4HUQB

Crystal structure of a transporter
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
275
structure length
275
Chain Sequence
ENIISVDHLTYQYDENQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a folate energy-coupling factor transporter from Lactobacillus brevis.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA
total genus 73
structure length 275
sequence length 275
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4huqB00
3R8CA 4BLOA 2WOJA 2QE7A 1G21E 4QXAA 2BEKA 3NXSA 5CYOA 1AZTA 2O8BB 3RWMB 4Z54A 3OF5A 3IPXA 5FTMA 5GJBA 1SHZA 3V00A 2YWEA 1DARA 2G83A 3NWJA 4HAWA 5CM9C 3LDAA 4BZXA 1JJ7A 5J5CA 1P9WA 2QAJA 4URVR 621PA 2Q9AA 5KSPA 1E2EA 1UFQA 2CNWD 3QKSA 3QNUA 4NYJR 6Q21A 2JLZA 2Z5FA 2HXYA 1JNYA 4LJ8A 2CJWB 4ZCMA 4DJTA 3RS5A 4JKYA 2JLSA 4LYAA 4PX9A 5LDDC 3O8BA 1LNZA 1ZNXA 1VCIA 3SJBA 4D4JA 1XTRA 1KHTA 1HQYE 1XNJA 3N2IA 3NG1A 1UBEA 2RHMA 4KFSA 1NBMA 5KNBA 4IVRA 4WXPA 3L2OB 1XU4A 1P2UA 2ATVA 2RGEA 4R2HA 3SE0A 2PLFA 2XTNA 1YRBA 5KDOA 2FZ4A 2CL7X 3GLGA 2V55B 3VR1A 5H8WA 4GMDA 4NE2A 2IUTA 1GL7A 2ZUCA 2NPIA 2CBZA 2ZVQX 4L8GA 2AK2A 1A2BA 1LS6A 1ESNA 4B3CA 4UXIA 5AJVB 1Z6XA 2YOFA 2ODEA 2OCBA 2ZJYA 5FI0B 3ZQJA 4K46A 4PHTA 1RRFA 5AJXA 4N1AA 4LJ5A 4LI0A 3OAAD 4Z8XA 4TWZA 3SYNA 2ZANA 4B35A 2ZPTX 4WBSA 2R65A 3CW2A 2C8VA 4D0GA 4YMUA 4PTLA 2BBOA 3BB4A 3QKSB 3SC3A 1OIXA 1KI7A 5HE9A 1T9HA 4YMVA 1SVIA 4NYMR 3JZAA 3SFZA 2OSBA 2P6RA 1WB9A 3EPHA 1VYUA 2QP3A 1GITA 2WWWA 3PUVA 1Q57A 4Q1AA 4A8JB 821PA 1JJVA 1ZCBA 2QRZA 1K5DA 1SXJA 2OCAA 3B60A 1GNRA 2DYKA 1OPXA 1ZUNB 3NVAA 1KDOA 4U02A 4ZCIA 4ZCLA 5C46F 4F91B 2V8OA 2EQBA 2JCSA 3PQCA 2AKAB 3FFAA 1TU4A 4QNMA 3U7EB 1W36B 3W6NA 3EZ2A 4EJSA 2RHDA 2XOKD 3KFXA 2A5DA 4ILEA 2GJSA 1EFHA 3ASYA 3I73A 5FI1B 2QPAA 3RYTC 1XJCA 1X6VA 5H68A 5B58C 3KQLA 2ZE5A 5JMTA 4MRNA 4HB0A 3REGA 4R9UC 4JBWA 3WNBA 1L4UA 3FHOA 3K70B 3LBHA 4PAQA 3NTUA 4WZAE 1Z8FA 5E7JA 2YNMA 4GOJA 3AVXA 4DB2A 2H18A 3SJZA 1JQLB 2G88A 5E4FA 1GWNA 4URXR 3ADCA 4A8JC 4N0DA 1XEXA 1P9NA 3K0EA 4A36A 1II8B 4IOLA 1P72A 2IXEA 4MUBA 1XF9A 4GOXA 5FBWB 3I5YA 2A9KA 3CR8A 3OFND 2JLQA 3KL4A 1Z0DA 1A82A 1T0JB 2NO6A 2OT3B 2ZYUX 3T12A 1VIYA 4IVPA 4YMSA 1EWQA 2N42A 3Q8XB 5KDLA 3SYKA 1EXMA 4A2QA 1FFHA 4AY2A 2DWQA 4MRPA 4EPXA 1G7RA 1R8QA 2WM9B 3QKRA 3QOFA 4ASUD 2GXUA 3HR8A 1SVOA 4M22A 5DE3A 1OB5A 3TGPA 4A0GA 2GNOA 1B0UA 2NGRA 1T4GA 5CB6A 1KI8A 1FOEB 2VQSA 4HLUA 4C0HA 1U0HC 2VLIA 1F2TB 3FOZA 2FX3A 4HDCA 2DFTA 4Q9KA 4IDPA 1DG3A 5A4JA 1TU3A 1V5WA 1AN0A 3A8TA 1ZM3A 3AKCA 5P21A 3ZD7A 1FX0B 1CJVC 1W5SA 2CLCX 3A1VA 4UJ5A 5GJCA 4B6EA 4URWR 5KPJA 1Z0AA 2GK7A 3PUYA 4WVFA 1BKDR 4NYIQ 5TV2A 4A15A 1NKTA 1KI2A 2FFHA 1YR8A 2ANCA 2HCBA 1Z28A 3SI7A 4Q7MB 3VKGA 1G7CA 4GI7A 3D31A 4JLVA 3AB3A 1QHNA 4QJ3A 4QHSA 1XJQA 4MDFA 2ZJOA 2EWWA 4HI0E 2VO1A 2QENA 1G3QA 2HLDA 1NNEA 1UKYA 3B78A 3GJ7A 1YRAA 1S4QA 4A4DA 1P7CA 1JR6A 4PC2A 4LJ7A 2IS1A 1PVOA 4YQFA 3DVLA 3UK6A 4M4SA 3D6TB 4MKIA 1XD9A 2VP6A 3NHBA 5AWFC 2O0HA 2R6CA 4NCNA 4FCTA 5SZJA 3UATA 2GJKA 2GHIA 3X1ZA 2QBYA 1M2OB 1JECA 4IDNA 4TN1A 1JAHA 4Q7LA 5J4VA 5C4MA 2J0VA 2KSQA 1JR3D 3AGPA 1HQCA 5JLJA 4QBHA 2MSDB 1PLLA 3SS8A 1CJTC 3KKNA 4UNPA 3VR6A 5DN6D 4ESVA 3ADKA 3PITA 2ZRFA 4LHVA 4QBGB 1M34E 4MYHA 3VHXA 1CR4A 3KKMA 4PAMA 4PPGA 2NTYC 5M04A 3VU9B 1YJ5A 2G9NA 3V4FA 3VFDA 4V03A 3K0CC 4KITB 4KLZA 2G0NA 4CEIA 5J4HA 2V4ZA 1XEWY 3GFOA 2WAYA 5GJVC 4MGYR 4V0ME 1OIWA 2QEQA 1R5BA 1U8AA 3FKQA 3A58B 3EARA 3OE7A 3OE7D 5KSYA 5L3SB 2ZR9A 4AI6A 1NG1A 4LY6A 1W4AA 1II8A 4UKDA 5IK2A 4JL8A 4Y0AA 3GMTA 1A5TA 2VSOA 4I81A 5CK5A 2IYSA 2QT1A 2FGJA 3GJ0A 3CZPA 1G41A 1ZBDA 1AGPA 4WW0A 4U00A 2VP4A 4KSCA 2IS4A 4DVGA 3PV0A 5HPYB 4URZR 5CITA 4WIAA 2QL6A 3TNFA 1HH4A 4L16A 3ZYCA 1Z2CA 4TL6A 1P62B 2OBLA 3EW9A 1T91A 2D7CA 2ZI4A 5KPDA 4GDFA 4UNQA 2O8CA 2H7VA 3DO6A 5HZKA 1AKEA 1XTQA 5KHOC 1E1QA 4RD3A 1BMFA 2NG1A 1E79A 4QJ4A 2QPTA 3JZMA 2ONKA 3THXA 3U60B 3B1ZA 3BJIC 2LKDA 2Q3HA 2JAQA 2JJ2D 4Q18A 1RZ3A 1Z0JA 3A1UA 1M7GA 3TVDA 4QBIA 4I1OA 1N6PA 4P4SB 5BN3A 4RCZA 2A2ZA 5K8LA 3THOA 1N0WA 1BOFA 1S9HA 2AR7A 4JJZA 3TSZA 1F3OA 3X1WA 1Z22A 4KAXA 5E95A 1RIFA 2BKUA 2XNDD 3LVRE 4BWYA 1E0KA 2ZU0C 3GJ8A 2B6HA 1NLFA 1XD2A 2J3EA 1SULA 4LBYA 5EQTA 3EIHA 3Q9LA 1LF0A 4CRWB 1OH8A 2ZRBA 3BAFA 4HLCA 4WOPA 5UKDA 5DGXA 221PA 1FTNA 3NBXX 5J40A 4V0OA 1HEIA 2J0UA 2AK3A 3IGFA 2PZFA 3B1WA 2BC9A 1UDXA 2ZRJA 5DYGA 4BQSA 5L3QA 2Q3MA 4HZUB 3PENA 3GLIE 5HTKA 4CF7A 4NTZA 5GJWC 4U7DA 4DZZA 4N0EA 3RABA 4PQFA 4FMDF 4CDGA 2IS2A 2DR3A 2HXSA 4JIMA 3CH4B 1AS3A 2CLDX 4B73A 3U61B 2QMUA 4DXAA 1ZINA 1U8ZA 5TXGA 3F5FA 1SXJC 1NBMD 2WSMA 5GVRA 4OJKA 1KK2A 3W3AA 2IWHA 3AVPA 4O25A 4ESHA 3SQXA 4A0RA 1XXHE 2ZAOA 4D4MA 4HB3A 4TT3A 4RD6A 3EA0A 1Q20A 4C2TA 1Z29A 1O3YA 3DMDA 4V0LA 4KFTA 1UADA 1DE0A 1SVSA 2C78A 5EE0A 2BJVA 3F0TA 3TK1A 1OKKA 2W58A 4PQYA 1G19A 2IYLD 2YZ2A 2BCJQ 3I62A 2C77A 3OHMA 2ZI3A 4EFNA 1OT3A 4R7ZA 1EFRA 2BWJA 3FPAA 1FP6A 1T0HB 3EC2A 5EP1A 2WKRA 1E1RD 2QA5A 1M6NA 3BIFA 3I8XA 4UJ3A 2ZTSA 1GSIA 1W4RA 2IA5A 2J0SA 4BLTA 3CF2A 1C4OA 2HJGA 1JR3A 3K0AA 1Z83A 3E70C 3IEVA 2OCYC 3WXMA 3ICQB 1NL3A 2YYZA 1SQ5A 