4HUUA

Crystal structure of h2db-npm6i
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
278
structure length
278
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Preemptive priming readily overcomes structure-based mechanisms of virus escape.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 73
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4huuA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4huuA01
1ORQA 2HMIC 3CD4A 1A0QL 2JJWA 2QL1A 4O4YH 5I1JL 2XKNB 3EFFB 5C09A 2WP3O 5E2UH 4YDJA 4ELMB 5DJ6B 1AXIB 3IETA 5FGBA 5TE6L 5I71B 1CICD 1BFVH 3P73A 1TTGA 1SY6H 5JHLL 3HC4L 4S1RH 4Y1AA 1U8PB 3PWUB 4X4YA 1FCCA 4HJJH 1M1SA 3S5LA 4OSUH 3H9ZA 4FNLH 2XYCA 3BGMA 4L3AA 2APWA 1BZQK 2NXYD 2VSDA 1V7NL 4HUVA 1ZHBA 3STZB 3ULSA 5DMYA 4XP9L 1FG2A 1VEOA 4YHYB 4JREB 1B2WL 2ZOKA 5IBLC 5J6GB 1G7QA 5I1DA 3RX8A 1C8PA 2OQJB 3T0BA 4MNGA 5DEGB 5L7XH 2ZG2A 1OTSD 2R69L 3TH4T 3Q3GA 4L29B 4X5WA 3T3MF 1HHIB 1U2CA 2BHUA 3QPXH 2EYTA 1MIMH 3K46A 4YC2C 1XAUA 3SDCD 4F9LA 3GBMH 5IFAL 3ARBD 5AZ2H 1ZHNA 3QPQD 2CLVB 3LKPA 3HS0A 3SE3C 5CJBA 5IR1B 1A7NL 2ICWB 3HZKB 2CGRL 3I50H 4G9DA 4OCXH 3RVXC 4XVJL 2JKXA 3HNVL 3JTTA 3L7EA 3ARDC 1XGPA 4OUOA 4Y0GA 3E3QA 1RUPL 4HW6A 5SX5H 3MLZH 1JGVL 3V6BR 2ICES 3QUMA 3CVHB 5D2LE 4H0IA 1NBZA 5IGXH 5JHDA 4G9FD 3FT2B 1F3DJ 3OF6D 5FKPB 3HCVB 1I8MA 4U1IB 2R1XA 1DQJB 4XCFH 5JW3L 2DL2A 1ZVYA 3VW3L 5FFLA 3UAJC 4Q9RH 4QF1A 3RZWA 3HPLB 3UTTA 3GKWH 2WBJC 3QEUB 1M05A 5LJYH 3I6GA 1EAPB 1VACB 2EE2A 5ICXA 2NLJA 3WLWD 5HY9B 5JIKA 5KANG 2YBRA 3LS5L 1CDBA 1O0VA 3SJVE 1G7IB 2MCPH 5C08A 2Q3AA 1EFXB 2VMFA 3GMLB 4YGAB 4R4FL 4OZ4B 2WK2A 4KROC 5D2NE 5INCB 2AAVA 5D7JD 5FEBA 4M3KB 2FX7H 3NFNB 3RZCC 1AI1H 3RDTB 4RGND 4BZ2H 3TPUE 3LKQB 3TBVB 5CWSB 2H32A 4JE4B 2IAMA 4LLWA 3E1F1 4ZS6D 4R97C 3O3EA 4PRBA 4FQHA 4O9HL 3THMH 3BJ91 1V8HA 2BY0A 4KHTH 3T3PE 4G43B 1MI5A 1NFDF 4RFNB 1AGFA 5D7IB 4BZ1L 5FO8B 5CSBA 5DQ9A 3SE8H 4K71C 2VTFA 1PZ5A 3HAEG 5DMKB 1LD9B 1UXSA 3QDGD 1VB9A 1U92A 2FD6L 2P7TB 2E5EA 4P2CG 1K9TA 1NUGA 1QSEB 2XA8L 2W59A 4MHHG 4LRIA 3L3GA 4CN1A 2MKWA 2P48B 3FB7B 4TVPL 1F4YH 1S9WA 3W9EB 1MUJA 1AJ7L 5DI8A 2XTJC 4QRTA 3BN9C 5ETUB 3OAUH 4PUBH 1QOKA 3JV0A 3GSUA 4OI8A 2VLJD 5EZJA 2VITA 5IIEA 1YUHA 5DRNB 4GRWH 3O0RH 5F7EH 4OGYL 4IIQA 4Y5VC 4GW1B 1KJ2L 4BK4A 1D5BB 3MLUH 2YUXA 5EU6E 4KI5C 2FWOA 2DDQH 5E2VH 2JJTA 3BPOC 4XCYA 4EXPX 5B3JF 4K3DH 1BGXL 3GSNH 3WNKA 4L8DB 1CVSC 3DXAE 4P2OA 5I17B 1QBAA 5C9JA 5C71A 2G75A 3P11L 4LDLB 1OAYL 2Z4QA 2OP4L 1FNAA 2VXTL 5DK2A 2WWKO 1JPSL 3O6FB 4NM8H 3VFUB 2WZPD 1F90L 5FDWB 4XNXL 5JZ7C 3QULB 4UQ3B 4WFHD 3F65A 4ZS7H 3KPLB 4OF7A 3MSPA 4A2LA 5FXCH 4U1MA 3ZO0A 1I7ZB 5C0ND 5CD5C 4RZCB 3S37L 4LCCB 1IGML 4L8CB 3NTCL 5DGRA 4NFCA 2MNUA 3B9VA 3BKMH 1YEKH 4G6ML 3R8BB 5JW5B 1XIWD 1XGUA 2V7HB 1W0VA 4M61B 5IOPA 1T1ZB 4M1GH 5DRXA 2DAVA 2O5YL 1XR9A 1ZLWH 3WNNA 3W11C 1FGVH 2A1WH 3HFML 4R26H 5DD1H 2MCG1 1CE1H 5FA4A 5BXFB 2P5EA 4KJWD 2MTPA 4OIIL 4PTUB 1JI2A 4LLUA 5DQJB 1JNHA 2CRYA 2VLME 3QA3A 3QZWB 2V2WA 2YWZA 1IC4L 1OLLA 1FVEA 5IBUB 5AWNL 5J9PA 3HNSH 3VFRB 4GAJL 4NHUB 4N8VB 3PIQB 1RIHL 1ONQA 3VMOA 5TFSL 3VG0H 4GXVH 1A3LH 3MUHL 3ZE1E 1VKXA 2EZ0D 3GEWB 5CD3B 5JA8B 4G8IB 1A1NB 3KR3L 1NGPL 5ANMA 4UZGA 2H2SD 5GS0C 4JG0L 1MEXH 1HSBB 2NX5B 3NFSH 4PJIF 4GLRI 4A6YA 1GOGA 2JJVA 2AJVL 4JM2F 2OTWB 3SE3A 5H94B 5FECA 1KIQB 5IJKC 4F2MA 2CLZA 3W9DA 3V5HA 4HIHA 1U3HA 1G6RH 1EHNA 4QY8A 4F8TA 1DEDA 2I9TA 1UKSA 4JFXA 5EOTB 1A1OA 1CF8L 1DBAL 2EH7L 4M7ZB 3RX5A 5K9JH 5GZOC 3QDJE 4KZDH 2FL5B 4TN9A 4XNYH 3TA3A 3C9NB 4FQXA 3H7BA 2FIRT 1OP5K 5T1MB 4P4RA 3JTSB 1KCRL 3RVUD 4OAWB 4PREB 5GHWH 2WWKT 5EO1A 1CLYH 3DMMB 4X6FA 3TBWB 1ADQH 4FQCL 4LNRA 1CDGA 4DKEL 4P9MH 1T6VN 4BH8A 5DJZA 3BYYA 5JW4N 1A14H 2HT4C 5F9WB 2MMXA 5ID0A 5ID1A 3T0XA 1LO2L 1H3GA 3TCXA 3IGAB 2AEPL 5MEPA 1G9MC 2X4QB 5TF1H 1K8IB 5ABDE 3X12B 3CMGA 4Z7UB 3NABL 1HZHL 1SBBA 4OZIB 3BP7B 3MNWB 3R0MA 1Q9OA 3H6JA 4LLDA 4J2XA 3TF7C 5C0CD 2WV3A 2IBBA 4WTZG 3VA2C 3DX9A 1L7IH 1FYHB 1I9JL 5GIRA 1Z5LB 3VFSA 4DGYH 5KSBF 5L2JB 1LEKB 3D1MC 4LVNC 4O2CB 5GS1B 2FHFA 4QRRE 4HQQH 4NQTA 3L95B 4QOKB 1K5NB 2YEZA 2P5WB 1CL7I 4UIMA 1BP3B 4GRWE 1DLHB 2HG5A 5EO0B 4X9IA 1L6ZA 2VR9A 3T77B 4IDJL 1MCJA 4G6AC 5EU5B 2P8MA 5K9OB 1T80A 4XP4L 1N59B 1YECH 2MQCA 2X4RA 3T3ME 4CMHC 1OP9A 2AJ3A 2E7MA 1F3RB 5MEOA 5D6DC 3HI1A 5BW7C 1N4XL 5LXGL 5L0QB 3T2OA 4K7PH 1F6LL 3ULVC 3F62A 1YEEH 3O2DH 1T04A 3JWDL 5EBMA 3UEZA 1FFRA 3DX8B 4X6DF 5K93A 2X4UB 3BSZH 3L1OH 1JYVA 2ZUQC 1KIPB 1KJ3H 1WZKA 4NGHH 4JPIA 2HJKA 2ED9A 5F71A 3IDXH 2Q87A 4DGVL 1NH6A 4YHZL 5B8CC 1Q38A 4KMTH 1RZGA 2NNAB 4YHOH 3WN5A 4TVPD 4YQXL 4G6FD 4DZ8B 4Q9QH 1IEBB 1FFNA 3GNMH 5FKAB 5JMOC 3MRRB 4FRWA 4Y16A 3VFMB 4EN3C 3TZVC 3WHXB 1YYML 5DXWA 1JV5A 3D39A 2GJ6D 5IK3B 3HNTH 5LWYL 4M7LT 5DJAA 2DKMA 5KW9H 1MRFH 5MHSD 1CFQA 2ERJC 3WDJA 1MFAH 4WI8A 2Y5TB 3Q6GH 3GGWB 2VLKA 1DBJL 3PWJB 3AUVA 3AXLB 3KYAA 4P57A 4I5BA 5IVZA 4KK5D 1I8KA 4P4KD 1D9KD 2DM4A 5D5ME 5D1XB 5HHNB 2LABA 2WMPA 4HH9A 1A7QH 5IJVB 4OLVH 4PJFA 3C2AH 4GBXB 5IVXA 2A6JA 1KLUB 1HINL 2R4RH 2R9HD 5SV4A 3DO7A 2VOTA 3W39A 