E8A A;  1L3U A;  1ESV A;  1VQO N;  2HVH A;  1HKG A;  2V7Z A;  1BIU A;  4RW4 A;  3F9M A;  4JI2 K;  2D4W A;  3IS9 A;  1ASW A;  4YFU A;  4K8X A;  4M63 C;  4YY3 K;  3ZX2 A;  4MLH A;  1TAU A;  4K42 A;  4CIE A;  4BRF A;  4B3R K;  1RBU A;  4LSL A;  2YNH A;  1TVR A;  4A5B A;  4W5Q A;  4HUF A;  4EHU A;  4H0P A;  1IKW A;  1NK5 A;  4DTR A;  4YHH K;  3THX B;  4QS7 A;  4CJF A;  4E89 A;  3ZEU A;  1BI4 B;  4O0I A;  4M3R A;  1UA0 A;  1KCF A;  3NVK A;  3VES A;  4KV8 A;  4OPK A;  4Z4G A;  3O9U A;  5AJ3 K;  1WAF A;  4FM1 A;  1Q82 O;  4PHT X;  2Y1I A;  2CH5 A;  3NH2 A;  3ZET B;  2ETJ A;  3O1B A;  3WQU A;  1NK9 A;  1X1P A;  3V9W A;  1TV6 A;  5EOY A;  3BZK A;  3JSM A;  4J8F A;  3AVH A;  3U3G A;  3EKU A;  1A5V A;  1JCE A;  3NHG A;  3CER A;  5KTQ A;  1IKV A;  4FYD A;  5LJV A;  4UQG A;  2KW4 A;  4FWP A;  3HK2 A;  3CMA N;  3CD6 N;  1WSI A;  5AQZ A;  1JL1 A;  4WQ5 C;  5EX5 A;  1ATS A;  2VWK A;  3EL2 A;  4DU4 A;  1IBK K;  3L4Q A;  2HHX A;  3EN9 A;  4E7I A;  4FO0 A;  4IDH A;  3M8P A;  4DV3 K;  1VSL A;  1VQ8 N;  4B3T K;  3IRX A;  4O5B A;  4AHV A;  4CEO A;  4CF9 A;  5AQG A;  4V19 S;  4LF7 K;  3RTV A;  1GOB A;  3DXM A;  1C0G A;  4DSL A;  3ATU A;  2X74 A;  3ZSO A;  4J2E A;  2EHG A;  4DV6 K;  1NG9 A;  4JI4 K;  2J4R A;  4RW9 A;  4R5P A;  3AO2 A;  1X9S A;  3JS6 A;  4YOW A;  2DPN A;  4M7X A;  3K5L A;  1YVU A;  3P4I A;  1HKB A;  1S72 N;  3M5R A;  5HRO A;  4KHY A;  1DTQ A;  1TUY A;  2JLE A;  3K58 A;  3RMB A;  3KTQ A;  2D0A A;  1SL2 A;  3GL1 A;  5F2R A;  2UXB K;  3MXI A;  3D7E O;  4WFB L;  3AO1 A;  4IKF A;  3K5O A;  2GUI A;  1SUQ A;  1LCU A;  4JI1 K;  3I8B A;  1D8Y A;  3IFR A;  4H4M A;  3VOV A;  3OJS A;  4KI6 A;  4DTU A;  2IDO A;  1JKH A;  3LDN A;  3FE1 A;  3AAR A;  3QIP A;  4CHN A;  5MLC Q;  4N41 A;  5KQ8 A;  4JRQ A;  1VQ6 N;  3OYJ A;  1U4B A;  4FWN A;  1LWF A;  1HMV A;  4M3T A;  3DYA A;  2O8F B;  1JLE A;  5FPD A;  4LF9 K;  1LAV A;  2P9S A;  3L4I A;  2X6N A;  3WT0 A;  2YKM A;  1L3T A;  3OJU A;  4PKI A;  5GIP A;  4FWO A;  3VGK A;  1WBB A;  4I6M A;  4MFB A;  3ZSX A;  4EP4 A;  3L2V A;  1HNI A;  3FGU A;  3CJC A;  4CZH A;  4WFN L;  3ZSQ A;  4WE1 A;  3D2F A;  4YNQ A;  4AM6 A;  1JL2 A;  5ADX H;  1NK8 A;  3KVG A;  1VHX A;  5FPM A;  5HRN A;  3OYG A;  5DMR A;  1NOY A;  1BU6 O;  1YJN N;  4H0Y B;  3OBY A;  4CJS A;  4O44 A;  4CHP A;  4DHY A;  4KAZ A;  3FZK A;  5M1F A;  3BZC A;  1JCG A;  2HHS A;  5I9E B;  2O8B A;  1VSD A;  5FRO A;  4H5R A;  3AVG A;  4OLB A;  5AQY A;  1YAG A;  3KKS A;  3QBX A;  3HO1 A;  4JD2 A;  1F21 A;  5HL7 L;  3VN5 A;  3KLE A;  3JAM