1KK0A 1XCMA 3B6EA 3K0CA 3TQCA 1LB1B 2EYQA 2W0SA 2A5JA 3THYA 3AVVA 3W34A 4MGZR 4GBMA 4MYCA 3LLUA 1CR0A 2FA9A 4LPSA 1UEJA 2J9RA 2RMKA 2WV9A 3GJ4A 1AGRA 2ATXA 3QF4A 1GL9B 2B21A 1HA3A 3EZ6A 4Z8YA 1QHIA 1Z0FA 1ZM2A 1XXHA 3FDIA 3U4QA 4OQFA 1F5NA 3TUIC 3KJGA 1XEWX 1G8GA 4JSYA 4KYUA 4D25A 4ACAA 4DDWA 3O8CA 1AQYA 1NSTA 2VH5R 2R6FA 4QM7A 2FFBA 1N2CE 4EFMA 3L82B 1E9RA 1MRSA 1US8B 4Q4HA 2IHBA 4BFYA 1PLJA 1P6XA 3IHWA 4QGFA 5JJIA 5JWOA 2JGNA 4HUQA 3W6OA 1U9IC 3TW8B 2BMDA 3QPWA 5HCNA 1NVVR 1FPMA 4D2IA 3SBEA 1XCGB 3PIRA 4PXAA 1RC8A 3RS3A 4CEJB 5G41A 3ADBA 4DLUA 2FEMA 1CS4C 1XZPA 2F43B 4NCJA 4TYPA 4CZ2A 1E2QA 1X1SA 2IF0A 1G3MA 1E4YA 4LYHA 5AJWA 3WY9A 3H84A 2IYZA 1SKYE 2ZSFA 5FBVB 2Z4RA 3QF4B 1RE0A 2GCNA 2ZEJA 2J7KA 2RGXA 2GZHA 1FNMA 4BLRA 4LRWA 4M1WA 4ARZA 4QKQA 2GCPA 3F8TA 2XXAA 2W00A 2QN6A 2CDNA 2ZR0A 3TH5A 1G6OA 1SXJB 1CIPA 1IY2A 2IXFA 1KZ7B 3UWOA 3B2EA 1KSHA 2IYVA 1GNPA 4C0JA 2ZREA 1OXUA 4DUGA 3GLIB 2N1BA 1SVKA 1EG7A 3NIBA 2Z83A 1PZNA 1WBDA 1VG0B 3OESA 1G5PA 2H8KA 4GOKA 4M53A 4RD1A 2FPKA 4MRVA 3FYHA 4DUGD 1W0JD 1EWRA 2CK3A 3SBDA 3PUXA 3B82A 1AK2A 4DC9A 2BIFA 4OI4A 2VHUA 2ORVA 3ZH9B 4IW3B 3B85A 4PZLA 2CHQA 3FWYA 4RFVA 4C30A 3U3MA 1CEEA 2GJAA 3CPHA 3KFVA 4MKGA 3VR3A 3SHFA 2QSZA 4KBGA 1YR6A 5B57C 3B9QA 5JRZA 1SVLA 3PVSA 2KWIA 1ZAKA 3AH8A 3LW8A 2DCUA 3AVUA 1WXQA 4US0R 1XMVA 1YVDA 2IEZA 4KFRA 2ZETA 2J1LA 4OQXA 5FL7A 5FTJA 1DADA 2XGJA 4Q1BA 2FSHA 2ZROA 3KUCA 5JSZA 1YKSA 3M6AA 1XEFA 1Y3AA 1Q1ZA 1JB1A 2C5LA 2PLRA 3JVVA 4ZKEA 2NZ8A 1Z2AA 2J46A 2CCJA 4ZPXA 4QHYA 2KI5A 1IM2A 1E99A 1Q0UA 5DLQC 2ZRKA 3LXXA 2UVQA 1XMIA 3EZ9A 4CEHA 3U5ZB 3LQRA 3GJ5A 4X8MA 1T8TA 1TQ2A 3SN6A 3GEHA 1TQDA 4TLAA 2G6BA 2WVJA 1WP9A 3BFVA 1KJYA 1TMKA 5GVSA 1U8YA 1W2GA 2HT1A 3NH6A 2F6RA 1W5TA 1CBUA 2QM7A 4PZYA 3U7GA 2OM2A 1S1CA 1DAFA 3IEUA 3LVQE 1IOZA 3OIWA 2AWNA 2RGNA 5AR1A 4IXMA 1WA5A 5EJEA 3HDTA 3TUJC 1M7HA 4JVLA 2ZU6A 2CMKA 3MWKA 2IHYA 3GFTA 3QI2A 4TMTA 4Q4AB 1QBKC 1KSFX 1S0UA 3D3QA 3CX6A 2IS6A 3IUYA 4BLPA 1A7JA 1HURA 3C5HA 1H8EA 3ZVNA 1YZGA 1HTWA 4AURA 4P3YA 4C0KA 1J99A 2FV8A 2O8CB 1ZCAA 1XTSA 4RZUA 4B34A 4LCBA 4NMMA 4XIGS 5G53C 4EIWA 4Q19A 4IDHA 4Q00A 5DI3A 2Y8EA 3G5UA 3D7MA 1OW3B 4KV9A 3CF0A 4X8OA 3T1QA 3CX8A 4KXFB 4XWAA 1U2RA 3MJRA 3QVUA 4EQ6A 5J47A 4B3GA 5KNCA 4TLEA 3SZRA 4CGZA 3PEYA 5K8UA 1NMYA 3QE0A 4DBLC 2QMEA 5JHHB 3U3RA 1NI3A 5KYKA 2PH1A 1ODFA 3CRMA 4L9WA 1W0KD 1Z6YA 3TBKA 3BBPA 4DEYA 4R71A 3ZS9A 5FR2A 3RNLA 1KMHB 3CRVA 3T06B 2YKGA 4FMDB 5EXTA 1Q22A 5HKKA 4POAA 1R5OA 2QAGA 4Q02A 4G5OA 5KSOA 1LF5A 4PPFA 1CLUA 3IBYA 2FSGA 3AF3A 4P31A 1XFAA 3K0FA 2JLXA 1G1MA 2AKYA 2HUPA 3HPQA 4OBEA 1JR3E 1E9AA 4PHFA 4KCGA 3O8RA 2WAXA 3KB2A 5AJZA 4Q9IA 2CVFA 1SXJE 5JCZA 1W49A 2YINC 1KMHA 4GL2A 1EGAA 2QTVB 1XB2A 5FPYA 1OHHA 3C5CA 4B75A 5KSZA 1MKYA 1N6OA 2Q9CA 3CNOA 2H57A 2X77A 3OEEA 4IEEA 3FTQA 4UNRA 3HU2A 3A1TA 4OKSA 2L0XA 4QC2A 4TQUS 1IN5A 2JDID 1V43A 1J70A 3NC1C 4O0MA 2V3CC 1NMZA 2IX3A 4O2RA 2XNSA 4W7SA 3EIEA 4LBWA 5AUOB 3ZVRA 4NYMQ 4Q21A 3EZFA 5FBRB 2ZSBA 2BBWA 3CNLA 2O8BA 3P27A 4G1UC 5SZIA 4NDZA 4AKIA 2WPDA 3LRPA 2OEPA 2ZUBA 1J8MF 2GA8A 1ZYUA 4DSTA 2FPLA 2VEDA 3EIQA 1VPLA 2BHRA 3V4RA 1EX7A 4QL3A 3NBFA 2QROA 3WP1B 4B6FA 1KAOA 3AP1A 3OEHA 3VKWA 5HE8A 3ASZA 1WCV1 1NN3A 2OESA 1IXRC 4ZIRB 4B2LA 1Y63A 3K9HA 3A6PC 4Q48A 4DSOA 3UIEA 3LA6A 4YXWD 5FOWA 1F2TA 1RRGA 1TNDA 3UMFA 2WJHA 4Z1MD 2V1UA 2YWGA 1LS1A 4C0SA 1MOZA 1ZUIA 4PZZA 1TPZA 3RAPR 4P33A 2F3TA 2NOAA 1CJMA 2PMDA 3EWAA 1HT2E 3QJYA 1E0SA 2DWPA 1BMFD 1FUKA 1DOAA 1QHYA 4F4JA 4CT4B 5EXXA 1UPTA 4XSHA 1GZSA 4TSFA 1W36C 1MO6A 2QTHA 1NN0A 2P3SA 1N5JA 2DHRA 2P5SA 4BRWA 1G8PA 3K9NA 1NSFA 5F9FA 1G64A 2EYUA 3QPUA 3H0KA 3QXXA 3ZVLA 1VECA 2WICA 4G5SA 4RFSA 3DHWC 3WRYC 1XEXB 1ONBA 4HDQB 2LCFA 1IONA 1E9EA 4RD4A 1JEEA 3LXRA 3TAUA 1CKEA 1XWIA 2KBFA 3KXIA 1RJ9B 1R5NA 3U3JA 2J41A 5EZ6B 4AKEA 4ZI2A 5KO2A 4B32A 1M1YE 4EQ6B 5IT5A 2PCLA 3MWJA 3WYAA 1R0YA 2OXRA 3E2IA 4D0LB 4ZIRA 4DLVA 1R0ZA 2WZQA 2A30A 2W0MA 1ZC4A 4CIDA 4GSYA 1YE8A 1KZGB 2HCJB 1EFUA 5BWMA 1XX6A 3TSOA 3F3YA 4Q1DA 2UZIR 4IRUB 5HZHA 2QQEA 2VHQA 3QKUA 3VX4A 4B43A 4IJMA 4URUR 1RYFA 3BH7A 1K5GA 3T35A 4JL6A 2JIZD 3ICEA 1FZQA 3U2QA 1FQJA 3GJ3A 2XEXA 5KNDA 5TMPA 2O8EA 4S2EA 2Q3FA 5CIQA 3T5DA 1P60A 3GLHA 3S1AB 2X2EA 4A82A 4HYYA 4ZDJA 4GFDA 1BO6A 2BMEA 2JLRA 2GZAA 5K8TA 2YC4C 4RCYA 2RGBA 1R8SA 1BH2A 2Q21A 4BFWA 3JVUA 4OJQA 4XH9B 2GDJA 3Q3JB 4B33A 4UXJA 5J4LA 2CVHA 5BYJA 2OG2A 1XP8A 4OK3A 2QP9X 4A0FA 2MMGA 5E7IA 5BQ5A 4D4KA 3IIMA 4ZV4A 4LX0A 3HWSA 1DPFA 5DH9A 1KNXA 2GXAA 2OUKA 1ZD9A 4GP6A 3AQ4A 2FU5C 2KE5A 2LWIA 4WZBE 1E2GA 1GG2A 1VHLA 1D5CA 2NIPA 1KI6A 4OQNA 1HE8B 2BDTA 1QHGA 4CEHB 4DLTA 2XB4A 1RKBA 2Q0HA 5F9HA 2ZS7A 4BE7B 3PEVA 1WBBA 4B3BA 4IKEA 4W5JA 4ZDWA 3MCAA 3VU9A 1F6BA 4BFTA 5TY0A 1FUUA 3OEHD 5FOSA 3OEED 3KQKA 4DKXA 4PC6A 5EE1A 3RC3A 3LX5A 4BFUA 2IYQA 1MV5A 4JSTA 2H17A 4ON9A 3BFKA 2JDIA 4FN5A 2Z6VA 3TR0A 4PHHA 2QNRA 1NJFA 2K5UA 4AC9A 3KQNA 1G4UR 3TUZC 1AA9A 1QVAA 4MYUA 2F1HA 2QTFA 3GP8A 5JS7A 4XWKA 4US1R 4DDTA 3TVTA 4LSGA 3B8HA 1Z06A 4TLDA 1XZQA 2PZEA 1Q3TA 2CJWA 4BEBA 1E9CA 2AFHE 4D26A 3CM0A 