4PJXF 1NSNH 2AJZA 4JAMB 3VFNA 1OGAE 4DFIA 3SDDB 1NFDE 2OJZL 43C9A 2LTQB 4EUPA 3SKJH 1T3FA 2VLRA 2R15A 1HHKA 1REIA 2G60L 1G7JA 4X7CC 3X3FL 1FDLL 5IQ7H 1A9EB 3CJJA 4C55A 2V5MA 2VC2H 5F72S 4Q6IC 5IROC 5T3XL 4MJIE 4DAGH 1XF2B 3FFCD 3KLAB 2EIBA 5IT2H 2JF1A 4R4ND 3K80A 4HFUH 4W4NA 3EZ8A 4MSWB 3FRUA 1QLFB 4G8EA 2AV7A 2GHWB 4UQ2B 3C5ZC 5D2NB 5DRZA 4WI9A 4WHTA 5GGQH 3CAFA 1DTUA 1FLTX 1Q9WB 4PRIA 1P7KB 4BFGA 5GZND 1RUAH 1T5WA 1TPXB 4PG9A 2HN7A 5I75C 5M7QA 1QFWI 3L6FA 3CVIH 4RCAA 2H9GB 5IJKA 4ALAH 2E9IA 1ETZB 2ADFH 2YPVH 3LZFH 5E2TH 4QO1A 5TQ0L 2FX9L 1BMGA 4PJ7E 4O02H 4X6BB 4N5ED 3QG7H 1FZMA 3TN0C 3K8LA 3VXPA 3B9KB 3EBAA 4FXKB 1X5GA 3CCHA 4WGVB 1HHGA 1C5DB 1F58L 3WV0A 5I1KH 3QI9A 3QSKB 4J3VA 3P4NB 5IB3B 3WDHA 4Y5YA 5IB5B 3QP3A 5CIPH 2HKFH 4CVXB 3GHEL 4KK9D 1IAOB 3FT4B 2X5PA 2WY3A 3QIWA 4PLJD 3NIGF 2CH8A 1LP9A 3AS2A 2O61B 1IC5H 5ICZB 1U93B 4U1SB 1JK8A 1JBJA 3F6LA 5FUZL 1QBMH 1YYLL 15C8L 3HRZB 2NW2B 2B1AL 4YE4H 4LVEA 1ZXQA 2J8UE 1J10A 3IS0X 5ECJE 3TF7A 5E24E 2JE8A 4QHNA 4MLSA 5EU6B 3EYUH 1E4XI 5GSVA 3FOLA 4UILL 4Q74A 3VD7A 1M7DB 3TNMB 3FJTA 1WWWX 5A3ID 5HHOE 4M5ZH 4F58H 4ACPA 5J3HD 2EDFA 2FSEA 1TVHA 4NQSA 4YHKL 1U8OB 4NWUL 3L3JB 1KCSH 1NC4D 2O5XL 5BJTA 3CFJB 3DROA 4APQC 3HC0A 1LVEA 3L3DA 1S7RB 1ZGLM 1AQDB 4Q2ZA 4KXZH 4PTTA 2Q7YB 2BNQE 3DX7A 4BQ9A 3NH7L 1C08A 4P48A 3IRPX 1II4E 4PJIE 1T4KB 1I1AA 1T0NA 3P4OA 2XFXA 1IGIH 2R0KL 4ODHH 3LKRB 5DMGC 3RWEB 1WZMA 4P2YA 2CQVA 4XWOD 2WANA 2IG2L 5JW4R 2A0LD 5IFJB 1W72H 3CX5K 2NY4D 3PHOA 4LLVA 3TJEL 1J1XH 4HFWA 1E6OH 3QUYA 5DJ2B 5CJQH 1T5XB 2A6KA 4GAGL 4JFYA 3B8YA 3QO1A 3P0VH 2CKBA 4D8PA 2RCSH 3KPRB 1CL7L 5I1AA 1MREL 4HC1L 4PGZA 3MGTB 4PJ5D 5BQ7B 4Y4FD 3GKZA 2GIYA 5GRVK 2ZUTA 2NY0C 3GMOA 3V6OA 3GSXB 2VDKH 2P8LB 1FHGA 3B9AA 4JDZB 1FGNL 1ULVA 2ZUXA 1RHFA 1ZMYA 4LLYB 3B2VL 4GOSA 5ISZA 8FABB 1EUTA 3MRPA 4PLKD 2FO4B 1E6JH 1PG7W 1UWEL 3K7UA 1LE9A 4XVTH 5TDPA 1H3PL 1GOFA 1AGEB 3T4AA 2VYRE 1UH3A 1H15B 4IRJC 5E8EA 5IEHB 1CIUA 1T2JA 4YIQB 1XCTA 3QDJB 4R7NB 3WIHL 4KPHH 1ED3A 1BVKB 4HS8H 5I1GL 1FAKT 4ZUSA 3QO0B 2AEQL 2XN9A 1FFPA 1K2DA 1JMXA 3BAEL 5FYKL 4OV5B 3OKKB 3O8XD 3UPRA 2OI9A 3WS3A 3JV4A 4IRSD 4P5TC 4XPBL 5D6CA 2Q7NA 3HR5A 5FYJH 4DW2H 3LHPL 4Z77A 2EKJA 3D18B 1T7ZA 3OKOA 4R3SA 1M71A 5BV7B 4HCRL 3RWIA 5IMMA 4U1GB 1T20A 3RWDA 1JNJA 4FQIL 3RGVC 1MCSA 2IPTH 2J4WH 3D3VD 5KOVC 4EIZC 3WSQL 3QIUA 1RHHA 1MQKH 4TNWK 4MS8A 3QDMA 5GGTA 3WUWB 2Z93A 5FDYA 5EU7E 3INUL 2ESVB 2PYFA 1OTSC 2OZ4A 5JW4M 3MR9B 1KFAL 1JHLH 2W9DL 1VPOL 4F33A 4FFYH 3U36A 1INEL 3KYKH 4N90E 3UTQA 4U6XA 4IMKC 3VJ6B 1MFNA 1DN0B 4TULH 2X44D 5CGYD 3ARBC 3IAGC 4G7VL 3BZ4B 4QRRB 5C0DA 2CRMA 2NZ9D 2QSCH 2BVTA 1CU4H 1CVRA 1UENA 4XBPA 3RIFK 1JF1A 3KS0H 2UV3A 1A0QH 2C3VA 5B38A 5H37H 1N7ML 3SDYL 5DURB 3MRNB 1NGZB 5J57B 5L2KD 3TO2A 1NJ9B 2NY6B 4CDGC 3BP6B 4OLYL 2SEBA 5E8NB 1IC1A 1N5AA 2B7DT 5TE6H 3GRWL 2EDWA 5IB2B 2Y06L 2OR8A 3EO1A 4QRPA 4ZDHB 2ZSWB 5I18L 2V7NA 5HYEA 4P46B 4O58H 3RWHB 2XY1A 1TXKA 4LFHG 2X9XA 3IJSB 4LPXA 5CINL 3KGRA 4PYGA 3TBTB 1V7NH 2UY7A 1XEDA 5D72L 3ISWA 1BQHG 5CEYB 4WNQB 1TZIB 3D87B 2F54E 4KKCC 4ZODA 2K3TA 1MWAL 1UH4A 1OAXH 4E41E 3WLWC 2VISB 4KV5E 5T5FH 1RZ7L 4X98A 1QFWL 2PO6B 3DETC 4O5LL 1U8LA 4FP8H 1Y6NR 4PJXE 2R69H 4KJYA 3JSSA 3BGFC 4NSKB 1ZLSL 3VWJD 3PQYD 3MRCB 4ZUVA 4PJGA 1Z9MA 1M6OA 1S7WB 3ALPA 4WFGD 4UOJA 1SBSH 1EVUA 1D5IL 1SYSB 3IFOB 4FQJH 5D7JC 3DURA 1R3LB 1HXMB 2MJWA 1UWGH 2J5LB 1F3JB 3BIKA 4JHBA 5ESQB 5J12C 1GZQB 4RGNC 5FYLL 5D7LE 1A7NH 2Y36L 5EORL 4I13B 1WBXA 3CZFB 4NBXB 4ZS6C 2N4IA 3C09C 1U3JA 2EC9T 2AI0L 5EC2A 3IKCA 4UNVA 2P8PA 2ZKHL 3Q5OA 2DQEL 5F1SA 1EMTL 3KPSA 4XCNB 2BOBA 4NN6B 1CGYA 2GFBA 2QR0B 2AV1B 1S3KL 2BXZA 4RISL 1KCUH 2EH8L 2DLEA 2PW2A 1NCCL 4KHXH 2C4FU 2MHAB 5CZVL 1QD0A 5I1IL 1CBVH 5J06A 2CDEA 2X1WL 1NL0H 1ES0B 4L3EA 4OQTA 4CVUA 4Z7OF 2FJFA 2IQAB 3SDAA 43CAA 1BQUA 2CKNA 1E4XL 1VGEH 5F9OH 1TMCA 3SY0A 1NFDB 3EYVB 3SE4C 3FO1A 4OFKA 2R0WL 4MJ4A 3U9PH 3TV3L 4POYA 5DJXA 1T7WA 3LQZA 2LE9A 2Y4SA 1P4LB 2IBGA 4UDTA 1WFNA 2FB4H 3BT2H 4MJIB 5EBWB 4TUJA 1S78D 3FAWA 3BPLB 4J3XA 2XWBA 4UI2A 1CGUA 4WWKD 3TIDA 3NIGE 3H3PL 3DGCR 4JHAH 5JIPA 3LVEA 2AJYL 5F7DA 5KOMC 3VG9B 1BD2E 2JJUA 2N7BA 2YD8A 3PGCB 5MEND 4L8SA 4WW1B 4FTVB 1A2YA 1IGJB 3ZTJG 1H8SA 1RK1A 1RZKH 1AGCB 3I9GL 4NQDE 3ZE2E 4Z7NF 4BFEA 1JWSA 3EHBD 3V5KA 3C6SB 2XKNA 4Z7QE 1A3QA 1QBLH 3EFFA 4LU5L 4N9OB 4IRJA 2YKLL 5IG7A 2FD6H 4ELMA 5DJ6A 5C0NC 1B0GB 4F9PC 3F7PC 2XA8H 5DFVC 1EZVX 4GRLB 1CFNB 3BXNB 3CXDL 5J6HB 1U8PA 4ZYKB 4MA7H 4NJ9L 3FQTB 1AJ7H 4LSVH 3S98A 4NDMB 4P5TA 1WBZA 2VWEE 4MD5B 4KVNL 3STZA 3PHQA 2D31B 5E00B 1NBYB 5EWIL 1S7XB 5IMOB 1A64A 5J6GA 4RMTA 4K3GA 3F58L 2YZ8A 3QAZC 5DDHB 4HHAB 3FMGL 5DEGA 2FLRT 4PGCB 4U0RB 5FYKD 2J8UB 1KCLA 4JGJA 1BGXH 4L29A 1HHIA 4PJBA 3S88H 4RMQA 2OP4H 5IW6B 5J4MA 1B88A 2ZCHH 5DLMH 5EN2B 4HWZA 2CLVA 2H2SC 5HYSB 4J4PA 4M7JH 3LDBB 5IR1A 1SEBB 1X5FA 5C0AE 1H9VA 3OR6A 1GIGL 2DQTH 3UYRL 2F53B 1D5MB 3CVHA 1DN2A 4QEGA 1JJUA 3TC9A 1IGMH 1RZJH 3FT2A 5FKPA 3HCVA 1LK3H 5HHMD 1OW0C 1DQJA 3BDBA 1DQDH 1LILA 4PJ8B 1FZKB 3TM6A 3HPLA 1RIUH 