4HV5A

Structure of the mntr fe2+ complex with e site metal binding
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
130
structure length
126
Chain Sequence
SMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator MntR
publication title Roles of the A and C sites in the manganese-specific activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
total genus 49
structure length 126
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hv5A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hv5A02
3QPHA 4KA4A 3I53A 2A69F 4RAZA 3HRSA 3KEOA 4ZH4F 1Z6TA 4BYYA 3V4GA 2XV4S 2NRAC 3GEZA 5DEQA 1XMKA 4G7ZF 3WG9A 2CO5A 4P55A 1OYIA 3QPTA 2FEZA 4HF0A 3PQKA 5LHHA 3T0YA 3GLXA 2EV5A 1H0MA 5ICGA 3HSFA 2JRTA 4Y15A 5E17F 2FBKA 3TO9A 1F1ZA 4KNYA 5BPIA 1BC8C 2HFHA 2DLLA 5CYVA 1KU3A 5AIPA 2Z9OA 2RDPA 4G9YA 5LBQA 3F72A 1BJAA 1XGOA 1FPQA 2YSRA 1SMYF 1FYMA 3GFMA 2ZBKA 4LFUA 1WQ2A 4LLGF 1ON2A 1BI3A 3GXOA 4F7ZA 4HV5A 3HSRA 3M1EA 2IRFG 3GYHX 2ZJ2A 2K4BA 3RTRA 2DW4A 4HBLA 1XSXA 4U0WA 3ZQ7A 2VOPA 3CO6C 2DTRA 2PMHA 4TV7A 1MDMA 1O3QA 3GZ6A 1ZLJA 3E5UA 2J5PA 3ABUA 2FU4A 3V8JA 3KETA 1IN7A 1ON1A 4O5VA 2HWVA 1MKMA 4OMZA 4AVPA 3J7AO 3ZMZA 1G3YA 4EQQA 2VOOA 5L3CA 2QWWA 1I6XA 1FLIA 1YS6A 2RV8A 2ELHA 5HLGA 2VC0A 2K27A 3RPQA 1KQ0A 3RDIA 4MNUA 4S04A 2V9VA 2GZWA 3BJOA 1G6NA 1FBSA 3KEQA 2LKPA 4HW0A 2IPQX 2H09A 1JHFA 2HZTA 2NAZA 3JAMZ 1HKQA 2FOKA 4L0ZB 2Y0MA 1YG2A 2O03A 4LGWA 1KYZA 1PUEE 1KU2A 1ZRFA 4A0XA 3HIFA 1R1VA 1R7JA 4XBFA 1GHCA 1J9IA 1JXSA 1LDJA 4RB1A 1W7PB 4FHTA 4QWQA 1K79A 3ISPA 4EVIA 2A5YB 2K02A 1FBQA 3V8KA 3T8TA 1KQ9A 2YPRA 4HF2A 2L4AA 4PDKA 3ZP5A 1A04A 3FZVA 1FZPB 3N4MA 5ERIA 4I7HA 3V7SA 5ILVA 3HHGA 1KA8A 1FNNA 1I1GA 4KIBA 2H6BA 3COAC 1OKRA 2QLZA 3E5XA 1WSUA 1NHAA 1EH8A 2UZKA 1RZ4A 1XGNA 1S8NA 1EV7A 1H9TA 3OOPA 4XSZF 3VFZA 3QOPA 3TOAA 5HVQC 4HX4A 3QU3A 4Q48A 2HTSA 2HDCA 3SZPA 1FC3A 3QP6A 5BMZA 1P4AA 4G94A 3BZ6A 2OU2A 2QZ8A 3K1MA 2EFOA 1ZRCA 2F5EA 1BM9A 4HYEA 2VBWA 3FF5A 1S29A 2BV6A 1TQMA 1IN5A 1T39A 1RUOA 2P8TA 2NS0A 4XLNF 3HRUA 2DPUA 5K5QA 3L7WA 4K2EA 1F5TA 2HKOA 1UHWA 3MZHA 4CXFA 1DP7P 2W24A 1Z91A 2DU9A 2V79A 4M72A 1QGPA 2QM3A 3CUOA 5CLSA 4EJVA 5HOOA 4WXDA 5FB2A 5D8KB 4IHSA 1D3YA 4IJAA 1KU7A 2L02A 1ZG5A 2FMLA 3F8CA 2M8EA 3BJ6A 5ED4A 1ODDA 2F2EA 1USSA 3L2CA 3MAJA 4LLLA 2HYFA 1KU9A 1FP2A 3ZMDA 2G7HA 1FT9A 3MQ0A 1EH7A 1CF7A 3E97A 4A6EA 3WTYC 1U5TA 3BJAA 2EB7A 4KMFA 3GFIA 2ZFWA 2W25A 4L5IA 4B8XA 3P7NA 5A2QK 2RVCA 4G7HF 4O3MA 5D4RA 4YFNF 4U7BA 2IW5A 5ILUA 4I01A 5LHGA 4H0EA 1FWZA 4CO8A 2ADUA 5D8LB 4WF2A 1B1BA 4BHBA 5DCFA 3GVAA 3SXYA 1YS7A 2EFPA 2XGXA 1UHMA 4HAMA 5D4SA 5LRRA 3KFWX 2JT1A 3E6MA 3M8EA 3G3ZA 2NYXA 5E8GA 4I02A 1G3SA 2BEOA 3C18A 4KN7X 1ZARA 2E1NA 1BI2A 2Z5UA 1TBXA 1OPCA 4LD5A 1E17A 3TQNA 2ISYA 1S7OA 4RGSA 4P5OA 4ZZLA 2BGCA 3KP6A 1EH6A 3FMQA 3ZMTA 1TW3A 5HS7A 1HSTA 4L18B 2M45A 4UVBA 4EM2A 3NEUA 3GZ5A 1HW5A 5EEGA 3LSTA 1G3TA 4R8HA 2CWEA 1Y0UA 2GAUA 1DDNA 4Z2YA 3F8BA 1U8RA 4GYGA 3IKTA 2LNBA 1MD0A 3WTVC 4OIQF 1YO5C 2K86A 1JGSA 1YQAA 4IRHA 3BP8A 2HYGD 3WTSC 4MQVA 2KRFA 3KP4A 4PCQA 2M1BA 5LEJA 4I0BA 2DK8A 3BY6A 4P96A 4HZFA 1YLFA 1L0OC 5L3FA 4OMYA 5ICFA 1TW2A 2ZKZA 2DK5A 2NNNA 5KVRA 2XAFA 2COMA 2F5FA 4R79A 2L3DA 1SD6A 4KUMA 1K7AA 3R4KA 3LQQA 5LEKA 3H3UA 1OYWA 2EFNA 4N0BA 3SFZA 4NB5A 2XKOA 4S05A 2BE5F 2V1DA 3D0SA 4CGZA 3T8RA 3GX4X 1GVJA 2HKXA 3R60A 1ZLKA 4CZZA 4UHTA 5LLQA 4KMUX 3VB2A 3O3KA 5J8CA 1B9NA 1SFUA 3SZTA 3IKVA 1PP8F 4UV9A 4ESBA 3CUQC 5BPDA 5H6QA 1BI0A 3F22A 1R22A 4EM0B 5JFRA 4EMSA 1IN8A 5FFZA 3DPLC 3IRQA 2L01A 4Q4ZF 3ABTA 1BOAA 4KICA 3KP3A 1FX7A 1UCRA 4M9ZA 3W6JB 3C3WA 4BH9A 3J81K 4KDPA 4GO1A 5HDKA 3M7GA 2V1XA 3ZMVA 2VODA 3WODF 5HS8A 1LDDA 5HLHA 1UB9A 4U88A 5F1RA 1R5GA 2A07F 1J7KA 1O7FA 1MGTA 1J2XA 4CICA 1OYYA 3KE2A 1LVAA 2JTVA 3WGHA 3DKWA 4ZYEA 4Y13A 2P5KA 4ENMA 3WE3A 2AXLA 2OQRA 5TJJA 3WTWC 4WCGA 1XSDA 2F5CA 2P5LC 2R3SA 2UXNA 2XAHA 3I59B 4ZYDA 5FLXK 4P9UA 4OIPF 2HQRA 1IAWA 5D5WB 2YX4A 2PQ8A 2EV0A 2HQNA 5AIQA 5E20A 2OAZA 5HDNA 1U6GA 3LQRA 5D5VB 2NNYA 2GA1A 2TDXA 1O3SA 4HX8A 2FSWA 3IWFA 3U1DA 3DFGA 2STTA 1SD7A 1RNLA 5CVJA 5ILSA 2DFIA 4B09A 3L09A 1IN4A 5BOXA 2XASA 3CTAA 3GFJA 1YIOA 1ZREA 4Q47A 1YTYA 1O7LA 5FD5A 3IC7A 4ZZDA 1B4AA 1LJ9A 3GWZA 3WTZA 1ULYA 2GQQA 5DCMB 1IXCA 3KZZA 2FA5A 3NQOA 2PBIA 2MLGA 1XGMA 5IT9K 3DF8A 5HLIA 4HDUA 5FD6A 4OINF 5DD4A 3DEUA 4ESFA 2PJPA 1DUXC 3KLNA 1XGSA 4UVAA 2PI0A 2A68F 1Z7UA 4M6YA 3HYIA 2Z3YA 3ZN0A 3I0TA 3P9IA 3F8FA 2CSOA 3PQJA 1FYKA 6PAXA 1WKMA 3HTUA 3BPXA 1TNTA 4OIRF 4D0PA 3FHZA 2FRHA 1B59A 5K5RA 3LA3A 2MH2A 2ISZA 2KIFA 3T1BA 1X3UA 3FM3A 1C0WA 3B73A 4LLNA 3MZYA 2XRNA 5J8FA 5D6EA 3JAMK 2ZNYA 4MTEA 3GW2A 2O8XA 2P5VA 2Q8KA 2ZMEB 2D1VA 1IN6A 1W7PD 4Q5SF 5LHIA 1SAXA 1BI1A 4M9XA 1BIAA 1RI7A 2XROA 1FOKA 5JHUA 5CVIA 2XKPA 3RPUA 2QYOA 4EJUA 2WC2A 4HA8A 4FX4A 3D5LA 4HLXA 4A6DA 2K7LA 3MWMA 2PG4A 4EV0A 2E7WA 3NRVA 2H94A 2PMUA 4M74A 4IRIA 3FMSA 2ZNZA 5E1XA 1G4DA 3KP2A 2LDUA 2ETHA 3F8MA 2FBIA 3ZMUA 4U0VA 2OZ6A 5HDGA 4UNOA 3LA7A 5CVRA 5LGNA 3DQVC 4HQEA 4LB5A 3E6CC 4G8XA 4AD9A 3DV8A 4JQFA 2DAOA 5E1ZB 