4HUSA

Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
212
structure length
212
Chain Sequence
HGPDPENILPIKGNRNLQFIKPTITNENILVGEYSYYDSKRGESFEDQVLYHYEVIGDKLIIGRFCSIGPGTTFIMNGANHRMDGSTYPFHLFRMGWEKYMPSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVAPYSIVGGNPLKFIRKRFSDGVIEEWLALQWWNLDMKIINENLPFIINGDIEMLKRKRKLLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virginiamycin A acetyltransferase
publication title Potential for Reduction of Streptogramin A Resistance Revealed by Structural Analysis of Acetyltransferase VatA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/antibiotic
total genus 63
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2012-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4husA00
4ISXA 3R3IA 3BSSA 3FSBA 4MZUA 4M9CA 4M28A 4N6BA 4IHHA 1QRFA 3IGJA 1V67A 4DCLA 3EH0A 2OI6A 4G3SA 4G87A 3HSQA 1KHRA 3CJ8A 1SSMA 4H7OA 3R1WA 4E6UA 3P1BA 1FXJA 3HJJA 1QRMA 4E75A 3PMOA 2OEGA 3D98A 2QKXA 3R0SA 1MR9A 4J09A 4MFGA 3VBMA 4EAAA 3MQGA 2OEFA 3EG4A 4EQYA 2ICXA 3FTTA 4M2BA 2W0VA 3DHOA 3VBIA 3D8VA 1KRRA 2I5KA 3BSWA 4G3PA 1YP3A 3VBPA 3SPTA 3VBJA 4MYOA 3R5DA 2IUAA 2P2OA 3V4EA 3KWCA 3KWDA 4R36A 1MR7A 4HCQA 3TDTA 3JQYA 4K6RA 2WLDA 3ST8A 4M2AA 3BXYA 3FSYA 3T57A 2WLGA 2V0KA 3TV0A 2Q4JA 3VBNA 2WLCA 3I3XA 4FCEA 3R8YA 5E3PA 4EABA 1MRLA 1V3WA 3R3RA 2OI7A 3GVDA 1OCXA 3OW5A 4G3QA 2TDTA 1KGTA 1SSQA 4AC3A 5DEMA 1SSTA 2FKOA 2XATA 4AA7A 1J2ZA 2IC7A 4R7PA 4EA7A 1QRGA 1KK5A 2V0HA 3FOQA 3OTZA 2ICYA 3TK8A 2JF2A 4HZDA 5AFUV 3FWWA 5L6VA 1LXAA 4N6AA 2NPOA 4EGGA 1YP2A 4E79A 2VHEA 3TISA 4AAWA 4N69A 1XATA 4J18A 2OI5A 1G97A 1QREA 2IU8A 3KWEA 1HM9A 5AFUU 1FWYA 3FSCA 5F42A 3DJ4A 2QIAA 2V0JA 2W0WA 4HURA 3GOSA 5DEPA 1TDTA 3C8VA 4M99A 5L6SA 3BSYA 3ECTA 3FS8A 3F1XA 2WLEA 3OTMA 4KQLA 3NZ2A 1QRLA 3OUPA 1HV9A 2RIJA 1QQ0A 3R5AA 4IHFA 2GGQA 4IHGA 2QIVX 1G95A 3VNPA 4KNXA 2IU9A 3I3AA 1HM8A 3IXCA 2AQ9A 3R5BA 3TIOA 2GGOA 4KPXA 5DG3A 5ADXV 4EA9A 4E6TA 3Q1XA 3FSXA 3EEVA 5U2KA 3TWDA 1KGQA 3DK5A 1HM0A 3BRKX 4KPZA 3R2WA 4E1KA 1KQAA 1Z90A 3R5CA 3OU9A 4KNRA 1XHDA 5E3RA 3GUEA 1KRVA 5E3QA 3VBKA 1KK4A 1T3DA 5ADXU 4EA8A 2VD4A 4N27A 3MC4A 2WLFA 4R37A 1KK6A 3VBLA 2V0LA 4HZCA 1S80A 4HUSA 2V0IA 3SRTA 3MQHA 3BFPA 1THJA 2JF3A 1KRUA 3P47A 4M98A 1YP4A