4CU7A 1TVBB 4PJIB 4Y19E 1AO7D 3QEUA 3D85B 4NC1E 4JM2B 3HFMH 1CFSB 4CAGA 4MXQD 4ZNEA 4N0CA 1EAPA 1VACA 3RTQD 4RSVA 5HY9A 3VXME 2LU4A 2HKHL 3M1BB 5DHVB 2Q8AL 5SWSB 3FN0H 1T89C 3UX9B 4QTIL 4KVCL 3GMPA 4JFED 2UYLB 4Y88A 2VQUA 4XAWH 5AWNH 1KYOJ 2GK2A 3GMLA 4OZ4A 5INCA 1J0HA 5GGRY 4B53A 3EOBB 3HMWL 3HI5H 3NFNA 3MZGB 5DD0L 3RDTA 4K9EC 3LKQA 3TBVA 5CWSA 2XPGA 5KS9E 1HKLL 5E6YA 1WGOA 5J13C 1KV3A 4QRQB 2DQHL 3D69B 3HZVB 4G43A 4MAYC 4JGUA 3HMXA 5AYUL 5D7IA 5KVDH 5B39B 1MIEH 5KN5B 4JFHE 3S4SB 3CXHK 1LD9A 1YC7A 4K55A 4S1QL 2P7TA 4WI6A 2MQ0A 3BDXA 3KDMB 1QSEA 5KSBB 5CEZL 3W9EA 2R29L 5AEAA 3WJLA 4PFEA 3QCTH 1KTDB 3RU8L 1CICB 1LO2H 3OAYH 5IF0B 1IGCL 5DRNA 1RJZB 2K1MA 3TYGH 3SE4A 4JRXA 3ARED 4P3CL 3ZDYF 4U4BA 4GW1A 4M9OA 5D1ZC 4ORZC 3NABH 3CC5A 1KXQE 1Q9LB 2IJ0C 1D5BA 5KSAD 2NXYB 2ADJB 2CR6A 1XGQB 5AG8A 3O3DA 2Z8VC 5FCSH 4FXGB 1YMMD 3MLRL 3C6LB 5JUEH 3QQ9D 4L8DA 4PV9B 1IQDB 2PXYD 5I17A 4ZTPL 3EW3B 4D3CH 5C9KA 1Q0XL 5F7NC 4X6DB 3PHSA 4JGMA 3P4LA 4XNZB 1N6QH 5ADOH 5TE4H 1MY5A 3U1SL 4X8JB 1GH7A 3VFUA 1B90A 3I84A 3SDCB 5FDWA 3QULA 4UQ3A 4KFZC 4AK1A 4V1DE 3KPLA 3OKMB 1A6UL 4IDJH 1KN2L 1NMBL 4PJDE 1KIRB 3TO4B 1I7ZA 1EDQA 3EAKA 1I4FB 4RZCA 5IQ9B 4LCCA 1S9XA 3DI3B 3OXRB 4L8CA 1J05B 1HILB 4U6VL 2VXUL 1UCTA 1NAKH 3RPKA 5JW5A 4P4KC 5HTSA 1D9KC 2ZJSH 2V7HA 3BKYH 5LXGH 4M61A 3SO5A 1T1ZA 1DUYB 4JEGB 1KENL 1MPAL 2CLRB 2AABL 3DYMA 4X7TB 2Q86B 3IDYC 2W9LA 1IE5A 4WFFE 3OB0K 5BXFA 2X42A 4PTUA 1ZA6B 5IMLB 5TPWL 5DQJA 4XB7A 1MAMH 1JUFB 4G42A 2XNAB 3QZWA 3QEGL 3BN3B 3NVQA 5DYOB 4XNUH 2P45B 3VFRA 4NHUA 4N8VA 4LFHD 3MFFB 3PIQA 4ZXBD 4E41B 4NQED 3MPCA 4U0QB 4YQXH 3WFHB 1AD9B 1Q1JH 3E6HB 3TT3L 3WMSA 4L1DA 3QXWA 4JO1L 1DEEB 1XF3B 3W5MA 5CD3A 4OCRH 5IHZB 2KZ1B 4G8IA 3QUXB 4PJXB 2DLGA 4JPWH 3BD4A 1K4DB 2UZIH 4YX2L 1HSBA 2NX5A 1A6VL 5FHAL 1HKFA 2EDLA 5I8KH 3LEVH 2OTWA 4NKMB 5H94A 1YJDL 1KIQA 1KLGB 3QHTC 4M4PA 3SO3B 3GSVB 3OG6B 1EEUA 4YEEA 2HT3D 4MYWB 1OM3L 3DPBA 4XPGL 2FL5A 1DBJH 3MRLB 3C9NA 4WFED 4FABL 1AXSB 3VGAC 5A43C 4ZQKB 1V3MA 2F15A 3JTSA 5T1MA 4OAWA 4PREA 2YUWA 4MJ2A 3T0EE 3TBWA 3DMMA 1ACZA 4JFZL 2IPKB 3QDGB 4JFFE 3V9FA 1HINH 3CFEB 1MFBL 4Z7NE 4FS0A 3IXAB 1FRGH 2NR6D 3IGAA 4KK9C 3V95A 2ORBL 4OZHE 4LLAA 4RX4D 3LPGA 2X4QA 4CDHA 5I8OH 5L8JB 1K8IA 3X3GL 5C0RL 1CK0H 3AM8A 4XHQA 3X12A 4NKQB 12E8L 2G60H 5IESL 1XGYH 4Z7UA 1W0YT 3ZE0F 5FO9B 1ZEAH 2Z0BA 1FDLH 4G80B 1EBAA 1T89A 1UJ3B 4H5SB 4OZIA 2YPLE 3BP7A 3E8UL 2XWTB 5T3XH 1F4HA 3FHQA 3U7WH 2Z91B 3LN9A 4FFWD 1R6VA 2EDXA 5HHVH 1Z5LA 2F5AL 3QCUL 2KPNA 2YS4A 3KXFE 4KH2A 4F57H 5L2JA 1MCFA 1LEKA 3MACH 4O2CA 5GS1A 2APTA 5TJWK 1TLKA 3L95A 4MMXC 4QOKA 5FYJD 5AZEH 1GGBL 1I9RH 3D9AL 1GXEA 4UMGA 2E9BA 2P5WA 1T0MB 3QCVL 5H35B 1B0RB 5F6HI 5J3HC 5EO0A 3VCLB 1PGRB 3U7AA 1VEMA 5EU5A 5TQ0H 4U1JB 4OCYL 4Y2OA 4IMLB 5BS0D 3G9AB 5I19H 3B3IB 1FIEA 3Q5YA 1MCNA 3VD5A 3G6DL 4LSDA 4MB4A 2EIEA 1RURL 4L4VD 3G5ZB 3UTOA 5E4IA 1KG0B 4Y8AA 4ZG1A 4OI7A 3ROOB 3QUMH 2ITCB 4LASH 4WV1B 3DX8A 1K6QL 1WJ3A 2B0SL 2X4UA 1XIWB 1T83C 2IEPA 3RWFB 2R2CA 1KIPA 5KG9B 5T3ZL 1NLBH 4S1SL 4H1LG 2CUIA 1UA6H 2OLDA 4NNXB 2P44B 1P69B 15C8H 2X1PA 3RIAK 5CEZD 3MOBL 1WICA 1OD7A 4HMCA 4M02A 4U6HB 4WEUD 4NRZB 1IEBA 3CFIC 1QFOA 4UILH 3MRRA 3VFMA 4Y4FC 3IFNL 4WI3A 2OXGA 2F58L 2W07A 3SKOB 2XKSA 3BESR 4YJZL 4KMLB 5EUOF 3MLVH 4HF5L 4K3EL 4JKKA 3EFDH 3FCTB 1F13A 1A1MB 4OGXH 4OLWH 4NP4L 4YBQC 2Y5TA 5C0AB 4G8GD 2UUDK 3GGWA 1P4IL 4BKLB 2H32H 3PWJA 3AXLA 2QEJA 3T4YB 4X80L 4B41A 1FNSL 1MSPA 2H45A 5D1XA 3C60D 3CH8A 5HHNA 2R2BB 5IJVA 5E6ID 4NKDB 5CEXA 2DWEB 4GBXA 5E8OA 3PE9A 1PKQE 2R0KH 1LDPL 3V4VL 4WUUD 4JAMA 5D7KE 4MNQE 4WDIA 1HQRB 1EK3A 4JFDD 1TITA 3JVGC 3O8XC 4PRHD 4Y19B 4N0RA 4RAUA 2V2TB 3H9SE 4MAUH 5MERB 4D9LL 4OM1L 3H42L 4Y4KD 2BHZA 2BDNH 4JY6B 4U1GC 1A9EA 4GFTB 2V2XB 5FO7B 1CDCA 2X4PB 1FIGL 1XF2A 3KLAA 4HUXB 2OM5A 2I07B 3VWKC 4MSWA 4R96B 4LSPL 1QLFA 1LK2B 2LU7A 3VI3F 4UQ2A 2VDLL 5D2NA 5C09E 3LB6D 1U8JA 2DL9A 3HG1D 2PETA 4F15B 2AGJL 1Q9WA 1BM3L 1P7KA 3R0NA 5DK3A 3ZDYE 3PV6B 5EZOL 3H9HB 3VRIB 3IJHB 2AJUH 3BWAB 5BRZD 3TPUA 2R0LH 2H9GA 5KS9B 4NZTH 1ETZA 2ZUVA 4HAFA 5CGYC 1Z0MA 3EYSL 4X6BA 3O2WH 1GYAA 1H3PH 1BJMA 4XVUC 3PL6C 2VDOL 3LKOB 5T3XE 1U95B 3FFDB 3B9KA 4FXKA 5EB9A 4N8CL 1UXWB 3QYCA 1IARB 3KG5A 5EU4B 4YFLI 3HUJE 3AROA 1C5DA 1HK6A 1KXVC 3WIHH 2BSRB 2IMMA 5IB3A 5JQ6L 3LSOA 3V8OA 5IB5A 2AEQH 4CVXA 5ESVB 1ZAGA 5CBAA 1IAOA 3FT4A 1QRKA 4GXUM 5CAYB 4M1CD 3GJFK 5ICZA 1U93A 4U1SA 1F11B 2YWYA 2DTSA 3N85L 1PEZA 2JIXD 3EDKA 2DQUH 2NW2A 5I76A 1FVDB 1CFVL 1SM3H 2C3HA 4UINH 2QQLL 3IDNB 1U6AL 5EU6A 2EECA 2BNRE 4LEXH 1M7DA 1IVLA 1VEPA 4OLXH 4PJHE 4IS6B 5EFIB 2G5BB 5C70A 1SY6A 3BUYB 3SPVB 5C7XH 2K7QA 4KRMB 3I85A 3GI9H 5GS3A 4G6FB 1AC6A 1NCDL 1X5JA 3OPZL 4ZPTB 1OT2A 1U8OA 2XQYK 1GGCL 2YD5A 4I48B 4MX7B 4G7VH 3UTSE 4KZEL 4UV7L 1QHPA 5FV2A 3CFJA 1QACA 5DK0B 3RVWD 5E4EC 1MNUL 1DVFD 5DS8B 3SDYH 1S7RA 4TSAL 3ZKXC 2XZCL 1AQDA 3V4PH 1KJ2B 3MO1A 1PQZB 4OZFH 4OLYH 1PAMA 4NQCD 4MVBC 1ZSDB 1T4KA 1BHGA 4M8QB 3LKRA 5C08E 3RWEA 4R8WL 5I18H 4WUKH 1S7TB 3OTTA 4QRSB 1ZTXH 4OCWL 5IFJA 1JTTA 2CIKB 4JO2L 