4HURA

Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
211
structure length
211
Chain Sequence
HGPDPENILPIKGNRNLQFIKPTITNENILVGEYSYYDSKRGESFEDQVLYHYEVIGDKLIIGRFCSIGPGTTFIMNGANHRMDGSTYPFHLFRMGWEKYMPSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVAPYSIVGGNPLKFIRKRFSDGVIEEWLALQWWNLDMKIINENLPFIINGDIEMLKRKRKLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virginiamycin A acetyltransferase
publication title Potential for Reduction of Streptogramin A Resistance Revealed by Structural Analysis of Acetyltransferase VatA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 64
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2012-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4hurA00
4E6TA 4G3PA 3FOQA 2WLGA 3TV0A 2JF3A 2GGOA 2WLEA 4N6BA 2Q4JA 4G3SA 4IHGA 3C8VA 3P1BA 4KPZA 1SSMA 3R5DA 3TIOA 1J2ZA 1KHRA 1G97A 3ECTA 2VD4A 2AQ9A 3IGJA 3R8YA 1MR7A 3VBIA 4HCQA 1FWYA 3FS8A 3TDTA 4M28A 3TWDA 1KK5A 4EA7A 3R5AA 4EABA 4MYOA 4E6UA 1KRRA 3VBLA 2ICYA 2NPOA 1KK4A 3KWCA 2W0VA 1G95A 1HM8A 4IHFA 3R5CA 3VNPA 5E3QA 1V67A 2GGQA 4R36A 4EGGA 3F1XA 3FTTA 4R7PA 3IXCA 2FKOA 5AFUU 4HUSA 1QQ0A 3VBPA 3VBMA 1QRMA 2ICXA 5U2KA 3D8VA 2IU9A 1MRLA 3MQHA 3OTZA 4E75A 2WLDA 4MFGA 4AA7A 3R2WA 3I3XA 5E3RA 2QIAA 2RIJA 2TDTA 2OEGA 2V0IA 3BSSA 3FSYA 3GVDA 2V0KA 3BRKX 4EQYA 4AC3A 1LXAA 3R5BA 3CJ8A 3JQYA 3R3IA 4FCEA 2P2OA 4G3QA 3P47A 3VBNA 3HSQA 1YP3A 4EAAA 3R3RA 1HM0A 4HURA 4M2AA 5DEMA 2IU8A 5AFUV 1KRVA 5DEPA 3BXYA 4KNXA 1QRFA 3DK5A 4MZUA 1S80A 3D98A 4E79A 1HM9A 1XHDA 1QRLA 1KRUA 1YP4A 2IUAA 3EG4A 1KQAA 5F42A 4IHHA 3SRTA 3T57A 1HV9A 1MR9A 5ADXU 4KPXA 3MQGA 3NZ2A 1OCXA 4R37A 2V0LA 3SPTA 3TK8A 4J18A 4K6RA 3GOSA 3FSBA 4G87A 1Z90A 4M9CA 3Q1XA 3V4EA 1QRGA 1TDTA 4HZDA 3OW5A 2QIVX 3BFPA 4N6AA 4M98A 4J09A 2WLCA 2XATA 3FWWA 4M2BA 1FXJA 4HZCA 5L6VA 5DG3A 3FSXA 3DJ4A 2W0WA 3PMOA 4N69A 3R1WA 3DHOA 5ADXV 1SSQA 1THJA 4EA9A 3BSWA 3I3AA 4EA8A 5L6SA 3EH0A 1SSTA 1KGTA 1V3WA 2QKXA 4M99A 4AAWA 3VBJA 2V0HA 4DCLA 1T3DA 3R0SA 3ST8A 2V0JA 2I5KA 3KWEA 3GUEA 3HJJA 4KNRA 1KGQA 2IC7A 2VHEA 1QREA 3KWDA 4KQLA 4E1KA 3TISA 3VBKA 2OI7A 3MC4A 3OUPA 4N27A 3EEVA 3OU9A 3BSYA 1YP2A 2WLFA 4ISXA 2OI5A 3FSCA 4H7OA 2OEFA 1KK6A 1XATA 2JF2A 5E3PA 3OTMA 2OI6A