3R9WA 1N6IA 3BGWA 1DAMA 3I61A 1UF9A 1R0WA 3EA5A 4D81A 4FMBB 3MFYA 3L8YA 2GJ8A 5FOXA 1LY1A 2BV3A 1KK1A 4B71A 1E1QD 1KNQA 4FCVA 2IUSA 2OO7A 2P5TB 2WJJA 2YOHA 3W5JA 5CLQA 1JQJC 1JEDA 1G16A 2FH5B 4DLSA 3I92A 1OB2A 1HUQA 1XD2B 2J45A 3BOSA 4TL7A 2WWHA 4JLDA 1W0KA 4YDHB 1UKZA 3KTAA 3N70A 2EU8A 3O8DA 4JKIA 4NZYA 1Z07A 4QGHA 1WRBA 2AFIE 2F1RA 2ASEA 1ZRHA 2VHJA 2KB0A 1DEKA 4KU4A 3FKSA 3TSWA 4WZ6A 4YLGA 5D3QA 2F9LA 3FHTA 4TMZA 3R20A 1E69A 1KI4A 4IOJA 1NG9A 3PEWA 4XD7D 4D80A 4MYTA 4KI0A 3KTAB 4V0MA 2QZ4A 3DOEA 4JBYA 1N6RA 1AQUA 4DT1B 1DELA 1UM8A 2J7PA 2GF0A 2KBEA 3W90A 2REXB 1GKIA 3EPLA 5B30A 2OLJA 2AHOA 1NIPA 1MT0A 1OYYA 3AVYA 2VIIA 3DM9B 4BFSA 4PO1A 4M1YA 5JI3E 1E32A 1OJLA 4TSFD 3HU3A 1FNNA 1KO5A 1N0VC 3AEZA 3B7GA 1RW4A 4OI1A 1W1WA 3RS7A 2XTMA 2DPXA 4M9SA 1NF3A 4OHZA 3QEOA 1U94A 4LJYA 5CDFE 3LW7A 1YZLA 4K8OA 3BH0A 1R6BX 1II0A 2JJ1A 2Z43A 2IYUA 1TUEA 3DMNA 3SJCA 3RANA 3AF2A 1US8A 4Q4HB 2JATA 4V0KA 4Q01A 2PJZA 3THWB 1COWD 1P3JA 1LTQA 4QJ5A 1KO8A 5FPTA 4NYIR 2GVDC 2P2LA 3NHAA 2VHCA 4BECA 3J81k 3CF6R 2ZUDA 1G3RA 3H2YA 2IL1A 4LC0A 4XVQA 4UNNA 3U4QB 5FUYA 4JLBA 4LYJA 2UKDA 3FGNA 2GBLA 3UWKA 1CP2A 4PO9A 5L3QB 2ECKA 3GLFA 2EFDB 2J59A 1G18A 3IDQA 3GLFE 4IOKA 4E03A 2OBMA 4M9QA 2QP4A 1OHHD 3QBVA 4MRSA 3H4MA 3A4MA 4F38A 2JLWA 3RS2A 1XDBA 4FXPA 1IJEA 5AJYA 4C0BA 3KX2A 1D8TA 3EPJA 3ZDQA 1W4CA 3IKJA 5HCIA 2XSZA 3K70C 2ZI5A 1G9XA 4RJLA 4FWTA 4KVGA 4C7OA 1SZPA 3KXLA 3LV8A 5JWRA 1E4VA 4N3NA 4M9XA 1W2HA 2F3RA 3AF0A 4M1SA 3MAAC 4AYWA 3GPLA 3FFBA 4Q9LA 1JXOA 2FSFA 3K09C 3CH5A 3M1IA 1KJWA 4H1VA 4NKRA 4GZMA 4A6PA 2GEDA 4O3MA 2LKCA 2ZRMA 5CDFA 3U3OA 2ZJ5A 5EE9A 2XZOA 3OIVA 2VA8A 1LVGA 4NHOA 3BERA 2AD1A 3MJHA 1Z6GA 4RVCA 4R2IA 3UPUA 4A6XA 1CULC 1ZP6A 3LX8A 5LD2B 1VCOA 1KI1A 2RAPA 4OYHA 2V7QD 1EFTA 2R9VA 1VKJA 4BLQA 3AKDA 4YONB 3CUEF 2WWGA 1Z6TA 5FBLB 3Q7QA 2I1QA 2PEZA 4B3DA 3WMEA 5IDVA 1NY5A 4E22A 2JLYA 1N6HA 1H8HA 3Q85A 4G5GA 4S35A 3QG1A 5LD2C 3B1XA 2FOLA 2NO0A 2X8AA 4CEJA 4IDOA 4Q1FA 1XBTA 4QOSA 5G3ZA 3GLGB 4NCKA 1QDEA 2V1XA 4RKEA 1XMJA 1G20E 2PX0A 3WNDA 4PQRA 5FFMA 2WOOA 4DCUA 1OXVA 5JEDA 3QSYA 1MO4A 4TYYA 4G5QA 1S2MA 1W36D 3B1VA 3IO3A 2YOGA 4RFSB 3HU1A 3Q5EA 1Q21A 2QE7D 3VR4A 4MKFA 1P4SA 1TQ6A 3EWSA 1ZIPA 5CJ2A 1GUAA 2DFKB 5JJLA 2B8WA 3U44B 1E9FA 2NZJA 1J90A 4L4UA 3I4LA 2QORA 2A5GA 2PCJA 4OL0A 3P4XA 1Q1QA 3CB4A 5H1YA 1VG8A 5JSZB 1XTJA 5IF9A 1T5LA 3ECCA 4D6PA 5BN5A 1JBKA 2OFWA 5KUTA 2XZPA 4FCWA 2AN9A 1WQ1R 2YV5A 1T5IA 4I99A 2C04A 4TMKA 2I4IA 5JCPA 1Z0KA 3RDPA 2OLKA 2WMOB 3BWDD 4AYXA 4DSUA 4BEJA 1OFTA 5JJKA 2EFHB 4JLJA 3HR7A 2XNDA 4QBFA 5CB8A 4PPQA 1F48A 1UDWA 1N5LA 2C03A 3IILA 4P4UA 3HPRA 3C15C 3EXAA 3W9YA 1PJRA 2GK6A 2UZ3A 4DB4A 2IWRA 1OYWA 1NVVQ 4LUCA 1D9ZA 3E1SA 2OZEA 1P73A 1IHUA 4TQAA 4JBXA 5EUQB 2ODNA 4TTQA 1LV7A 1FW6A 1AIPA 3L0SA 4XD7A 4E07A 2E9SA 4RZXA 4A8JA 2JLVA 5KDDA 3WHKA 3A1WA 1WDTA 3FMOB 5GADl 4DLYA 2REBA 3UG7A 3BS4A 5LB4A 2VBCA 2WJIA 3KUDA 2R6GA 2D4HA 4M8NE 1KTVA 5DNYB 1G4AE 3MRSA 4NH0A 5JFGA 2E1RA 3EPKA 1KYIA 4KJZA 4DDVA 5FPKA 1G3IA 1YZKA 1JAIA 2GXQA 2P67A 5LB2A 4Q03A 3BRWD 2YWFA 1ESMA 1NVXQ 3WNCA 4LBVA 3RSOA 4AWXA 1PV4A 1ZD8A 1BYIA 2C95A 3NEJA 1YZQA 5IK2D 2P6UA 2XTZA 3GLHE 2JASA 1DVRA 4H1UA 4Q1CA 1MABA 2WSSD 2WSSA 3I3SR 5DHFA 1YR9A 3RRYA 2JJ8A 4ITRC 1OH7A 2QAGB 2W6JA 4B76A 4FD2A 1RYHA 4JVMA 4WXRA 1OFIA 4A2WA 5BW8A 2ZRNA 4CYMA 1KDPA 1L8QA 3AF1A 3GCGA 4LHWA 2GBLC 4LJAA 4LC1A 1A4RA 4B2IA 1AZSC 4Y0VA 1EFRD 4OK6A 1W0JA 1X1RA 4A1FA 2OXCA 5AK0A 3BB1A 3CO5A 3LNCA 2WBLC 1J8YF 3CPEA 3TJZA 3UMSA 2BCGY 4UXHA 4AKHA 1IJFA 2H1LA 4TL8A 3TR5A 2VSFA 1FTSA 2V6JA 5FH9A 1I2DA 2XZLA 5E3HA 2N46A 4NU0A 2P65A 3FHCB 4HAVA 2VF7A 1E2IA 3AUYA 2QUZA 1VG1A 5EXPA 4TQ9A 1ETUA 1NN1A 1XXHB 1ZNWA 5G40A 4YMTA 4QG7A 5LBIA 2EWVA 3IIKA 2W2TA 3VR5A 5JWHA 4B3XA 4EPYA 4DWJA 3FMIA 1GFIA 4DHEA 1UBCA 4HATA 1HE1C 5A0FA 4QM6A 1JPJA 3O47A 5C18A 4IVQA 3KQHA 5KU1A 2VF8A 2OFXA 2O0JA 2V6IA 4AKGA 4IEIA 2O5VA 2NQ2C 3HYRA 5EXSA 1UAAA 2R6DA 4C4PA 3MSXA 4FMCB 3PEUA 1KKLA 3KB1A 4Q4AA 4NL4H 4TTRA 2WJYA 3H1TA 3CZQA 3NH9A 3GLGE 3L0PA 3SR0A 4II7A 4KLNA 5FUWA 2B92A 4JJKA 3B9PA 3VNVA 4OQMA 1UKEA 1IN8A 3DDCA 1COWA 4M9ZA 5FUXA 4V0NA 5JI2E 4G0NA 3LY5A 3ZD6A 2GILA 4Q9JA 2PX3A 1NLYA 4JLNA 5AUQA 4CVNA 2WJGA 3P1JA 3ZIAA 2QU8A 1KO7A 4RD0A 5DISB 1AKYA 2ZM5A 1TF7A 2GAOA 1U81A 1G6HA 3ADDA 2H92A 3IHLA 1SKYB 4JVSB 4XOIA 1X8KA 3IQXA 2V9PA 1OE0A 1ANKA 2AL7A 2DY1A 5JRJA 2W6ID 4FI3C 1M74A 3BE4A 4QNRA 1Q1BA 3BORA 4P32A 4I1SA 3A4NA 4QFMA 4RD2A 1MABB 4Z51A 1F2UB 1TEXA 3AVWA 2PT5A 4GRAA 1KO4A 2ZJAA 3PUWA 4ZI3A 5JEEA 1GL6A 5EE3A 5B64A 3LH5A 4F93B 3AF4A 2ZR7A 3B5JA 2BBTA 5DI9A 1XRJA 1W48A 2QAGC 4OI0A 3W8NA 2GEVA 4TL9A 5FR1A 4PC1A 2NO9A 4Q1EA 3VQTA 2PL3A 4EFLA 4E5UA 1EK0A 2D62A 3DZ8A 5TB5A 3ONWA 2R62A 4JT4A 4TLBA 2QMOA 3KKPA 3SDZA 3K9GA 5HR5A 1E9DA 2J0UB 2V7QA 4L5BA 2QPOA 4HLQB 2RGDA 3QY0A 1G7TA 2W6IA 2BM1A 3SOPA 5JZVA 4CT5A 3BD9A 3K1JA 4D4LA 4DIEA 4EJSB 5EP4A 3RRMA 3WYFA 1OF1A 5J4YA 1E2HA 1IN6A 1A2KC 2QM8A 4ABYA 2TMKA 2ZI7A 1Q12A 1GRNA 1OXTA 3KDSE 3T15A 1XPUA 3GLIA 2QMHA 5A5GA 3AGQA 3T61A 2ZYTX 2W83A 3C41J 3LLMA 4ZO4A 