2L54A 3FXRA 4I2OA 1D8KA 3K2ZA 2OD5A 2DT5A 5A2QZ 3JTHA 4JBAA 2A6HF 2J5OA 3HRTA 3VODA 2LF8A 1BIBA 5DUIA 4CHUA 2MBFA 4IXAA 2QQBA 1XMAA 4IVNA 1QQIA 2Q0OA 4HLYA 2WTEA 4LMYA 4HX7A 3RKYA 5D6FA 3CO7C 3C1DA 1TQIA 4A0YA 4P9FA 4KN4X 2FQ3A 4L9VA 2CFXA 2D2WA 2M30A 4GGGA 3SQNA 2DQLA 4ETSA 3M8FA 3WTTC 4KIGA 1ONVA 4ESJA 1BC7C 5L3DA 4LK0F 2P7CB 1XN7A 4AIJA 3M9AA 1HKSA 1ZYRF 2MD5A 4RGXA 2V6CA 4A0ZA 3F23A 1O3RA 4M6XA 1D8JA 1S6LA 1MJBA 2FNAA 2EJRA 2VE8A 4MGRA 1LQ1A 2D1HA 4RB0A 4A2UA 4A5NA 1USTA 3HUGA 2FF4A 4LG0B 2IA0A 1QNTA 1IRFA 4PGHA 1S3JA 2FMYA 3EDPA 2ZXJA 3MCZA 4LK1F 1T98A 5L3GA 1W4MA 4L9TA 2QVOA 2KIMA 2CYYA 2PN6A 3F6OA 4L9NA 2EFWA 3DP7A 3O2PE 2CW0F 3H3ZA 1TLHB 4WK8F 3K1PA 3LFKA 3TGNA 4FX0A 1J59A 2WWYA 2C6YA 5TRDA 3KZYA 5IT3A 3CLOA 3MEXA 4M71A 3ROUA 1RUNA 4CDGA 3C7JA 3CUQB 1J75A 1GXPA 2DQRA 4ENJA 4HOBA 2CQKA 4DNCA 3LA2A 1QZYA 2YR2A 4BHPA 4RS8A 4KT5C 4KFCA 2AS5F 3U2RA 1QZZA 3TDUC 1IXSB 4WXHA 5F6FA 4A5MA 5DCMA 3KLOA 2IVMA 3HOTA 3P9CA 1DPRA 1K6OA 3F21A 4Y17A 2M87A 3IL2A 4DQ2A 3HRMA 4U0YA 3FXQA 2A6EF 1E2XA 3K1NA 5JR3A 5EEHA 4I0AA 1VTNC 4XLPF 1FP1D 3RJPA 1V4RA 2HTJA 1DPUA 3J81Z 3E6BA 2Z99A 1W7PA 2JSCA 4U7DA 2P7VB 4ZYGA 1JHHA 2XAQA 2DBBA 3I4PA 1ZN2A 4BNCA 2HGCA 4EJOA 4XRFA 3WU1B 1HXDA 1B9MA 2KIUA 2X0LA 3CDHA 4L9JA 4WX9A 2R7DA 2XAGA 2RN7A 1ZHFA 2PFBA 4EJWA 3E6DA 2F5DA 3E3VA 5JVTA 2BBYA 2OBPA 2RGVA 1FYLA 2XIGA 4EM1A 4HDVA 3I64A 2KJCA 1KGSA 3ML6A 2FXAA 1V3FA 1FSEA 1R58A 4MTDA 4UXNA 2ZMEA 3JSOA 5AONA 2Z33A 5FLXZ 5K1YA 3QP5A 1U78A 3FWEA 5H20A 3KP7A 1PDNC 3J80K 3AAFA 2FBHA 1T6SA 1I1SA 3HTSB 4RB3C 1R36A 4IRGA 1U5TC 2GA2A 4HF1A 3RYRA 3V8LA 1ZAOA 1UFMA 2VT3A 3IRRA 3P9KA 4KIFA 4XSXF 4QLCU 3WTXC 2EK5A 2Y75A 3FM5A 5L3BA 1TNSA 4BAYA 2JZYA 3GUDA 3K9TA 2O0YA 1TTYA 1IRGA 1HKTA 2GIVA 5E1WA 4GXOA 3I58A 4YG2F 4RB2C 2D45A 1D5VA 4OU0A 4AWXB 4G6DA 2XAJA 3WGIA 3I5UA 4M9SA 5FO5A 1K78B 1XDUA 2DI3A 3SHFA 1HW2A 2B0LA 2RNJA 3JSPA 2CGPA 2GWRA 5IT9Z 2G7UA 3ZPLA 2H6CA 3QRFF 1O3TA 3HSEA 3E5QA 5CJ9A 1KYWA 2MLKA 2XHKA 1P6RA 1P2FA 1ZH5A 2QBYB 1ZRDA 1WWXA 1SD5A 4MHGA 2VBZA 2EV6A 1ZGAA 5D5UB 4PGGA 1T0FA 3R61A 3DPTA 3ULQB 1QPMA 4OIOF 2FE3A 3H92A 5DYMA 2IJLA 4HV6A 4O6JA 5DUKA 1MJAA 3WTUC 1KQ8A 3WGGA 1BBYA 4WXCA 4N9IA 3R6SA 1BN5A 3ZN1A 1YW7A 3BOQA 4UV8A 3O6BB 3R0JA 1J0RA 2MC3A 1LEBA 4CYDA 1R5HA 3QAHA 3JTGA 4G7OF 2RC4A 1YW9A 1WRJA 1ZGJA 4I09A 5D5XB 1L3LA 3FXUA 2VN2A 1LB2A 2LF7A 5CVUA 1AOYA 1IW7F 3G73A 3ECHA 3RI4A 3KP5A 3GFLA 1LDKB 4EJTA 2UXXA 5K5OA 3RKXA 2RQPA 1J5YA 4A12A 1Z6RA 4RGRA 5FGMA 4LG0A 3VEPA 1P92A 4RAYA 2GXGA 3REOA 2CG4A 2EA4A 1R00A 1QBJA 2L4MA 2Y48A 2E7XA 2QENA 4AIKA 1I27A 1REPC 2X4HA 3TO6A 3FMRA 1P4WA 5BS6A 2HOEA 1HSJA 1U3EM 5JI6A 2O6GE 1H9GA 1IF1A 1GXQA 1R1UA 4UVCA 1B6AA 1U2WA 4GYIA 5E8IA 2UWMA 2XVCA 4G6QA 2OQGA 2QQ9A 2VXZA 1SFEA 3GF2A 2BYVE 3Q5FA 4R1HA 3CUQA 3TKYA 1LNWA 1P4XA 3WE2A 2MH9A 4N9HA 2P6TA 1MZBA 2FNPA 5FFXA 2YU3A 1Z1DA 3RYPA 5ICEA 3EYYA 4EGZA 3WU0A 2O3FA 3T5XA 1MDMB 1S7AA 3EUHA 2P6SA 4YFKF 3I54A 3MFKA 2V1UA 1MJ9A 3LAJA 4E70A 3V7RA 3VOEA 4IF4A 1LEAA 2IT0A 2E1CA 1T38A 2YX7A 3DXJF 4IHTA 4L0YB 4JK1X 3ZMSA 1YW8A 3HHHA 4BQAA 1T2KA 3S2WA 1F4KA 2KJBA 1W5TA 3EYIA 1XDSA 4EGYA 1JE8A 2VC1A 1PP7U 2VBYA 5L3EA 5LRSA 4RGUA 1AWCA 4OOIA 3L00A 1HW1A 2PEXA 1YYVA 3PFIA 1XCBA 3TO7A 1QO0D 2QUFA 4WWCA 3B02A 3ERED 4ASNA 3BDDA 4ENNA 3N97A 4BHCA 2G9WA 2IA1A 3BWGA 2VE9A 3TOBA 2HEOA 4LJZF 5E18F 5F64A 3R0AA 1XSVA 1SD4A 2GXBA 2W85A 4GCVA 4BXUA 1YFHA 4ZYHA 2ACJA 2P4WA 2VT2A 4YIIA 1STZA 4IPAA 1SMTA 2VBXA 4L5JA 4MEYF 3ELKA 1Z9CA 3ECOA 5ICCA 2VONA 2ESNA 1SFXA 3BROA 4NHJA 3L9FA 3OV8A 1Q1HA 2KKOA 3I59A 1RIOH 1HQCA 5H6RA 1TQPA 1O57A 2K4JA 3F6VA 1W5SA 2QQAA 1XCVA 2HS5A 4UUVA 2IP2A 2H27A 1FY7A 2WV0A 4FT8A 1R1TA 1G3WA 1XD7A 2ZCWA 4MEXF 3U9GA 2R7FA 5DDGA 1FSHA 1XB4A 1K78A 3LWFA 1OMIA 5LGUA 2DPDA 2ZO4A 3IWZA 1IUYA 4I98B 3KCCA 2IA2A 4PZJA 2PLYA 3EQLF 3K0LA 3TDZC 3F8NA 4LB6B 4M73A 3RIRA 2A3SA 2QBYA 3IHUA 4ENKA 5KK1A 5DD8A 1IZ1A 4YFXF 3K69A 5J6XA 2OA4A 1R23A 3CJNA 4HQMA 1OR7A 2DO7A 4NQWA 4AIHA 2RKHA 1ZG1A 2LSOA 1HBXG 4KYWA 3BPVA 5CVVA 1WI9A 4MQ9F 3Q9SA 1F9NA 2M5WA 1I5ZA 2EFQA 3LAPA 3W6KB 2A61A 2OZUA 2STWA 3I71A 2EWNA 2ESHA 2MA3A 1ZG3A 1Z05A 3HOSA 5LGTA 1IXRC 2Q2EA 1CF7B 2EA2A 3QU6A 3RKWA 5BQTA 2W57A 4ON0A 3Q9VA 2HR3A 2JPCA 3F3XA 3V7CA 2W84A 3GO5A 1U5TB 5HS9A 2O61A 3EETA 3FX3A 4YIFA 2JPBA 5DV5A 1CGPA 3JW4A 3J80Z 1FBUA 2XUBA
chains in the Genus database with same CATH superfamily