chains in the Genus database with same CATH superfamily
4E6TA 4G3PA 3FOQA 2WLGA 3TV0A 2JF3A 2GGOA 2WLEA 4N6BA 2Q4JA 4G3SA 4IHGA 3C8VA 3P1BA 4KPZA 1SSMA 3R5DA 3TIOA 1J2ZA 1KHRA 1M8NA 1G97A 3ECTA 2VD4A 1EWWA 2AQ9A 3IGJA 3OH1A 1MR7A 3R8YA 3VBIA 4HCQA 1FWYA 3FS8A 3TDTA 4M28A 3TWDA 3OGZA 1KK5A 4EA7A 3R5AA 4EABA 4MYOA 4E6UA 1KRRA 3VBLA 2ICYA 2NPOA 1KK4A 3KWCA 1N4IA 2W0VA 1G95A 1HM8A 4IHFA 3R5CA 3VNPA 5E3QA 1V67A 2GGQA 4R36A 4EGGA 3F1XA 3FTTA 4R7PA 3IXCA 1L0SA 2FKOA 5AFUU 4HUSA 1QQ0A 3VBPA 3VBMA 1QRMA 2ICXA 5U2KA 3D8VA 2IU9A 1MRLA 3MQHA 3OTZA 4E75A 2WLDA 4MFGA 4AA7A 3R2WA 3I3XA 5E3RA 2QIAA 2RIJA 2TDTA 2OEGA 2V0IA 3BSSA 3FSYA 3GVDA 2V0KA 3BRKX 4EQYA 4AC3A 3OH4A 1LXAA 3R5BA 3CJ8A 3JQYA 3R3IA 4FCEA 2P2OA 4G3QA 3P47A 3VBNA 3HSQA 1YP3A 3OH2A 1Z2FA 4EAAA 3R3RA 1HM0A 4HURA 4M2AA 5DEMA 2IU8A 5AFUV 1KRVA 5DEPA 3BXYA 4KNXA 1QRFA 3DK5A 4MZUA 1S80A 3D98A 4E79A 1HM9A 1XHDA 1QRLA 1KRUA 1YP4A 2IUAA 3EG4A 1KQAA 5F42A 4IHHA 3SRTA 3T57A 1HV9A 1MR9A 5ADXU 4KPXA 3MQGA 3NZ2A 1OCXA 3GQAA 2V0LA 4R37A 3OH0A 3SPTA 3TK8A 4J18A 4K6RA 3GOSA 3FSBA 4G87A 1Z90A 4M9CA 3Q1XA 3V4EA 1QRGA 1TDTA 4HZDA 3OW5A 2QIVX 3BFPA 3GQ9A 4N6AA 4M98A 4J09A 2WLCA 2XATA 3FWWA 4M2BA 1FXJA 4HZCA 5L6VA 5DG3A 3FSXA 3DJ4A 2W0WA 3PMOA 4N69A 3R1WA 3DHOA 3OH3A 1SSQA 1THJA 3SUCA 3BSWA 3I3AA 4EA8A 4EA9A 5ADXV 5L6SA 3EH0A 1SSTA 1KGTA 1V3WA 2QKXA 4M99A 4AAWA 3VBJA 2V0HA 4DCLA 1T3DA 3R0SA 3ST8A 2V0JA 2I5KA 3KWEA 3GUEA 3HJJA 4KNRA 1KGQA 2IC7A 2VHEA 1QREA 3KWDA 4KQLA 4E1KA 3TISA 3VBKA 2OI7A 3MC4A 3OUPA 4N27A 3EEVA 3OU9A 3BSYA 1YP2A 2WLFA 4ISXA 2OI5A 3FSCA 4H7OA 2OEFA 1KK6A 1XATA 2JF2A 3GQ8A 3GQ7A 5E3PA 3OTMA 2OI6A
chains in the Genus database with same CATH topology