chains in the Genus database with same CATH superfamily
4ISXA 3R3IA 3BSSA 3FSBA 4MZUA 4M9CA 4M28A 4N6BA 4IHHA 1QRFA 3IGJA 1V67A 4DCLA 3EH0A 2OI6A 4G3SA 4G87A 3HSQA 3OH1A 1KHRA 3CJ8A 1SSMA 4H7OA 3R1WA 4E6UA 3P1BA 1FXJA 3HJJA 1QRMA 4E75A 3PMOA 2OEGA 3D98A 2QKXA 3OH3A 1MR9A 3R0SA 4J09A 4MFGA 3VBMA 4EAAA 3MQGA 2OEFA 1EWWA 3EG4A 4EQYA 2ICXA 3FTTA 4M2BA 2W0VA 3DHOA 3VBIA 3D8VA 1KRRA 2I5KA 3BSWA 4G3PA 1YP3A 3VBPA 3SPTA 3VBJA 4MYOA 3R5DA 3SUCA 2IUAA 2P2OA 3V4EA 3KWCA 3KWDA 4R36A 1MR7A 4HCQA 3TDTA 3JQYA 4K6RA 2WLDA 3ST8A 4M2AA 3BXYA 3FSYA 3GQ8A 3T57A 2WLGA 2V0KA 3TV0A 2Q4JA 3VBNA 3GQAA 2WLCA 3I3XA 4FCEA 3R8YA 5E3PA 4EABA 1MRLA 1V3WA 3R3RA 2OI7A 3GVDA 1OCXA 1L0SA 3OW5A 4G3QA 2TDTA 1KGTA 1SSQA 1M8NA 4AC3A 5DEMA 1SSTA 2FKOA 2XATA 4AA7A 1J2ZA 2IC7A 4R7PA 4EA7A 1QRGA 1KK5A 2V0HA 3FOQA 3OTZA 2ICYA 3TK8A 2JF2A 4HZDA 5AFUV 3FWWA 5L6VA 1LXAA 4N6AA 2NPOA 4EGGA 1YP2A 4E79A 2VHEA 3TISA 4AAWA 4N69A 1XATA 4J18A 2OI5A 1G97A 1QREA 2IU8A 3KWEA 1HM9A 5AFUU 3OGZA 1FWYA 3FSCA 5F42A 3DJ4A 2QIAA 2V0JA 2W0WA 4HURA 1Z2FA 3GOSA 3GQ7A 5DEPA 1TDTA 3C8VA 4M99A 5L6SA 3BSYA 3ECTA 3FS8A 3F1XA 2WLEA 3OH0A 3OTMA 4KQLA 3NZ2A 1QRLA 3OUPA 1HV9A 2RIJA 1QQ0A 3R5AA 1N4IA 4IHFA 2GGQA 4IHGA 2QIVX 1G95A 3VNPA 4KNXA 2IU9A 3I3AA 1HM8A 3IXCA 2AQ9A 3R5BA 3TIOA 2GGOA 4KPXA 5DG3A 3OH4A 5ADXV 4EA9A 4E6TA 3Q1XA 3FSXA 3EEVA 3GQ9A 5U2KA 3TWDA 1KGQA 3DK5A 1HM0A 3BRKX 3OH2A 3R2WA 4KPZA 1KQAA 1Z90A 4E1KA 3R5CA 3OU9A 4KNRA 1XHDA 5E3RA 3GUEA 1KRVA 5E3QA 3VBKA 1KK4A 1T3DA 5ADXU 4EA8A 2VD4A 4N27A 3MC4A 2WLFA 4R37A 1KK6A 3VBLA 2V0LA 4HZCA 1S80A 4HUSA 2V0IA 3SRTA 3MQHA 3BFPA 1THJA 2JF3A 1KRUA 3P47A 4M98A 1YP4A
chains in the Genus database with same CATH topology