2DA6A 4BY7J 3QPHA 3B6AA 1IV6A 2XB0X 1OCTC 4KA4A 3I53A 5A2QR 2A69F 2COBA 4RAZA 4ZJZA 2R0QC 2HOTA 3S2HJ 2HXIA 3HRSA 3KEOA 4ZH4F 1Z6TA 4BYYA 3V4GA 2XV4S 2NRAC 2R7UA 3K7AJ 3GEZA 3K70C 5DEQA 1XMKA 4G7ZF 4IKFA 3K4MA 2I8DA 3WG9A 1ZR2A 3OS0A 2CO5A 4PSXA 4P55A 3EUHC 1OYIA 3QPTA 4GDFA 2FEZA 1QU3A 4HF0A 3PQKA 5LHHA 3T0YA 2JA7J 3GLXA 1KZHA 4ZTJA 3GTGJ 2EV5A 5J4YA 1H0MA 5ICGA 3HSFA 1A6IA 5E79C 3FKIJ 2LK2A 2F4IA 2JRTA 4Y15A 1OCOH 3CJRB 2JQ7A 4CCLA 2DMNA 5E17F 1WZ2A 1FEXA 4XMYA 2FBKA 3TO9A 1IDYA 5IP6A 4HSTA 1YX3A 5DS9A 1F1ZA 4KNYA 4XN3A 5BPIA 1BC8C 3QYFA 2HFHA 1I39A 2DLLA 5CYVA 4AUXA 4M3BA 1Z3YA 5F0CA 4FASD 1SVMA 4XLEA 1KU3A 5AIPA 2Z9OA 3DBHB 4B3AA 2RDPA 2LTPA 2DMTA 4G9YA 5LBQA 2EPFA 3CESA 3F72A 4FE7A 1SFKA 2HVQA 3Q3SA 4IZZA 1BJAA 2ICWG 3Q0UA 1XGOA 2HZDA 1FPQA 2KMUA 2YSRA 1SMYF 1FYMA 3GFMA 4F92B 2EZIA 3OYDA 3A01B 2ZBKA 4LFUA 1WQ2A 4I99C 1B8IB 4NDLA 1FIPA 1ON2A 1BI3A 3PUFA 4LLGF 3GXOA 3ABKH 4F7ZA 4BQOA 3FDYA 1BW5A 1ACIA 2DT6A 4HV5A 3S14J 3JRCA 3M1CA 1BJZA 4DBQA 3HSRA 1WJCA 3M1EA 2IRFG 3ZR8X 3GYHX 3CC7I 1HLVA 2ZJ2A 2K4BA 5EDNA 2OJED 3RTRA 2DW4A 4LITA 4HBLA 2HNHA 3HM5A 1XSXA 3OMYA 4U0WA 3HOUJ 3TEDA 4J01A 5BNGA 3ZQ7A 3HOVJ 2VOPA 3CO6C 4V19K 2P0TA 3F0CA 3I4MJ 2DTRA 2PMHA 5M3MJ 2E2JJ 3F9KA 4TV7A 3OYAA 4A3JJ 1O3QA 1MDMA 4XIDA 5GPAA 3FBIB 3GZ6A 2L7MP 2BW3A 3KYDB 2Y2ZA 4C30A 1ZLJA 2QGUA 2QSFX 3DTEA 1WGXA 2J5PA 2LYCA 3E5UA 3ABUA 2FU4A 3V8JA 3KETA 1IN7A 1WH7A 1VQ9I 1ON1A 4O5VA 3DLLF 2HQAA 3MKLA 2HXOA 5DTDA 2HWVA 3CCQI 1MKMA 2X1DA 4OMZA 4AVPA 3J7AO 3ZMZA 1G3YA 4EQQA 2VOOA 5L3CA 2E60A 1HDPA 2VKVA 1X1AA 2QWWA 3G71I 1I6HJ 1I6XA 4I76A 3OY9A 2JVGA 4UB8C 1DGWY 1FLIA 1YS6A 2RV8A 3RQIA 2ELHA 5HLGA 2VC0A 2JVHA 2K27A 3HGGA 3RPQA 1KQ0A 3IAM2 3RDIA 4MNUA 3SZGA 3H35A 4S04A 2V9VA 1YHQI 2GZWA 3CD6I 2VB6A 1WPKA 4A3GJ 4UY8I 3BJOA 1RQ6A 2CV2A 1G6NA 1DGRM 1DQUA 4NBQA 2E1MB 4Y3OA 1E3OC 2KP6A 1FBSA 3KEQA 2LKPA 4ZYAA 4HW0A 2IPQX 2H09A 1JHFA 2HZTA 2NAZA 2NVUB 3JAMZ 1HKQA 3G1LA 4YRVA 2FOKA 4L0ZB 2JRMA 4DZPA 2HOSA 2Y0MA 1YG2A 2O03A 4LGWA 4PUSA 3RKQA 3LSRA 2VIXA 5EG0B 1KYZA 3C2BA 1PUEE 1XC5A 1QVUA 1P7JA 2YUSA 3ZCOA 1KU2A 1ZRFA 4A0XA 4BJ5C 2CUZA 2XF5A 3HIFA 1R1VA 1R7JA 2CRGA 4XBFA 1GHCA 2D5VA 1J9IA 1VQ6I 2EILH 1JXSA 4AC0A 3TBIA 2LH9A 2LD5A 1LDJA 2ZSIB 3BR5A 4RB1A 1MMGA 1WJ5A 2XAUA 1W7PB 2VJ5A 3QYBA 4FHTA 4QWQA 2KDOA 4YIRX 1K79A 2OTJI 3L2RA 3H0GJ 3ISPA 3ABMH 5KAFC 1IUFA 2RNGA 4EVIA 2A5YB 3C2HA 3OYEA 2K02A 1FBQA 3V8KA 2EBIA 2OCCH 3T8TA 1KQ9A 2YPRA 1AA7A 1FOWA 4HF2A 2L4AA 1OR7C 4PDKA 3ZP5A 1A04A 3FZVA 1FZPB 5M3FJ 2LC2A 5FJ8J 3N4MA 5ERIA 2Y9ZA 2LY1A 1YRNA 4I7HA 3V7SA 5ILVA 4BJ6C 3A52A 1FTZA 1N25A 1HDDC 5HLTA 3HHGA 5K7ZA 1KA8A 5E3LA 3QPLA 1FNNA 1I1GA 1JTXA 4KIBA 2H6BA 5FKOA 3VSLA 3COAC 1OKRA 2QLZA 3E5XA 1WSUA 3H0DA 1NHAA 2DTZA 1BW6A 1EH8A 2UZKA 1RZ4A 1XGNA 1S8NA 3RZDJ 1EV7A 1TWCJ 1H9TA 3OOPA 1X19A 4XSZF 3VFZA 3QOPA 4E7HA 1DP3A 3TOAA 3CQZJ 5HVQC 4HX4A 3QU3A 3KEYA 4Q48A 2HTSA 2HDCA 3FBNB 3SZPA 4E6KG 2ZJQF 4AIDA 1FC3A 3QP6A 4N4OB 5BMZA 1P4AA 4G94A 3BZ6A 3J80R 1E3HA 2OU2A 3Q0VA 3W6VA 1UG0A 2E71A 3JRGA 4BQQA 2QZ8A 1Z77A 3K1MA 2EFOA 1ZRCA 2F5EA 1BM9A 4HYEA 2VBWA 4B4CA 2DXIA 4BXXJ 2AXTC 1V5FA 2EZKA 2UUZA 1U9OA 2L2OA 3FF5A 1VNDA 1GV5A 1S29A 2BV6A 3NAUA 1TQMA 2CFOA 1IN5A 1T39A 1RUOA 2P8TA 2NS0A 4XLNF 3MVPA 3CJQB 3HRUA 2DMUA 1RKWA 2DPUA 2MVTA 5K5QA 1WJDA 3L7WA 4K2EA 1F5TA 1Y56A 2HKOA 1JUSA 1UHWA 4HSRA 4CXFA 3MZHA 1DP7P 2W24A 1VQMI 1MBFA 4C9YA 4YEJA 4XKWA 4C3IJ 4RMNA 1Z91A 2DU9A 2V79A 1JKPC 4M72A 2V9PA 4OAYA 1TC3C 2PMZA 1QGPA 2QM3A 4XOTA 2ZMEC 3CUOA 4AU7A 5CLSA 4EJVA 1U8BA 3G1MA 5HOOA 2DFFA 4WXDA 5FB2A 5D8KB 4IHSA 1D3YA 3BG6A 1Z7LA 4IJAA 3S8PA 1KU7A 2L02A 2RQQA 1IRZA 3DKXA 4FE4A 3JRDA 1HA8A 1ZG5A 2FMLA 3F8CA 2XPUA 2VL8A 3EUAA 2M8EA 3BJ6A 5ED4A 1ODDA 2F2EA 1USSA 3L2CA 3PIOF 3DTKA 3K4LA 2ME0A 2MD0A 3MAJA 2KLOA 4LLLA 2HYFA 2WA0A 1KU9A 1FP2A 3S93A 3ZMDA 1S5LC 3VYUB 4XKVA 2ZC2A 2G7HA 2P0WA 1MNMC 2LG4A 1UELB 4F93B 1FT9A 4N4NB 3MQ0A 1EH7A 4C3HJ 3HOYJ 3AL0B 3CMEI 1CF7A 1D1BA 3E97A 4A6EA 2JWTA 2R5YB 3WTYC 1U5TA 3BJAA 3NARA 1VF9A 2IS1A 2EB7A 4KMFA 3GFIA 2ZFWA 1NH3A 2W25A 3IUOA 4L5IA 2L5QA 4B8XA 3OS1A 3P7NA 3HOWJ 1I3QJ 5FLMJ 2H8RA 3LL7A 5A2QK 4XRSG 5IT9R 4A3FJ 2RVCA 4G7HF 3BT9A 4O3MA 5D4RA 4YFNF 4U7BA 4AYBA 3S1RJ 5CQGA 2IW5A 1LKXA 2I5UA 1T08B 5ILUA 3OR2C 4I01A 3PJRA 2F4MB 5LHGA 4H0EA 1FWZA 4CO8A 2ADUA 5D8LB 4WF2A 1B1BA 4BHBA 3OOUA 3GCMA 4E7JA 5DCFA 3GVAA 3SXYA 1YS7A 4XL9A 3AKZA 2EFPA 2DFHA 4A3IJ 3P5JA 4L5EA 2XGXA 2E5NA 4D9JA 1UHMA 2CU7A 4ITVA 3LSMA 4BQNA 1A31A 4HAMA 5D4SA 5LRRA 1ETVA 3KFWX 3IH4A 2JT1A 3E6MA 4M3GA 3M8EA 4XOPA 3G3ZA 2NYXA 2VI6A 5E8GA 4I02A 4XICA 2IGNA 4E4HA 1MMSA 1YITI 3S1NJ 1G3SA 2BEOA 3C18A 4KN7X 4BUPA 1ZARA 2E1NA 1BI2A 3BG9A 2Z5UA 1TBXA 1UHSA 1OPCA 5GAEJ 4LD5A 5B1BH 1E17A 1W0UA 1FIAA 2WADA 3TQNA 2ISYA 4BY1J 1S7OA 4RGSA 1Y39A 2BXYA 4P5OA 5DM7F 4ZZLA 2BGCA 4LOCA 3KP6A 1EH6A 3JAMR 3FMQA 1P7IA 3ZMTA 4BEHB 4U87A 1TW3A 5HS7A 4IHVA 1HSTA 4L18B 2M45A 4UVBA 1NTCA 2O7OA 4EM2A 3AG4H 3NEUA 4XM3A 3A01A 4II3A 2K40A 3GZ5A 4CCKA 1B8IA 1HW5A 3A0BC 2JK3A 3LSTA 5EEGA 1G3TA 1MMNA 4R8HA 1VQ8I 1QVTA 3CZ6A 3QODA 1UZCA 2QF7A 2GIZA 2CWEA 1Y0UA 2GAUA 1LPQA 1DDNA 4Z2YA 5GAHJ 1HC8A 3F8BA 5F04A 1U8RA 4B1RA 1H88C 4E7SA 3BR1A 4GYGA 2R7XA 1T8IA 1XS9A 3IKTA 2LNBA 5H2FC 1MBGA 2FJ1A 3ESWB 1MD0A 2DOAA 3WTVC 4OIQF 3JRIA 2XGDA 1YO5C 3IAS2 2K86A 1JGSA 1F43A 1YQAA 2I10A 4IRHA 3BP8A 2HYGD 1FOYA 1MH3A 2PJRB 3OYBA 2QKLB 3WTSC 5GP9A 4MQVA 2W4SA 4MFDA 2KRFA 3KP4A 4PCQA 4Y7NJ 1YJ9I 2M1BA 2ZXIA 3S3NA 5LEJA 4I0BA 1APLC 4IHWA 2DK8A 2ZJRF 3CCJI 2E5ZA 3BY6A 1Y8QB 4P96A 3OYHA 1PJRA 1NK3P 2KQRA 1W36D 3DPUA 1F36A 4HZFA 1YLFA 1L0OC 2XGCA 3KYCB 2R7RA 4XN0A 5L3FA 4OMYA 3J7AY 2DMQA 2XF6A 5ICFA 4H4KC 1W0TA 1TW2A 3TP3A 