3BFXA 1E0AA 1ZW6A 1IBRA 2XSZD 4JS0A 4B3FX 4QHTA 2ZRIA 2B7BA 3GLHB 2RH5A 3FVQA 5FUVA 1C9KA 2ZI9A 4DLRA 3MD0A 2BJWA 2IYRA 4CW7A 2J5XA 2IYYA 2CHGA 2ZRCA 1X3SA 8OHMA 4HEJA 4MUAA 5JBQA 3ND8A 2HF8A 4EJSC 3U6KA 3PXGA 2R6AA 3C16C 3ND9A 4OI2A 4IHQA 2X19A 3MWYW 2ERYA 2F43A 3NBZC 5E7MA 3X1XA 4TYWA 3IO5A 1ZNYA 1FMJA 1D9XA 2VYFA 3ZLJA 3A1SA 5J4KA 3U44A 4PSAA 4FIDA 4G01B 4PO8A 1QG2A 2VL7A 4MITA 1ZMXA 2REOA 4LOAA 4YC7A 2J0QA 3OZXA 1U0JA 4HAZA 5L3SA 3EC1A 2WHXA 4QRHA 1W46A 4HLUC 4DCVA 5FTKA 1DAEA 2YHSA 3ZVMA 2RB4A 5FPSA 3BC1A 1IY0A 1KSGA 2W6JD 4YDSA 3T34A 3ETLA 2XAUA 2CE7A 3GJ6A 4ASUA 3KJHA 2WMNB 3MLEA 2WIAA 2C9OA 1GOTA 3KKOA 3W5IA 1WE2A 4L15A 3GEEA 2A5YB 3Q7PA 4IDQA 1HV8A 2O8FA 5DI3B 1F60A 3CPJB 2PMKA 4JLMA 4KSBA 5IHPA 4Q4LA 3P32A 1QHHB 1LFDB 2A5FA 2JIZA 4X8LA 4YMWA 1RRCA 1NJGA 1S3GA 1EESA 2G77B 4Q9HA 4BRUA 1E79D 4LJ4A 1ZM9A 4DCSA 1WF3A 1VTKA 1NBME 1TQ4A 4JLKA 1CR1A 1KIMA 1NN5A 2HYDA 3FKSD 1X86B 3VX3A 2IT1A 3EASA 1DTSA 1CTQA 1XTIA 2C9CA 2X2FA 1ELOA 3RVBA 2MSEB 1SVMA 1S96A 4DCNA 2CCKA 5L3RA 4F4IA 4XTRA 4OHYA 2OILA 2OFOA 5FTLA 5CLLA 5HKKD 2ZQ5A 4DIDA 4FINA 1GTVA 3KZ1E 1DAGA 1I4DD 1N25A 1OFUX 4F92B 1AJEA 2IEYA 1R0XA 3TIFA 4XVRA 1UKVY 1Z63A 5BN4A 3C8UA 1NKSA 2MMCA 1CRQA 1RRPA 2OCPA 3IQWA 2A78A 4BFVA 1G8FA 4L9SA 2R44A 1WMSA 4GMXA 2I1VB 4PC7A 1TAGA 1D2NA 4HSEA 1SXJD 1Z3IX 4MGIR 4RSGA 1S9DA 4KYIB 1QF9A 3PUZA 2O52A 3VR2A 4TMVA 1KSJA 2ZSEA 3AUXA 4X8HA 2H16A 2QRNA 3AVOA 4D0NA 2IK8A 2D06A 3IBGA 2GCOB 3WP0A 3THWA 3B13B 3QXSA 3QKRB 2P0EA 2BEJA 3LO5A 4ERNA 3DL0A 4B2PA 4A2PA 1CXZA 1DAIA 2HLDD 3P26A 1E3MA 1CJKC 1N5KA 1ZU4A 4C0LA 2ORIA 2ONJA 2VPPA 1MRNA 4OHXA 5DO9A 5SZHB 3U3KA 1L2TA 3K9LA 4IFEA 2WPDD 2G0TA 1XD8A 1IXSB 3KKQA 3W6PA 2BKEA 2CL0X 1SHKA 2BVNA 3K09A 4QGGA 1OH5A 3KXKA 1J7KA 5F98A 1CF4A 2A7QA 3X1YA 4LPKA 1NRJB 4ZDIA 3TKLA 2DFLA 3A4LA 1E98A 2PJRA 2QGNA 1E2NA 1IN7A 3OAAA 3R8FA 2Q6TA 3EAQA 1E2JA 3U6BA 3UKDA 3SFVA 1P2VA 2HV8A 2WKQA 4LJ6A 3R7WB 3CIOA 1KO1A 3G0HA 3I5XA 2ZRLA 5FTNA 4TMXA 1EFCA 4HAXA 3CKLA 2B8TA 2JEOA 3CLVA 1NY6A 2BMFA 2CK3D 1GRRA 2FSIA 3K70D 4FMCF 1JPNA 1CRPA 1UBFA 3SU8A 5FL3A 1GKYA 2ZE7A 1G7SA 2IYTA 4JLOA 4KFUA 1VDZA 2O8EB 4Q5IA 2XITA 4LV8B 4C3ZA 1T3SA 5IRCD 2GEUA 3LBIA 4GNKA 1YHNA 1P5ZB 4NP6A 5DSZA 1E9BA 1L4YA 2C9YA 4NYJQ 4GPTA 4I1VA 3A37A 1ZD1A 1N0UA 1R10A 2ANBA 1VMAA 2PZGA 2EVWX 5CYPA 2O8FB 5EUMA 2CCGA 3MUFA 4C9BA 1TEVA 4LHZA 5L8VA 3AVTA 2F1IA 2EFCB 1TADA 1UEIA 1R7RA 4IXNA 5C1BA 1H8ED 4HUTA 1KJZA 2OAQ1 2NPFA 1VCMA 3DKPA 4UNSA 1Q3HA 1AS2A 3AVQA 3VNUA 4FW9A 1QRAA 3KQUA 1P9RA 4B74A 3NBYC 2GF9A 4LHXA 3WBKA 3CRQA 1OV4A 4H9GA 1Z6AA 3IIJA 2F9MA 2R2AA 1TTTA 4LV5B 4KODA 3I32A 2ZYWX 1S3SA 3SJAA 1E2PA 1DAHA 1NVWQ 1S8FA 3QENA 3EX7C 2RGGA 4RZ2A 4TMWA 1Z08A 2FEOA 5TDHA 1XPRA 3NKVA 1UJ2A 2GWHA 3GQBA 3AM1A 1IY1A 4M2LA 2QBYB 2WIBA 2ZE6A 2C96A 4U5XA 3TQFA 2V54A 3BK7A 5BXQC 3QUSA 1OIVA 1P2TA 3D8BA 1IXZA 1DS6A 1TF2A 2ZS9A 3GFPA 2YJTD 4PR0A 4W9MC 3LBNA 4MRRA 4M1MA 1DO2A 1GM5A 4Q66C 1E96A 1KDRA 2B7CA 2JA1A 3RHFA 721PA 3RS4A 1A1VA 1KY3A 4J0QA 2AD5A 3CRRA 2EFGA 1G291 4R98A 2WWYA 1VG9B 4C7OB 3ZZ0A 2IF2A 3CONA 3HP1A 4PSKA 1MH1A 3UG6A 1VHTA 1QVRA 4DSNA 2XX3A 3CX7A 3L43A 2CHVA 3GEIA 1RFLA 1KMQA 2YWHA 2AXPA 4JZKA 2ZI6A 1HYQA 1KI9A 4JLAA 2D2EA 3TMKA 2PBRA 1AM4D 4K81B 3FMFA 1VIAA 2VRWA 3OIYA 1XTKA 3I72A 1W47A 2R8RA 3X1DA 1SVWA 2XJ9A 3LWNA 5K8IA 1YZNA 4WA7A 3QPVA 4NCHA 4ARZB 3PG5A 3WMGA 4Q4JA 4V02A 3KJEA 1ZM4A 5FL7D 4A9AA 3RRZA 4ACBA 4G5RA 3SYLA 1RJ9A 2VP9A 2BOVA 3LQQA 4LGMA 4M1KA 4EUNA 4URYR 1ZNZA 2ZITA 2GRJA 3NC0C 2D74A 3QEJA 1Q44A 4OQLA 1QZXA 4JYCA 1SKQA 5TVKA 3K0FB 1F2UA 2C99A 2IXGA 4C0QC 4Q7JB 3OFNA 3ZJYA 2ZJZA 5CK4A 4PPNA 5DIFA 3QKTA 1H8HD 4PSVA 3QQ5A 2WWIA 2VP2A 3M4YA 2XB2A 1N6NA 1U90A 4TYNA 1KI3A 5FOUA 4BFXA 3QIAA 1BIFA 2GETA 3UANA 1LW7A 1N5IA 2YC2C 2P6NA 3EZ7A 4EKDA 2ZSDA 2HEIA 4A0HA 4JT2A 5DYIA 4DT1A 3R9XA 1KGDA 1G17A 1NIJA 4I1UA 1E2DA 1T3LA 2C98A 2QGZA 1OLOA 1ZC3A 4Q4JB 4EDHA 2WKPA 1B23P 2HYIC 421PA 1D6JA 2HDNB 3GJXC 3OIUA 3AV0B 4MQBA 4PC3A 1JXMA 1W4BA 1ZJ6A 5EE5B 3C14C 2FJUA 1OH6A 4P4SA 4KHZA 2GAAA 1KAGA 3RWOA 5C2JB 3RS0A 1S1MA 3TLXA 1I4TD 2VP0A 4HB2A 1GRQA 1YQTA 1MO3A 1EX6A 4P4TA 3K8YA 1OSNA 3ZZTA 2D7DA 2Z4SA 1KK3A 2ZYVX 5H70A 3DPUA 4P0TA 2KJQA 3Q72A 3K53A 2RGCA 1TUIA 4OHVA 1RPZA 1W7AA 2BBSA 3ZS8A 1GILA 4EPRA 1QHHA 2EW1A 1PLKA 1GP2A 4PANA 3U7HB 3BB3A 2D3WA 3DM5A 1ZUHA 3I1FA 2BMJA 2JJ2A 3QG5A 1HY3A 2FE4A 4RZ3A 1N6LA 5FOTA 4DLWA 1ZM7A 3ZGXA 4EPTA 2WTUA 1G8YA 3VTKA 2QY9A 3PFIA 1HT1E 3MG9A 2AWOA 3WRXC 3SEAA 1E94E 4TZ0A 2MSCB 2ZE8A 2OV2A 2HJVA 1FL9A 2XJ4A 2F1JA 4TTPA 1T8UA 2VSXA 5AUPB 1H65A 2DWOA 4LBZA 3RRNA 3GLFB 3LD9A 3CRW1 1U9IA 4HAYA 4MDEA 2W2XA 4CEIB 2X1VA 3PR1A 3WYGA 3N5CA 5LPNA 3CWQA 1E1RA 1C1YA 3A36A 2ODWA 4EPVA 2CLSA 1ZU5A 5AUNB 4NONA 4NPHA 4C0AC 1XCPA 1JI0A 3CNNA 2FFQA 2WWXA 3G82C 4TLCA 3W8RA 3ZZUA 3K0SA 5JS8A 1KI6B 5F2EA 3NDBB 2RCNA 2FFAA 3BH6A 1OKKD 3L8ZA 5FBQB 5FPHA 1CJUC 2CNWA 2I3BA 2ZIAA 1KY2A 2AX4A 3DKVA 1TX4B 2C2HA 2PEYA 4B48A 4JLPA 4O2LA 4BASA 2NO1A 1II9A 1DO0A 1ZIOA 4HZUA 1E2LA 1D2MA 4W5HA 1CU1A 5C4GB 3UMRA 2FGKA 1NVUQ 2G1JA 2IYXA 