4ISXA 3R3IA 3BSSA 3FSBA 4MZUA 4M9CA 4M28A 4N6BA 4IHHA 1QRFA 3IGJA 1V67A 4DCLA 3EH0A 2OI6A 4G3SA 4G87A 3HSQA 1KHRA 3CJ8A 1SSMA 4H7OA 3R1WA 4E6UA 3P1BA 1FXJA 3HJJA 1QRMA 4E75A 3PMOA 2OEGA 3D98A 2QKXA 3R0SA 1MR9A 4J09A 4MFGA 3VBMA 4EAAA 3MQGA 2OEFA 3EG4A 4EQYA 2ICXA 3FTTA 4M2BA 2W0VA 3DHOA 3VBIA 3D8VA 1KRRA 2I5KA 3BSWA 4G3PA 1YP3A 3VBPA 3SPTA 3VBJA 4MYOA 3R5DA 2IUAA 2P2OA 3V4EA 3KWCA 3KWDA 4R36A 1MR7A 4HCQA 3TDTA 3JQYA 4K6RA 2WLDA 3ST8A 4M2AA 3BXYA 3FSYA 3T57A 2WLGA 2V0KA 3TV0A 2Q4JA 3VBNA 2WLCA 3I3XA 4FCEA 3R8YA 5E3PA 4EABA 1MRLA 1V3WA 3R3RA 2OI7A 3GVDA 1OCXA 3OW5A 4G3QA 2TDTA 1KGTA 1SSQA 4AC3A 5DEMA 1SSTA 2FKOA 2XATA 4AA7A 1J2ZA 2IC7A 4R7PA 4EA7A 1QRGA 1KK5A 2V0HA 3FOQA 3OTZA 2ICYA 3TK8A 2JF2A 4HZDA 5AFUV 3FWWA 5L6VA 1LXAA 4N6AA 2NPOA 4EGGA 1YP2A 4E79A 2VHEA 3TISA 4AAWA 4N69A 1XATA 4J18A 2OI5A 1G97A 1QREA 2IU8A 3KWEA 1HM9A 5AFUU 1FWYA 3FSCA 5F42A 3DJ4A 2QIAA 2V0JA 2W0WA 4HURA 3GOSA 5DEPA 1TDTA 3C8VA 4M99A 5L6SA 3BSYA 3ECTA 3FS8A 3F1XA 2WLEA 3OTMA 4KQLA 3NZ2A 1QRLA 3OUPA 1HV9A 2RIJA 1QQ0A 3R5AA 4IHFA 2GGQA 4IHGA 2QIVX 1G95A 3VNPA 4KNXA 2IU9A 3I3AA 1HM8A 3IXCA 2AQ9A 3R5BA 3TIOA 2GGOA 4KPXA 5DG3A 5ADXV 4EA9A 4E6TA 3Q1XA 3FSXA 3EEVA 5U2KA 3TWDA 1KGQA 3DK5A 1HM0A 3BRKX 4KPZA 3R2WA 4E1KA 1KQAA 1Z90A 3R5CA 3OU9A 4KNRA 1XHDA 5E3RA 3GUEA 1KRVA 5E3QA 3VBKA 1KK4A 1T3DA 5ADXU 4EA8A 2VD4A 4N27A 3MC4A 2WLFA 4R37A 1KK6A 3VBLA 2V0LA 4HZCA 1S80A 4HUSA 2V0IA 3SRTA 3MQHA 3BFPA 1THJA 2JF3A 1KRUA 3P47A 4M98A 1YP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISX A;  3R3I A;  3BSS A;  3FSB A;  4MZU A;  4M9C A;  4M28 A;  4N6B A;  4IHH A;  1QRF A;  3IGJ A;  1V67 A;  4DCL A;  3EH0 A;  2OI6 A;  4G3S A;  4G87 A;  3HSQ A;  1KHR A;  3CJ8 A;  1SSM A;  4H7O A;  3R1W A;  4E6U A;  3P1B A;  1FXJ A;  3HJJ A;  1QRM A;  4E75 A;  3PMO A;  2OEG A;  3D98 A;  2QKX A;  3R0S A;  1MR9 A;  4J09 A;  4MFG A;  3VBM A;  4EAA A;  3MQG A;  2OEF A;  3EG4 A;  4EQY A;  2ICX A;  3FTT A;  4M2B A;  2W0V A;  3DHO A;  3VBI A;  3D8V A;  1KRR A;  2I5K A;  3BSW A;  4G3P A;  1YP3 A;  3VBP A;  3SPT A;  3VBJ A;  4MYO A;  3R5D A;  2IUA A;  2P2O A;  3V4E A;  3KWC A;  3KWD A;  4R36 A;  1MR7 A;  4HCQ A;  3TDT A;  3JQY A;  4K6R A;  2WLD A;  3ST8 A;  4M2A A;  3BXY A;  3FSY A;  3T57 A;  2WLG A;  2V0K A;  3TV0 A;  