4IOCF 2ZKZA 2DK5A 2NNNA 2GOXB 5KVRA 2XAFA 4FTHA 2COMA 2F5FA 1R4MB 1N75A 1TT0A 2K9MA 3ZQQA 4R79A 2L3DA 2E34A 3NWSA 1VZ0A 1SD6A 2JA5J 4KUMA 1VQ4I 1K7AA 2EIKH 3R4KA 4FETA 2X1EA 4CH7A 2BOLA 1UMQA 3LQQA 5LEKA 3M3YJ 1ZGWA 3H3UA 2OCEA 4HNTA 1FTTA 1OYWA 2EFNA 4N0BA 3SFZA 4NB5A 2MGQA 2XKOA 4S05A 2BE5F 2V1DA 3D0SA 3H9GA 4CGZA 3T8RA 1R71A 3GX4X 1GVJA 4PJ0C 3U21A 2HKXA 5EG0A 3R60A 3CCRI 3QOEA 4HRIA 1ZLKA 3A0HC 4CZZA 3E1SA 4AM3A 2BY2A 1K83J 4NC8A 5B5EC 1EA3A 4UHTA 5LLQA 1PUFB 4KMUX 5E3NA 4A3MJ 3VB2A 3O3KA 5J8CA 1IG7A 1B9NA 1I50J 1SFUA 3SZTA 3IKVA 1PP8F 4UV9A 2ELJA 4ESBA 2KZVA 3CUQC 5BPDA 2O5RA 5H6QA 1Z67A 2KRCA 2N8GA 1BI0A 4ANJA 4DOZA 2XPVA 3F22A 1R22A 5IPAA 1Y6IA 2HPIA 4EM0B 4PJLA 2M4GA 5JFRA 4EMSA 1IN8A 2L0KA 4P1WA 5FFZA 2VXDA 3DPLC 5C3EJ 3IRQA 2L01A 4XLFA 2VQGA 3BZCA 4Q4ZF 3ABTA 1BOAA 2AHQA 3OL3A 2PMZN 1X3ZB 3HKZA 2JUCA 2VKHA 5EF6A 4KICA 3KP3A 1FX7A 2L7KA 2F6CA 3MMYB 5EGOB 4UB6C 1UCRA 5FKLA 4D7NA 4M9ZA 3OYNA 4GFBA 3RZOJ 2L7FP 3HC7A 3W6JB 2QSHX 3C3WA 5HODA 4XKBA 2JSPA 4BBRJ 4BH9A 4RAGA 1AKHB 3J81K 4KDPA 4GO1A 5HDKA 2M7BA 3NWTA 3M7GA 2CQNA 1MNDA 2V26A 2WAFA 2V1XA 2WAEA 3ZMVA 2VODA 1V5GA 3WODF 5HS8A 4DJAA 1LDDA 2NOJB 1FOXA 5HLHA 1UB9A 1Z3XA 1T95A 3FIWA 4DYQA 4U88A 5F1RA 4HNUA 1R5GA 2EIMH 1J7KA 2A07F 2R5ZA 1O7FA 4Y52J 1MGTA 1J2XA 4CICA 3CCMI 1OYYA 1D1CA 3KE2A 1LVAA 1S7EA 2LVSA 5J4VA 2JTVA 3HUGB 5HNFA 1WJAA 2Q1ZB 3WGHA 3RSNA 3L1PA 3DKWA 4ZYEA 1LE8A 4Y13A 2P5KA 2B9SA 1ZTRA 1ZQ3P 4ENMA 3WE3A 2AXLA 2ZXHA 3LSGA 2OQRA 1VFCA 5TJJA 3H1CA 3WTWC 4WCGA 2CUFA 4XKCA 1NG7A 3GTQJ 1XSDA 3ZOBA 1DU6A 2F5CA 3SJMA 3LSIA 2P5LC 2R3SA 2UXNA 5F27A 2XAHA 3I59B 4ZYDA 5FLXK 2X6YA 4P9UA 1MBKA 4OIPF 4AYBN 2HQRA 1GLNA 1IAWA 3LSJA 1OCZH 5EJCA 5D5WB 2YX4A 2PQ8A 3W2VA 2EV0A 2HQNA 2V7FA 3A03A 2IS4A 5AIQA 5E20A 4UUSB 2BXZA 2B7EA 2OAZA 5HDNA 2QCOA 3FXOA 4BU2A 1U6GA 2VPRA 3W3CA 2R92J 3LQRA 3L2WA 3ONQA 2HQ5A 5D5VB 2NNYA 3G1OA 1X2NA 2GA1A 2TDXA 3O8GA 1O3SA 4HX8A 1HF0A 4F52A 3S15J 2FSWA 3IWFA 1JKOC 3U1DA 3DFGA 5F1JA 4NUBA 2LBFB 2V4JC 3TW6A 1O4XA 2STTA 2TRTA 1SD7A 2X6XA 3BQZA 1IJWC 3VWBA 1RNLA 4F3QA 3ASNH 5CVJA 5ILSA 2DFIA 2Y0SA 4DIQA 4B09A 3L09A 1IN4A 2EZHA 5BOXA 1K6YA 1S72I 2IS2A 2XASA 3CTAA 3GFJA 1YIOA 1ZREA 4Q47A 4BKXA 1YTYA 1EKEA 1O7LA 2K9QA 3LSHA 3IC7A 5FD5A 4E7ZA 2KFDA 4ZZDA 2BHYA 4J00A 1B4AA 3OYMA 2YS9A 1ETXA 1LJ9A 3GWZA 1MNEA 3Q0WA 1MMDA 1WJBA 3PL8A 1J09A 3WTZA 4BL0B 2IS6A 1ULYA 2GQQA 5DCMB 1IXCA 4RDUA 1R9TJ 2M2EA 3KZZA 2FA5A 3NQOA 2PBIA 2MLGA 1E3PA 2CQXA 3E7LA 2LP0A 4JX6A 1XGMA 5IT9K 3DF8A 5HLIA 5J1UA 5FD6A 4HDUA 4OINF 5DD4A 3DEUA 2EZLA 2X9DA 4ESFA 2PJPA 4KJZA 1DUXC 3OS2A 3CF2A 1LFBA 1XG1A 3KLNA 3ZQGA 1XGSA 4UVAA 1EF4A 2PI0A 2A68F 2BVMA 3SDBA 1Z7UA 4M6YA 3HYIA 2Z3YA 3ZN0A 3GTOJ 2EINH 3I0TA 3P9IA 3F8FA 2CSOA 1VQOI 3PQJA 1FYKA 4IOAF 1X4OA 6PAXA 1WKMA 2WB1N 3HTUA 3BPXA 1TNTA 4OIRF 3AG3H 5JHFA 3GTKJ 4D0PA 2E2IJ 1M1EB 2NXNB 4RM3A 5M5YJ 3FHZA 2FRHA 2IBDA 1B59A 3JR9A 5K5RA 3CC4I 1VI0A 1JUPA 1SC7A 3LA3A 2MH2A 2ISZA 4PFOA 2KIFA 4DYCA 3T1BA 3V42A 1X3UA 4MO7A 4FISA 3FM3A 1JI8A 3BQYA 1C0WA 3B73A 3TP0A 4LLNA 3MZYA 3G2BA 2XRNA 2BHZA 5J8FA 2QQ8A 5D6EA 3JAMK 1UG2A 4NC6A 2ZNYA 4MTEA 3GW2A 2O8XA 2P5VA 2Q8KA 2R7ZJ 3VYTB 1Y8RB 2WAQA 2ZMEB 2D1VA 1IN6A 1W7PD 2DA1A 1YX5A 4QSHA 1IDZA 4Q5SF 5LHIA 3S1MJ 1SAXA 1BI1A 2E1MC 2CV0A 4M9XA 1G59A 1BIAA 2BVLA 3HPHA 1RI7A 2XROA 1FOKA 4BS9A 1ETKA 5JHUA 5CVIA 3OYGA 1AU7A 2XSJC 2FQ4A 1ETQA 2XKPA 3RPUA 2QYOA 4EJUA 2WC2A 4HA8A 4FX4A 2EH3A 1MIJA 3D5LA 1GDTA 4HLXA 4A6DA 2K7LA 2X6OA 3MKWB 3MWMA 3FKJA 2PG4A 4EV0A 4A3BJ 1QZEA 2E7WA 2JA2A 3K4KA 2XSDC 2A5WA 1VQKI 3BTCA 2PJRA 1UAAA 1ITYA 3OYLA 3NRVA 1RR7A 5TISC 5IYBJ 3KPHA 3JREA 2H94A 2PMUA 4M74A 4IRIA 1MW7A 2LKXA 3CCVI 3FMSA 3DU6A 2ZNZA 3CJTB 5DM6F 5E1XA 1G4DA 2LDUA 2ETHA 3KP2A 3F8MA 2FBIA 1JKQC 3ZMUA 4U0VA 2OZ6A 4DGWB 4BBSJ 1OCRH 2F48A 2ELKA 5HDGA 4UNOA 3HKZN 3LA7A 2HDDA 5CVRA 3JCUC 4XONA 5LGNA 3DQVC 4HQEA 4LB5A 4IQJA 3E6CC 1K4TA 2VQCA 1WCMJ 4G8XA 4AD9A 3DV8A 2ECBA 3BCBA 3BTLA 5GAGJ 3G6EI 2HVRA 4KITB 2CUJA 2IGMA 3CDIA 4JQFA 4II2A 2DAOA 2E35A 5E1ZB 3JRFA 2L54A 1YJNI 2A05A 3FXRA 4I2OA 1D8KA 2L9VA 3H5RA 2HOAA 3K2ZA 4XLAA 2OD5A 3CP2A 2DT5A 4MIMA 5A2QZ 3JTHA 4JBAA 5C4JJ 2A6HF 4A3LJ 2J5OA 3HRTA 3VODA 3ZQFA 3TL4X 4D5CA 1IGNA 2DCEA 2LF8A 2LY2A 1BIBA 4KT6A 5DUIA 4CHUA 4PK4A 2MBFA 4IXAA 2DA4A 2QQBA 3J7AW 1XMAA 1TT5B 4IVNA 3D1NI 2F5VA 1QQIA 2H8WA 2WY8Q 2KRHA 3EUKL 1Y1VJ 3I55I 2R7SA 2X48A 2Q0OA 4HLYA 2WTEA 4LMYA 2XF7A 2JA6J 3SEZA 3OR1C 4HX7A 3LNQA 3WU2C 2BY1A 3RKYA 3LMMA 5D6FA 3CO7C 1TL8A 4LIVA 1JUMA 1MBJA 3C1DA 1TQIA 1SVLA 3HB9A 4P9FA 4A0YA 1VQLI 4KN4X 1MBHA 2FQ3A 4L9VA 2CFXA 5K7FA 2D2WA 3PO2J 2M30A 4GGGA 3SQNA 2DQLA 4A3DJ 4ETSA 3OSFA 1TWHJ 1A35A 3M4OJ 3M8FA 3WTTC 1WFXA 5J40A 4KIGA 2W7NA 3JRHA 1ONVA 1NK2P 4ESJA 1BC7C 4RA2A 5F0HA 4M6VA 5L3DA 3S1QJ 4B43A 2Z16A 4LK0F 5HNHA 2ZFUA 4BDYA 1H8AC 1LUJB 2P7CB 2LR8A 1XN7A 4BE2A 2M34A 5EGOA 3FK6A 4AIJA 3M9AA 3SEQA 2R7TA 4KISA 1HKSA 1ZYRF 4NC7A 1AKHA 2MD5A 4RGXA 2V6CA 4V2GA 4A0ZA 3F23A 3KZIC 4PSWA 1O3RA 3DLAA 4C3JJ 2HI3A 4M6XA 1D8JA 1S6LA 4E7LA 1MJBA 2RAEA 5CKTA 