4E6TA 4G3PA 3FOQA 2WLGA 3TV0A 2JF3A 2GGOA 2WLEA 4N6BA 2Q4JA 4G3SA 4IHGA 3C8VA 3P1BA 4KPZA 1SSMA 3R5DA 3TIOA 1J2ZA 1KHRA 1G97A 3ECTA 2VD4A 2AQ9A 3IGJA 3R8YA 1MR7A 3VBIA 4HCQA 1FWYA 3FS8A 3TDTA 4M28A 3TWDA 1KK5A 4EA7A 3R5AA 4EABA 4MYOA 4E6UA 1KRRA 3VBLA 2ICYA 2NPOA 1KK4A 3KWCA 2W0VA 1G95A 1HM8A 4IHFA 3R5CA 3VNPA 5E3QA 1V67A 2GGQA 4R36A 4EGGA 3F1XA 3FTTA 4R7PA 3IXCA 2FKOA 5AFUU 4HUSA 1QQ0A 3VBPA 3VBMA 1QRMA 2ICXA 5U2KA 3D8VA 2IU9A 1MRLA 3MQHA 3OTZA 4E75A 2WLDA 4MFGA 4AA7A 3R2WA 3I3XA 5E3RA 2QIAA 2RIJA 2TDTA 2OEGA 2V0IA 3BSSA 3FSYA 3GVDA 2V0KA 3BRKX 4EQYA 4AC3A 1LXAA 3R5BA 3CJ8A 3JQYA 3R3IA 4FCEA 2P2OA 4G3QA 3P47A 3VBNA 3HSQA 1YP3A 4EAAA 3R3RA 1HM0A 4HURA 4M2AA 5DEMA 2IU8A 5AFUV 1KRVA 5DEPA 3BXYA 4KNXA 1QRFA 3DK5A 4MZUA 1S80A 3D98A 4E79A 1HM9A 1XHDA 1QRLA 1KRUA 1YP4A 2IUAA 3EG4A 1KQAA 5F42A 4IHHA 3SRTA 3T57A 1HV9A 1MR9A 5ADXU 4KPXA 3MQGA 3NZ2A 1OCXA 4R37A 2V0LA 3SPTA 3TK8A 4J18A 4K6RA 3GOSA 3FSBA 4G87A 1Z90A 4M9CA 3Q1XA 3V4EA 1QRGA 1TDTA 4HZDA 3OW5A 2QIVX 3BFPA 4N6AA 4M98A 4J09A 2WLCA 2XATA 3FWWA 4M2BA 1FXJA 4HZCA 5L6VA 5DG3A 3FSXA 3DJ4A 2W0WA 3PMOA 4N69A 3R1WA 3DHOA 5ADXV 1SSQA 1THJA 4EA9A 3BSWA 3I3AA 4EA8A 5L6SA 3EH0A 1SSTA 1KGTA 1V3WA 2QKXA 4M99A 4AAWA 3VBJA 2V0HA 4DCLA 1T3DA 3R0SA 3ST8A 2V0JA 2I5KA 3KWEA 3GUEA 3HJJA 4KNRA 1KGQA 2IC7A 2VHEA 1QREA 3KWDA 4KQLA 4E1KA 3TISA 3VBKA 2OI7A 3MC4A 3OUPA 4N27A 3EEVA 3OU9A 3BSYA 1YP2A 2WLFA 4ISXA 2OI5A 3FSCA 4H7OA 2OEFA 1KK6A 1XATA 2JF2A 5E3PA 3OTMA 2OI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6T A;  4G3P A;  3FOQ A;  2WLG A;  3TV0 A;  2JF3 A;  2GGO A;  2WLE A;  4N6B A;  2Q4J A;  4G3S A;  4IHG A;  3C8V A;  3P1B A;  4KPZ A;  1SSM A;  3R5D A;  3TIO A;  1J2Z A;  1KHR A;  1G97 A;  3ECT A;  2VD4 A;  2AQ9 A;  3IGJ A;  3R8Y A;  1MR7 A;  3VBI A;  4HCQ A;  1FWY A;  3FS8 A;  3TDT A;  4M28 A;  3TWD A;  1KK5 A;  4EA7 A;  3R5A A;  4EAB A;  4MYO A;  4E6U A;  1KRR A;  3VBL A;  2ICY A;  2NPO A;  1KK4 A;  3KWC A;  2W0V A;  1G95 A;  1HM8 A;  4IHF A;  3R5C A;  3VNP A;  5E3Q A;  1V67 A;  2GGQ A;  4R36 A;  4EGG A;  3F1X A;  3FTT A;  4R7P A;  3IXC A;  2FKO A;  5AFU U;  4HUS A;  1QQ0 A;  3VBP A;  3VBM A;  1QRM A;  2ICX A;  5U2K A;  3D8V A;  2IU9 A;  1MRL A;  3MQH A;  3OTZ A;  4E75 A;  2WLD A;  4MFG A;  4AA7 A;  3R2W A;  3I3X A;  5E3R