2Q4J A;  3VBN A;  2WLC A;  3I3X A;  4FCE A;  3R8Y A;  5E3P A;  4EAB A;  1MRL A;  1V3W A;  3R3R A;  2OI7 A;  3GVD A;  1OCX A;  3OW5 A;  4G3Q A;  2TDT A;  1KGT A;  1SSQ A;  4AC3 A;  5DEM A;  1SST A;  2FKO A;  2XAT A;  4AA7 A;  1J2Z A;  2IC7 A;  4R7P A;  4EA7 A;  1QRG A;  1KK5 A;  2V0H A;  3FOQ A;  3OTZ A;  2ICY A;  3TK8 A;  2JF2 A;  4HZD A;  5AFU V;  3FWW A;  5L6V A;  1LXA A;  4N6A A;  2NPO A;  4EGG A;  1YP2 A;  4E79 A;  2VHE A;  3TIS A;  4AAW A;  4N69 A;  1XAT A;  4J18 A;  2OI5 A;  1G97 A;  1QRE A;  2IU8 A;  3KWE A;  1HM9 A;  5AFU U;  1FWY A;  3FSC A;  5F42 A;  3DJ4 A;  2QIA A;  2V0J A;  2W0W A;  4HUR A;  3GOS A;  5DEP A;  1TDT A;  3C8V A;  4M99 A;  5L6S A;  3BSY A;  3ECT A;  3FS8 A;  3F1X A;  2WLE A;  3OTM A;  4KQL A;  3NZ2 A;  1QRL A;  3OUP A;  1HV9 A;  2RIJ A;  1QQ0 A;  3R5A A;  4IHF A;  2GGQ A;  4IHG A;  2QIV X;  1G95 A;  3VNP A;  4KNX A;  2IU9 A;  3I3A A;  1HM8 A;  3IXC A;  2AQ9 A;  3R5B A;  3TIO A;  2GGO A;  4KPX A;  5DG3 A;  5ADX V;  4EA9 A;  4E6T A;  3Q1X A;  3FSX A;  3EEV A;  5U2K A;  3TWD A;  1KGQ A;  3DK5 A;  1HM0 A;  3BRK X;  4KPZ A;  3R2W A;  4E1K A;  1KQA A;  1Z90 A;  3R5C A;  3OU9 A;  4KNR A;  1XHD A;  5E3R A;  3GUE A;  1KRV A;  5E3Q A;  3VBK A;  1KK4 A;  1T3D A;  5ADX U;  4EA8 A;  2VD4 A;  4N27 A;  3MC4 A;  2WLF A;  4R37 A;  1KK6 A;  3VBL A;  2V0L A;  4HZC A;  1S80 A;  4HUS A;  2V0I A;  3SRT A;  3MQH A;  3BFP A;  1THJ A;  2JF3 A;  1KRU A;  3P47 A;  4M98 A;  1YP4 A; 
#chains in the Genus database with same CATH topology
 4ISX A;  3R3I A;  3BSS A;  3FSB A;  4MZU A;  4M9C A;  4M28 A;  4N6B A;  4IHH A;  1QRF A;  3IGJ A;  1V67 A;  4DCL A;  3EH0 A;  2OI6 A;  4G3S A;  4G87 A;  3HSQ A;  3OH1 A;  1KHR A;  3CJ8 A;  1SSM A;  4H7O A;  3R1W A;  4E6U A;  3P1B A;  1FXJ A;  3HJJ A;  1QRM A;  4E75 A;  3PMO A;  2OEG A;  3D98 A;  2QKX A;  3OH3 A;  1MR9 A;  3R0S A;  4J09 A;  4MFG A;  3VBM A;  4EAA A;  3MQG A;  2OEF A;  1EWW A;  3EG4 A;  4EQY A;  2ICX A;  3FTT A;  4M2B A;  2W0V A;  3DHO A;  3VBI A;  3D8V A;  1KRR A;  2I5K A;  3BSW A;  4G3P A;  1YP3 A;  3VBP