O;  5HRP A;  4WYB A;  2IVN A;  3ZT1 A;  5D3G A;  2A42 A;  3C6T A;  2F9W A;  4DQP A;  3CCU N;  3AV9 A;  3RR8 A;  2HHW A;  2Z1H A;  1FKP A;  4QAG A;  4KTW A;  4AM7 A;  4FLT A;  1KFS A;  4H8K A;  1XC3 A;  4M42 A;  3NF6 A;  1L3V A;  1YTU A;  3CFR A;  4LFA K;  4CZF A;  2O8E A;  1BI4 A;  1RTI A;  1RGI A;  3VGL A;  2NNW A;  1NGH A;  3QEW A;  2KFZ A;  1NGG A;  3THX A;  3AGR A;  4LF5 K;  2QWP A;  3TR8 A;  1U45 A;  3UKU A;  3T7Z A;  4DR7 K;  4CCH A;  3DLB A;  3SPZ A;  4CW7 B;  3CCL N;  4IBN A;  3HOT A;  4IEE A;  4GNI A;  2O8D A;  4YOX A;  4JN4 A;  4OGE A;  2ITG A;  1RT1 A;  3S3M A;  2WC9 A;  2XHB A;  1SL0 A;  3AA4 A;  2UU9 K;  3P83 D;  4FJJ A;  4CF8 A;  3W0L A;  1VQM N;  1VK0 A;  2BGG A;  1TK8 A;  4J2B A;  4BE2 A;  2HB5 A;  1GLL O;  1A5X A;  4BR4 A;  4FK2 A;  4EHT A;  4HWI A;  1NNE A;  4E1J A;  3THV A;  3K2P A;  1LOT B;  4E3S A;  1N33 K;  2IGI A;  2E4L A;  3F73 A;  3BDP A;  3SZ2 A;  3B6P A;  4A62 A;  3OTO K;  5AZI B;  2F7T A;  4F3T A;  2ZGY A;  2XY6 A;  2QK9 A;  4KFB A;  4ZHR A;  2OA8 A;  3M1F A;  1JLC A;  5GAE P;  1S22 A;  3QFU A;  1YUW A;  2OTL N;  1T03 A;  2HBM A;  1N32 K;  2FSK A;  4ICL A;  3ENB A;  1TKX A;  1Y64 A;  3QO9 A;  2D0O A;  4Y0W A;  4BRN A;  2WOM A;  1N8R O;  1RBV A;  3VER A;  1NKC A;  1KFD A;  1O13 A;  2GX9 A;  3MWT A;  5DM6 L;  1BDG A;  3O3H A;  3MX2 A;  5AQJ A;  2QXF A;  1YJW N;  1ASV A;  2YHY A;  3P31 A;  4IFV A;  4MO5 A;  3NAE A;  3VEZ A;  3CCQ N;  3HXM A;  1E3M A;  1BG3 A;  3L0Q A;  2VWJ A;  5KQD A;  1T3V A;  2VG6 A;  3MCP A;  2WBN A;  3Q7C A;  3QES A;  4LFC K;  1B9D A;  2NZT A;  3RRH A;  4RTF D;  1SKW A;  3QIC A;  4BVP A;  4JK8 A;  3HJF A;  2BE2 A;  2DFE A;  3U9Z A;  1A5W A;  2P9K B;  4DWI A;  1I94 K;  3SV4 A;  1U2V B;  4BRC A;  4GVM A;  3FZL A;  4CER A;  3C7N A;  1NK4 A;  1WBD A;  4FOI A;  4DQS A;  2Z1J A;  5KPR A;  3DXM B;  1U49 A;  3J81 O;  3MDQ A;  5FDL A;  5AR0 A;  3R9P A;  2HHH K;  2QWR A;  3CCM N;  2UXC K;  3AO4 A;  3TAN A;  2P5O A;  1BL3 A;  1LW0 A;  3V81 A;  1HNW K;  3KK7 A;  3IKM A;  5GAD P;  4OPH A;  4M45 A;  2YHX A;  3C7N B;  4FLU A;  4J2D A;  1C0F A;  5F0X A;  5AQR A;  1RCH A;  4CJT A;  1U6Z A;  1WSF A;  3DM2 A;  4X66 K;  5FPN A;  3TAG A;  4H03 B;  4X62 K;  2D0B A;  3O9S A;  4CEB A;  5E84 A;  4FWQ A;  2V51 B;  3OS1 A;  1NGF A;  2OPS A;  2DFF A;  4GV3 A;  3KLH A;  5J2N A;  4BRQ A;  4FLW A;  4A59 A;  4MLE A;  4AHU A;  4GKK K;  3O9R A;  3PUF A;  4FM2 A;  4OLA A;  2P9P A;  3ENH A;  3CJA A;  5AQH A;  3AVL A;  4CFD A;  2P9K A;  4NCB A;  1EET A;  3CFP A;  3THW A;  3NF7 A;  3VTI A;  