A;  2QIA A;  2RIJ A;  2TDT A;  2OEG A;  2V0I A;  3BSS A;  3FSY A;  3GVD A;  2V0K A;  3BRK X;  4EQY A;  4AC3 A;  1LXA A;  3R5B A;  3CJ8 A;  3JQY A;  3R3I A;  4FCE A;  2P2O A;  4G3Q A;  3P47 A;  3VBN A;  3HSQ A;  1YP3 A;  4EAA A;  3R3R A;  1HM0 A;  4HUR A;  4M2A A;  5DEM A;  2IU8 A;  5AFU V;  1KRV A;  5DEP A;  3BXY A;  4KNX A;  1QRF A;  3DK5 A;  4MZU A;  1S80 A;  3D98 A;  4E79 A;  1HM9 A;  1XHD A;  1QRL A;  1KRU A;  1YP4 A;  2IUA A;  3EG4 A;  1KQA A;  5F42 A;  4IHH A;  3SRT A;  3T57 A;  1HV9 A;  1MR9 A;  5ADX U;  4KPX A;  3MQG A;  3NZ2 A;  1OCX A;  4R37 A;  2V0L A;  3SPT A;  3TK8 A;  4J18 A;  4K6R A;  3GOS A;  3FSB A;  4G87 A;  1Z90 A;  4M9C A;  3Q1X A;  3V4E A;  1QRG A;  1TDT A;  4HZD A;  3OW5 A;  2QIV X;  3BFP A;  4N6A A;  4M98 A;  4J09 A;  2WLC A;  2XAT A;  3FWW A;  4M2B A;  1FXJ A;  4HZC A;  5L6V A;  5DG3 A;  3FSX A;  3DJ4 A;  2W0W A;  3PMO A;  4N69 A;  3R1W A;  3DHO A;  5ADX V;  1SSQ A;  1THJ A;  4EA9 A;  3BSW A;  3I3A A;  4EA8 A;  5L6S A;  3EH0 A;  1SST A;  1KGT A;  1V3W A;  2QKX A;  4M99 A;  4AAW A;  3VBJ A;  2V0H A;  4DCL A;  1T3D A;  3R0S A;  3ST8 A;  2V0J A;  2I5K A;  3KWE A;  3GUE A;  3HJJ A;  4KNR A;  1KGQ A;  2IC7 A;  2VHE A;  1QRE A;  3KWD A;  4KQL A;  4E1K A;  3TIS A;  3VBK A;  2OI7 A;  3MC4 A;  3OUP A;  4N27 A;  3EEV A;  3OU9 A;  3BSY A;  1YP2 A;  2WLF A;  4ISX A;  2OI5 A;  3FSC A;  4H7O A;  2OEF A;  1KK6 A;  1XAT A;  2JF2 A;  5E3P A;  3OTM A;  2OI6 A; 
#chains in the Genus database with same CATH topology
 4E6T A;  4G3P A;  3FOQ A;  2WLG A;  3TV0 A;  2JF3 A;  2GGO A;  2WLE A;  4N6B A;  2Q4J A;  4G3S A;  4IHG A;  3C8V A;  3P1B A;  4KPZ A;  1SSM A;  3R5D A;  3TIO A;  1J2Z A;  1KHR A;  1M8N A;  1G97 A;  3ECT A;  2VD4 A;  1EWW A;  2AQ9 A;  3IGJ A;  3OH1 A;  1MR7 A;  3R8Y A;  3VBI A;  4HCQ A;  1FWY A;  3FS8 A;  3TDT A;  4M28 A;  3TWD A;  3OGZ A;  1KK5 A;  4EA7 A;  3R5A A;  4EAB A;  4MYO A;  4E6U A;  1KRR A;  3VBL A;  2ICY A;  2NPO A;  1KK4 A;  3KWC A;  1N4I A;  2W0V A;  1G95 A;  1HM8 A;  4IHF A;  3R5C A;  3VNP A;  5E3Q A;  1V67 A;  2GGQ A;  4R36 A;  4EGG A;  3F1X A;  3FTT A;  4R7P A;  3IXC A;  1L0S A;  2FKO A;  5AFU U;  4HUS A;  1QQ0 A;  3VBP A;  3VBM A;  1QRM A;  2ICX A;  5U2K A;  3D8V A;  2IU9 A;  1MRL A;  3MQH A;  3OTZ A;  4E75 A;  2WLD A;  4MFG A;  4AA7 A;  3R2W A;  3I3X A;  5E3R A;  2QIA A;  2RIJ A;  2TDT A;  2OEG A;  2V0I A;  3BSS A;  3FSY A;  3GVD A;  2V0K A;  3BRK X;  4EQY A;  4AC3 A;  3OH4 A;  1LXA A;  3R5B A;  3CJ8 A;  3JQY A;  3R3I A;  4FCE A;  2P2O A;  4G3Q A;  3P47 A;  3VBN A;  3HSQ A;  1YP3 A;  3OH2 A;  1Z2F A;  4EAA A;  3R3R A;  1HM0 A;  4HUR A;  4M2A A;  5DEM A;  2IU8 A;  5AFU V;  1KRV A;  5DEP A;  3BXY A;  4KNX A;  1QRF A;  3DK5 A;  4MZU A;  1S80 A;  3D98 A;  4E79 A;  1HM9 A;  1XHD A;  1QRL A;  1KRU A;  1YP4 A;  2IUA A;  3EG4 A;  1KQA A;  5F42 A;  4IHH A;  3SRT A;  3T57 A;  1HV9 A;  1MR9 A;  5ADX U;  4KPX A;  3MQG A;  3NZ2 A;  1OCX A;  3GQA A;  2V0L A;  4R37 A;  3OH0 A;  3SPT A;  3TK8 A;  4J18 A;  4K6R A;  3GOS A;  3FSB A;  4G87 A;  1Z90 A;  4M9C A;  3Q1X A;  3V4E A;  1QRG A;  1TDT A;  4HZD A;  3OW5 A;  2QIV X;  3BFP A;  3GQ9 A;  4N6A A;  4M98 A;  4J09 A;  2WLC A;  2XAT A;  3FWW A;  4M2B A;  1FXJ A;  4HZC A;  5L6V A;  5DG3 A;  3FSX A;  3DJ4 A;  2W0W A;  3PMO A;  4N69 A;  3R1W A;  3DHO A;  3OH3 A;  1SSQ A;  1THJ A;  3SUC A;  3BSW A;  3I3A A;  4EA8 A;  4EA9 A;  5ADX V;  5L6S A;  3EH0 A;  1SST A;  1KGT A;  1V3W A;  2QKX A;  4M99 A;  4AAW A;  3VBJ A;  2V0H A;  4DCL A;  1T3D A;  3R0S A;  3ST8 A;  2V0J A;  2I5K A;  3KWE A;  3GUE A;  3HJJ A;  4KNR A;  1KGQ A;  2IC7 A;  2VHE A;  1QRE A;  3KWD A;  4KQL A;  4E1K A;  3TIS A;  3VBK A;  2OI7 A;  3MC4 A;  3OUP A;  4N27 A;  3EEV A;  3OU9 A;  3BSY A;  1YP2 A;  2WLF A;  4ISX A;  2OI5 A;  3FSC A;  4H7O A;  2OEF A;  1KK6 A;  1XAT A;  2JF2 A;  3GQ8 A;  3GQ7 A;  5E3P A;  3OTM A;  2OI6 A; 
#chains in the Genus database with same CATH homology