2W9EL 5E8PB 2EE9A 3GHBH 5DEFB 4QWWD 2UVEA 5DJ2A 4M8VA 1T5XA 5DWUH 1MWAH 4HMDA 4M6ML 4H0HB 2ZCLL 1RZ7H 3PWPD 1RUML 3MGTA 5DTFB 3J8F7 5BQ7A 1J0IA 3KVQA 5SWZE 4M6AA 1EH9A 1XR8B 3GSXA 1E28B 1ZLSH 1X4XA 2P8LA 3GI8H 5EBGA 1RZ8B 5D71L 1FJ1A 4YHLH 2ZOLB 3WBDA 3CMOL 1YEJH 1JGLH 4JVPA 4OFDA 4EI5D 1D5IH 4WWKC 1OTTD 4XMLH 5KAQG 2VH5H 3O9WD 5D1QD 1AKJD 5CJOH 1BQLH 1HIML 5FYLH 1JZ8A 2VL5B 3UTZB 2Y36H 8FABA 5EORH 2FO4A 2CJUL 1NCTA 4K23H 1N0XL 5I1CL 4DOHB 1AGEA 4ZNCD 1IGYB 2HT2C 3BPNB 4QHLB 4JY5L 2BRRH 4YIQA 2NY2C 5FUOL 3VXUD 3HA0A 3DSFL 3QDJA 4R7NA 1G6VK 4LPWA 3UYPA 2UZXB 4CN6A 1T7VA 2EH8H 4YHNB 2B4CL 2VXSL 3QO0A 5I1IH 4OV5A 3OKKA 1GC1L 3T0EB 5IV2A 3P9LA 3QXUA 4JFFB 1OP5H 3IDIB 4J6RH 3GSQB 3DVNB 5DJYB 4H20L 3D18A 3RNQB 2DI8A 2DLFH 2PTTB 4XAKD 3VXSD 2MQ3A 4N1CA 1FC1A 3HAEB 3HZMB 4PJ9D 2APVA 1KELH 4W6WB 3A6OA 2M8XA 2H41A 4NUGL 3TBYB 3WUWA 2NYYD 1ND0B 5A16B 4DVRL 2YPLB 1TJHL 3MV7E 4E42A 2ESVA 1WVZA 4HIEB 1IFHL 3MR9A 4ZAKD 4C83B 4Y5XC 1A9BB 1H0DB 3D0LB 4LSUH 4UT7L 3WE6B 2LU3A 4I0PC 2PYEE 1IBGL 5FCUL 5D7SL 3VJ6A 2P43B 3S34H 1DN0A 3UZEA 1KC5H 3O4LD 4TTDD 4EOWL 4NNPL 2ADGB 3P9MB 3BZ4A 1G9NH 4QRRA 4OLUL 4Z7VE 3I9GH 1DQTA 2IQ9L 1OSZB 4RNRB 3W0WE 1HE7A 2CK0H 3R8QA 4Z0BL 1B6UA 4UB0L 3MLXH 2DTMH 2HAZA 4TPRL 1NGZA 4XWGL 3LS4H 1I85C 1BEYH 1DCLA 1NJ9A 2P5EE 1VFAB 1KN4H 2YKLH 3BP6A 3KYNB 3WXVL 5J7CC 2NY3D 4KJQD 2J88H 4NT6B 4HD9A 2AVGA 5E8NA 1JL8A 3ZZ1A 4KAQL 5HD8D 1FLRL 1XGRB 5IB2A 1B4JL 5IKCB 5ERWB 2D9CA 4ZDHA 3QH3B 1NCNA 3QXVA 4P46A 4NJ9H 3RWHA 5HI4D 2DMBA 2X4NB 3IJSA 1DE4B 4KKBC 2GITB 4KVNH 4L8BB 1BAFL 5CEYA 4MXQC 4Y2DC 5EWIH 4WNQA 1TZIA 4YXLL 1I7UA 2J6EA 2NY5L 4DK3A 1LO4L 4ZSOE 2VISA 4GW5B 4X4XB 1EEQA 4JB9L 4LPVA 1OSPL 2NY4B 5AUMB 4GUPA 1S7UB 4EUPH 2OJEB 1JPTL 3EOTH 4L9LB 5GS2H 3FB8B 3ARTA 4JFEE 4NSKA 3F6IA 3E2HC 3MRCA 4MQXD 1NCWH 3L9RA 2NXZC 1SYSA 4DTGL 2V5YA 1HXMA 5ESQA 1F3JA 3OKYA 5SX4I 4MA3B 5F7WC 1GZQA 4S0SD 4YHIB 4UOW0 4WCYH 5HGGS 4WHDA 4BFBD 1GIGH 1CR9L 4L4TD 1F8TL 2VO5A 4XCNA 2HFEB 4TSCL 2YMXL 5AAWA 2AV1A 1GCFA 4JO3H 2DQCL 5J1SC 1G0XA 1JVKA 5LKNA 2R1YA 4MVBA 2MHAA 5D5MA 2RQ8A 4DQOH 3NZ8B 1ES0A 4HS3B 3V79C 2LAGB 1PKQB 3MJ8B 2IQAA 3S3SA 2HH0H 4AIXA 2X6MA 4DN3L 2A74B 1Q8MA 3SBWC 1OGAA 2ARJB 4MNQB 5FYLE 1NFDA 3EYVA 2Z8RA 5EOCH 2W91A 4GG6F 3P40A 2ENSA 4OB5H 4IRSB 3H9SB 1OOAA 1YEGL 3HE6D 1BZ9B 2R4SL 3VFGH 2Q8AH 1BBDH 4YBLC 5KSAC 5D8JL 4GKSA 2NTSP 1W2KT 3C6LC 4MJIA 5EBWA 4JRYD 1F4AA 3VXOB 3D3VB 4P23B 3NPSC 4F7CB 3IS1X 4HBQA 2RFXB 2PXYC 5ITFB 4NO3B 4ZFZB 4AYFA 1KJVB 3LN4B 4OFPA 1OAZL 3PGCA 3IB4A 4FFZH 2Z31B 5JO5B 6FABL 4FTVA 1EO8H 1IGJA 4DN4H 1A7PL 4WI2A 5E8DL 4Y1AD 1AGCA 3WKNA 4KJPD 5F3BB 1VFBA 1OCWL 2JCCF 3ELAT 1OPGL 3TYFB 3HI6L 3I3DA 3B2UD 3C6SA 5E6ZA 3U4BL 3NCFB 3IDMB 1EGJL 1VADB 2FHBA 4S1QH 4NJAH 5TGBA 1B0GA 3EOYG 2ID5A 1T2QL 4JQVA 3NAAL 1DUZB 4GRLA 3BXNA 4EJ1C 5J6HA 5GISH 3O3AB 4ZYKA 1IEHA 2R29H 3FQTA 4KTEL 3CSBA 5DVLA 3UJJL 3B9EA 4ZO7A 3QHFL 2ATPB 3S37X 4JKWA 2D31A 5E00A 1S7XA 3GUTB 4QXGL 3BRFA 1FH5L 5DDHA 4HHAA 4K2UL 1NMCB 4K94L 4PGCA 4U3CA 5BOZG 1KCKA 3MLRH 2J8UA 3TVMB 1MJUL 5TE7H 1W0WA 3QEHB 4ZTPH 5INDB 2BNRB 1DSFH 4ZOCA 5E7FA 1FE8L 3I75B 4I0PA 2CKBH 1F6FB 5IW6A 5JHDD 4OZGF 5EN2A 3JUZA 5ESAB 1D6EB 3NMEA 5HYSA 5HHOA 3VWJB 3PQYB 2F74B 2GJZB 2IADB 5IVXE 2YC1B 5DGQA 3LEXB 1JNLL 4C56E 3UTTD 1HH9B 3Q5TA 5I9QC 3UTSB 1ZT1A 2F53A 1NDMB 1D5MA 4AL8H 4IHOB 4CVWA 2EICA 1I85A 3MRMA 3SQOL 2IBZX 2VLRE 4M93B 4Z8FL 1BIIB 4LSRL 2BHYA 1UZ6E 5CP3H 4PJ8A 1FZKA 3WFBL 5JIHA 1TVBA 1Y0LA 4PJIA 2YA1A 1MPAH 4UTBL 3D85A 2NTFB 4IBLT 1LEIB 3GSOB 1E4WH 4JM2A 4JY4B 2Y72A 1CD8A 2VXQL 1UM5L 4L5FH 4LQFH 4RDQG 3UCRA 5HHQB 2NR6C 3M1BA 4PRIE 5DHVA 5SWSA 5E5RB 1NEZB 4GSDL 3QFJE 1MOEA 1PYWB 5MI0B 2UYLA 2NY7H 3O6KL 2KBGA 4PRPD 1MI5D 4NO2A 2IPUG 3TT3H 1OF2B 3B5TA 2OX5A 2VDQL 3EOBA 4JO1H 2AJSL 3AU1B 3MRGA 1KCGC 1CLOH 4YX2H 1J18A 4MA1C 3LIZL 4OJFL 3PF2A 3ESVF 3N0PB 1MFDL 2MOVA 1T2XA 3HZVA 2BCKA 4XGZB 1WWCA 4ODWB 1AY1L 3BH9B 3ZKSD 1FO0B 4YK4B 3N1QC 3HB3C 3CSGA 5B39A 5KN5A 3S4SA 1S7QA 4XI5D 1OM3H 2QHLA 3U6RB 1MVUA 4XC3L 3KDMA 4FABH 1H3XA 3SE9H 2VKWA 3F12B 4FG6D 1C5CH 2LVCA 5KSBA 2XA3A 4S2SB 1SEQH 3IXTB 2BMKA 2VSCA 3RUGF 2EO9A 2DBLH 1KTDA 1CICA 4NZUL 4P2OD 5IF0A 5LVEA 3X13B 1RJZA 4HJGB 4LMQI 5LQBL 2D03L 4B0MM 5BZDB 4HLJA 5C0RH 5IESH 5E0QA 2GY7B 12E8H 1EA9C 3REWB 1Q0YL 4ONGL 2PR4L 4DZBB 3L3HA 2FEDD 3HC3L 5C92A 5A2FA 2ADJA 1XGQA 1YNKL 3BWUC 1JTOA 3EUUA 4HUKB 3GK8L 5DZOA 3TESA 1FAIL 3P9WB 4FXGA 3C6LA 3R1GH 3LQMA 2IGFL 4PV9A 1IQDA 1MJ8L 2F5AH 3MV7B 1A22B 2UWEF 4RGOL 3LD8C 4EZMA 1T1XB 1UGNA 2HVJA 3WEXB 3K8MA 3RAJL 1GGBH 3SHSA 5E03A 4WIQA 4X8JA 2PYEB 3V6ZB 3NN8B 3SDCA 5I1EL 3BE1L 3OKMA 4U31A 1I8LA 2PKDA 4S11A 1KIRA 3HZYA 4Z7VB 3TO4A 3O3BB 4OFYD 4LOUD 5IQ9A 5GS0L 3W0WB 1QVOB 1Q9KA 3OXRA 1SMAA 1J05A 3QNZB 1HILA 3MZTA 1RULL 1BPVA 5ILTL 5LGKA 2A73A 1YEFL 5IBLD 4ETYA 1DUYA 4DEPB 1QNZH 1LDSA 2OTUB 1F2QA 3LEYL 5E6IC 4BSWB 2Z92B 3OF6A 2V17L 2CLRA 2Q86A 4X7TA 5I74C 4R2GB 5EUOB 3TWCL 2F5BL 5JR1L 5L9DL 3CPLB 3AB0B 4GMTL 2E7LA 3V6OE 1U3YA 1DANT 4PY7A 4JJHA 4J1UB 5DUML 1AO7B 4LKXA 1JUFA 