A;  3SPT A;  3VBJ A;  4MYO A;  3R5D A;  3SUC A;  2IUA A;  2P2O A;  3V4E A;  3KWC A;  3KWD A;  4R36 A;  1MR7 A;  4HCQ A;  3TDT A;  3JQY A;  4K6R A;  2WLD A;  3ST8 A;  4M2A A;  3BXY A;  3FSY A;  3GQ8 A;  3T57 A;  2WLG A;  2V0K A;  3TV0 A;  2Q4J A;  3VBN A;  3GQA A;  2WLC A;  3I3X A;  4FCE A;  3R8Y A;  5E3P A;  4EAB A;  1MRL A;  1V3W A;  3R3R A;  2OI7 A;  3GVD A;  1OCX A;  1L0S A;  3OW5 A;  4G3Q A;  2TDT A;  1KGT A;  1SSQ A;  1M8N A;  4AC3 A;  5DEM A;  1SST A;  2FKO A;  2XAT A;  4AA7 A;  1J2Z A;  2IC7 A;  4R7P A;  4EA7 A;  1QRG A;  1KK5 A;  2V0H A;  3FOQ A;  3OTZ A;  2ICY A;  3TK8 A;  2JF2 A;  4HZD A;  5AFU V;  3FWW A;  5L6V A;  1LXA A;  4N6A A;  2NPO A;  4EGG A;  1YP2 A;  4E79 A;  2VHE A;  3TIS A;  4AAW A;  4N69 A;  1XAT A;  4J18 A;  2OI5 A;  1G97 A;  1QRE A;  2IU8 A;  3KWE A;  1HM9 A;  5AFU U;  3OGZ A;  1FWY A;  3FSC A;  5F42 A;  3DJ4 A;  2QIA A;  2V0J A;  2W0W A;  4HUR A;  1Z2F A;  3GOS A;  3GQ7 A;  5DEP A;  1TDT A;  3C8V A;  4M99 A;  5L6S A;  3BSY A;  3ECT A;  3FS8 A;  3F1X A;  2WLE A;  3OH0 A;  3OTM A;  4KQL A;  3NZ2 A;  1QRL A;  3OUP A;  1HV9 A;  2RIJ A;  1QQ0 A;  3R5A A;  1N4I A;  4IHF A;  2GGQ A;  4IHG A;  2QIV X;  1G95 A;  3VNP A;  4KNX A;  2IU9 A;  3I3A A;  1HM8 A;  3IXC A;  2AQ9 A;  3R5B A;  3TIO A;  2GGO A;  4KPX A;  5DG3 A;  3OH4 A;  5ADX V;  4EA9 A;  4E6T A;  3Q1X A;  3FSX A;  3EEV A;  3GQ9 A;  5U2K A;  3TWD A;  1KGQ A;  3DK5 A;  1HM0 A;  3BRK X;  3OH2 A;  3R2W A;  4KPZ A;  1KQA A;  1Z90 A;  4E1K A;  3R5C A;  3OU9 A;  4KNR A;  1XHD A;  5E3R A;  3GUE A;  1KRV A;  5E3Q A;  3VBK A;  1KK4 A;  1T3D A;  5ADX U;  4EA8 A;  2VD4 A;  4N27 A;  3MC4 A;  2WLF A;  4R37 A;  1KK6 A;  3VBL A;  2V0L A;  4HZC A;  1S80 A;  4HUS A;  2V0I A;  3SRT A;  3MQH A;  3BFP A;  1THJ A;  2JF3 A;  1KRU A;  3P47 A;  4M98 A;  1YP4 A; 
#chains in the Genus database with same CATH homology