1NKB A;  4B8C A;  3V9X A;  4FJ9 A;  3DLE A;  4FW1 A;  4MQ3 A;  1SAZ A;  5KGW A;  4FK4 A;  4Z4F A;  1NMN A;  3HVT A;  3VQQ A;  4BG9 A;  2YCH A;  4AQY K;  1NLV A;  1ZBF A;  2XO7 A;  3CM6 A;  3AA5 X;  3J8A A;  3A0I X;  2A5X A;  1MA9 B;  3KHY A;  4FLV A;  3EY1 A;  3OYE A;  3VMF B;  2P9N B;  1QHA A;  4RW8 A;  3DOL A;  3V1O A;  1DKG D;  1IBM K;  3LM9 A;  3AVJ A;  3DLK A;  5KRT A;  4CF2 A;  3IUC A;  2KQ2 A;  3DLG A;  4DCH A;  2HND A;  3MK6 A;  2WTU A;  2E6M A;  5C15 A;  4Q0B A;  3LZJ A;  1LW2 A;  2PYL A;  3MN6 A;  3I8D A;  3L8B A;  4NCA A;  4K8Z A;  1ZBL A;  1YXQ A;  3VQ6 A;  2HHQ A;  4RG8 A;  3ATV A;  3U6F A;  3OYC A;  4BRE A;  1RBR A;  3ULE A;  4HTU A;  2ZJQ L;  1BIZ A;  1ZC6 A;  3HM8 A;  4DTX A;  4FJ5 A;  5IT9 O;  4KHP K;  3OVN A;  2HVI A;  2HNZ A;  3ZCM A;  2NRH A;  1RNH A;  4CGD A;  5BRH A;  3QFP A;  4LF4 K;  4CIF A;  3F9K A;  2DFH A;  3RSE B;  4CZE A;  5BN8 A;  3KJV A;  4BGA A;  4ILH A;  1HPM A;  3SUO A;  1VQ5 N;  4B9M A;  3V6D A;  3HRG A;  3K5N A;  4X64 K;  4FJH A;  1DTT A;  4WFA L;  4KHS A;  3CC2 N;  3A5N C;  4CEC A;  3HYF A;  1RTH A;  1C1A A;  4CGG A;  3M8Q A;  4OVL A;  4ELU A;  3CJ1 A;  3TAF A;  4JI8 K;  3H1Q A;  3VEY A;  2YNG A;  4L3Q A;  4BE0 A;  1S1T A;  4EP5 A;  3QDK A;  4CD3 A;  2ZF5 O;  3H08 A;  3OYN A;  1RT7 A;  3OYA A;  3H45 C;  4YDU C;  3KK1 A;  3RSE A;  3E01 A;  1BA1 A;  3T1H K;  3CQX A;  3I56 N;  5JS1 A;  2Q1N A;  1RFQ A;  3SMS A;  1ZYQ A;  3AAQ A;  3PIP L;  1QSS A;  1NJX A;  4DLG A;  3VEX A;  3H3N O;  3CQ8 A;  1G15 A;  1RTD A;  3SI6 A;  4QS8 A;  2NRV A;  1SKS A;  5KPZ A;  2DTU A;  1XNR K;  1NBW A;  4I2Q A;  4BDP A;  4H0O A;  3MMV A;  4IO8 A;  1XQS C;  3ENO A;  2F8T A;  3CET A;  3CJ9 A;  3PX4 A;  4CGI A;  4F2R A;  4FZY A;  4I6M B;  1NGB A;  5EVZ A;  2YNI A;  4H5N A;  3ISN C;  2P9S B;  5AQP A;  4JV5 K;  1C0T A;  3ZT0 A;  3LP3 A;  5BN9 A;  4OKE A;  4FSV A;  3VF4 A;  4CJR A;  4IOX A;  4H0X B;  5IWA K;  4KI4 A;  1QSL A;  1RTJ A;  2XY5 A;  4N56 A;  4IG3 A;  2QKK A;  4DSK A;  3HST B;  4DV7 K;  5E41 A;  3I0S A;  4HTL A;  3OYH A;  2AA4 A;  3A5M C;  3O3G A;  5CYQ A;  3CYM A;  4DTJ A;  2QA4 N;  2FF6 A;  3CC4 N;  4PUO A;  3JYT A;  4M7Y A;  4A61 A;  3KLI A;  4OJR A;  1MDU B;  4FLY A;  2VG5 A;  1WSG A;  2Q3S A;  4WF9 L;  1X9M A;  4XH5 A;  5BR9 A;  3D2E A;  2ITM A;  2KKZ A;  1YF5 L;  2QWM A;  2IC3 A;  4LH4 A;  2YI1 A;  4CK2 A;  5LJW A;  4AHT A;  2Z1I A;  1FJG K;  5GAH P;  5ELZ A;  4O8U A;  1QQN A;  3AO5 A;  4EFH A;  4B1X B;  2O4G A;  5GIO A;  1ZBU A;  3D2F B;  4JI3 K;  2IAJ A;  4BR7 A;  1N6Q A;  3HPO