1YJWI 1MSEC 2Y0SN 2FNAA 2EJRA 1R49A 2K5CA 2H1KA 3L2QA 3S3OA 2VE8A 4GRIA 1E0EA 4MGRA 1LQ1A 3K4NA 2D1HA 4RB0A 4A2UA 4B47A 1WI3A 4A5NA 5JVGF 1USTA 2MZ4A 4OWRB 3HUGA 3HL2A 4E7KA 2FF4A 2MSYA 4LG0B 4CCMA 1D0XA 4BE0A 2IA0A 4OAZA 1D5YA 2NOGA 4CZCA 1SVOA 1QNTA 2H1LA 2JMWA 1IRFA 4PGHA 1YRNB 1S3JA 2FMYA 3BR6A 3I56I 1D1AA 3EDPA 3JRAA 2ZXJA 3MCZA 3WHBA 4LK1F 1T98A 2QSGX 4D7MA 4CYCB 1OFCX 5L3GA 1W4MA 4RAFA 4XRSA 1WJEA 3I4NJ 4L9TA 2QVOA 2KIMA 5B1AH 1HOMA 2CYYA 2M3AA 2PN6A 2KT0A 3F6OA 4L9NA 2VQHA 3GTPJ 3OL4A 2EFWA 2NVXJ 4FQGA 3DP7A 3O2PE 4XORA 2CW0F 2ZJPF 1FJLA 4UUSA 3H3ZA 5KAIC 1TLHB 5GPCA 1VQNI 4QPOA 1JJ6C 4WK8F 2DJNA 3K1PA 1W5CC 5FKKA 3LFKA 3TGNA 2WB1A 4W97A 2FX0A 4FX0A 1J59A 2WWYA 2R7OA 2W82A 2C6YA 3KZYA 5TRDA 3BC8A 2DA5A 2KISA 5IT3A 1JKRC 2O9LA 4LIUA 2LBFA 3CLOA 3GZNB 2EIJH 3MEXA 2VJIA 4M71A 3ROUA 1P9QC 3CMAI 4RLQA 1RUNA 4CDGA 1R4NB 1K4SA 3C7JA 3CUQB 1YE9A 2MFZA 1J75A 1UJ8A 1GXPA 2DQRA 3ZQIA 4ENJA 3RPUD 3OIPA 3A02A 4HOBA 3HJEA 1G8XA 2CQKA 2K3FA 4DNCA 3LA2A 2R7VA 1QZYA 3H5AA 1B72B 1TWAJ 3PNYA 4X0GA 2YR2A 4BHPA 4RS8A 4ABZA 3IV5A 3D5RC 4KT5C 3GTJJ 3CLQA 4ZTFA 4QTRA 4KFCA 2AS5F 3U2RA 1QZZA 4BE1A 1FMVA 3TDUC 2WAQN 1IXSB 3ZRGA 4WXHA 3CCLI 5F6FA 1QHGA 2LFBA 4A5MA 5DCMA 2ECCA 3DCFA 3KLOA 5EZHA 3VYSB 4RLFA 2IVMA 3HOTA 3P9CA 1DPRA 1K6OA 4JX4A 3FXMA 3F21A 2LLKA 3HDDA 4Y17A 2M87A 3QYEA 4V2FA 1RESA 3IL2A 2XRLA 2CH0A 3ASOH 1WHUA 1RPWA 4DQ2A 3HRMA 4U0YA 5FRNA 3C2GA 3FXQA 3CMMA 3IH2A 2A6EF 1D0YA 1E2XA 3BG3A 3H5NA 3K1NA 5JR3A 3CCYA 5EEHA 4I0AA 4XRMA 1VTNC 4BACA 4XLPF 3GLLA 1FP1D 1R5ID 2MYSA 1JTYA 1V4RA 2HTJA 3RJPA 1DPUA 1BR4A 3J81Z 1OLTA 3E6BA 3HXLA 2Z99A 1A6QA 2OTLI 1W7PA 2JSCA 4U7DA 5FLVA 5B66C 5FRMA 5GTHC 3A2KA 2P7VB 3W2WA 1SEUA 1JT0A 2HU9A 1GVDA 4ZC3A 4ZYGA 1JHHA 2XAQA 3K70D 4CSWA 2DBBA 3I4PA 1ZN2A 4BNCA 2HGCA 5CQEA 4EJOA 4XRFA 3WU1B 1HXDA 1B9MA 1XX5A 2KIUA 2X0LA 3CP8A 3CDHA 3H9JA 1BL0A 2O8KA 4L9JA 1ZKGA 4WX9A 1JJ8C 2R7DA 4BXFA 4XK4A 2XAGA 3LSKA 2RN7A 4HPQA 3SFIA 1ZHFA 2PFBA 4EJWA 3E6DA 3A4CA 3KYLA 4I6ZA 2M7AA 1JT6A 3FXKA 3QWLA 3PFYA 2F4OB 2F5DA 3E3VA 2VKDA 5JVTA 2BBYA 2OUMA 2Y69H 5LFAA 2OBPA 2RGVA 1FYLA 2VKEA 2M4KA 2XIGA 4EM1A 4HDVA 5C4XJ 5E3OA 1IV8A 1SFOJ 3I64A 2KJCA 1KGSA 2RREA 3ML6A 2FXAA 1V3FA 3PSFA 1FSEA 1R58A 4MTDA 4UXNA 2ZMEA 3JSOA 1IC8A 2FD5A 5AONA 2Z33A 3DEEA 2OC6A 5FLXZ 1OCCH 5K1YA 2EQRA 3QP5A 3CCEI 2JUGA 1U78A 3BLYA 2GXAA 2XDVA 4JX5A 3FWEA 4D1QA 5H20A 3KP7A 1PDNC 1A36A 2R7WA 5FROA 3J80K 1OISA 3AAFA 2E2HJ 2FBHA 1T6SA 1I1SA 3HTSB 2PX9A 2DT7B 3FXLA 1V54H 4RB3C 1R36A 4IRGA 1U5TC 2W00A 4RBOA 2GA2A 4DZJA 3MKYB 4HF1A 3RYRA 2LRDA 1D0ZA 1RKTA 3V8LA 1ZAOA 1K61A 1UFMA 2L9NA 2P81A 5JLWA 4RM2A 2VT3A 3IRRA 4CCNA 2JA8J 3ZQLA 2W48A 1VQPI 3P9KA 4KIFA 3K10A 2V1NA 4XSXF 4QLCU 3WTXC 2EK5A 2Y75A 3FM5A 5L3BA 1TNSA 1SAUA 2JZYA 3GUDA 4B48A 3K9TA 4BAYA 4CCOA 3MD2A 2O0YA 1TTYA 2DFEA 1IRGA 1HKTA 2GIVA 2K9NA 3AFHA 3BTIA 5E1WA 4XNFA 4GXOA 3I58A 3MKZA 4YG2F 2NS7A 4RB2C 2D45A 1D5VA 1QRYA 4OU0A 5B3SH 2DA3A 3K2AA 4AWXB 4G6DA 2XAJA 3WGIA 5CPRB 3I5UA 4M9SA 5FO5A 1K78B 1XDUA 2DI3A 3SHFA 1HW2A 2B0LA 2RNJA 2GOMA 3JSPA 2KDZA 2TCTA 2GWRA 2CGPA 5J3LA 1YI2I 4X6AJ 5IT9Z 2G7UA 3ZPLA 3FHNA 2H6CA 2X51A 3QRFF 1O3TA 1TZLA 3OYJA 3HSEA 2XPWA 3E5QA 5CJ9A 4J19A 5K7HA 1KYWA 1VQ7I 1WVRA 2MLKA 2XHKA 4XLCA 3OYCA 1P6RA 2CW7A 3O8HA 1P2FA 1ZH5A 5F08A 3HPGA 2QBYB 3W2AA 4W1UA 3TMOA 1ETYA 3RCOA 1VQ5I 2Y30A 1ZRDA 1MBEA 1WWXA 3G4SI 1SD5A 4MHGA 3S2DJ 2DA7A 2BY3A 2VBZA 2XC7A 2R5YA 2GBYA 2CJJA 2X85A 5IYCJ 4B3XA 2V6EA 1W1WE 2AQEA 2EV6A 2G0EA 4NQWB 1ZGAA 3OYKA 2Z2SB 5D5UB 2M0CA 3VPRA 4PGGA 5EYRA 2GLOA 1T0FA 3R61A 3U1KA 3DPTA 3GTMJ 3A1YA 1OCPA 3K4BA 3ULQB 1QPMA 3BCAA 2L7ZA 2CV1A 4XR6A 3BG5A 2HVSA 4OIOF 2FE3A 1BR2A 2X1CA 3H92A 5DYMA 1H89C 4M3EA 2IJLA 1X58A 5FKMA 4HV6A 4O6JA 5DUKA 1XPXA 1G2HA 1MJAA 3MZ8A 3MN2A 4UUTA 1POGA 3WTUC 1KQ8A 2E19A 5IY5H 3AG1H 2DODA 2Y9YA 1T56A 1BBYA 4WXCA 4N9IA 3WGGA 3LSPA 5EEAA 3R6SA 1BN5A 4D5FA 1BA5A 3ZN1A 1YW7A 3BOQA 4NNJA 4UV8A 3O6BB 3R0JA 1J0RA 2MC3A 3OYFA 1LEBA 3ZGKA 4CYDA 2R4GA 4JYKA 4IL6C 2Q2EB 1R5HA 3QAHA 3JTGA 2K85A 4G7OF 2RC4A 4ZDOA 3E0JB 1X3WB 1YW9A 3OWTA 1WRJA 1ZGJA 3K6GA 1QHHD 4I09A 2IXSA 2OF7A 5D5XB 1LFPA 1L3LA 3DTIA 3FXUA 4DBRA 3S17J 2VN2A 1LB2A 2LF7A 5CVUA 4BJTA 1SANA 5IYDJ 1AOYA 2K3PA 4F91B 1IW7F 1X2MA 4YELA 3G73A 3AG2H 3ECHA 3RI4A 4G12A 3KP5A 3GFLA 3HOZJ 2DYRH 1TWGJ 2HPMA 2ID6A 1LDKB 3DEWA 4HEA2 4X1EA 2VJJA 2GM4A 4EJTA 1Y1WJ 2CUEA 5KNLA 2DDAA 2R93J 1BOBA 2UXXA 5K5OA 2Y31A 3RKXA 4HNVA 1WH5A 4BEHA 2RQPA 1J5YA 4A12A 3CDLA 2KHMA 5TGTA 2NVQJ 1Z6RA 4RGRA 5FGMA 4LG0A 3VEPA 1P92A 4RAYA 4CA0A 2GXGA 3REOA 1U0JA 2CG4A 3BG7A 1YOVB 2EA4A 2KZGA 3CCSI 1R00A 3UR3C 1QBJA 2L4MA 2Y48A 1T33A 1WJFA 2E1OA 2E7XA 3J81R 1X1DA 2OV7A 3FXJA 2QENA 4AIKA 1I27A 4CYCA 2QEXI 1REPC 2X4HA 3TO6A 4IQ4A 3FMRA 1P4WA 5BS6A 2MABA 1ZR4A 2HOEA 2FUG2 3IH3A 1HSJA 2DJIA 1U3EM 5JI6A 2O6GE 1H9GA 2IEKA 1ORKA 1IF1A 1GXQA 1R1UA 4UVCA 1ZELA 2L9SA 4XQFA 1GT0C 3DBLB 2R5ZB 1B6AA 1U2WA 4GYIA 2X6WA 3ERMA 3VYRB 3ABLH 5E8IA 2MW8A 2UWMA 2A6TA 2XVCA 4G6QA 2OQGA 4IHXA 2QQ9A 2XB5A 2K9SA 3K4JA 3J7YJ 