5JIIA 2XNAA 2XIDA 3G6JF 3MV01 5DYOA 3CLFL 2YK1L 2F54A 1JNNL 3RTQB 5ISZE 1FNHA 3PP4L 3MFFA 4E41A 2VIRB 1U3HD 4ZSOB 2Z9TA 3WFHA 3E6HA 2C4XA 2QHRH 3B4NA 1QP1A 1XF3A 2EDKA 4OZFB 5IHZA 3JWOH 3BZEB 3PJSB 3QUXA 4PJXA 4WW2C 3MJ9A 2X1OA 4JDVB 4JFEB 1K4DA 3LOWA 3IFNH 1JI1A 3FRPA 3OV6A 5FM8A 3ILQD 4GG6E 3LB6C 1H5BC 1NMAL 4XBEL 4NKMA 5F7FA 4HF5H 5C3LD 4LCIL 4K3EH 1AR1C 2XN9E 3GSVA 5K9KA 3RX7A 4Z7WF 2ZCKH 3T2QA 2BY3A 2WBJD 3BIAX 3LV3A 2EDEA 2EE6A 2WBKA 4ERSH 4JO4L 4M5YL 2C1OB 3WNLA 4YDKL 1AXSA 2MSPA 3TBSB 3KPPA 5DA0B 3V0AC 4XX1G 4N1HB 4WU7B 3OL2A 5F88A 3B83A 3QDGA 4HWUA 3BPCB 1WEJL 3CFEA 3V4VH 1WWAX 3D2UA 3PDGA 2OMBA 3IXAA 4KROD 3ZLQC 1G7HB 4PPTA 4UV4H 1RZKC 3MQIA 1GAFH 2GTWB 3H42H 3QEQE 3GSRB 1ITCA 3CX2A 5FO9A 4AIZB 3OJDB 3MFGB 1UJ3A 4H5SA 3ULVL 4KGJA 4LAQH 3MROB 1AHWB 4RFEB 3CX5J 2Z91A 3AREB 3DX6B 4LSPH 3M17B 4OD1H 1BBJA 3WFCL 2FZ3A 2XZAH 2WUBL 1Z3GL 2W0PA 4Z0XB 3QJFB 2RBLA 2BNUB 2AK4E 4YDVB 2AGJH 3UXFA 4JZOB 3BKCL 4G7YL 1V5JA 3MODL 1BD2A 1B0RA 5H35A 3CSYB 4EDWL 4OI9A 4QRPE 3T08A 5T33H 2C9AA 4M62L 3VCLA 3U46B 2XTJD 3VRJB 3BN9D 3EYSH 4JR9H 4U1JA 4IMLA 2D0FA 3MA9L 1OAUL 3N50A 5IBTH 4LIQL 1F6AA 1KTLA 3RVWC 3V2AR 1HH6B 1TCRB 5FV1L 3WUZA 1KYOK 4N8CH 2VKXA 4WEBH 4X8XA 2BVQB 1IT9H 2D4FA 1U58B 5TQ2L 5LGHH 3SGJC 1BFOB 1J87A 1TQBB 2HA1A 3VU2A 1RU9L 3G5ZA 2VAAB 1KG0A 3ROOA 2ITCA 4WV1A 4AEHL 2BFVL 2D7OA 1RUKL 1S9YA 1T6WA 2DJ4A 4FQ1L 4JJ5B 5C86A 1MAJA 1UB6B 1XIWA 3FO2B 3RWFA 3SOBL 3CFKB 1RSFA 3C8HA 5TF0A 5KG9A 1G7PB 2DI7A 5KVGH 1JMZA 3D39D 3N85H 3UPAA 4NNXA 3O11B 2BY1A 4QWWC 2QJDA 4N0YL 1CDHA 5JZ7D 4YWGL 2VZ1A 1BLNB 2Y07L 1DP0A 1RZJC 5LGJB 4U6HA 4NN7C 4NRZA 1UYWH 1IAII 1OWRM 1E27B 2VLKD 5CD5D 3LY6A 1RV6X 1NDGB 4PB9L 5JORB 4ZXBB 5GJTL 3RBGA 3I2CL 3D0VB 2OL3L 3U4AA 3UDWC 1NCDH 4GKNB 4J23A 2KUTA 1OTTC 3O9WC 1IEAB 1BQHB 5T3ZE 4KZEH 3FCTA 4UV7H 1A1MA 2X1QA 1QG3A 5C0AA 2V9TA 1PSKH 3SEPA 1FPTL 4KRLB 3WKMH 4BKLA 4C56B 1LO0H 4FQQB 3T4YA 2E7CA 5IW3A 5MP6L 3AAZB 2VUOA 4WY7H 5I1HL 2R2BA 3IJYB 2FH6A 3HMXH 3N06B 1FYTE 4NKDA 1TJGL 5KTEL 2DWEA 3RNKB 3TFKC 5J8OA 1D5ZB 5FUCC 3MV8E 2EDOA 3CFCH 1GGYA 5CJXC 5GRJL 4W4OA 2D0HA 4OM0L 1NUNB 1T7XA 4Y19A 2D7TH 4OCSH 3LMJL 2V2TA 5MERA 5GS0D 2J8OA 4JY6A 1XF5B 4JFOB 1TZGL 3ZT5A 3WHE0 1VCAA 2V2XA 4PJEF 5FO7A 3RVTC 1X44A 2X4PA 3BH8B 4LPYA 3LQAH 4HUXA 3ERYA 4XT1C 4QNPF 1TZHB 4PJ9C 2I07A 3QFJB 4R96A 1LK2A 5IMKB 1L7TL 1DQQA 1KSRA 3UBXA 5J1AB 4WW2A 5A2LH 3RWCB 4ZAKC 5F21B 3SCMC 3PV6A 5E94B 3WIIL 5EBLB 5KAQF 3H9HA 3NCYP 3VRIA 3QI9D 5IW1B 3IJHA 3SGDI 3BWAA 3VMNA 1UM4L 5KS9A 3CNKA 3FQXB 4YFLF 2ITDB 5A2IH 5I1CH 1UQSB 3LKOA 3QIWD 4YO0B 2AQ2A 4ZPVB 3WJJC 1U95A 3FFDA 1EUUA 1UXWA 2UWEE 1P4BH 3DSFH 5EU4A 3ILPA 4L4JA 4POUB 2BSRA 4IOSD 2B2XL 3IFLL 5DC0A 2VXSH 5BS0B 2WWMC 2OMNA 1CD1A 3F5WB 1HHJA 5ESVA 4XRCB 2H1PL 5HI4C 4JG1L 4P2RD 4H20H 3TJHA 5EZIL 2WINB 1F11A 4RGMB 4RMVA 4M03A 2YZ1A 4PGEB 3ARQA 1PKOA 2A9MH 2VABB 2BVPB 3QRGH 3FL7A 5CS7A 4ODSH 4NNYB 1RFDH 5EOQH 1FVDA 4HT1L 1A5FL 5FK9B 4G6AD 5F1IB 2I5YL 4BH7B 4IS6A 5EFIA 2G5BA 5CCKL 3BUYA 4TOYL 3SPVA 1D3CA 4YPJA 3KHQA 4HWBL 4JDTL 2CO6B 1IBGH 4ZPTA 4XNMB 1QPPA 4I48A 1FNEB 4EOWH 4MX7A 1I1AD 1P6AB 2ZUUA 1IKNA 3ULVD 4HDIB 3MLWH 4M1DL 5DK0A 4V1DA 1J1PH 5DS8A 3DUUB 4UB0H 4X5LA 4ZD3H 4HH8A 4ZNEE 1E4KC 4NKIL 4TPRH 1A6WH 4I9WE 1KJ2A 2PW1B 1PQZA 3OKLB 2ICWJ 5DJCB 1M4KA 2EDHA 3BVNB 3QUYD 4KAQH 1AQKL 3QNXA 3SGJA 4M8QA 1PVHA 1AIFB 3A6BL 2W65B 1S7TA 5CBEA 4JN1L 4QRSA 1U8QB 4YPGB 3C60B 3MOAL 3L7FB 4HXBH 3L3KA 1VDGA 4V2BA 1BJ8A 1BAFH 5E8PA 5DEFA 2MWCA 4WUUB 5GSRA 4QLRA 4LARL 3KPNB 4JFDB 4Z5RB 3QXDB 2GCYB 2A9NL 2CIIB 1P9MA 2NY5H 4NWTH 1JFQL 1QUNA 3ARGC 1EJOL 1OSPH 3HE6C 3OB0H 4H25B 4Y4KB 1JPTH 5DTFA 3EDEA 3U7YH 1NQBA 2DYPA 1AR2A 2FH8A 1UADC 5GRYA 1XR8A 5D7IE 1E28A 1MCRA 1RZ8A 2FBJH 5E5MB 2ZOLA 4D9RD 4KUCD 3WYRA 3F7VB 4KRNA 4LVHC 1QSEE 3WFEL 4UTAL 3UDWA 4LSQH 1FQ9C 3QUKB 4ODTL 2VL5A 3UTZA 4GG6B 4X99B 4MWFB 1NGYB 3ARRA 1OAQH 3RPIB 1YPZF 4KJPC 4YGVB 5JOPE 1TENA 4DCQB 1IGYA 4U49A 3SGEI 5TDNB 4QHLA 5BRZB 3BP5B 4PS4H 3B2UC 1NAML 3NIFE 1FL6B 1SJEA 5H8DA 4YHNA 7CGTA 1K85A 3S96B 4U2ZA 4ESKA 2ILLA 3EJYD 1MFEH 3GJEB 2ZUSA 5F7MC 4MS8D 2MFNA 3T0EA 4U3XA 3QDMD 2D4DA 4JFFA 4Q0XH 3T65B 1I9IH 3IDIA 3GSQA 3DVNA 3VMPA 5DJYA 4DN3H 1J0JA 4X6EB 5HHXH 1RPQA 3C5ZD 3RNQA 4YXHL 1C5BL 1IAIL 2PTTA 3ZDXE 4LSTL 2I60H 4NPYB 3CLEH 1YEGH 3HZMA 2CRIA 4LRNH 3BKJH 3QEQB 4JZNB 3ROLB 2GEEA 3QISA 3TBYA 1ND0A 5A16A 2QV2A 2YPLA 5F6HJ 5HYJE 4HIEA 1MRCL 3QHZH 3G6AB 5SX5K 4U6YB 4NN5C 4C83A 1OB1B 1A9BA 3ZDZF 3L3OB 3MRQB 4N5UA 3E3QC 5JNYB 1K4CB 4BZYA 3BQUB 1XT5A 4XPHL 5C1MB 1OAZH 2LFGA 5F8QC 2NZIA 1F3DH 2VZ3A 1S5IH 1U8IB 2ADGA 2AK4B 1BVZA 4G3YL 1H8NA 4FMKA 5IBUG 4MXVF 2QQNL 3T2NL 1OSZA 4LVOC 4RNRA 4ZUWB 3KJ6H 4YDLC 4I3RH 4MMZC 1NCAH 3KYNA 4HWEL 1I1FA 1RJLB 2W0FB 4NT6A 3AS3A 4XH2A 1MCHA 2I25N 1CE6B 4TSBL 1MLCB 1XGRA 4PB0H 5IKCA 1DVFB 1T2QH 5ERWA 1I3UA 1KCVH 3QH3A 4OZGB 1AGDB 4HJ0C 1G7MB 4KTEH 3CXHJ 3DVGA 2X4NA 1L4IA 1T03H 2GK0B 5D93C 4XP1H 3LKSB 1UT9A 3BEWB 1IKFL 1KB5L 2GITA 2ZPKH 3QHFH 3ECBB 1JHTA 4CMMB 3C8DA 4IJ3C 3BDYH 2NX5E 4DKFH 3O4OC 