A;  2KZM A;  3HP9 A;  2FBY A;  3RMC A;  2FBX A;  4GVE A;  3WXJ A;  1TGO A;  4YOR A;  4K0K K;  5A2Q O;  2A6A A;  4OKJ A;  5J2M A;  4KH5 A;  2G8U A;  4W5N A;  1NJY A;  4DS4 A;  2A41 A;  4JKH A;  3NBP A;  4B9L A;  4B1Z A;  2G8W A;  5CR4 A;  3EE9 A;  5H1S Q;  1EP4 A;  3O9Q A;  1SS6 A;  1YHQ N;  1RDC A;  3U8X A;  3KLF A;  2W6K A;  1GLE G;  4FOE A;  3FZF A;  1QQM A;  2P9U B;  5AQU A;  1BUP A;  1ZBS A;  4GKJ K;  1NGD A;  3ZX0 A;  4FVU A;  1KVB A;  5AQN A;  1NGA A;  1YVN A;  1ATN A;  4BRA A;  2GEL A;  2PBD A;  1VSH A;  2Q31 A;  3NGY A;  1VQ9 N;  1RDU A;  2Q36 A;  1BWF O;  3ZLJ A;  4UY8 O;  4C8N A;  1Q9X A;  1NJW A;  4HCB A;  1Z6R A;  1DGK N;  2HNY A;  1WSJ A;  4LD0 A;  4O4G A;  1TKT A;  5AFU A;  3CJB A;  4KRF A;  2GV9 A;  4NO7 A;  1VQL N;  1VSK A;  3QEI A;  3PO5 A;  4BR0 A;  1J6Z A;  2QTD A;  4C1N K;  5FRN A;  4O0J A;  3HZ6 A;  1KAZ A;  3MN9 A;  3VF2 A;  3NMU A;  1VRT A;  2D0C A;  2XY8 A;  1RT5 A;  2KTQ A;  5AQS A;  4DSE A;  4B3S K;  2OYQ A;  3OA9 A;  1S6Q A;  1S9E A;  4FJI A;  2NUB A;  4DV2 K;  4BWJ A;  5AQO A;  4ZTJ A;  2P5G A;  4HVJ A;  3VQE A;  2F4V K;  3TAM A;  2RE2 A;  3D0P A;  1W9H A;  4FPA A;  3FLC O;  2LSN A;  1K6Y A;  4ELV A;  4BDZ A;  4BRM A;  1JXE A;  4CJP A;  2VGN A;  1HJO A;  1L5U A;  1ZBH A;  3SQ1 A;  4ID5 A;  4CF0 A;  1D4X A;  4CHO A;  1TL3 A;  1QVG M;  4B9V A;  3LDP A;  3LPU A;  3NF9 A;  1D9F A;  3VQ4 A;  4R79 A;  3FFI A;  1M1K O;  3FFK B;  4Y1D A;  2JWK A;  4ISG A;  1B92 A;  1U2V A;  3THW B;  1ZBI A;  1XWL A;  4DUY K;  3CME N;  3UB5 A;  3M6G A;  5CYM A;  3D2E B;  1HUX A;  5CY4 A;  2HHV A;  4KBO A;  4M3U A;  1IO2 A;  2GEM A;  4IG0 A;  4KO0 A;  3LDS A;  4H0T B;  5BPM A;  5AZJ A;  4DSI A;  4Z4I A;  3UKU B;  4BGB A;  4Z0U A;  4B1U B;  4K41 A;  4YOV A;  1IKY A;  4MDB A;  3WEE A;  4CJU A;  2B6A A;  3QNO A;  4JKF A;  1XUP O;  2W40 A;  1T6D A;  3VPZ A;  1WOQ A;  3HP6 A;  1S3X A;  5HBM A;  1QZ6 A;  1Q8I A;  3ID8 A;  1JXB A;  4NYN A;  4CEA A;  1X3N A;  2E2O A;  4DB3 A;  2Y1J A;  3D45 A;  1P8Z A;  3CFO A;  1JLA A;  1NGJ A;  1X9W A;  3HI0 A;  1ATR A;  3WEE B;  5JVH L;  4M41 A;  5C2F A;  4LF6 K;  2RF2 A;  4ID1 A;  3ZYY X;  1FK9 A;  4IWV A;  4HHT A;  5HLF A;  2IOC A;  4KTZ A;  4DR2 K;  4KB0 A;  3KLG A;  3OYI A;  2UUB K;  3MX5 A;  4M3Z A; 
#chains in the Genus database with same CATH homology
 1WSF A;  4DU3 A;  4RW6 A;  3DM2 A;  3TAG A;  3OYB A;  2FC0 A;  3AVN A;  1WSE A;  1VSI A;  4C8O A;  4JS5 A;  3G10 A;  2D0B A;  3TAP A;  1IH7 A;  4CEB A;  5J1E A;  3OYF A;  1TKD A;  3ZSW A;  1W0H A;  3PO4 A;  4C8L A;  4H4O A;  4Z4C A;  3OS1 A;  3G0Z A;  4EZ9 A;  1I3A A;  2OPS A;  2DFF A;  5HP1 A;  2PYJ A;  4DU1 A;  5J2Q A;  1D9D A;  4IFY A;  1CXQ A;  3KLH A;  3QIN A;  1ITG A;  5J2N A;  4DF4 A;  4CJQ A;  4FLW A;  4AHU A;  4NYF A;  3PUF A;  4KHQ A;  4FM2 A;  3K5M A;  4OLA A;  3ASM A;  1I39 A;  3MAQ A;  3AVL A;  4JLH A;  3QEP A;  4CFD A;  3TWH A;  2ZD1 A;  4DFK A;  4NCB A;  1EET A;  3M8R A;  5KI6 A;  1S1X A;  3CFP A;  1YT3 A;  3UIQ A;  4AHC A;  1KVA A;  3NF7 A;  4N47 A;  1YTA A;  3LWL A;  4I7F A;  4CJL A;  3DOK A;  4AH9 A;  2R7Y A;  1NKB A;  4B8C A;  1JLB A;  1UWB A;  3HPG A;  3V9X A;  4FJ9 A;  3DLE A;  1L3U A;  4FW1 A;  4MQ3 A;  5KGW A;  4FK4 A;  4F2S A;  2HVH A;  4Z4F A;  1BIU A;  4FXD A;  3HVT A;  3VQQ A;  4RW4 A;  2AJQ A;  2YHA A;  5CZ2 A;  3IS9 A;  1TAQ A;  1ZBF A;  1ASW A;  4CES A;  2XO7 A;  3CM6 A;  1BHL A;  4YFU A;  4K8X A;  3AA5 X;  1UAX A;  4OPJ A;  3TAB A;  1T05 A;  3KD5 E;  4FLV A;  1RT3 A;  3ZT4 A;  3NFA A;  3EY1 A;  1TAU A;  3OYE A;  4RW8 A;  3DOL A;  1T8E A;  3V1O A;  4CIE A;  4B08 A;  3T3F A;  1TK0 A;  3ZT3 A;  3AVJ A;  1RBU A;  3DLK A;  3ZSY A;  4LSL A;  4CF2 A;  5KRT A;  2YNH A;  3DLH A;  4FJX A;  1TVR A;  4W5Q A;  2KQ2 A;  4HUF A;  3SQ4 A;  3DLG A;  2B5J A;  2HND A;  1FKO A;  3NH0 A;  1IKW A;  1D5A A;  2E6M A;  4DTR A;  1NK5 A;  1UA1 A;  4Q0B A;  2O4I A;  3LZJ A;  1LW2 A;  4E7L A;  1RDA A;  5C42 A;  3I8D A;  3L8B A;  4DTS A;  2PYL A;  4NCA A;  4K8Z A;  4CJF A;  4E89 A;  1ZBL A;  3VQ6 A;  3MXJ A;  2HHQ A;  1BI4 B;  1RBT A;  4RG8 A;  4O0I A;  1WAJ A;  4M3R A;  3NGI A;  3U6F A;  3PX6 A;  3OYC A;  1UA0 A;  1KCF A;  2HW3 A;  4GW6 A;  1RBR A;  4KV8 A;  4OPK A;  3M8S A;  4HTU A;  5FRM A;  4Z4G A;  4KRE A;  4FJ8 A;  1XHX A;  1BIZ A;  1WAF A;  1QS4 A;  3AA2 A;  4FM1 A;  3AVK A;  1C0M A;  4W5O A;  4DFM A;  1J54 A;  3KK3 A;  4E19 A;  4E7H A;  1JLG A;  3SUN A;  3QEX A;  2Y1I A;  1EX4 A;  4B9U A;  3NH2 A;  4DTX A;  4FJ5 A;  1Y97 A;  2OZS A;  2ZQB A;  2ETJ A;  3ZSZ A;  4FJL A;  3OVN A;  2HVI A;  2HNZ A;  3ZCM A;  1NK9 A;  1HYV A;  1XHZ A;  1RNH A;  1X1P A;  4CGD A;  3NGZ A;  4ZTF A;  3V9W A;  1TV6 A;  3F9K A;  2DFH A;  4CIF A;  2G8F A;  4HUE A;  3QET A;  4CEQ A;  3JSM A;  1XC9 A;  3AVH A;  3U3G A;  3KJV A;  4C8M A;  3O4N A;  1A5V A;  3NHG A;  4LSN A;  3SUO A;  3VQ7 A;  1L3S A;  4B9M A;  5KTQ A;  1IKV A;  3V6D A;  3V4I A;  4FYD A;  3K5N A;  1QTM A;  4UQG A;  2KW4 A;  4FJH A;  1DTT A;  3DLR A;  3TI0 A;  4CEE A;  2A1S A;  1WN7 A;  2JGU A;  3ITH A;  3LZI A;  3HK2 A;  3EYZ A;  4BWM A;  4KHS A;  3CM5 A;  1C1B A;  