2JJ7A 2VXZA 5FKNA 3VSKA 1LE8B 1SFEA 3GF2A 1HCRA 2ME6A 4C2MJ 2M35A 1XTAA 2BYVE 2KIQA 3PIPF 3Q5FA 3HGYA 5IP9J 3TW7A 2DYSH 2ZSHB 4R1HA 3CUQA 2X98A 3TKYA 1LNWA 4AVZA 1YIJI 1P4XA 3WE2A 2MH9A 3CCUI 2JN6A 4CUGA 4N9HA 1B72A 2VUMJ 3DKYA 3GTLJ 2P6TA 5FLXR 5IP7J 1MZBA 2MC4A 1DU0A 2FNPA 5FFXA 4A3EJ 2YU3A 3BZKA 4HG2A 3WHCA 2QKMB 3QQAA 1Z1DA 1PVEA 4DW6A 3HZJA 3RYPA 5ICEA 3PO3J 1ETWA 9ANTA 2IAIA 3EYYA 3HEFA 3WU0A 2O3FA 4EGZA 3T5XA 1MDMB 1GUUA 1S7AA 3EUHA 4IHYA 2P6SA 2YU9J 4YFKF 2BW3B 3I54A 2WBMA 4CCJA 3MFKA 2LKSA 2V1UA 1MJ9A 4BDZA 4F55A 3KIOA 2WY7Q 1FMWA 1MH4A 2KPMA 3LAJA 4PFPA 4E70A 4JOMA 3V7RA 1CQTA 1OJLA 3VOEA 1N78A 1X4PA 4IF4A 1LEAA 2FOWA 5J47A 5GTIC 4JP0A 2IT0A 1OQYA 1KONA 2E1CA 1T38A 2YX7A 3VDXA 3DXJF 4IEJA 1MSFC 4IHTA 4LG3A 4L0YB 3FISA 3ZQCA 4JK1X 3ZMSA 1YW8A 3HHHA 2CQ7A 1PUFA 4BQAA 1T2KA 1ETOA 3S2WA 1R6RA 2ID3A 1F4KA 2DMPA 2KJBA 1W5TA 5LD2C 3L2VA 3HOXJ 3EYIA 1ZK8A 1XDSA 2HYJA 4EGYA 1JE8A 2VC1A 1PP7U 2VBYA 4A3KJ 5L3EA 2MG4A 5LRSA 3B6CA 4RGUA 1AWCA 4OOIA 3L00A 1ENHA 5J1RA 2DDBA 4IX7A 3OSGA 2E36A 2LMDA 3RQ4A 1QPIA 3M8JA 3D5SC 1HW1A 3I9V2 2PEXA 2BZTA 1IO2A 1YYVA 3PFIA 3IP4B 1XCBA 2NS8A 3TO7A 3JRBA 3H3VK 1TP4A 1QO0D 4EATA 2DN0A 3GBGA 2K9LA 4BGDA 2QUFA 4WWCA 3B02A 3ERED 3H36A 2VJ4A 4ASNA 2B63J 3BDDA 5EZGA 4ENNA 3N97A 1NG6A 2NVTJ 1X1BA 4BHCA 2G9WA 2IA1A 3BWGA 2VE9A 1Z21A 3TOBA 2HEOA 2CQQA 4LJZF 4G6TB 5E18F 2LREA 5F64A 3R0AA 1XSVA 1SD4A 2GXBA 2W85A 3BR2A 1V55H 3N05A 4GCVA 4BXUA 2BY0A 1RRJA 1YFHA 4ZYHA 1V5EA 3OIQA 1IRXA 2ACJA 2P4WA 3SDGA 3PUBA 2M0MA 2VT2A 3LOCA 4YIIA 4M3DA 1STZA 4PJJA 4IPAA 3CC2I 3AL0C 2CS3A 1SMTA 3S32A 1ERDA 2VASA 2VBXA 1LVKA 4L5JA 4MEYF 3ELKA 3CF5F 1Z9CA 4A69C 3ECOA 5ICCA 3DWLE 1T0FC 1EJ9A 3I3LA 3BR0A 2VONA 2ESNA 2MUNA 3SYTA 5IOZA 5KCMA 1PYVA 1U9NA 1SFXA 3BROA 4EEFG 3HBLA 4NHJA 3X2QH 3L9FA 1I3AA 3OV8A 3S3MA 1Q1HA 2KKOA 3I59A 1RIOH 2WV1A 1HQCA 5H6RA 3H9QA 1TQPA 2HDWA 2M9HA 1O57A 1X1PA 2K4JA 3F6VA 2ZB9A 1W5SA 2QQAA 1XCVA 2HS5A 4MLOA 4UUVA 2IP2A 1A5JA 2H27A 2LOOA 1FY7A 2WV0A 1RETA 2OPTA 4FT8A 1R1TA 4M3FA 3QPSA 1G3WA 1XD7A 1Q1VA 1RC9A 2ZCWA 4MEXF 3U9GA 2R7FA 5DDGA 1FSHA 1XB4A 1K78A 4A3CJ 2IGOA 3PSIA 3LWFA 1N77A 1OMIA 4QPQA 4PJNA 2DOFA 2KL4A 4DYRA 5LGUA 3K4CA 2R7QA 2ZO4A 3IWZA 1MMAA 2DPDA 1IUYA 5M5WJ 4I98B 4E7IA 3HG9A 3KCCA 2XGEA 2IA2A 4PZJA 3UKGA 2PLYA 3EQLF 1JGGA 4S0HB 3K0LA 1BR1A 3TDZC 2V9KA 3F8NA 4LB6B 1QA6A 2IGKA 3FK7A 2AO9A 4A93J 4M73A 5C44J 4ZDLA 2CMPA 3RIRA 2A3SA 2W1OA 2QBYA 3IHUA 4ENKA 1Z0XA 5KK1A 5DD8A 1IZ1A 4YFXF 2CW8A 2M8GX 3K69A 2ZXWH 3KX2A 5J6XA 2OA4A 1R23A 3CJNA 4HQMA 3L2UA 1OR7A 2LY9A 1AHDP 2VPLA 2DO7A 3OYIA 3ZQHA 4B44A 1LFUP 1TWFJ 2QA4I 2Z1DA 1S9HA 3OIOA 4NQWA 4AIHA 2RKHA 3WG7H 1X1CA 1ZG1A 5E3MA 2LSOA 4Z6YA 1HBXG 2VLAA 4KYWA 1W36C 5IOYA 3BPVA 5CVVA 1GV2A 1WI9A 4MQ9F 4XLHA 3Q9SA 2NVYJ 1RR8C 1F9NA 3DU5A 4C2UA 2M5WA 1I5ZA 2EFQA 3LAPA 3W6KB 2UV1A 3GMEA 2A61A 2AQFA 3PM1A 4PJMA 2OZUA 3J7ZI 5KHDA 2STWA 3BR3A 3I71A 5J1YA 4ZDPA 5M5XJ 5F0FA 4Y33A 2EWNA 2ESHA 2DOEA 2MA3A 4C2TA 2L9RA 1ZG3A 1Z05A 4MFEA 4Y4RA 3HOSA 1Y0NA 3BTJA 5LGTA 3CMYA 3ZXSA 1IXRC 2Q2EA 3M07A 2VQLA 5GADJ 1CF7B 2EA2A 3LFUA 3QU6A 3RKWA 2W57A 4ON0A 5BQTA 3Q9VA 2HR3A 2JPCA 3F3XA 2DA2A 3V7CA 3UNGC 2W84A 3EPZA 3GO5A 1U5TB 5HS9A 5JLXA 1XMXA 3DBRB 3PNTA 3EETA 2O61A 3FX3A 3PNVA 4QIWN 4YIFA 2JPBA 4IO9F 5DV5A 1CGPA 3JW4A 3J80Z 3S16J 1FBUA 2XUBA 4FCYA
chains in the Genus database with same CATH topology
3QPHA 4KA4A 3I53A 2A69F 4RAZA 3HRSA 3KEOA 4ZH4F 1Z6TA 4BYYA 3V4GA 2XV4S 2NRAC 3GEZA 5DEQA 1XMKA 4G7ZF 3WG9A 2CO5A 4P55A 1OYIA 3QPTA 2FEZA 4HF0A 3PQKA 5LHHA 3T0YA 3GLXA 2EV5A 1H0MA 5ICGA 3HSFA 2JRTA 4Y15A 5E17F 2FBKA 3TO9A 1F1ZA 4KNYA 5BPIA 1BC8C 2HFHA 2DLLA 5CYVA 1KU3A 5AIPA 2Z9OA 2RDPA 4G9YA 5LBQA 3F72A 1BJAA 1XGOA 1FPQA 2YSRA 1SMYF 1FYMA 3GFMA 2ZBKA 4LFUA 1WQ2A 4LLGF 1ON2A 1BI3A 3GXOA 4F7ZA 4HV5A 3HSRA 3M1EA 2IRFG 3GYHX 2ZJ2A 2K4BA 3RTRA 2DW4A 4HBLA 1XSXA 4U0WA 3ZQ7A 2VOPA 3CO6C 2DTRA 2PMHA 4TV7A 1MDMA 1O3QA 3GZ6A 1ZLJA 3E5UA 2J5PA 3ABUA 2FU4A 3V8JA 3KETA 1IN7A 1ON1A 4O5VA 2HWVA 1MKMA 4OMZA 4AVPA 3J7AO 3ZMZA 1G3YA 4EQQA 2VOOA 5L3CA 2QWWA 1I6XA 1FLIA 1YS6A 2RV8A 2ELHA 5HLGA 2VC0A 2K27A 3RPQA 1KQ0A 3RDIA 4MNUA 4S04A 2V9VA 2GZWA 3BJOA 1G6NA 1FBSA 3KEQA 2LKPA 4HW0A 2IPQX 2H09A 1JHFA 2HZTA 2NAZA 3JAMZ 1HKQA 2FOKA 4L0ZB 2Y0MA 1YG2A 2O03A 4LGWA 1KYZA 1PUEE 1KU2A 1ZRFA 4A0XA 3HIFA 1R1VA 1R7JA 4XBFA 1GHCA 1J9IA 1JXSA 1LDJA 4RB1A 1W7PB 4FHTA 4QWQA 1K79A 3ISPA 4EVIA 2A5YB 2K02A 1FBQA 3V8KA 3T8TA 1KQ9A 2YPRA 4HF2A 2L4AA 4PDKA 3ZP5A 1A04A 3FZVA 1FZPB 3N4MA 5ERIA 4I7HA 3V7SA 5ILVA 3HHGA 1KA8A 1FNNA 1I1GA 4KIBA 2H6BA 3COAC 1OKRA 2QLZA 3E5XA 1WSUA 1NHAA 1EH8A 2UZKA 1RZ4A 1XGNA 1S8NA 1EV7A 1H9TA 3OOPA 4XSZF 3VFZA 3QOPA 3TOAA 5HVQC 4HX4A 3QU3A 4Q48A 2HTSA 2HDCA 3SZPA 1FC3A 3QP6A 5BMZA 1P4AA 4G94A 3BZ6A 2OU2A 2QZ8A 3K1MA 2EFOA 1ZRCA 2F5EA 1BM9A 4HYEA 2VBWA 3FF5A 1S29A 2BV6A 1TQMA 1IN5A 1T39A 1RUOA 2P8TA 2NS0A 4XLNF 3HRUA 2DPUA 5K5QA 3L7WA 4K2EA 1F5TA 2HKOA 1UHWA 3MZHA 4CXFA 1DP7P 2W24A 1Z91A 2DU9A 2V79A 4M72A 1QGPA 2QM3A 3CUOA 5CLSA 4EJVA 5HOOA 4WXDA 5FB2A 