 4E6T A;  4G3P A;  3FOQ A;  2WLG A;  3TV0 A;  2JF3 A;  2GGO A;  2WLE A;  4N6B A;  2Q4J A;  4G3S A;  4IHG A;  3C8V A;  3P1B A;  4KPZ A;  1SSM A;  3R5D A;  3TIO A;  1J2Z A;  1KHR A;  1G97 A;  3ECT A;  2VD4 A;  2AQ9 A;  3IGJ A;  3R8Y A;  1MR7 A;  3VBI A;  4HCQ A;  1FWY A;  3FS8 A;  3TDT A;  4M28 A;  3TWD A;  1KK5 A;  4EA7 A;  3R5A A;  4EAB A;  4MYO A;  4E6U A;  1KRR A;  3VBL A;  2ICY A;  2NPO A;  1KK4 A;  3KWC A;  2W0V A;  1G95 A;  1HM8 A;  4IHF A;  3R5C A;  3VNP A;  5E3Q A;  1V67 A;  2GGQ A;  4R36 A;  4EGG A;  3F1X A;  3FTT A;  4R7P A;  3IXC A;  2FKO A;  5AFU U;  4HUS A;  1QQ0 A;  3VBP A;  3VBM A;  1QRM A;  2ICX A;  5U2K A;  3D8V A;  2IU9 A;  1MRL A;  3MQH A;  3OTZ A;  4E75 A;  2WLD A;  4MFG A;  4AA7 A;  3R2W A;  3I3X A;  5E3R A;  2QIA A;  2RIJ A;  2TDT A;  2OEG A;  2V0I A;  3BSS A;  3FSY A;  3GVD A;  2V0K A;  3BRK X;  4EQY A;  4AC3 A;  1LXA A;  3R5B A;  3CJ8 A;  3JQY A;  3R3I A;  4FCE A;  2P2O A;  4G3Q A;  3P47 A;  3VBN A;  3HSQ A;  1YP3 A;  4EAA A;  3R3R A;  1HM0 A;  4HUR A;  4M2A A;  5DEM A;  2IU8 A;  5AFU V;  1KRV A;  5DEP A;  3BXY A;  4KNX A;  1QRF A;  3DK5 A;  4MZU A;  1S80 A;  3D98 A;  4E79 A;  1HM9 A;  1XHD A;  1QRL A;  1KRU A;  1YP4 A;  2IUA A;  3EG4 A;  1KQA A;  5F42 A;  4IHH A;  3SRT A;  3T57 A;  1HV9 A;  1MR9 A;  5ADX U;  4KPX A;  3MQG A;  3NZ2 A;  1OCX A;  4R37 A;  2V0L A;  3SPT A;  3TK8 A;  4J18 A;  4K6R A;  3GOS A;  3FSB A;  4G87 A;  1Z90 A;  4M9C A;  3Q1X A;  3V4E A;  1QRG A;  1TDT A;  4HZD A;  3OW5 A;  2QIV X;  3BFP A;  4N6A A;  4M98 A;  4J09 A;  2WLC A;  2XAT A;  3FWW A;  4M2B A;  1FXJ A;  4HZC A;  5L6V A;  5DG3 A;  3FSX A;  3DJ4 A;  2W0W A;  3PMO A;  4N69 A;  3R1W A;  3DHO A;  5ADX V;  1SSQ A;  1THJ A;  4EA9 A;  3BSW A;  3I3A A;  4EA8 A;  5L6S A;  3EH0 A;  1SST A;  1KGT A;  1V3W A;  2QKX A;  4M99 A;  4AAW A;  3VBJ A;  2V0H A;  4DCL A;  1T3D A;  3R0S A;  3ST8 A;  2V0J A;  2I5K A;  3KWE A;  3GUE A;  3HJJ A;  4KNR A;  1KGQ A;  2IC7 A;  2VHE A;  1QRE A;  3KWD A;  4KQL A;  4E1K A;  3TIS A;  3VBK A;  2OI7 A;  3MC4 A;  3OUP A;  4N27 A;  3EEV A;  3OU9 A;  3BSY A;  1YP2 A;  2WLF A;  4ISX A;  2OI5 A;  3FSC A;  4H7O A;  2OEF A;  1KK6 A;  1XAT A;  2JF2 A;  5E3P A;  3OTM A;  2OI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...