3Q1SH 3DHMA 2WQ8A 2EKSB 4K3JH 4GW5A 1N5YH 4K7FB 4OTXH 1N2RB 5AUMA 2CD0A 4PJFF 2OJEA 3BFOA 2IAMC 4K94H 4L9LA 3FB8A 4QXUH 3NACH 3WIFB 1TTUA 1UB5B 1I7TB 2FATL 3BZFB 1M7XA 3HE7B 4APQD 3KPSD 4HIIA 2D9QB 3X14B 3FQUB 3PWPB 1W8NA 3ZSTA 3GIZL 2BY2A 3RA7L 1ZVSB 2GT9A 3MUZ1 4MA3A 4M6OH 4MA8H 1EHLH 4PJEE 5ALBL 4YHIA 4LRIC 1AH1A 4L3ED 5IM7B 4EI5B 5ENWB 5D1QB 1P7QD 3SDAD 3S35L 1AKJB 3MRBB 1OGTB 3A6CH 1MCEA 1VFMA 4PJCE 4TRPL 4XI5C 1P1ZB 4Y4HB 3F8UB 4Z7UE 4QGTA 1XF1A 2QQKH 4I77L 2UUDH 3ZT7A 3NZ8A 4FG6C 4XC1L 5DD6B 4HS3A 3VXUB 2EDRA 1PKQA 2LQRA 3MJ8A 1TQCC 2ICEB 2A74A 3WCYA 1NCBH 5DT1H 3ZKQD 4MNQA 2JJTC 3U79A 5E70A 1JGUL 1UM5H 5KANI 4RDQF 2RAMA 2NY1C 3H9SA 3EIFA 3U83A 1JP5A 1BZ9A 3MGOA 1SJVA 2WUCH 4YAQB 2P5WE 4GSDH 4I8DA 3W2DH 3ZT6A 2E8YA 1JZ6A 3VXSB 3O6KH 4OF6A 2FEDC 3VXOA 4DUVA 1R5WB 1MY7A 1NGQL 3OKNA 4AG4H 4F7MB 3O6LH 4P23A 2VDQH 1R3KA 4F7CA 1FORL 1SYVB 4IRJD 4ZFZA 2RFXA 5ITFA 4NO3A 3RUGB 5JPNA 1KJVA 3LN4A 1LP9F 1JHKH 4QHUB 4XCCL 3LIZH 3QIBB 3UO1L 5IEKB 2L7JA 2H6PB 2Z31A 5JO5A 3MBEB 1MFDH 3FONB 4XPAH 2DQFB 1ACYL 4LQ1A 1AY1H 1MAKA 5E08L 5EDXA 3TYFA 2Y25A 3TNNB 3JUYA 4P5TD 3O4LB 1S5HB 4OLZH 1NGWA 3IDMA 4UAOB 4XMPL 1VADA 4HXAH 3QT2A 5IHLB 4WTZA 4FMFA 4MHHI 4LOUC 3GDBA 5I30H 3GBNH 3WFDH 2Q8BL 4W6YB 2Z8SA 3ULUD 4U7KA 3RGVD 1DUZA 4H8WH 2UWEB 1GVIA 4WO4B 3HUJA 3O3AA 2GTZB 4XMKL 2NY3B 4HPOL 5GGVH 3ZYJA 4RBPK 1N8ZB 4LSSL 3AB0C 2ATPA 2GW5A 3NCJH 3C08L 3C5JB 3MV9E 2XZZA 4AQOA 5ADPH 4IOFD 3WHE1 5LQBH 1UWXK 3GUTA 1FFOB 5DEZA 5ACLA 2VDNL 5T1DL 5C0BE 4IRZL 5F9JB 4ORGB 4WGWB 2EDBA 4Z76B 3GK8H 3EYFB 4X9BA 1C1EL 1JE6A 1ODAA 4FFEX 3OWEA 4M43L 3ULVF 3B43A 2IGFH 3BMWA 5I16B 1U3HC 1OQXA 3TVMA 4EXKA 1JYNA 3NCYS 5C0GB 3QEHA 5INDA 2BNRA 4FN0A 3I75A 5CUSL 1GL4B 4PJHA 5CKAA 4EEEA 3PUCA 1DBKL 2IFGA 1LO3L 2BP3A 5ESAA 1D6EA 3TA3C 4FQXC 3PQYA 2F74A 2QADC 2GJZA 3VXRE 1YQVL 2UVFA 3ILQC 4HK3N 4M6NL 2YC1A 2V9QA 3LEXA 3UC0L 5HJ3B 4H1LB 1HH9A 3BE1H 3F7RA 4N68A 3G6JB 4HG4J 3UTSA 4LP5A 1EHXA 2ZSVB 1ZANH 5AAMA 1NDMA 5HYIA 4IHOA 3GO1L 1WC7B 4G6KL 4K9EL 1QPXA 3N1FC 1JZ7A 3AS0A 1BIIA 1YN7B 5ILTH 4KKCD 1YEFH 2HTLD 1PY9A 2KDGA 4NZRH 4MXWL 3I6KB 4DWHA 1QRNE 2QSTA 2EIZA 3DETD 3O41B 2NTFA 2V17H 1LEIA 3GSOA 5IB1A 3RJQB 1RIVH 1W8OA 1YPZE 4Z7WB 5A40E 3NGBC 2XG4A 5CGTA 5HHQA 3KJ4B 3RDTD 4KUCF 5DUMH 5JXAL 2XKUA 2R2HB 1G84A 1NEZA 1CDUA 2BJMH 5F6IC 4AT6B 4CJ0A 2W60B 5DHYB 3L5XL 3ZSSA 3PP4H 1INDL 2FJGB 4I1NB 1XGTB 4D0CB 5BV7H 5E2WH 4ISVB 5FOBB 2F8XC 1DQML 1OF2A 5B3NA 4ODVL 4K07A 1YNTB 3AU1A 3RFZC 5JOFB 4JPKL 5SWZA 4R0LB 2HFGH 2I24N 2IAND 4HV8B 2FECL 3MBXH 4JRYB 1ORQB 3K0WA 1ZWIB 1N6UA 4V3DB 1F4WL 4XBEH 4XGZA 4ODWA 3AVEA 3BH9A 4YDJB 1DJSA 1WZ1H 4JPVH 4R7DA 5GJSH 2PN5A 5D70L 4HKJB 5HGDA 4O2FB 2XQBH 4NM4L 1G0YR 3U6RA 3S36L 3PWLB 5C6TL 35C8L 4JRXD 4JQIL 5DQDH 2XI9A 5L6YL 3F12A 4HC1A 3BGMB 1AE6H 4S2SA 1AFVL 3K1DA 3IXTA 3NIDF 5HVHB 4GS7B 4D9QD 1KGCD 2K9UA 3S3PA 5BMFL 4MXVE 3GZKA 3OX8B 1T21B 2ZOKB 4KI5E 3WN5C 5I73C 1DZBA 4U1LB 4FXLA 1B6DA 2PTVA 3CUPB 3X13A 2GYSA 1WK0A 3FHAA 4HJGA 5F89B 5FHBH 1G9NC 5BZDA 1A3RL 4KDTA 3RY6A 1RQ5A 3REWA 2O26U 3MLYH 4JN2B 4Y16C 5I2IB 2WLZA 3Q3GB 4DZBA 2X9YA 4HGKC 4BFIB 1EHAA 4PRNB 5KSUB 4LCWE 5TDOB 4PIRF 4F37F 3D25B 1KPUB 5HYJB 2J6EH 3MV7A 3WIHA 2WUBH 5E1AA 1V7ML 1G9EA 1QSFE 2VDML 4G9DB 1T1XA 5E9DE 3WEXA 3L7EB 4S1DD 3ES6B 3LKNB 4HIJB 5KVFH 5DFVD 2PYEA 5GRUH 4R90H 5BVJB 3NN8A 2YR3A 1WIOA 1RZIB 4NZJA 1P84K 5E56A 2B5IB 4WHYH 4Z7VA 4HCRA 3O3BA 2JB5L 1MH5B 3W0WA 1QVOA 2YSSB 3TT1H 3DHJA 3QNZA 1JZ2A 1MCIA 3F7QA 2W0KA 4WENB 2EEBA 5F7HA 4EBQH 3WD5L 2FJHB 1J8HD 1RMFL 4YHPB 1I7RA 5DVNA 3CU7A 1RJCA 3MRKB 2OTUA 3KPRE 1BF8A 1KJMB 2Z92A 1U36A 3VRLF 2NLJB 5ALCH 4I3SH 1ZHLA 5EUOA 4AEHH 3VXNA 3KPMA 3CPLA 3DWTA 2JJSC 1OVZA 4U2YA 3SOBH 1YNLL 2DWDB 2VR5A 4H0GA 4J1UA 1AO7A 5GRXG 1CDIA 3O45B 4YHML 3ARFB 5DJDB 3VFPB 3MMEB 1RVFL 3P2TA 4A2MA 2VIRA 4ZSOA 5I15L 1J1OL 4YWGH 4JHWL 4GAYA 4MGXA 1HNFA 4OZFA 4RWHA 3BZEA 3PJSA 5I66B 4FQPA 4HLZH 4JFEA 4JDVA 4KRPB 5FGRA 4FQHB 3GRWA 2JELH 1X5HA 3MC0A 5T1KD 3U30B 4PRPB 1HWGB 1IM3B 4O4YL 3I3EA 3LN5B 1B3JA 1NC2D 1NANH 3FO0H 1TNMA 5E2UL 5HDQH 4OGAC 3QI9C 4WVRA 4PJEB 3WUWG 4Y5YC 1A7BA 2O5ZH 2AW2A 1BFVL 5ICYB 1FPTH 4S1RL 4F3FB 1MWAA 2C1OA 4LGRB 4XP6L 2VDPH 4K8RH 3RP1A 4HJJL 2E7HA 3TBSA 2C7UB 3QIWC 4OSUL 1A02N 4FNLL 1HDMB 2DB8A 3I6LD 2L0DA 3FT3B 4WU7A 5I1HH 4PJCB 5J1TC 3UTPE 5KTEH 1VENA 3QNYB 2YRPA 3BPCA 1CGSL 2ADIB 3AY4C 5IIEB 4TUKH 5GRJH 1V05A 4IIQB 2ZZUT 1QO3B 1NUDA 2ESVE 1G7HA 1H3WM 4OM0H 3NZHL 5L7XL 1UCBH 1Y6KR 3KWWB 1JRHH 3GSRA 32C2B 4IDLA 4QOKD 4ELMF 5FIEA 3OJDA 3P0GB 4XTRD 4P2OB 2Q1EA 1MIML 3MROA 1AHWA 4RFEA 3AREA 3GBML 3PXJA 4MAYD 2DI9A 3MUY1 1KEMH 4Z0XA 1OARH 3UYOD 2HJLB 3QJFA 3I50L 1YN6B 2BNUA 4YDVA 5DJ0B 2AJXL 4JZJB 4JZOA 4XP5H 4XZUB 2YD3A 3WIIH 1FBIH 3H9YA 1BQSA 4U1MB 3ULUF 4OD3H 1RI8A 5KSVB 5IGXL 1UM4H 4JLRA 3U46A 3VRJA 1I1AC 3B9DA 3P0YH 4QXWA 1UZ8B 1XGUB 1EO7A 1HH6A 2YRLA 1TCRA 3GKWL 4PJBF 4YXKH 5E7BA 1JIBA 2Y6SC 2BVQA 1U58A 5D1ZD 3BIBX 1BFOA 2ZUWA 4OKVA 2F19L 2B2XH 3RKDC 3IFLH 2VAAA 3QUYC 3QUZB 3CGTA 4F7TB 4J7RA 4LLUB 4WWID 