3MED A;  1RT6 A;  2OPP A;  4CEC A;  3HYF A;  1WSI A;  1RTH A;  1C1A A;  4CGG A;  5T7B A;  2DY4 A;  1JL1 A;  3M8Q A;  4OVL A;  4CJW A;  4ELU A;  2VWK A;  3LP1 A;  4FJN A;  3TAF A;  4DU4 A;  1TL1 A;  3QLH A;  2HHX A;  1VSM A;  2YNG A;  3NH1 A;  4BE0 A;  3S3O A;  4BDY A;  4E7I A;  1S1T A;  1VSF A;  3M8P A;  4EP5 A;  3QIO A;  3V1Q A;  1CXU A;  1RT4 A;  1S6P A;  1VSL A;  4FLZ A;  3V9S A;  3ZT2 A;  3H08 A;  1DLO A;  3OYN A;  3IRX A;  1RT7 A;  3LP0 A;  4AHR A;  4FW2 A;  1HRH A;  3OYA A;  4O5B A;  4AHV A;  4CEO A;  3KK1 A;  3PX0 A;  3SUQ A;  4CF9 A;  3E01 A;  1R0A A;  1NK0 A;  3BGR A;  3LP2 A;  5JS1 A;  4CJK A;  3RTV A;  1ZYQ A;  1GOB A;  3S3N A;  1QSS A;  3S9H A;  1NJX A;  4CE9 A;  4DLG A;  4IDK A;  1NKE A;  1KRP A;  4TSX A;  3V9U A;  1T7P A;  4DSL A;  3CQ8 A;  2KFN A;  1G15 A;  1RTD A;  2X74 A;  3ZSO A;  3SI6 A;  4J2E A;  2BAN A;  2EHG A;  1BCO A;  1SKS A;  4CGH A;  2DTU A;  3IAY A;  4I2Q A;  1QHT A;  3HL8 A;  4BDP A;  1U04 A;  1SV5 A;  2RN2 A;  3OYD A;  2F8T A;  2HHU A;  2WON A;  2OPR A;  4CJ4 A;  3PX4 A;  4CGI A;  3K59 A;  3VQA A;  4RW9 A;  4F2R A;  4FZY A;  1RT2 A;  4R5P A;  3ALY A;  3AO2 A;  5HRR A;  1X9S A;  3VQC A;  2P51 A;  2YNI A;  3K5L A;  5J2P A;  1YVU A;  4DFP A;  3ISN C;  5HRO A;  5EU7 A;  4KHY A;  1DTQ A;  2JLE A;  3L2U A;  4F4K A;  4FK0 A;  3K57 A;  3K58 A;  3RMB A;  3KTQ A;  2D0A A;  1SL2 A;  3VQ5 A;  1C0T A;  3ZT0 A;  3LP3 A;  3MXI A;  4CHZ A;  2D5R A;  4B9N A;  3AO1 A;  4IKF A;  1WNS A;  3K5O A;  4CK1 A;  5I3U A;  2GUI A;  2RKI A;  4OKE A;  1LAW A;  4CJR A;  3KIO A;  1Q9Y A;  3RMA A;  4QCL A;  1SUQ A;  3O3F A;  4KI4 A;  2ATQ A;  4JRP A;  1RTJ A;  1QSL A;  3EZ5 A;  2XY5 A;  2X6S A;  4IG3 A;  4N56 A;  2QKK A;  4DSK A;  4KTQ A;  3O4Q A;  4FJK A;  1BQM A;  3AVB A;  3HST B;  5E41 A;  1D8Y A;  3I0S A;  2OPQ A;  3LAN A;  2P1J A;  4H4M A;  3OYH A;  3VA0 A;  3O3G A;  1REV A;  3OJS A;  3B6O A;  5CYQ A;  3PV8 A;  3LAL A;  3RR7 A;  4KI6 A;  4DTU A;  3HT3 A;  4KB1 A;  4GMJ B;  2IDO A;  1RDB A;  3CYM A;  4DTJ A;  3TAR A;  1JKH A;  1KSP A;  4Q5V A;  3QIP A;  4CHN A;  2FBT A;  5SWM A;  4I9L A;  1HYZ A;  4N41 A;  4ELT A;  4JRQ A;  4PQU A;  4DQR A;  2XRI A;  4C8K A;  4PUO A;  4DG1 A;  3OYJ A;  3JYT A;  1LWF A;  1U4B A;  2HHT A;  1HMV A;  3KLI A;  4OJR A;  3DYA A;  4FLY A;  4AIL C;  1JLE A;  4M3T A;  3HVR A;  1VRU A;  3WNG A;  4CFC A;  2VG5 A;  2HMI A;  1LAV A;  1WSG A;  2Q3S A;  2X6N A;  3RMD A;  1X9M A;  2YKM A;  1L3T A;  1S5J A;  4G1Q A;  3OJU A;  1FXX A;  2G8V A;  3CG7 A;  2B4J A;  2E6L A;  1EKE A;  4LY7 