5D8KB 4IHSA 1D3YA 4IJAA 1KU7A 2L02A 1ZG5A 2FMLA 3F8CA 2M8EA 3BJ6A 5ED4A 1ODDA 2F2EA 1USSA 3L2CA 3MAJA 4LLLA 2HYFA 1KU9A 1FP2A 3ZMDA 2G7HA 1FT9A 3MQ0A 1EH7A 1CF7A 3E97A 4A6EA 3WTYC 1U5TA 3BJAA 2EB7A 4KMFA 3GFIA 2ZFWA 2W25A 4L5IA 4B8XA 3P7NA 5A2QK 2RVCA 4G7HF 4O3MA 5D4RA 4YFNF 4U7BA 2IW5A 5ILUA 4I01A 5LHGA 4H0EA 1FWZA 4CO8A 2ADUA 5D8LB 4WF2A 1B1BA 4BHBA 5DCFA 3GVAA 3SXYA 1YS7A 2EFPA 2XGXA 1UHMA 4HAMA 5D4SA 5LRRA 3KFWX 2JT1A 3E6MA 3M8EA 3G3ZA 2NYXA 5E8GA 4I02A 1G3SA 2BEOA 3C18A 4KN7X 1ZARA 2E1NA 1BI2A 2Z5UA 1TBXA 1OPCA 4LD5A 1E17A 3TQNA 2ISYA 1S7OA 4RGSA 4P5OA 4ZZLA 2BGCA 3KP6A 1EH6A 3FMQA 3ZMTA 1TW3A 5HS7A 1HSTA 4L18B 2M45A 4UVBA 4EM2A 3NEUA 3GZ5A 1HW5A 5EEGA 3LSTA 1G3TA 4R8HA 2CWEA 1Y0UA 2GAUA 1DDNA 4Z2YA 3F8BA 1U8RA 4GYGA 3IKTA 2LNBA 1MD0A 3WTVC 4OIQF 1YO5C 2K86A 1JGSA 1YQAA 4IRHA 3BP8A 2HYGD 3WTSC 4MQVA 2KRFA 3KP4A 4PCQA 2M1BA 5LEJA 4I0BA 2DK8A 3BY6A 4P96A 4HZFA 1YLFA 1L0OC 5L3FA 4OMYA 5ICFA 1TW2A 2ZKZA 2DK5A 2NNNA 5KVRA 2XAFA 2COMA 2F5FA 4R79A 2L3DA 1SD6A 4KUMA 1K7AA 3R4KA 3LQQA 5LEKA 3H3UA 1OYWA 2EFNA 4N0BA 3SFZA 4NB5A 2XKOA 4S05A 2BE5F 2V1DA 3D0SA 4CGZA 3T8RA 3GX4X 1GVJA 2HKXA 3R60A 1ZLKA 4CZZA 4UHTA 5LLQA 4KMUX 3VB2A 3O3KA 5J8CA 1B9NA 1SFUA 3SZTA 3IKVA 1PP8F 4UV9A 4ESBA 3CUQC 5BPDA 5H6QA 1BI0A 3F22A 1R22A 4EM0B 5JFRA 4EMSA 1IN8A 5FFZA 3DPLC 3IRQA 2L01A 4Q4ZF 3ABTA 1BOAA 4KICA 3KP3A 1FX7A 1UCRA 4M9ZA 3W6JB 3C3WA 4BH9A 3J81K 4KDPA 4GO1A 5HDKA 3M7GA 2V1XA 3ZMVA 2VODA 3WODF 5HS8A 1LDDA 5HLHA 1UB9A 4U88A 5F1RA 1R5GA 2A07F 1J7KA 1O7FA 1MGTA 1J2XA 4CICA 1OYYA 3KE2A 1LVAA 2JTVA 3WGHA 3DKWA 4ZYEA 4Y13A 2P5KA 4ENMA 3WE3A 2AXLA 2OQRA 5TJJA 3WTWC 4WCGA 1XSDA 2F5CA 2P5LC 2R3SA 2UXNA 2XAHA 3I59B 4ZYDA 5FLXK 4P9UA 4OIPF 2HQRA 1IAWA 5D5WB 2YX4A 2PQ8A 2EV0A 2HQNA 5AIQA 5E20A 2OAZA 5HDNA 1U6GA 3LQRA 5D5VB 2NNYA 2GA1A 2TDXA 1O3SA 4HX8A 2FSWA 3IWFA 3U1DA 3DFGA 2STTA 1SD7A 1RNLA 5CVJA 5ILSA 2DFIA 4B09A 3L09A 1IN4A 5BOXA 2XASA 3CTAA 3GFJA 1YIOA 1ZREA 4Q47A 1YTYA 1O7LA 5FD5A 3IC7A 4ZZDA 1B4AA 1LJ9A 3GWZA 3WTZA 1ULYA 2GQQA 5DCMB 1IXCA 3KZZA 2FA5A 3NQOA 2PBIA 2MLGA 1XGMA 5IT9K 3DF8A 5HLIA 4HDUA 5FD6A 4OINF 5DD4A 3DEUA 4ESFA 2PJPA 1DUXC 3KLNA 1XGSA 4UVAA 2PI0A 2A68F 1Z7UA 4M6YA 3HYIA 2Z3YA 3ZN0A 3I0TA 3P9IA 3F8FA 2CSOA 3PQJA 1FYKA 6PAXA 1WKMA 3HTUA 3BPXA 1TNTA 4OIRF 4D0PA 3FHZA 2FRHA 1B59A 5K5RA 3LA3A 2MH2A 2ISZA 2KIFA 3T1BA 1X3UA 3FM3A 1C0WA 3B73A 4LLNA 3MZYA 2XRNA 5J8FA 5D6EA 3JAMK 2ZNYA 4MTEA 3GW2A 2O8XA 2P5VA 2Q8KA 2ZMEB 2D1VA 1IN6A 1W7PD 4Q5SF 5LHIA 1SAXA 1BI1A 4M9XA 1BIAA 1RI7A 2XROA 1FOKA 5JHUA 5CVIA 2XKPA 3RPUA 2QYOA 4EJUA 2WC2A 4HA8A 4FX4A 3D5LA 4HLXA 4A6DA 2K7LA 3MWMA 2PG4A 4EV0A 2E7WA 3NRVA 2H94A 2PMUA 4M74A 4IRIA 3FMSA 2ZNZA 5E1XA 1G4DA 3KP2A 2LDUA 2ETHA 3F8MA 2FBIA 3ZMUA 4U0VA 2OZ6A 5HDGA 4UNOA 3LA7A 5CVRA 5LGNA 3DQVC 4HQEA 4LB5A 3E6CC 4G8XA 4AD9A 3DV8A 4JQFA 2DAOA 5E1ZB 2L54A 3FXRA 4I2OA 1D8KA 3K2ZA 2OD5A 2DT5A 5A2QZ 3JTHA 4JBAA 2A6HF 2J5OA 3HRTA 3VODA 2LF8A 1BIBA 5DUIA 4CHUA 2MBFA 4IXAA 2QQBA 1XMAA 4IVNA 1QQIA 2Q0OA 4HLYA 2WTEA 4LMYA 4HX7A 3RKYA 5D6FA 3CO7C 3C1DA 1TQIA 4A0YA 4P9FA 4KN4X 2FQ3A 4L9VA 2CFXA 2D2WA 2M30A 4GGGA 3SQNA 2DQLA 4ETSA 3M8FA 3WTTC 4KIGA 1ONVA 4ESJA 1BC7C 5L3DA 4LK0F 2P7CB 1XN7A 4AIJA 3M9AA 1HKSA 1ZYRF 2MD5A 4RGXA 2V6CA 4A0ZA 3F23A 1O3RA 4M6XA 1D8JA 1S6LA 1MJBA 2FNAA 2EJRA 2VE8A 4MGRA 1LQ1A 2D1HA 4RB0A 4A2UA 4A5NA 1USTA 3HUGA 2FF4A 4LG0B 2IA0A 1QNTA 1IRFA 4PGHA 1S3JA 2FMYA 3EDPA 2ZXJA 3MCZA 4LK1F 1T98A 5L3GA 1W4MA 4L9TA 2QVOA 2KIMA 2CYYA 2PN6A 3F6OA 4L9NA 2EFWA 3DP7A 3O2PE 2CW0F 3H3ZA 1TLHB 4WK8F 3K1PA 3LFKA 3TGNA 4FX0A 1J59A 2WWYA 2C6YA 5TRDA 3KZYA 5IT3A 3CLOA 3MEXA 4M71A 3ROUA 1RUNA 4CDGA 3C7JA 3CUQB 1J75A 1GXPA 2DQRA 4ENJA 4HOBA 2CQKA 4DNCA 3LA2A 1QZYA 2YR2A 4BHPA 4RS8A 4KT5C 4KFCA 2AS5F 3U2RA 1QZZA 3TDUC 1IXSB 4WXHA 5F6FA 4A5MA 5DCMA 3KLOA 2IVMA 3HOTA 3P9CA 1DPRA 1K6OA 3F21A 4Y17A 2M87A 3IL2A 4DQ2A 3HRMA 4U0YA 3FXQA 2A6EF 1E2XA 3K1NA 5JR3A 5EEHA 4I0AA 1VTNC 4XLPF 1FP1D 3RJPA 1V4RA 2HTJA 1DPUA 3J81Z 3E6BA 2Z99A 1W7PA 2JSCA 4U7DA 2P7VB 4ZYGA 1JHHA 2XAQA 2DBBA 3I4PA 1ZN2A 4BNCA 2HGCA 4EJOA 4XRFA 3WU1B 1HXDA 1B9MA 2KIUA 2X0LA 3CDHA 4L9JA 4WX9A 2R7DA 2XAGA 2RN7A 1ZHFA 2PFBA 4EJWA 3E6DA 2F5DA 3E3VA 5JVTA 2BBYA 2OBPA 2RGVA 1FYLA 2XIGA 4EM1A 4HDVA 3I64A 2KJCA 1KGSA 3ML6A 2FXAA 1V3FA 1FSEA 1R58A 4MTDA 4UXNA 2ZMEA 3JSOA 5AONA 2Z33A 5FLXZ 5K1YA 3QP5A 1U78A 3FWEA 5H20A 3KP7A 1PDNC 3J80K 3AAFA 2FBHA 1T6SA 1I1SA 3HTSB 4RB3C 1R36A 4IRGA 1U5TC 2GA2A 4HF1A 3RYRA 3V8LA 1ZAOA 1UFMA 2VT3A 3IRRA 3P9KA 4KIFA 4XSXF 4QLCU 3WTXC 2EK5A 2Y75A 3FM5A 5L3BA 1TNSA 4BAYA 2JZYA 3GUDA 3K9TA 2O0YA 1TTYA 1IRGA 1HKTA 2GIVA 5E1WA 4GXOA 3I58A 4YG2F 4RB2C 2D45A 1D5VA 4OU0A 4AWXB 4G6DA 2XAJA 3WGIA 3I5UA 4M9SA 5FO5A 1K78B 1XDUA 2DI3A 3SHFA 1HW2A 2B0LA 2RNJA 3JSPA 2CGPA 2GWRA 5IT9Z 2G7UA 3ZPLA 2H6CA 3QRFF 1O3TA 3HSEA 3E5QA 5CJ9A 1KYWA 2MLKA 2XHKA 1P6RA 1P2FA 1ZH5A 2QBYB 1ZRDA 1WWXA 1SD5A 4MHGA 2VBZA 2EV6A 1ZGAA 5D5UB 4PGGA 1T0FA 3R61A 3DPTA 3ULQB 1QPMA 4OIOF 2FE3A 3H92A 5DYMA 2IJLA 4HV6A 4O6JA 5DUKA 1MJAA 3WTUC 1KQ8A 3WGGA 