4JJ5A 1T0PB 1UB6A 4HZAA 3FO2A 3IDJB 1UVQB 3CFKA 1JWUA 1L0XA 1G7PA 5J9PB 3V6OC 4JHZA 3MV9B 3IAQA 3O11A 1A6AB 1MLBB 5F9AC 4LIQE 1UACH 5C0BB 2FX7L 4ZUTB 5ANMB 4YC2B 5JLZB 4RMUA 4HT1H 1BLNA 1A5FH 5KBNC 4UUJB 4BZ2L 5LGJA 2VR4A 4WJ5A 4LLMB 3MCLH 4NO5A 5DHVH 1E27A 3Q0HA 5KZCB 3THML 1NDGA 4TOYH 4KHTL 5JORA 4JKPH 4HIHB 2IFFH 3D0VA 3IDUA 3UJTH 2D7NA 3ARDB 3KLDA 5DR5H 5LBSL 1MCWW 4GKNA 3RY5A 2Q20A 3SE8L 4CNIB 2GUOB 2VXVH 1IEAA 1BQHA 4O2EA 4ZFOL 5A2JH 5CMAB 4NFDA 3VXRB 3B6SB 3QBTB 5KVEL 2VDRL 1WT5A 5I8EB 4C56A 4MDIB 1F4YL 2OI9C 4X6FB 3S3JA 4LNRB 4Z18A 4NKIH 3ARSA 5DJZB 3AAZA 3OAUL 3BEVB 5J11C 4PUBL 3IJYA 2BVUA 2WBJB 5K33A 4B7IA 2R0ZL 3RNKA 1D5ZA 1H3UA 5F7EL 1HQ4B 3SJVD 3EJYC 4MCZB 3QIUC 3QWOB 4JN1H 4GQ9L 4MS8C 3MOAH 3U0WL 1QRNB 4ONOA 3MLUL 4PBVC 2JJSA 1GHFH 2XRAL 2DDQL 5E2VL 1CDYA 1YPZB 3WL9A 1XF5A 4JFOA 3W5NA 5C0FB 3GSNL 4KROB 4XPTH 2B20A 4LARH 1U41A 4FTVE 3BH8A 5DVKA 5CJ8A 1WIPA 3VFSB 3QFJA 3KPOB 3NIDE 3RZCB 5IMKA 4LAJH 3M8OH 1U8MA 3FN3A 4NM8L 3D5OF 5J1AA 1D5XA 4R97B 4UIMB 2HG5B 3B9KD 3OKEB 3RWCA 1DQLL 4ZS7L 5B3JE 5E94A 2HWZL 3FQRB 4S0UC 1EAJA 2FGZA 2P8MB 5IW1A 4K71B 4ODTH 3FQXA 3O6MH 2G2RB 1YEKL 3Q6FA 4YFDB 3CIQA 5F93C 1UQSA 3VXQB 1IQWH 4YO0A 1MJ7H 1K3ZA 4M1GL 4P2QE 2OR9H 1I8IB 1N6VA 1FSKC 1RAMA 2B1HH 2XTJB 1FGVL 2A1WL 5DD1L 4I0KA 1CE1L 4HBCL 5C07E 5HYSG 1MF2H 5IWLA 3AY4A 3F5WA 3EDDA 4XRCA 4Y5VB 5CSGA 5HDBF 4M3JA 3OXSB 5K59F 1QFHA 1FL3A 2JTDA 3HNSL 4W6XB 4YXHH 2JK5B 2WINA 1DFBL 3DXAD 3WO4C 2R56H 4U1KA 3BPOB 4PGEA 2BZDA 3IU4L 1A3LL 2VABA 1VERA 2BVPA 1KB9K 4NNYA 2Q3ZA 1MEXL 5HSFA 4FZEH 1YEIL 3NFSL 3D39B 3UZVB 1D6VL 5FK9A 2DD8L 1Z2KA 3DLQR 1MRCH 5F1IA 5DJAB 2F53E 4BH7A 4LCWB 2L7UA 5F1KC 1G6RL 2F9BT 2VAJA 1CFQB 4H26B 4BQ8A 1QSFB 4Y89A 4AM0B 4G5ZL 1FNEA 5K9JL 5E9DB 2HRPL 2YHGA 2VLKB 5BVPH 1JWMB 2BXYA 4GMSH 3PV7A 4HDIA 3MJ9H 3VGDA 3KNBB 3MLSL 2XWJB 4AMKH 3DUUA 1UC6A 4AEEA 1ADQL 1YEHH 1WCBB 4P9ML 3MUGB 4DGIL 3SDAC 3OKLA 5DJCA 3LH2H 1FO0L 3BVNA 5LCVH 4LPTA 3GJFB 4ZOEA 4L9DA 5JTWA 1ZE3C 5SWSE 4KQ3H 4KXZI 2VLMD 3JWOC 5TF1L 1AIFA 3V0WL 2W65A 3MUJA 4YPGA 1U8QA 3C60A 3L7FA 1AXTL 4AJ0A 1MRDH 3QDAA 5B39G 3RBSA 2DLTA 1JN6B 4HGWB 4FZ8L 2Y9RT 4WUUA 1KTKE 3KPNA 1L7IL 4JFDA 4Z5RA 5TH2A 2GCYA 3VH8G 2CIIA 4ONFH 1YEDB 2CMRH 3MCKA 1C7SA 3V7AE 4DGYL 3QQ3B 4H25A 4L8SC 2DICA 3SQBA 3K74B 4Y4KA 4WHTB 4HQQL 3IDGB 1T66C 2HTKC 4YBQD 2A77H 4KY1L 5CP3A 5E5MA 3HN3A 2XTLA 1H8OA 3F7VA 3QDJD 3GIZH 4P59H 1J86A 3QUKA 3O81A 1R3JB 5KSBE 1YECL 4GG6A 4X99A 5I71C 1NGYA 4OT1L 3RPIA 4YGVA 3HTLX 1HHGB 4DCQA 3BHBA 4UAOC 5TDNA 5LAXA 2XG5A 4K7PL 1FL6A 1YEEL 3O2DL 1BF2A 1HN1A 3S96A 1SVZA 3EYOB 1TETH 3BSZL 4FQ2L 2J8HA 1CFTB 3BISA 3L1OL 4WO4C 3MCG1 4YHYC 3GJEA 4JREC 4LHUB 4PP2B 5E1HB 3ULUC 5L88H 1KJ3L 1LP9B 1S9VB 1JK8B 3VWKD 3T65A 3ZMRA 3IDXL 2Y7QA 1P5UA 4LK4A 4YHOL 1TDQA 3KAAA 4KK6D 4X6DE 1QEWB 4ZFGH 4Q9QL 4NPYA 4IOFC 5HI5C 4M7LL 3QEQA 5GSVB 3D6GA 3BJLA 4JZNA 4HS6B 4QRRD 4P2RB 3ROLA 1PZUB 3RY4A 4J4PC 3HNTL 2D7PA 4LVNB 3RJDA 3NCMA 1CT8B 3G6AA 3EDFA 4U6YA 5GGSY 4X7DC 1OB1A 3L3OA 3MRQA 3PL6D 4XVUD 1MRFL 2EDQA 4JM4H 1UFUA 1FORH 5JNYA 1JZ3A 5I6XB 1K4CA 2VRAA 3WS6A 2VN4A 3NBNA 3BQUA 5I1JH 4AY0A 1MFAL 4XCCH 4C54A 3Q6GL 2AK4A 3L3DB 3CFDA 1IAMA 3VGEA 5M95B 4G9FE 4KDVA 1UH2A 4YH6A 4ZUWA 5JHLH 3HC4H 3IVKB 2CXGA 4OLVL 3C2AL 2E7LE 2R4RL 1QSZA 1FFQA 1RJLA 2W0FA 3FB5B 3WNPA 4N0CC 3FRPG 1G1CA 1CE6A 1MLCA 3U4EA 3L5WB 4O00A 1DVFA 4XP9H 5MEQB 5AD0B 4OZGA 3T0DA 1AGDA 4LLVB 2HTLC 1B2WH 1G7MA 2ZUQB 2GK0A 1QZ1A 2AKRB 1I75A 3BYTA 3LKSA 3BEWA 5IQ7L 3SDXF 4OD2B 2VC2L 4YR6B 4JFYB 1JFMA 3ECBA 4DAGL 4CMMA 5B8CB 1MHEB 5IT2L 4D8PB 2DKUA 3DRTB 4HFUL 4Q6YA 1F97A 5T1DH 2EKSA 4K7FA 3RDTC 3RRQA 4KDWA 1N2RA 5D2LF 5IFAH 4EN3B 3TZVB 1XZ0A 3E0GA 4FHBD 2MPAL 1C1EH 1RUAL 4RGNE 4MNHB 1I7TA 2CGRH 3HE7A 3CVIL 4Q9BA 4RFNC 4HUNB 4XVJH 2H3NB 3HNVH 3X14A 1QHOA 1KBGL 3NPZB 1M7IA 2X09A 1RUPH 2ADFL 2YPVL 3LZFL 5E2TL 5CUSH 2ERJB 1FNLA 4O02L 1JGVH 1LO3H 3QG7L 3EGSB 4MVBD 3T4AB 2P24B 1YQVH 2FDBP 3QDGE 1OT1A 2FEEI 3UC0H 2EC8A 1Y6MR 3OAZK 5JW3H 5IM7A 4GW4A 3VW3H 3OAYK 1ED3B 3WJLC 3MRFB 1AKJA 3MRBA 1OGTA 2YA2A 2EIDA 1OGAD 3NA4A 4ZUSB 3REVB 3TH3T 2C5DC 3KHOA 1K2DB 1X6NA 2HKFL 3PP3K 1P1ZA 3LQAC 4Y4HA 4CW1A 1J5OL 5CP7B 2HLAB 2ENYA 2HFTA 5AYQA 3GIVB 3MA7B 5CZXC 4YBHA 2VLJE 2CR3A 3KLHC 4Z77B 4MXWH 1IC5L 1FYTA 3NCEB 3OKOB 3LS5H 4HUMB 3RHWF 3VXUA 4CUCA 3UBXI 1MHCB 2ICEA 4MJID 1QBML 3MV8A 1BWMA 1FVCB 3CDYA 1T20B 3DIFB 5IB4B 2OL3B 4JVWA 4YE4L 4R4FH 4Q6IB 1WIUA 2H26B 4YAQA 1RUQL 3C5ZB 4K8RD 3TIEB 4LKCB 4M5ZL 4F58L 3O6FC 1S7VA 1R5WA 4JKMA 4F7MA 1H3VA 4O9HH 2E9JA 5I75B 2HT2D 5K59E 1SYVA 1KCSL 3J7HA 2APBA 4RWYL 4BZ1H 2NY2D 4WFHE 3GBLA 4XBGB 4QHUA 4LCCC 3QIBA 5IEKA 2H6PA 3MLTB 1I3VA 1AD0B 3MBEA 4GRLD 4S1DC 3TN0B 3FONA 2DQFA 5H37G 2R23B 2GI7A 4TVPH 3TNNA 1JF6A 1S5HA 3PWUA 4HUWB 1IILE 1IGIL 4ODHL 3EO1B 5GGVY 3S36H 1UJTA 1LO5B 1FCGA 4AEIL 4JQIH 4M48L 4QTHB 4P2QB 3GB7B 2GY5A 1W72L 2UWEA 1X5IA 4WO4A 4OGYH 1AFVH 2GTZA 4P5KB 4GQPH 1DDHB 1KJ2H 1WISA 1N8ZA 2OQJA 5C07B 1IAKB 3G5VB 3QWRD 1ERNA 3C5JA 3P0VL 2RCSL 1XF4B 4UT9L 3WNMA 4I0PD 1JZ4A 1A3RH 