2JLUA 2WWFA 121PA 1BYUA 2ZJ2A 1NMXA 3L0OA 2IYWA 5BYKA 5JHGB 2E87A 3FE2A 4IFBA 4PFSA 3REFA 1ZVQA 2FPMA 3DZDA 4AD8A 4NBSA 1AS0A 3PCRB 3SQWA 1I2MA 1L7VC 1XJ0A 2QT0A 4DDUA 2ODBA 4M21A 4LDJA 1YZUA 4M1TA 2XOKA 4LJ9A 4MH0R 5F3WB 1E2MA 1IAQA 3I8SA 4AIIA 4DLXA 4BFZA 2ZAMA 4HZIA 2GTPA 2FF7A 2VHTA 1Z5ZA 3QVVA 1KKMA 1O87A 3C7KA 4LV6A 4C2UA 2W2VA 3QXHA 4NCIA 1T6NA 5EP2A 5KOYA 1KDTA 2CEAA 2DFNA 4MA4A 2XXAB 3UXMA 3VKHA 4Q7KA 3THXB 3E5HA 2BM0A 2QQ0A 3L0IB 5FOVA 2SHKA 4DEXA 4WAUA 1E0JA 1GVNB 4LZZA 4RKFA 5D3MB 3WBJA 1E9SA 1GDDA 3V9PA 1YU9A 3ZIAD 3HYTA 1OXSC 4JMPA 3T5GA 3WMFA 1OFHA 1X8LA 2NMVA 2YVUA 2FMXA 3QF7A 1VCNA 3CR7A 4JVNA 1QHXA 3SNHA 4XWOA 3M0EA 3C4JA 4GT1A 2FDCA 1BS1A 2O8DB 2QI9C 2AXNA 3W3ZB 2NO7A 1M7BA 2PT7A 2ZRHA 3LFUA 3U7FB 2Q9BA 1JALA 4MGKR 521PA 4HB4A 3NEYA 3X2SA 4BGDA 4EPWA 3FB4A 4HLDA 4F4CA 1Q1EA 4EAQA 1TL7C 2FG5A 3AP2A 2GKSA 4FWIB 1FMLA 2QG6A 1MR3F 2CE2X 4M1OA 3GD7A 3AKYA 4B47A 1Z47A 3FMPB 4G3XA 2ZRGA 1R4AA 3T1OA 1X8JA 5JECA 2O0KA 3ZQ6A 3AKEA 4QGAA 1GKUB 3BXZA 2GESA 2IBMA 2RGAA 2FNAA 2FN4A 2J7PD 4JYBA 3QBTA 1P75A 1G8HA 1KOFA 2GJ9A 4GZLA 3MMPA 4XVUA 4PAOA 1VYTA 3RC8A 2GZDA 2RGNC 1NP6A 3K0AB 2G1KA 2OAP1 4A92A 2GXSA 5G3YA 4F7WA 2HF9A 5DHAA 5ELXA 1IQPA 5CM8B 2Z0MA 3NDPA 4IOMA 2F55A 2F7SA 1U98A 2QSYA 3EG5A 1OXXK 3DEFA 4XTCS 3TRFA 1N6KA 2DBYA 1P61B 2ORWA 3S1AA 4PHGA 1XPOA 4DCTA 3P20A 4KVAA 4LYFA 1XMSA 4I4LA 3H86A 1GIAA 3IPYA 3CWZA 1P2SA 4AG5A 2CXXA 2IC5A 3MGCA 4UQOA 4XJXA 3VHLB 1N3BA 4KO8A 5ANRB 4DRZA 2FWRA 3MWLA 3CBQA 3TE6A 4D82A 4GP7A 4TZ6A 4OK5A 1FX0A 4HDOB 4TT3D 1GNQA 2CL6X 3R9IA 1E2FA 4DLZA 2ZRDA 1G3UA 2OBNA 3PJRA 4US2R 2HT6A 1DAKA 1QHSA 1YZTA 2ZJ8A 3RSLA 1MO5A 4LHYA 1M8PA 3DOFA 1YR7A 1R2QA 2ZJBA 5DN6A 2ZSAA 4ZDKA 4Q47A 2GCOA 5B2ZA 2ERXA 2EFEB 2VP5A 5EP3A 5L3VA 4AYTA 4BPBA 2A3RA 2D2FA 4HUQB 4OHWA 1K6MA 4Z1MA 1E2KA 1U99A 2ZS8A 1G5RA 4YXWA 4AG6A 5KTYA 3Q5DA 5CJPA 4M0LA 4TYQA 4MKHA 3VAAA 2GVZC 4KBFA 1G5TA 4XSGA 2JJ1D 3RLFA 2ZXUA 2O8DA 1FQKA 3T1TA 3QXJA 2OHFA 2J87A 5SZKB 5TARA 1VYVA 1Z0IA 2ZRAA 1TF5A 4W5WA 1PUJA 3N2EA 3P4YA 1J2JA 1DBSA 2OE2A 1K8RA 3T1VA 4RY2A 3VMFA 3WHLA 4LWZA 3LAWA 1T3HA 2VTKA 1CR2A 1PUIA 2H5EA 3HJNA 1E6CA 5D3MA 5CIWA 4BZPA 1U0LA 4BLSA 1RVDA 4B44A 3THYB 4JL5A 4HAUA 1W44A 2ZRPA 1GAJA 1SGWA 1UBGA 3TW4A 2DB3A 2RKOA 1QG4A 1FP7A 2G3YA 3AP3A 2IUUA 1D2EA 1DG1G 4BUJA 2WJVA 3QXCA 1NLZA 2IW3A 4AK9A 4LK2A 4E09A 1I4LD 3B1YA 1IN4A 2ZVPX 4BZQA 3R7WA 3KJIA 5EZ5A 3TAHA 3SHWA 2FZLA 4ZKDA
chains in the Genus database with same CATH superfamily
1YO6A 5G0TA 2H31A 3OPYB 1PFQA 4JV5B 3G8CA 2O8BB 2VTBB 1U9CA 1ENYA 2JD2A 3EVCA 3P5SA 4KQKA 4YP1A 1OD6A 3K0KA 1U7PA 1SHZA 4RGYA 3V00A 4R6WA 5FKJA 1YDMA 1X7DA 5IEBA 4KV7A 3L9WA 4HAWA 5CB0A 1T13A 5JYDA 4QUJA 4BZXA 3WLTA 1TECE 2WT9A 3DTTA 2Q9AA 3C6ZA 4JI6B 5HUQA 2IOFA 3EGDA 4NYJR 2XVMA 4MQLA 2Z5FA 5EIOA 4X61A 2OGSA 1JNYA 1R27A 4L9AA 4N7BA 2PS0A 2GEFA 4BXOB 1WLYA 4LYAA 3TOSA 5B7QA 3E03A 3EFHA 3OETA 3O8BA 5DASA 4WN9A 1VCIA 1KVUA 3SIWA 4MR8B 1UBEA 1Z74A 5CHYA 2XYQA 1NBMA 3WX0A 5LQDA 4RS4A 3UB2A 4GBGA 4DUPA 3L2OB 1P2UA 3SE0A 4Q3NA 2XTNA 3GA7A 1UP4A 3UVEA 2FZ4A 4Q9NA 5H8WA 4D3DA 1GAWA 4GMDA 3IV6A 3AFOA 4E11A 2ZIXB 2ZUCA 2CBZA 1Q92A 3VHQA 3ERCA 3B36A 3AEUB 3DUWA 3HL4A 3UJCA 2FW0A 4UMFA 3GMDA 2HHHB 1A2BA 3MB5A 4DJFC 1ESNA 4B3CA 1CY8A 5A1JA 1E3LA 2ZJYA 2ODEA 8GPBA 4K46A 4MW0A 4PHTA 4WN9B 4Z8XA 1QV7A 4TWZA 1GAQA 2XYGA 1H3FA 2F4VB 4K9DA 1BJRE 3WL8A 1DPGA 4G5YA 3CW2A 2VDWA 1H2EA 2HUNA 4IGKA 2JLBA 3MS2A 4DR4B 5JS1A 3QUQA 3UJ8A 3H9QA 1T9HA 1YMUA 4ZVRA 2MINB 2QZ9A 5KZMB 1AMNA 3JZAA 1A8UA 1GA1A 1Q1GA 2GARA 1BE8A 2MYPA 3NM6B 2JFHA 4I4TA 4MEJA 4X1OA 1TTQB 2PWZA 4X6LA 3EPHA 2WWWA 1TQ8A 3VZRA 3PUVA 4LZPA 2P8JA 1VSTA 4MAMA 3VBEA 3JCZA 2QRZA 1ZCBA 1K5DA 1BWSA 1G5IA 1SXJA 2C57A 2OCAA 3B60A 3KQTA 5C46F 1KDOA 4F91B 3QBEA 5J23A 1MQ9A 1S2IA 2D1YA 3B53X 4OREX 3FFAA 2M1XA 5JNRA 5BSHA 2Q7DA 3W6NA 3HKCA 3HI6A 2RHDA 3L5OA 2CMGA 2XLCA 3VI4B 3WWZA 2VSQA 4JLSA 5A03A 5LL6P 4OGLA 3ONVA 4BJ3A 2GJSA 4ZVLA 2QPAA 2PV7A 1XJCA 2P6MA 3G2KA 1Q74A 1CDEA 1Z82A 3D8RA 1HOTA 5B58C 2HQRA 3RYHA 2ZE5A 2UVPB 4JP1A 1QK5A 4C88A 4E70A 1XVLA 2X58A 3REGA 3IB6A 4WUTA 3CVOA 3R09A 2PU5A 5HGXA 4XEUA 5CMLA 2Z6QA 4WZAE 3MWDA 1Z8FA 4Z2AA 1YQEA 1ODIA 2XI4A 3AVXA 4UE6A 2FFRA 2H18A 4MDYA 4BTLA 5AXDA 1J09A 4LKRA 1RJEA 1JQLB 4K2AA 4KK3A 4YP9A 1T1SA 3RAGA 4YGXB 2O2ZA 1JIXA 1XEXA 4N0DA 3PF9A 2X1MA 3SBXA 4P0PB 3PXUA 4A36A 1DJLA 2J3JA 4G9GA 5IDYA 4MUBA 1EFLA 3Q7IA 3FXAA 2OGZA 1XF9A 4GOXA 3TL6A 2H7CA 3MTIA 3CR8A 4KPUA 2I66A 3KL4A 2QN2A 1FS4A 1KZYC 1TJ5A 2Z57A 3JSAA 1LVUA 4R1UA 3C3MA 4KX5A 3IPLA 1ILEA 2OT3B 2ISSD 4Q7EA 3V7UA 1EWQA 2N42A 3I1IA 3KSMA 1PUXA 2P75A 3OEYA 3OTWA 2C9BA 3BL8A 1CCWA 4P38A 5IBRA 3FDFA 3EIFA 3OZAA 3T5PA 4R05A 1R3UA 4GKAA 1Y42X 4CM8A 1CW2B 1G7RA 2UDPA 1KFKB 4JFRA 3W5HA 5JZOA 4FZ3A 4ZI7B 5EMKA 1THGA 1PNVA 3CUSA 2H0AA 5DE3A 3V7WA 4EQZA 4FXOA 1X1BA 1FVFA 1X80B 3SR3A 2NGRA 1JEOA 1YZYA 1PQWA 2PKQO 3RC9A 5LQJA 2Y2UA 4OHRA 1SFRA 2B0JA 2Z5VA 4C0HA 2FN7A 2WTAA 1H3EA 1VE6A 3FYTA 4O6VA 1KJQA 3U13A 3WDMA 5MFZA 2C7QA 3E05A 2Z5GA 3HFRA 4FYMA 3U62A 1V5WA 1ZA1A 