A;  1J5O A;  4MFB A;  2IC3 A;  3ZSX A;  4LH4 A;  4N76 A;  1U48 A;  3C94 A;  4EP4 A;  3L2V A;  3T1A A;  4CFA A;  4BAC A;  1HNI A;  4CK2 A;  4AHT A;  2Z1I A;  3ZSQ A;  4B9S A;  3AVI A;  1S9G A;  3MEG A;  4WE1 A;  4YNQ A;  4PWD A;  5C24 A;  1JL2 A;  5K14 A;  1NK8 A;  1KLM A;  3LAM A;  3L3V A;  3KK2 A;  4FJG A;  4FCY A;  3AO5 A;  3AA3 A;  5DMR A;  1LWC A;  5HRN A;  3OYG A;  2O4G A;  1NOY A;  2I5J A;  1HPZ A;  1ZBU A;  3TAE A;  4KHU A;  1C0U A;  4CJS A;  4O44 A;  4CHP A;  2IAJ A;  4KAZ A;  2HHS A;  4KHN A;  3SPY A;  3QNN A;  3HPO A;  4I2P A;  1N6Q A;  4CEZ A;  2YNF A;  1VSD A;  4KKO A;  5FRO A;  2KZM A;  3AVG A;  3HP9 A;  2FBY A;  4DSF A;  4OLB A;  3TAQ A;  4AHS A;  1CLQ A;  3DI6 A;  3RMC A;  3KKS A;  2FBX A;  1KLN A;  4DQI A;  3HO1 A;  3P5J A;  1TGO A;  1F21 A;  3DRR A;  3KKR A;  5HRS A;  3VN5 A;  4OKK A;  3KLE A;  4OKJ A;  5J2M A;  5HRP A;  4CED A;  1B9F A;  3ZT1 A;  1S1U A;  3U3Y A;  1VSJ A;  5D3G A;  2G8U A;  4W5N A;  1NJY A;  4DS4 A;  1CZB A;  1HQU A;  3NBP A;  3C6T A;  4B9L A;  3RWU A;  4DQP A;  1BIS A;  2G8W A;  3AV9 A;  3RR8 A;  4CJE A;  3AVM A;  4M3W A;  1EP4 A;  2Z1H A;  2HHW A;  4DFJ A;  1FKP A;  1RDC A;  4QAG A;  3HPH A;  3SNN A;  1IKX A;  1VSE A;  4KTW A;  4FLT A;  1NJZ A;  1TKZ A;  1J9A A;  1KFS A;  3VQP A;  3DRS A;  3KLF A;  4I9Q A;  4H8K A;  1ASU A;  4M42 A;  3NF6 A;  3SYZ A;  1L3V A;  3CFR A;  3MEC A;  3L2R A;  4LH5 A;  4DTN A;  1YTU A;  3NE6 A;  1LV5 A;  1RDD A;  3C6U A;  3L3U A;  1BI4 A;  3QEV A;  1RTI A;  1KVB A;  3AO3 A;  2BDP A;  4FZZ A;  3QEW A;  2YV0 X;  2KFZ A;  3NCI A;  1KVC A;  3KD1 E;  1HNV A;  3A2F A;  1VSH A;  3OYM A;  2W42 A;  4E7J A;  3NGY A;  1KTQ A;  3T19 A;  3TR8 A;  1U45 A;  4CGF A;  1EXQ A;  4C8N A;  3OS2 A;  2XY7 A;  2A1R A;  1NJW A;  1Q9X A;  2X78 A;  3WNH A;  4Z4H A;  4HCB A;  4E1N A;  4CHQ A;  2HNY A;  4DQQ A;  1WSJ A;  4LD0 A;  4CCH A;  4DMN A;  3SCX A;  3SPZ A;  3DLB A;  1LWE A;  1WSH A;  4O4G A;  3SV3 A;  4M3Y A;  1TKT A;  4IBN A;  2G8I A;  4CF1 A;  3VQ9 A;  4B9T A;  4KRF A;  1BGX T;  2GV9 A;  3SJJ A;  4OGE A;  1SKR A;  2ITG A;  1RT1 A;  4Y1C A;  2XHB A;  3S3M A;  1SL0 A;  4CJ3 A;  3AA4 A;  1VSK A;  4O55 A;  1C6V A;  3P83 D;  3QEI A;  3PO5 A;  4FJJ A;  3HM9 A;  4JS4 A;  4CF8 A;  3L2W A;  3LAK A;  3AVA A;  3SQ0 A;  2G8K A;  1VK0 A;  1MU2 A;  5FRN A;  4O0J A;  2BGG A;  1TK8 A;  4QOZ B;  4J2B A;  4BE2 A;  4FLX A;  2HB5 A;  4B3O A;  1HQE A;  3RRG A;  1A5X A;  3VQD A;  4FK2 A;  2OZM A;  1VRT A;  2D0C A;  2XY8 A;  5I42 A;  3L2Q A;  4M3X A;  1RT5 A;  5DK5 A;  4DF8 A;  