1FFOA 1GOHA 4X4ME 4UBDD 3P11H 1TTFA 1OAYH 2V6HA 2VDKL 5HHOD 1CGXA 5F9JA 4ORGA 1JF5A 2VXTH 4JCMA 3EYFA 3ARXA 2X89A 1JPSH 1HI6B 2ICWA 3HZKA 1NFKA 1F90H 3BIKB 4XNXH 1PX3A 1YQ2A 5C0GA 3WFZA 1EIBA 1UKQA 1V7MH 1JPST 2KKQA 1WITA 4M7ZC 4XVTL 4C58B 3S37H 4PJ8D 3NTCH 4APQB 3KPSB 4BA8A 1E0OB 2BNQD 1MJJB 4U1IA 2GFBB 4G6MH 5HJ3A 4H1LA 3DMMC 5D4QA 4KPHL 2ZSVA 4JM2D 4AZ8A 4HS8L 3GMNB 4KKBD 4HK0B 1ZLVK 1WC7A 2O5YH 5F9WC 2NY5C 2X4OB 3UBXG 5GGUB 4L3EB 1YN7A 4Y2DD 3ZE1F 3V4UL 4R9HA 1IZJA 2AXFB 5FYJL 1MCWM 3WD5H 1P7QB 2FJFB 4LNVA 4OIIH 3AM8C 1QR1B 1WF5A 4CADB 3I6KA 4P0DA 4IM8A 1ORSB 3O41A 1CYGA 1G7IA 3FN9A 4G6JL 1R0AL 1IC4H 3WLBB 1EFXA 2J4WL 1NLDL 4GAJH 3JXAA 2YOCA 1MQKL 1RIHH 2ZUYA 1GGUA 5HYFA 1YNLH 5TFSH 4CBPA 2ICCA 2NXZD 5ACMA 3IF1B 4UDTB 5C0CE 3KR3H 1NGPH 1IM9B 2NY0B 5GS1C 1JHLL 2XWBB 4JG0H 4AT6A 2W60A 5DHYA 3KYKL 2FJGA 5F7DB 1XGTA 4XTRC 4D0CA 5HDOA 1ZT4B 1J1OH 2AJVH 4ISVA 4NYLB 5FOBA 4JHWH 5CSZB 3H2WA 2A38A 1YNTA 2AXHA 3HAEH 4GXUN 5DC9B 5JOFA 2QSCL 1CU4L 5FO8A 4HV8A 1CF8H 1DBAH 2EH7H 4LGSB 1NCUA 5DMKA 2DIAA 1R3IL 1ZWIA 4ODXB 3V5KB 4GAFB 5DVOA 3HKFA 4MQ7B 5T1LB 2N7AA 1KCRH 4IRJB 5IG7B 2IALB 2FCBA 3FB7A 5L0QC 4HKJA 4FQCH 4PG2A 5EU3B 3LRGA 4O2FA 4DKEH 5DSCB 2EXWC 5ETUA 3PWLA 1H3TA 6CGTA 4XP6H 4O58L 3L5HA 3BRGC 2CDFB 3K3QA 4P5TB 1WBZB 2AEPH 4MDJB 2YD9A 1LE5B 2FLBT 3QUZC 3S9DB 1CLCA 1A7OL 2GJJA 1CGSH 3PHQB 2DLIA 3IU3B 1HHHB 4TNVF 3SN6N 2VQTA 1HZHH 3VDCA 3C6LD 3OX8A 1T21A 1KXTB 1OAXL 4GG8B 4U1LA 5B21A 4DJMA 5T5FL 3RGVB 4GRWF 3CUPA 2RR3A 3NZHH 3U2SB 1FN4B 5F89A 4I4WB 1VESA 4TVPE 4BUHA 4FP8L 1I9JH 3EOAB 4F7PB 4JN2A 2WM0A 5I2IA 2H2PC 4N90D 5A2KH 1HSAB 4BFIA 4PRNA 4PJBB 5KSUA 1SBSL 4FQJL 3O6FA 4X5XB 2GJ6E 2FEEL 5TDOA 1UWGL 1NAMB 2P49B 2FX8L 3TO4D 4HWZB 3D25A 1KPUA 5HYJA 4Q9CA 1Y18B 3ARBB 3VXTB 3SDXE 2C4FT 5MHSE 3DGGB 3UP1A 3LRHA 2AJXH 1EERB 3OKDB 3ES6A 3OR6B 4XP4H 3LKNA 4HIJA 3KLSA 4DVBB 5BVJA 4QHMB 2X4SB 5D1XC 3P4MB 1RZIA 1UG9A 3MJ7B 4GBXC 1N4XH 4EKXA 1KCUL 1MHHB 5DUBB 5F96L 1MH5A 4G9FB 4KHXL 1CBVL 3SDDC 3JWDH 2YSSA 1ZS8B 1NL0L 3P3YA 2LTQC 4KTDL 4K94C 2FJHA 3TH2T 1O7VA 4YHPA 1G7LB 1X3DA 1VGEL 5F9OL 1J11A 4PJAF 2F19H 3MRKA 2WP3T 5GPRA 2F54D 3O2VL 3AMLA 5JXEA 1KJMA 2NW3B 4YUEL 4E41D 3B5GA 4U7SA 4QKXB 4DGVH 4YHZH 3U9PL 4WEMB 5FYKU 1OQOA 2QSQA 3QUXD 2DWDA 3FFCE 1X5KA 3GMPB 5HHPB 4Z7OE 4KQ4L 1A1NA 5BO1L 2FB4L 3BT2L 3O45A 1CLZL 3ARFA 5D2NC 5DJDA 3VFPA 3BGFB 3C8KB 1YYMH 3MMEA 4JHAL 1TPXC 5LWYH 3AMKA 2XXMB 5D5MF 2BVYA 4HIXL 3TEUA 1KACB 5D7LD 5D7JB 2XPGB 4DOHE 5J12B 5I66A 1RZKL 4UT6L 4RGNB 5EOTA 4N8PA 4PRPA 1IM3A 3C09B 3LN5A 5LBSH 3B9KC 1QBLL 1KB5B 2JB6B 5F7YC 5CLWA 2DLHA 2IANB 3D2UD 4PJEA 1A7RL 2AK1L 3GMRB 5B4MD 5ICYA 3CK0L 5KVEH 2VDRH 4F3FA 3KYMB 1BVLB 1YMHB 3RL2B 4MA7L 2C7UA 4LSVL 2OJZH 3PGFL 1HDMA 3FT3A 4PJCA 3G5YB 1NPUA 2R0ZH 3QNYA 5AG9A 2CXKA 3LPWA 1FZJB 2ADIA 3X3FH 4XHJD 4JRXB 4Q58C 2VLJB 1QO3A 4NQXB 3MNWA 3RL1B 2ARWA 3CC5B 4GQ9H 1DR9A 4RRPG 4EI6B 3U0WH 2XRAH 3KWWA 3O3DB 4ONHB 1LEGB 4PJ7F 3RGHA 32C2A 1QKZL 3OHXB 4HG4K 1CDJA 3RI5F 1BD2D 3S88L 1AGBB 1K5NA 2ZCHL 3HB3D 5DLML 1KNOB 1DLHA 4NQDD 4M7JL 1ZA3B 3T77A 4TQEL 2HJLA 2YRZA 1DL7L 4H8WC 5E99L 1CI5A 1YN6A 2FX9H 5K9OA 5DJ0A 3STLB 4JZJA 1DQLH 2DQTL 5CLTA 4K7PY 4XZUA 1N59A 4CU8A 1OP3K 2HWZH 1N26A 3ZKMC 5KSVA 1ZLUH 2A6DB 3CDGB 4X9HA 1S9XB 4PGJA 1RZJL 4XNQB 4PRDB 1F58H 3DV6B 4NRXB 1LK3L 1DQDL 4J3SA 3EYQC 4D0DB 1UZ8A 3DRQB 2J8UF 5HVWA 1RIUL 3GHEH 5E2JA 3MX0A 3V8CA 3CU1A 2OYPA 3QFDB 4OFYA 4HBCH 3MRHB 3QUZA 2I27N 4KKLC 5FUZH 4F7TA 1WBYB 4P3DB 2ATKB 1YYLH 4GLRH 4XXDB 2NNAA 4PGDB 2B1AH 3MRDB 3FN0L 4G42B 4BQBA 1J8HB 3IDJA 1UVQA 5HYQB 3QAZB 2RJMA 1CFBA 4XAWL 4DZ8A 2AS5M 5HGHB 1DFBH 2VZUA 5FKAA 1BZ7B 5IVOA 4PJ5E 1X9QA 3MV9A 2X4TB 3IU4H 3WHXA 4RBPH 1A6AA 1MLBA 2EDDA 5IK3A 1I9EA 5C0BA 4ZUTA 3HI5L 5JLZA 3C87A 1YEIH 4UUJA 1EGJA 4YHKH 4NWUH 1UWXH 1D6VH 2DD8H 4LLMA 5C0AD 1J7VR 5KVMC 2O5XH 4I18B 2RGSA 1MVFA 3ARDA 5KVDL 1MIEL 2NMSA 3VFWB 4NO0D 4HGMA 5FAAA 4G5ZH 4CNIA 2HRPH 2GUOA 3NH7H 5CMAA 3X11B 3VXRA 5T1KB 1GGIL 3B6SA 1KLUA 5I8EA 3MLSH 4MDIA 1NC2B 2R1WB 4Y19D 3SDDA 5I8CB 2IG2H 1G0DA 4DGIH 3BEVA 3RVVD 3QCTL 2WBJA 1K3IA 1FO0H 5KJRL 1JYWA 5BV7C 3TJEH 4ELKB 3VXMD 4RAVB 1X7QB 3TYGL 3CDFA 1HQ4A 2D7MA 1BOGB 3V0WH 4XCEB 4MCZA 1U9KA 3QWOA 4GAGH 1MELA 1QRNA 1AXTH 1SHMA 1CL7H 1A6TB 1PBYA 3D3VE 1MREH 5EO9B 4HC1H 1R3HB 3NCBB 4XB8A 4FA8A 1KULA 3S5LG 1YPZA 2LV4A 4FZ8H 5C0FA 4PBXA 1ROWA 5JUEL 1VGKB 1BJ1H 1YA5A 4NKOB 5FA3B 5DVMA 1J8KA 2P42B 4KK6C 1FGNH 5C0CB 4D3CL 1AR1D 3KPOA 3RZCA 1N6QL 5ADOL 3B2VH 5TE4L 2O93L 3LRSB 4KY1H 5J13B 2X70B 1UWEH 5I6XC 2DBJA 3OKEA 4JFHD 4I2XE 5A1AA 4MAYB 3L3IB 1A4JB 3FQRA 4X0KB 2NY6C 4PP8C 3HPJB 2VUYA 4HMEA 5L2KE 4X9GA 4OT1H 5I1GH 3P4NA 2G2RA 1NAKL 3VXQA 2FYYB 3BAEH 2ZJSL 4P46C 5FYKH 1MCQA 3BKYL 3TJHD 4XPBH 1I8IA 3PDOB 3ET9F 3LHPH 1PG7L 3DJ9A 3FO9B 4QHKI 2O61A 4X7FC 4FQ2H 4HCRH 3V52L 4N1EA 3KYOB 3QJHB 3MJGX 4FQIH 1EEYB 1MAML 3HRZA 4Y5VA 3D48R 3NFPB 3WSQH 5D1ZB 3OXSA 2PO6C 4XNUL 1WAAF 2JK5A 3INUH 4ZMAT 2VNCA 4PRAB 1Q1JL 1KFAH 3TNMA 2C3WA 2W9DH 1VPOH 1NGXB 4OCRL 5FYJU 5GGSB 1INEH 3PQYE 4M7LH