3A8TA 2WIFA 3TPCA 1HMPA 1XZKA 4ER0A 3L4BA 2G4LA 2UYCA 1MVLA 4M1EA 5A9SA 1DRWA 2D0OB 2JRLA 3SR4A 4D43A 5BSFA 2JFWA 3IP9A 1NJ2A 2GK7A 2HIGA 4WK6A 5K3OA 4DSZA 4I46A 4NOMA 5DKFA 1WNFA 4F5EA 4NYIQ 2CFOA 3Q7SA 4NSNA 2HMTA 5TV2A 1PZXA 2FG7C 1YE3A 2JFVA 2V59A 2M6SA 3EMVA 4PGGA 3I6ZA 4O4IB 1HOXA 1PBNA 3H1EA 5GV8A 4WK4B 2WQ7A 4QJ3A 3BMOB 4QHSA 3VO2A 2YXLA 4OOEA 4E6EA 2ZJOA 4FP9A 2ONCA 1N2EA 2VO1A 3VUFA 5JAUA 1BS2A 3RAFC 1V2GA 2WFLA 1KZHA 1YRAA 3P2IA 1XCLA 2QGFA 4A4DA 4X45A 3KEOA 1RXYA 1PVOA 4WPGA 4MK4A 2C54A 4UUQA 2GYYA 3TB4A 3NHBA 2IV2X 4CMAA 3LCCA 3WKDA 1O03A 5SZJA 4NR0A 1Y1TA 2GHIA 4UHCA 1P91A 2XT6A 3VPBA 4AB1A 1M2OB 1YRHA 4IDNA 1SH7A 3N05A 1JAHA 4Q7LA 4ZVPA 3W1VA 4CCAA 1FW8A 2Q49A 5JLJA 2JI8A 3A6LA 4NH4A 4WOKA 4QBHA 3W4KA 1PLLA 1O97D 1SBCA 1WPXA 1T4MA 1BVRA 3VR6A 3ADKA 1WBJB 3BMQA 3PITA 4QTZA 1GG5A 1J2YA 1DOHA 1C3VA 1GNVA 2H5JA 1I6MA 2QTLA 2QVYX 1YJ5A 4ND1A 4NDAA 2G9NA 3VU9B 4W63A 4C6TB 3V4FA 5CT4A 4MOWA 3DD1A 3VFDA 4KITB 4KLZA 3BTOA 1RYYA 3ZK9A 1TAQA 1V1RB 4LQ4A 1VLMA 1PEKE 1XEWY 4V2IA 4O4LA 2VWHA 2VFAA 1Z7GA 2VSNA 2A88A 2GN2A 5L3SB 5KSYA 3ENVA 3OE7D 4AI6A 2EX1A 4RLFA 1W4AA 2CC2A 2RJNA 4IQ0A 2ATIA 1C8KA 1PVDA 1OXKB 2ZBFA 4Y0AA 5HJ2A 3SSOA 4FM9A 2Y92A 4FGLA 4X3OA 1RBMA 4I81A 5CK5A 3DS8A 5L7TA 3V2HA 1XDSA 3ME5A 2Y1KA 4WW0A 4WV3A 3BG5A 4JK3A 4U00A 2HHJA 1MX1A 1BTOA 2VP4A 4BMPB 4DTIA 4WEQA 1P29A 4DVGA 1PL6A 2BZGA 3M8KA 4JJAA 5GMOA 1EUZA 4ZEWA 4M0MA 5LA6F 3R76A 1CHDA 4WIAA 2QL6A 4UAUA 1HH4A 3VA7A 4L16A 2FOXA 3TMYA 4DMUB 2PLNA 3SXUA 3EW9A 2X4DA 1UBHS 3EUWA 3Q3CA 1FXWF 5IVPA 1V37A 5HQ3B 2PT6A 3E9NA 4GDFA 2O8CA 3OHPA 4P35A 1FQWA 1XTQA 1E1QA 4RD3A 1BMFA 4ZAXA 4E2XA 4E3ZA 4G0QA 4DF3A 2I76A 3MHTA 1B0PA 1N8SA 2ONKA 1M75A 2IQIA 2MTBA 4CCYA 3DA8A 1L8LA 1E1YA 4B4WA 5EFOA 3RKUA 1ULAA 3SEZA 3SYRA 5LIPA 5J2TB 4FLFA 3CJTA 4I1OA 5BN3A 4TS9A 4RCZA 5K8LA 3FPHA 1M0TA 5LVAA 2GFQA 1BOFA 1S9HA 2XOXA 2AR7A 4N49A 3TSZA 3GWGA 4KAXA 1C8VB 1PGOA 1MW8X 1OX5A 2BKUA 3HV2A 3LVRE 3HZRA 1E0KA 1Z5WA 3GJ8A 3LOUA 4RAQA 2XCUA 4P53A 5D87A 4C4ZA 1U2DA 3FJOA 1OVGA 2J3EA 4KIFA 4O29A 4P86A 3TEJA 3UMCA 4PRYA 5BWLA 1FRFS 4UDOA 1JLHA 5EPOA 3TJMA 5IZCC 1T24A 2Q8NA 5CEFA 3CEMA 1BZYA 5DGXA 5KCZA 2I78A 1VZ2A 4K9RA 3WBBA 1AA6A 2V0CA 3UOWA 2PH7A 4CG2A 1Z4NA 4U8GA 4ESVA 3B1WA 5CPBA 2PV0A 4OQEA 4AJ4A 3MQ2A 1TUGA 4Q0MA 5DYGA 4M8IA 5IARA 2ZIZA 5L3QA 5KYXB 4HZUB 3DWEX 2IUFA 1TLTA 4X20B 5EIEA 3GLIE 5HTKA 1XTPA 5IVDA 3W8FA 5ER6A 3V80A 4U7DA 1QRUA 2R6ZA 4ZEXA 3BHMA 3IP6A 4L1KA 1L7OA 2CFRA 2ATEA 4CDGA 2HXSA 4ETNA 2IS2A 3PTAA 1O0SA 1STOA 1AS3A 2EP8A 3IH5A 2GCIA 4PG4A 1QCZA 3ZDXB 2Q29A 1ACJA 2XVXA 1KK2A 1T34A 3O03A 4HWOA 1JF8A 5LXTB 3VSBA 4EEKA 5LMNB 1FZTA 2CXTA 3TQIA 2FP4B 3SG0A 3WK7A 2BI7A 3EVTA 3ZV5A 3H3XA 2KMLA 2XF8A 3QLVC 3OCXA 3EA0A 3UK2A 4CODB 1ISJA 1O3YA 2JAOA 5AH0A 1C7RA 3HUFA 2EWMA 1WV1A 3PQ8A 1LFAA 3H4TA 4B8YA 1DE0A 1SVSA 4BKPA 5HS6A 1VE9A 4GXTA 3V4LA 3KKKA 3GP5A 3F0TA 4OLFA 2OMKA 2W2OA 4Y9UA 1WXDA 3QWHA 4IIXA 4D46A 4S1WA 5HEKA 2VRBA 3CZAA 1RCTE 3G9UA 5EJAA 1Z35A 1QZUA 1GTRA 4K3UA 1YB1A 2X9GA 3TSYA 3C6QA 3OIFA 1EFRA 1EZZA 2BWJA 3JQGB 3SZOA 1U8FO 2C2BA 1OXBB 1P0QA 1O89A 1TCAA 3G8AA 1H2WA 2F9FA 2YQZA 3F47A 3LY9A 5ED0A 1N33B 1M6NA 3K9CA 3PZBA 4TZTA 1NX6A 1ZUWA 1W4RA 2H51A 2IA5A 4UJ3A 1QTQA 2J0SA 4BLTA 3IP8A 1ISMA 2NTVA 3CF2A 3EVNA 3ZD9A 1J06A 4I19A 2EEPA 2O5RA 2VH1A 2M32A 2HZBA 2NQTA 3E70C 2QTMA 4EG8A 1YGYA 3DC7A 1P0FA 3R5TA 1T9BA 1V9SA 5HX7A 5B2FA 5JV5A 3K0CA 1Y4DE 4XI9A 3R8XA 2NNLD 2EYQA 1GLGA 2WIKA 1BAPA 2A5JA 3COZA 3TEMA 3TQCA 3THYA 4G09A 5KQMA 3UCEA 1KRHA 2PS1A 1FEZA 3R7DA 2A67A 2WV9A 2XMQA 2H63A 1UPBA 1BROA 1GL9B 4P2BA 5T4FA 4Z8YA 4KUHA 4XM2A 3WK9A 3EQ2A 3OG9A 4GI3A 2BEVB 2FN9A 3NIDB 3SSMA 1O6GA 3LKBA 4OQFA 2X7XA 4RV4A 1IYZA 1OYOA 4IIYA 1TD1A 2OK8A 4JSYA 4GOND 3FR8A 4OAOA 3P9IA 1QGUA 4QDTA 1NSTA 4PX5A 3PUJA 3H5LA 3WKAA 4HFRA 1Z4PX 3RS9A 4NBUA 4QM7A 1P1BA 1UJ6A 1M8GA 1N2CE 2FFBA 1NXQA 3MIZA 1E9RA 1US8B 4MP6A 2C2ZA 4Q4HA 5E7QA 4EFMA 4BFYA 1PLJA 1DP4A 5TJHA 4CKEB 1OX4B 2G1UA 3OH8A 4BP9A 4QGFA 5H7XA 5CD1A 5JJIA 5EJ6A 3DOHA 1MCZA 2BMDA 3EVBA 1Y3BE 1G2QA 4AICA 5CDHA 1R9JA 3V8MA 1KQNA 1EJ2A 5B1EA 5AKIA 3STWA 3SBEA 3EGOA 5ADVA 3OT4A 4PXAA 3JALA 2D8AA 1RC8A 1JVBA 3HBAA 3S2UA 1GQSA 3QRWA 5AVQA 3UMBA 1SCJA 2FEMA 4NCJA 5DBOA 3VKVA 4KXXA 4BNNA 1E2QA 3BXOA 2LDBA 2GF2A 3C6BA 1G3MA 3MM4A 3WGTA 2MR6A 2WF8A 5AJWA 1H6DA 2P62A 2IYZA 2ZSFA 3T7AA 1JZQA 1HR0B 4F71A 2RHOA 1RQLA 4BOYA 2Z4RA 1ZH8A 1EKXA 1EBFA 1L4NA 3HHEA 2J7KA 4WY2A 4YJFB 1L6IA 2FR8A 2VNIA 2WYOA 1L5FA 1FPQA 3HDVA 3I1YA 4OQDA 2GZHA 2WFMA 4BLRA 2VTDA 2NZWA 1GRCA 2VQ6A 2VTVA 1HNZB 4NG5A 1U0BB 4ARZA 1Q15A 1ZG3A 2GCPA 1RI1A 2C7BA 4ENQA 5ITZA 2PSJA 4L8FA 2QX4A 2Y0EA 2QVCA 5ELMA 2XMPA 4LCEA 5AKLA 3W5BA 1CIPA 1IY2A 1JYSA 1JEJA 3IP1A 4RAOA 3T0IA 3ED5A 4UARA 3W1EA 3GRFA 4C0JA 3L7IA 1YUNA 4NAHA 3REQA 3VO8A 2N1BA 1SVKA 1EG7A 5C53B 3FDZB 3UNXA 4TKUB 3NIBA 2G40A 4CI0B 2DKFA 5IH7A 4BJ1A 3ZCQA 1G5PA 2BELA 2Q4OA 5CXUA 4ZJZA 3AU9A 4MRVA 4DUGD 3NTRA 1F8UA 2CK3A 3RIMA 2Z56A 3B82A 1AK2A 3C3YA 6REQA 4C2BA 3H97A 4OI4A 1YDFA 2G9RA 2VHUA 2XPCA 4ZHQB 1FTWA 