3THV A;  3K2P A;  2KTQ A;  1N5Y A;  2PY5 A;  4DSE A;  4E3S A;  1JLQ A;  4B8A B;  3LWM A;  1S1W A;  2IGI A;  2E4L A;  4CJV A;  3F73 A;  4HUG A;  2YHB A;  4BE1 A;  3VA3 A;  3SZ2 A;  3QER A;  3B6P A;  3BDP A;  2OYQ A;  5SZT A;  4F3T A;  1S6Q A;  1S9E A;  2XY6 A;  2QK9 A;  4FJI A;  2NUB A;  2ZE2 A;  4KHW A;  2GBZ A;  4KFB A;  1C1C A;  4BWJ A;  4ZHR A;  1JLF A;  3OYK A;  4CFB A;  2OA8 A;  3SQ2 A;  4ZTJ A;  2P5G A;  4HVJ A;  3VQE A;  5KRS A;  1QSY A;  1JLC A;  3TAM A;  2QKB A;  3D0P A;  1W9H A;  1RIL A;  1T03 A;  2LSN A;  3V9Z A;  4ICL A;  1K6Y A;  1Z25 A;  4PA1 A;  3WNE A;  4ELV A;  1TKX A;  1GOC A;  3QO9 A;  2IS3 A;  4BDZ A;  1NK7 A;  2RPI A;  2WOM A;  2EX3 A;  1RBV A;  4DTP A;  1NKC A;  3DRP A;  1JXE A;  1KFD A;  3LPT A;  4CJP A;  4DS5 A;  1L5U A;  1ZBH A;  3SQ1 A;  4ID5 A;  4CF0 A;  4CHY A;  4CHO A;  3O3H A;  4E0D A;  1TL3 A;  3SUP A;  1Z26 A;  4B9V A;  4KPY A;  2QXF A;  3NF8 A;  1ASV A;  3LPU A;  4IFV A;  3NF9 A;  3VQ8 A;  3NAE A;  3VQ4 A;  3C95 A;  1D9F A;  3FFI A;  3HXM A;  4FZX C;  4Y1D A;  1NOZ A;  2VWJ A;  4CK3 A;  4F3O A;  1B92 A;  4DTO A;  3VQB A;  1S1V A;  1ZBI A;  1XWL A;  2VG7 A;  2VG6 A;  3ZSR A;  1XI1 A;  1J53 A;  1HYS A;  5CYM A;  3V1R A;  3QES A;  2FBV A;  1B9D A;  2F8S A;  1BQN A;  3AVC A;  5CY4 A;  2PZS A;  1QQC A;  3RRH A;  2HHV A;  4EZ6 A;  1CZ9 A;  1SKW A;  4M3U A;  1HJR A;  1IO2 A;  4E1M A;  3HJF A;  1O1W A;  4IG0 A;  3PY8 A;  2BE2 A;  3MEE A;  2DFE A;  4KO0 A;  3LDS A;  4DSI A;  4NCG A;  1A5W A;  5JS2 A;  4DTM A;  1IG9 A;  4Z4I A;  4CEF A;  4F8R A;  1WLJ A;  4Z0U A;  4DWI A;  1TK5 A;  1NK6 A;  4E7K A;  4CIG A;  3SV4 A;  1QE1 A;  1IKY A;  3ZSV A;  2KZZ A;  3OYL A;  2F96 A;  3DMJ A;  4GVM A;  4CJU A;  4J2A A;  2B6A A;  3QNO A;  3IG1 A;  4CER A;  2YKN A;  3ULD A;  1RBS A;  3HP6 A;  4L8R B;  4OGC A;  1GOA A;  5HBM A;  4DLE A;  4CJ5 A;  1NK4 A;  4DQS A;  2Z1J A;  1Q8I A;  5C25 A;  1JXB A;  1U49 A;  4NYN A;  4CEA A;  4HCC A;  1BCM A;  4FM0 A;  5FDL A;  3OY9 A;  1SL1 A;  2Y1J A;  4FJM A;  2G8H A;  3D45 A;  4FJ7 A;  3CFO A;  1JLA A;  3MXM A;  1X9W A;  4Z4E A;  3AO4 A;  4M41 A;  3OS0 A;  3TAN A;  3I0R A;  2P5O A;  1BL3 A;  1LW0 A;  1U47 A;  4RW7 A;  3V81 A;  2RF2 A;  4ID1 A;  4HHT A;  1FK9 A;  4FVM A;  4M45 A;  4W5T A;  5HLF A;  3AVF A;  4FLU A;  4CGJ A;  3P1G A;  2IOC A;  2Z1G A;  4N5S A;  4KTZ A;  3NDK A;  4J2D A;  4PY5 A;  4KB0 A;  5CZ1 A;  4DSJ A;  1UOC A;  4XIU A;  3KLG A;  5KGX A;  4W5R A;  3OYI A;  4M3Z A;  1RCH A;  4CJT A;  3WNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...