 4ISX A;  3R3I A;  3BSS A;  3FSB A;  4MZU A;  4M9C A;  4M28 A;  4N6B A;  4IHH A;  1QRF A;  3IGJ A;  1V67 A;  4DCL A;  3EH0 A;  2OI6 A;  4G3S A;  4G87 A;  3HSQ A;  1KHR A;  3CJ8 A;  1SSM A;  4H7O A;  3R1W A;  4E6U A;  3P1B A;  1FXJ A;  3HJJ A;  1QRM A;  4E75 A;  3PMO A;  2OEG A;  3D98 A;  2QKX A;  3R0S A;  1MR9 A;  4J09 A;  4MFG A;  3VBM A;  4EAA A;  3MQG A;  2OEF A;  3EG4 A;  4EQY A;  2ICX A;  3FTT A;  4M2B A;  2W0V A;  3DHO A;  3VBI A;  3D8V A;  1KRR A;  2I5K A;  3BSW A;  4G3P A;  1YP3 A;  3VBP A;  3SPT A;  3VBJ A;  4MYO A;  3R5D A;  2IUA A;  2P2O A;  3V4E A;  3KWC A;  3KWD A;  4R36 A;  1MR7 A;  4HCQ A;  3TDT A;  3JQY A;  4K6R A;  2WLD A;  3ST8 A;  4M2A A;  3BXY A;  3FSY A;  3T57 A;  2WLG A;  2V0K A;  3TV0 A;  2Q4J A;  3VBN A;  2WLC A;  3I3X A;  4FCE A;  3R8Y A;  5E3P A;  4EAB A;  1MRL A;  1V3W A;  3R3R A;  2OI7 A;  3GVD A;  1OCX A;  3OW5 A;  4G3Q A;  2TDT A;  1KGT A;  1SSQ A;  4AC3 A;  5DEM A;  1SST A;  2FKO A;  2XAT A;  4AA7 A;  1J2Z A;  2IC7 A;  4R7P A;  4EA7 A;  1QRG A;  1KK5 A;  2V0H A;  3FOQ A;  3OTZ A;  2ICY A;  3TK8 A;  2JF2 A;  4HZD A;  5AFU V;  3FWW A;  5L6V A;  1LXA A;  4N6A A;  2NPO A;  4EGG A;  1YP2 A;  4E79 A;  2VHE A;  3TIS A;  4AAW A;  4N69 A;  1XAT A;  4J18 A;  2OI5 A;  1G97 A;  1QRE A;  2IU8 A;  3KWE A;  1HM9 A;  5AFU U;  1FWY A;  3FSC A;  5F42 A;  3DJ4 A;  2QIA A;  2V0J A;  2W0W A;  4HUR A;  3GOS A;  5DEP A;  1TDT A;  3C8V A;  4M99 A;  5L6S A;  3BSY A;  3ECT A;  3FS8 A;  3F1X A;  2WLE A;  3OTM A;  4KQL A;  3NZ2 A;  1QRL A;  3OUP A;  1HV9 A;  2RIJ A;  1QQ0 A;  3R5A A;  4IHF A;  2GGQ A;  4IHG A;  2QIV X;  1G95 A;  3VNP A;  4KNX A;  2IU9 A;  3I3A A;  1HM8 A;  3IXC A;  2AQ9 A;  3R5B A;  3TIO A;  2GGO A;  4KPX A;  5DG3 A;  5ADX V;  4EA9 A;  4E6T A;  3Q1X A;  3FSX A;  3EEV A;  5U2K A;  3TWD A;  1KGQ A;  3DK5 A;  1HM0 A;  3BRK X;  4KPZ A;  3R2W A;  4E1K A;  1KQA A;  1Z90 A;  3R5C A;  3OU9 A;  4KNR A;  1XHD A;  5E3R A;  3GUE A;  1KRV A;  5E3Q A;  3VBK A;  1KK4 A;  1T3D A;  5ADX U;  4EA8 A;  2VD4 A;  4N27 A;  3MC4 A;  2WLF A;  4R37 A;  1KK6 A;  3VBL A;  2V0L A;  4HZC A;  1S80 A;  4HUS A;  2V0I A;  3SRT A;  3MQH A;  3BFP A;  1THJ A;  2JF3 A;  1KRU A;  3P47 A;  4M98 A;  1YP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...