1TKRA 4IW3B 4MW4A 3U3MA 3IUNA 1B15A 4NNOA 4WSOA 3TD9A 3OKFA 1GV1A 1UXIA 3CPHA 3ZLTA 1YTUA 2GZ2A 1KZ9A 3LC1O 4QUDA 3SHFA 4LF9B 3JYLA 1TW2A 1EDDA 4EJ6A 1T9ZA 2O19A 3B9QA 3DLPX 5DFAA 3LYUA 3PVSA 4YAWA 2DCUA 1SA0A 4US0R 1XMVA 4UUPA 4E21A 2ZETA 1F3LA 2J1LA 4FE4A 4OQXA 1HSZA 1J2RA 3PHGA 3S7TA 3DZGA 2FSHA 3OZBA 4GPD1 3EFBA 4Q1BA 2ZCVA 5ELLA 5JSZA 1YKSA 1Q77A 3BJEA 3PKZA 1JIJA 2JAUA 4J0JA 4KMRA 1LLDA 5GINE 1Y3AA 1N2SA 2ACKA 1FFGA 4LS3A 4R8VA 2AMJA 2XB6A 3G9XA 3N8DA 5TQ0B 2J46A 1OA1A 2OORC 1B6GA 3G5TA 3GLUA 3KHSA 3NHKA 4GI2A 4QHYA 4QNNA 5ES4B 1Q0UA 1CK4A 2NVWA 4CTOA 3FWZA 2KLBA 2MSNA 3H5IA 4MR9A 5DLQC 3EEBA 4IQ4A 3HH8A 3O1IC 2DJIA 4IIJF 4QVIA 2QBYA 2Y77A 2NSDA 2RONA 3LQRA 5DM60 1BOOA 1XDZA 2QL9A 1GXSA 1T8TA 1TQ2A 3D6NB 3ILXA 4KYTA 3SN6A 4EHNA 1NVTA 3HCDA 2XKJE 2G5TA 1JXAA 2WVJA 3QPAA 1WP9A 3BFVA 1D1PA 1KJYA 5ENVA 1W2GA 2LDXA 2R4UA 2GBGA 1AVTA 3R7AA 5JISA 3G2MA 1DQRA 3V7FA 3AYXB 1CBUA 1N2GA 2QM7A 2Y3IA 2OM2A 5ALHA 5TJ9A 2M2IA 1OWNA 4QUBA 5H83A 1NBEA 4BVLA 5LMZA 2WC1A 5BP7A 4E46A 3K6JA 3EE6A 1IOZA 1V5GA 5DMXA 2A1TS 2B1GA 4FSHA 2AWNA 2FYTA 4B6QA 1EINA 2RG7A 1QRRA 5IN5A 4R2KA 2YBEA 4R7GA 1POXA 3IJRA 1NV8A 2V4MA 3TUJC 1ES9A 1M7HA 5FNVB 5IFKA 4JVLA 3HZHA 1XQYA 4Q3KA 3MWKA 3V6MA 1PJSA 2B94A 3GFTA 4MS1A 4RVOA 4Y7CA 2AB0A 4K9NA 5TQ2A 5IWAB 5TVGA 1QCCA 1XJ5A 2VAMA 3FYCA 1W29A 5ALVA 1S0UA 3D3QA 3Q7EA 1I3KA 4IQFA 3IUYA 1K6IA 2B3DA 1HDZA 3N86A 4AJ2A 4BLPA 4NRDA 1JKFA 3E4DA 1B8VA 1H8EA 3ZVNA 1MNQA 1YZGA 3ICCA 1HTWA 3QLVA 4AURA 2B20A 1DWOA 5E2AA 4L8VA 3JWJA 3II6X 2FV8A 4GGMX 4QQKA 1ZCAA 2OV3A 3NOOA 3HL0A 1G6KA 2QTGA 4KI7A 3WB9A 1GVHA 2AUTA 3AJRA 4JUAA 4XIGS 5G53C 4EA9A 3WADA 2GO7A 1GPYA 4EIWA 4Q19A 3TZHA 3C5WP 4ZOQI 4Q00A 5DI3A 1AUOA 1XDWA 3T1QA 3ZE6A 3CF0A 2VPXA 3P2OA 4YO8A 5J47A 3MTBA 3EYAA 2P4EA 1G55A 4DIBA 3U4CA 1U3GA 2P0YA 3GZNA 4ZK6A 3VJRA 4FX2A 1PV2A 4NMXB 2QQFA 4L9WA 3ACCA 4U5QA 1Z6YA 4AQYB 4LFBB 2IEAA 5TMEA 4NPAA 4AP5A 5J2UF 1C9DB 3KD2A 4OJTA 1N78A 4DEYA 4EF4A 1YB6A 3QMPA 4C7MA 2QUBA 5FR2A 1ISRA 1IZZA 4K88A 1RP1A 1SKAA 2HDWA 4Q4CA 4FMDB 3I53A 1L1QA 8LDHA 2QAGA 1H4QA 1UCFA 3CIFA 1E1CB 2HWUA 1LF5A 2NXNA 2G7MC 4DM4A 1KAMA 1P4GA 3AZOA 3PWZA 4P31A 2RC5A 3RREA 3OT5A 2ZTMA 3M4ZA 5KINB 1NFQA 1U80A 1ZA2A 4PHFA 5L6MB 2JFBA 3F8SA 3O8RA 2NUBA 3L7YA 3LKVA 1VCHA 1WR8A 1SXJE 3A25A 1ZUD1 2YINC 3U9SA 2R6R1 2VDNB 3ZUGA 2F8SA 5HMLA 3DULA 3T3EA 1JQBA 2FUNB 3HB1A 3ZHOA 3VHRA 3ESYA 1N6OA 3MCTA 3KVNA 4OKIA 3SNHA 1DC3A 2H57A 1FNSA 5HFAA 4IEEA 1J6UA 3FTQA 4UNRA 2G71A 3ZPXA 3A1TA 3BX1A 5HTOA 2ZYGA 1V35A 2RSLA 2WD8A 4TQUS 2BUAA 4YASA 2DPGA 2RCYA 1V43A 1T25A 4JITA 2IYAA 4E1BA 2GAIA 5A3SA 2V3CC 1NMZA 3QUBA 4M36A 1GGVA 1RABA 2JI6A 2R7KA 4DA6A 1VP3A 2PKXA 2FR8C 3EZFA 4YUYA 4EJ2A 4GXQA 3ZDFA 1WB4A 4UMVA 2O8BA 3BF7A 2OECA 1TEHA 3ILVA 5TQVA 2EZ4A 4FDUA 5D1HA 1TXGA 3LRPA 4TV8F 3ESAA 3VJLA 4K40A 2W8BA 4FGSA 4JBIA 3IR6A 2GA8A 1H1TA 3OUUA 3PFGA 4IIUA 4KVZA 4KQ1A 4I5DA 4DSTA 2ZB8A 2VEDA 3UK1A 2IYOA 2CUTA 1Y82A 2F2TA 2FN3A 2L19A 3DAYA 3EPPA 3O8OB 4PGFA 2WNIA 4ZPJA 2CXQA 3AP1A 2AVNA 3OEHA 2VHEA 5HKLA 4B2YA 4H3SA 1UFOA 3IESA 1TYDE 5JFOA 4FFWA 4NCBA 1P8JA 1QLJA 2RH8A 3JD4A 5I7HA 2G1AA 4RIFA 1K7FB 5L40A 5TSDA 4DSOA 3HABA 3LA6A 4KLAA 5DJ5A 5I5EA 4OMCA 2V1UA 4QU9A 5D7NA 3TL2A 4EO7A 3L6UA 5F1OA 3UJ7A 3U3DA 2NU8B 1ENPA 5KTRA 3K9FC 4F12A 3HJHA 4YQEA 3RAPR 2GHRA 1DTEA 4P33A 4CM5A 4IIVA 2PMDA 3EWAA 1P0IA 2NXEA 2P2ZA 1AURA 4RW0A 1BMFD 4F2DA 5M7EA 4F4JA 3NTOA 5LR6A 3GIDA 4Y1FA 3I5MA 1OWPA 3D2CA 1TGVA 1ENOA 1T1IA 3E81A 3DLCA 3FGOA 4ILKA 4WLNA 3ZDRA 1MO6A 2AFIA 5ECYA 5HZMA 1DJPA 1NN0A 1YZFA 2HLNA 1KMMA 1N5JA 4AY4A 1RDFA 4BRWA 1G8PA 3FCSB 2R7MA 4TMFA 3TM5A 1LSUA 4CDNA 2YZKA 3QPUA 3T9DA 4CR7A 3P0FA 1VECA 3LPDA 1L1RA 4JUFA 4WOCA 2JF0A 2VI5A 3RIXA 3DHWC 2R1TA 2POQX 2CSXA 3F2VA 1UBKS 4MQ6A 2DHEA 3FLAA 1E9EA 3OOYA 1YBFA 2W7TA 1ZOLA 4RD4A 1HQKA 1JEEA 1JS1X 1O54A 1CKEA 2WQZA 1XWIA 3HGQA 5DSTA 4RTRA 1XNRB 3X3HA 1GGKA 1RJ9B 1EH5A 2HCFA 5B36A 2JIDA 2HD4A 4B32A 1M1YE 4EQ6B 4MW9A 4OXKA 4WN3A 2C20A 2G04A 4X0EA 4UU1A 2OG1A 2O2CA 2QRLA 3FM9A 3LX6A 4O0LA 3LF1A 4BKMA 5LQAA 5IWCA 3NNDA 1R0YA 3IXQA 1INLA 3GUCA 4M9UA 4NHEA 3RYHB 5H4HA 4D0LB 1ULBA 3I9JA 3NJ4A 2YXBA 4UASA 3CJRA 4MB0A 4Z0NA 4EARA 1YMVA 1DEHA 3PFFA 2W0MA 3D4IA 1GGJA 4O4HB 3RSCA 1V6CA 3LRTA 2FI1A 5BWMA 2UYYA 3LHDA 2NYAA 1X15A 4EENA 1QFYA 4IRUB 4FJ0A 2VHQA 1I1QB 2HREA 3LOPA 4NJMB 4IJVA 4RESA 3KVRA 3MERA 4EB6B 6REQB 3ZWYA 4S1OA 2XE7A 1LEHA 4RMHA 1JDUA 1OI4A 2O8NA 4JL6A 1Z12A 4JJ6A 4P5DA 3EXEA 1GR1A 1SKUA 1B2RA 4HGYA 5KNDA 4C06A 1U1DA 3TQSA 4HDNA 5CIQA 2Q3FA 2CLLB 4ZP1A 1P60A 2C88A 3D8SA 3GLHA 3RVMA 4CLRB 4DXDA 4JDPA 1JMYA 5A5EA 1SO8A 2JLRA 4OHPA 4ZOLF 4YRJA 5CUQA 1R8SA 4HH1A 3RIEA 1BH2A 3NANA 1KJ9A 3UUEA 3JVUA 3A1NA 4XH9B 4M60A 4UXJA 3AKZA 2OG2A 4FYPA 2QP9X 5IKOA 4A0FA 5BQ5A 4CLEA 4D4KA 3RUHA 2R97A 4LX0A 5C5DA 4E88A 4F0JA 1ORTA 1DPFA 1WHTA 2AJ8A 1DBPA 3R9XA 1JG1A 1CT9A 1FYXA 2OQIA 3N8HA 3ZWKA 1QBGA 4UCQA 3ZHBA 5FUMA 3CLUC 2WHYA 4BCBA 4UTOA 1ZJ4A 3RTGA 4F21A 3K9QO 1SIUA 1E2GA 2DPLA 4WZBE 1D5CA 1NA5A 5ESXA 4ATNA 5HIAA 4M0FA 1SELA 2ZJFA 4TYMA 3ZYZA 4K9KA 3GGOA 3I83A 1AKMA 2BAGA 2OGTA 2AI2A 3PXAA 4X84A 4BYMA 4BE7B 3PEVA 1EQ2A 1WBBA 5F9HA 2QM0A 2A94A 3IRUA 3AEKB 4IXTA 1BD3A 3FPEA 1TO2E 1YONA 2XXAA 4WK2B 1CY1A 3TCNA 4DKXA 2PS9A 1BE6A 5EE1A 4AZSA 3EGEA 5JYEA 4L8WB 1SIBE 2H17A 3SQMA 4R1SA 5GM1A 4IDFA 3NBAA 5BV8A 5LMUB 4Q39A 1C41A 4ZT5A 4C2AA 4GMGA 4AC9A 3FB1A 2IXDA 5LBUA 3KXDA 4REOA 3DBOB 2FDRA 3DXYA 1AA9A 3DEIA 1YJ8A 1TMOA 4MYUA 2LPMA 2R1TB 4XDZA 3EWIA 5AI8A 5DHSA 5KX5B 4US1R 3GP8A 4DDTA 4ZYUA 3C74A 3I2FA 4WZZA 2JHGA 4BEBA 4EG1A 2PZEA 4D8XA 1BVYF 4EKGA 4FBGA 1X19A 1LJUA 3WLMA 1UQTA 1C1HA 3QTLA 4W6QA 5E38A 4DIOA 1ZOSA 2P9QA 4D26A 4Y6LA 2VXBA 1TM3E 5KNCH 1UC9A 4KE9A 4D9IA 1AXGA 3EA5A 4DQ0A 2AZMA 1Z0SA 3IBFA 4W6ZA 1KY5A 1JPUA 3BEOA 1EP9A 4F3KA 1AQIA 1NUPA 4B71A 1RXSA 3MK31 3OCWA 1TLFA 1XDDA 4FCVA 2OO7A 2P2CA 3AIKA 3SX2A 3EDQA 2YOHA 3EBOA 5BO5A 3UHPA 4BWGA 1QIFA 3NHWA 1JQJC 3DQQA 1G16A 2FH5B 4UZEA 3OPMA 3I92A 5IUKC 2YY7A 2HK6A 3AHHA 4U6SA 4OP3A 1PR0A 1PNRA 3RBVA 2LIVA 1W88A 3NDJA 3D4BA 1W0KA 1UKZA 3KHTA 3AFIA 4F56A 4C5AA 2IPNA 3VVCA 4JQOA 1ZDMA 2X9QA 1XAJA 2F1RA 3GAMA 3L1JA 2ASEA 2VHJA 3QWIA 4L74A 1R16A 2DR0A 2G09A 2KB0A 3LA8A 1DEKA 3SDBA 3G7UA 3TSWA 4F06A 5TMBA 3IUSA 3MGKA 5K0TA 2F9LA 2C2YA 1QIIA 4TMZA 4M7PA 1IZ7A 1E69A 1KI4A 3EAGA 1N5OX 4HNGA 5HMMA 2WHPA 3X44A 1EU1A 5G1OA 5GZ3A 2IH2A 1YUBA 3NPAA 3MTQA 1KYYA 1QE0A 2W98A 5DT2A 5EMLA 4LFCB 1PDVA 1Z34A 2A14A 4HEA1 1LQTA 4MO9A 4P3NA 1DELA 3ANXA 4WE3A 1N32B 4I36A 1V4NA 4LC9A 3E1GA 4RMGA 5G1PA 3ZHQA 1UJ5A 1HRDA 2WYWA 4CKCB 3USES 1DUSA 3TJRA 4HVLA 2XGGA 2J9FA 4WOJA 4WINA 2FK7A 1OYYA 2ORED 1TFUA 2Q0XA 1MB4A 2IOQA 1SZCA 2PIDA 2VJAA 4M1YA 1VM6A 1E32A 3EXHC 3Q6IA 2I9PA 1CJBA 2X6RA 2HRQA 3CWCA 1KO5A 1N0VC 2YR0A 3I30X 3JALB 3T7KA 1RW4A 2DETA 3GBVA 5CVEA 2V9CA 4M9SA 4DILA 5EC8A 4ZGGA 3QEOA 5I3CA 3BQ9A 1T0UA 4KWIA 3ZUPA 3LW7A 4DNOA 3RADC 5J58A 4JNKA 4LJRA 4UD2A 1AKUA 3LKZA 1R6BX 2C3UA 3MBKA 1TLLA 3PK0A 4CKEA 4H7FA 5L3ZA 3D7LA 2O2HA 2GZRA 1U0TA 1U9ZA 2I2FA 2O3UA 3KETA 1NJSA 2XUAA 2JIPA 4Q01A 1LTQA 4FGWA 1T26A 5T6BA 1L4EA 2FJPA 3LBAA 1OILA 2HXGA 4RTJA 2QVLA 2ZUDA 4OFBA 1I2CA 2JAPA 2JFYA 1E5TA 5U4XA 1C7FA 1NU6A 1XGKA 3VHXB 2P9JA 1I30A 2VKTA 4AJLA 4L95C 3INNA 5FUYA 4JLBA 5KYTA 4GXRA 2UKDA 3DL4A 1TCCA 3UHAA 1IPHA 1ZD2P 2ECKA 3GLFA 2P4HX 1PGJA 1EUDB 2P2SA 1M2EA 3DT8A 3EGIA 2B7LA 1N2XA 3QPCA 1QHFA 4IOKA 4L9RA 4G0XA 4LJSA 3PC6A 2NUPB 3LXUX 1OHHD 2W2MA 4GXNA 5CR9A 1XP5A 1YA8A 3H4MA 4F38A 4PNEA 3HJTA 1Q7GA 2Q5EA 3PGKA 4FXPA 1IJEA 3O75A 2FLVA 3QITA 2JH3A 3KX2A 4TUYB 1LV8A 1SUAA 4BO7A 2Q1SA 3VC3A 1D8TA 1XALA 1QC5A 2XSZA 4AN0A 2ZI5A 1G9XA 1ZUNA 4RJLA 5K0BA 2V98A 1CJCA 3SP1A 2BGTA 4XFDA 3LV8A 1E4VA 3VYVA 4ZQEA 4EB3A 4M1SA 1AGNA 5ED4A 2YXNA 3K09C 3OWXA 1E3WA 1YA4A 2HPZA 4BBAA 4RETA 1GEGA 1W34A 4DY6A 5KREA 5HP4A 4O3MA 1W9MA 4P6VF 2LKCA 4CKWA 3RBAA 1F8XA 2ZJ5A 1SOMA 2XZOA 1N5MA 3MLAA 3OIVA 3RF6A 1LVGA 2ZBDA 4ITVA 4NU5A 1HDCA 2AD1A 2QMYA 3RTDA 1PR9A 1Z6GA 2Z5LA 3CKYA 3HWWA 1ZSVA 1R00A 4A6XA 5C35A 5LD2B 5KTOA 1U7DA 2BF7A 2V5AA 3O9VA 1LK7A 4RTMA 3ZCXA 4B82A 4EL0A 3L1HA 1U2GA 4TWAA 1RLOA 4YONB 3DDHA 2QY6A 4FHFA 3RJMA 3NONA 1FQOA 1T9AA 2I1LA 1HC7A 1NY5A 4LQCA 3CC8A 4E22A 3PR3A 2JLYA 2P6OA 2GM4A 2QW0X 2VRCD 1H8HA 3ICPA 2X4IA 3CLTC 5LD2C 3IBTA 5CEEA 3ZKWB 4QOSA 3OEWA 2JIQA 3VJMA 3UHOA 3GLGB 4NCKA 1J0BA 1ICIA 3F5QA 5A9TA 2OM6A 1ZXXA 2PZKA 2RH9B 2V1XA 4KE7A 2PX0A 1G20E 3WNDA 5B5SA 5CFLA 2ILVA 3OM1A 4M0KA 4RE6A 5HBGA 4X3PA 2AMYA 2AMVA 3QSYA 4K2HA 4MS4A 2RH4A 2WVAA 4LECA 4EDFA 2N75A 1S2MA 1YT5A 4ENSA 4HZGA 3AJDA 3Q5EA 2QYHA 4FGZA 4MJ3A 3L0CA 2HI0A 1P4SA 5CFRA 4NARA 1I4EB 5TGTA 1JZSA 4LXIA 2YN0A 3QHAA 1WCIA 2IHJA 2Q5JA 4C0XA 4R41A 5IJZA 1QWSA 1DXQA 3EWSA 1ZIPA 3KXPA 4HC4A 1ZCJA 3N8GA 5CJ2A 5SY4A 1J0DA 2Q3EA 5AM4A 4EY6A 5JJLA 3G89A 3PVZA 2B8WA 5G0UA 1TW3A 3U44B 4CV2A 1JG4A 2HSJA 4YBZA 3D5TA 1H05A 1P7VA 2QORA 2JIOA 4ME6A 2PA0A 2PCJA 3L3BA 3CB4A 5T8KC 3WTCA 1JSXA 1YS6A 3GGPA 4D9FA 4CKCA 3AR6A 3P0RA 4KN6A 5IF9A 5KUTA 4FCWA 2WYUA 4Y2SA 1H4TA 2XODA 1MLDA 4AJEA 2A86A 4C4TA 3ER9A 3I39X 3OQVA 3BJMA 1C0KA 3FZYA 4XDYA 4KDEA 4WNAB 3RDPA 2CV0A 1ODKA 2C83A 3BWDD 5A0TA 3ZY5A 4BEJA 3O93A 3TLBA 5JJKA 3BD6A 2EFHB 4GPAA 3BWCA 4QBFA 1XMQB 5CB8A 4PPQA 1F48A 3OE4A 5FTWA 2NU7A 3EXAA 3S27A 1PJRA 2GA9A 2GK6A 1NVVQ 3E1SA 2OZEA 4DV2B 1AKNA 3PWTA 3NP9A 2EQAA 1D6SA 4JBXA 1U4SA 3TBHA 1GZ3A 3UBMA 5JD5A 4C4YA 3L0SA 3M3HA 4DCPA 2Y76A 4UEWA 5EL0A 4EZEA 4IIJB 4EWLA 1UFRA 2BH2A 1ZITA 4Z3DA 4KRFA 4J94A 3SXUB 2IH4A 2XCTB 1NJ5A 3A1WA 2GAFA 1XT6A 3E8XA 4RLSA 4WZAB 1XZEA 3H2BA 3PGLA 4X94A 3H1FA 4GM1A 1B0ZA 3BS4A 5AVZA 2ESRA 4I6EA 1N34B 1PFUA 1JHAA 1PZMA 2TSYB 4QGSA 2A0XA 3QFSA 1U02A 1KTVA 1G4AE 2CLEB 4QOFA 5F51A 5T57A 1ZPDA 6ADHA 2WIJA 2E1RA 3K2BA 1GSHA 3L7JA 1D09A 2WJWA 3PQ5A 5IM4A 5FPKA 2Q4TA 4NULA 3QVLA 3AB7A 1GU1A 4P7KA 4QQFA 1H22A 1Q0RA 4X60A 4Q03A 3U0VA 3BRWD 2AC4A 3UQYS 1XHFA 4LBVA 3RSOA 2Y9PB 1W93A 2C95A 3F8WA 1F5SA 3DYIA 2GPSA 2QL5A 4ENWA 1NP7A 2IUYA 2P6UA 3TBFA 4BBJA 3I2KA 1W6UA 1KDYA 3SSAA 4H1UA 4Q1CA 1MABA 4IH1A 2RHTA 5DHFA 3RRYA 3PA8A 4LA4A 3FPCA 4ITRC 3VU3A 4HADA 1UT6A 4OH7A 2ET6A 4N47A