1BBYA 4WXCA 4N9IA 3R6SA 1BN5A 3ZN1A 1YW7A 3BOQA 4UV8A 3O6BB 3R0JA 1J0RA 2MC3A 1LEBA 4CYDA 1R5HA 3QAHA 3JTGA 4G7OF 2RC4A 1YW9A 1WRJA 1ZGJA 4I09A 5D5XB 1L3LA 3FXUA 2VN2A 1LB2A 2LF7A 5CVUA 1AOYA 1IW7F 3G73A 3ECHA 3RI4A 3KP5A 3GFLA 1LDKB 4EJTA 2UXXA 5K5OA 3RKXA 2RQPA 1J5YA 4A12A 1Z6RA 4RGRA 5FGMA 4LG0A 3VEPA 1P92A 4RAYA 2GXGA 3REOA 2CG4A 2EA4A 1R00A 1QBJA 2L4MA 2Y48A 2E7XA 2QENA 4AIKA 1I27A 1REPC 2X4HA 3TO6A 3FMRA 1P4WA 5BS6A 2HOEA 1HSJA 1U3EM 5JI6A 2O6GE 1H9GA 1IF1A 1GXQA 1R1UA 4UVCA 1B6AA 1U2WA 4GYIA 5E8IA 2UWMA 2XVCA 4G6QA 2OQGA 2QQ9A 2VXZA 1SFEA 3GF2A 2BYVE 3Q5FA 4R1HA 3CUQA 3TKYA 1LNWA 1P4XA 3WE2A 2MH9A 4N9HA 2P6TA 1MZBA 2FNPA 5FFXA 2YU3A 1Z1DA 3RYPA 5ICEA 3EYYA 4EGZA 3WU0A 2O3FA 3T5XA 1MDMB 1S7AA 3EUHA 2P6SA 4YFKF 3I54A 3MFKA 2V1UA 1MJ9A 3LAJA 4E70A 3V7RA 3VOEA 4IF4A 1LEAA 2IT0A 2E1CA 1T38A 2YX7A 3DXJF 4IHTA 4L0YB 4JK1X 3ZMSA 1YW8A 3HHHA 4BQAA 1T2KA 3S2WA 1F4KA 2KJBA 1W5TA 3EYIA 1XDSA 4EGYA 1JE8A 2VC1A 1PP7U 2VBYA 5L3EA 5LRSA 4RGUA 1AWCA 4OOIA 3L00A 1HW1A 2PEXA 1YYVA 3PFIA 1XCBA 3TO7A 1QO0D 2QUFA 4WWCA 3B02A 3ERED 4ASNA 3BDDA 4ENNA 3N97A 4BHCA 2G9WA 2IA1A 3BWGA 2VE9A 3TOBA 2HEOA 4LJZF 5E18F 5F64A 3R0AA 1XSVA 1SD4A 2GXBA 2W85A 4GCVA 4BXUA 1YFHA 4ZYHA 2ACJA 2P4WA 2VT2A 4YIIA 1STZA 4IPAA 1SMTA 2VBXA 4L5JA 4MEYF 3ELKA 1Z9CA 3ECOA 5ICCA 2VONA 2ESNA 1SFXA 3BROA 4NHJA 3L9FA 3OV8A 1Q1HA 2KKOA 3I59A 1RIOH 1HQCA 5H6RA 1TQPA 1O57A 2K4JA 3F6VA 1W5SA 2QQAA 1XCVA 2HS5A 4UUVA 2IP2A 2H27A 1FY7A 2WV0A 4FT8A 1R1TA 1G3WA 1XD7A 2ZCWA 4MEXF 3U9GA 2R7FA 5DDGA 1FSHA 1XB4A 1K78A 3LWFA 1OMIA 5LGUA 2DPDA 2ZO4A 3IWZA 1IUYA 4I98B 3KCCA 2IA2A 4PZJA 2PLYA 3EQLF 3K0LA 3TDZC 3F8NA 4LB6B 4M73A 3RIRA 2A3SA 2QBYA 3IHUA 4ENKA 5KK1A 5DD8A 1IZ1A 4YFXF 3K69A 5J6XA 2OA4A 1R23A 3CJNA 4HQMA 1OR7A 2DO7A 4NQWA 4AIHA 2RKHA 1ZG1A 2LSOA 1HBXG 4KYWA 3BPVA 5CVVA 1WI9A 4MQ9F 3Q9SA 1F9NA 2M5WA 1I5ZA 2EFQA 3LAPA 3W6KB 2A61A 2OZUA 2STWA 3I71A 2EWNA 2ESHA 2MA3A 1ZG3A 1Z05A 3HOSA 5LGTA 1IXRC 2Q2EA 1CF7B 2EA2A 3QU6A 3RKWA 5BQTA 2W57A 4ON0A 3Q9VA 2HR3A 2JPCA 3F3XA 3V7CA 2W84A 3GO5A 1U5TB 5HS9A 2O61A 3EETA 3FX3A 4YIFA 2JPBA 5DV5A 1CGPA 3JW4A 3J80Z 1FBUA 2XUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPH A;  4KA4 A;  3I53 A;  2A69 F;  4RAZ A;  3HRS A;  3KEO A;  4ZH4 F;  1Z6T A;  4BYY A;  3V4G A;  2XV4 S;  2NRA C;  3GEZ A;  5DEQ A;  1XMK A;  4G7Z F;  3WG9 A;  2CO5 A;  4P55 A;  1OYI A;  3QPT A;  2FEZ A;  4HF0 A;  3PQK A;  5LHH A;  3T0Y A;  3GLX A;  2EV5 A;  1H0M A;  5ICG A;  3HSF A;  2JRT A;  4Y15 A;  5E17 F;  2FBK A;  3TO9 A;  1F1Z A;  4KNY A;  5BPI A;  1BC8 C;  2HFH A;  2DLL A;  5CYV A;  1KU3 A;  5AIP A;  2Z9O A;  2RDP A;  4G9Y A;  5LBQ A;  3F72 A;  1BJA A;  1XGO A;  1FPQ A;  2YSR A;  1SMY F;  1FYM A;  3GFM A;  2ZBK A;  4LFU A;  1WQ2 A;  4LLG F;  1ON2 A;  1BI3 A;  3GXO A;  4F7Z A;  4HV5 A;  3HSR A;  3M1E A;  2IRF G;  3GYH X;  2ZJ2 A;  2K4B A;  3RTR A;  2DW4 A;  4HBL A;  1XSX A;  4U0W A;  3ZQ7 A;  2VOP A;  3CO6 C;  2DTR A;  2PMH A;  4TV7 A;  1MDM A;  1O3Q A;  3GZ6 A;  1ZLJ A;  3E5U A;  2J5P A;  3ABU A;  2FU4 A;  3V8J A;  3KET A;  1IN7 A;  1ON1 A;  4O5V A;  2HWV A;  1MKM A;  4OMZ A;  4AVP A;  3J7A O;  3ZMZ A;  1G3Y A;  4EQQ A;  2VOO A;  5L3C A;  2QWW A;  1I6X A;  1FLI A;  1YS6 A;  2RV8 A;  2ELH A;  5HLG A;  2VC0 A;  2K27 A;  3RPQ A;  1KQ0 A;  3RDI A;  4MNU A;  4S04 A;  2V9V A;  2GZW A;  3BJO A;  1G6N A;  1FBS A;  3KEQ A;  2LKP A;  4HW0 A;  2IPQ X;  2H09 A;  1JHF A;  2HZT A;  2NAZ A;  3JAM Z;  1HKQ A;  2FOK A;  4L0Z B;  2Y0M A;  1YG2 A;  2O03 A;  4LGW A;  1KYZ A;  1PUE E;  1KU2 A;  1ZRF A;  4A0X A;  3HIF A;  1R1V A;  1R7J A;  4XBF A;  1GHC A;  1J9I A;  1JXS A;  1LDJ A;  4RB1 A;  1W7P B;  4FHT A;  4QWQ A;  1K79 A;  3ISP A;  4EVI A;  2A5Y B;  2K02 A;  1FBQ A;  3V8K A;  3T8T A;  1KQ9 A;  2YPR A;  4HF2 A;  2L4A A;  4PDK A;  3ZP5 A;  1A04 A;  3FZV A;  1FZP B;  3N4M A;  5ERI A;  4I7H A;  3V7S A;  5ILV A;  3HHG A;  1KA8 A;  1FNN A;  1I1G A;  4KIB A;  2H6B A;  3COA C;  1OKR A;  2QLZ A;  3E5X A;  1WSU A;  1NHA A;  1EH8 A;  2UZK A;  1RZ4 A;  1XGN A;  1S8N A;  1EV7 A;  1H9T A;  3OOP A;  4XSZ F;  3VFZ A;  3QOP A;  3TOA A;  5HVQ C;  4HX4 A;  3QU3 A;  4Q48 A;  2HTS A;  2HDC A;  3SZP A;  1FC3 A;  3QP6 A;  5BMZ A;  1P4A A;  4G94 A;  3BZ6 A;  2OU2 A;  2QZ8 A;  3K1M A;  2EFO A;  1ZRC A;  2F5E A;  1BM9 A;  4HYE A;  2VBW A;  3FF5 A;  1S29 A;  2BV6 A;  1TQM A;  1IN5 A;  1T39 A;  1RUO A;  2P8T A;  2NS0 A;  4XLN F;  3HRU A;  2DPU A;  5K5Q A;  3L7W A;  4K2E A;  1F5T A;  2HKO A;  1UHW A;  3MZH A;  4CXF A;  1DP7 P;  2W24 A;  1Z91 A;  2DU9 A;  2V79 A;  4M72 A;  1QGP A;  2QM3 A;  3CUO A;  5CLS A;  4EJV A;  5HOO A;  4WXD A;  5FB2 A;  5D8K B;  4IHS A;  1D3Y A;  4IJA A;  1KU7 A;  2L02 A;  1ZG5 A;  2FML A;  3F8C A;  2M8E A;  3BJ6 A;  5ED4 A;  1ODD A;  2F2E A;  1USS A;  3L2C A;  3MAJ A;  4LLL A;  2HYF A;  1KU9 A;  1FP2 A;  3ZMD A;  2G7H A;  1FT9 A;  3MQ0 A;  1EH7 A;  1CF7 A;  3E97 A;  4A6E A;  3WTY C;  1U5T A;  3BJA A;  2EB7 A;  4KMF A;  3GFI A;  2ZFW A;  2W25 A;  4L5I A;  4B8X A;  3P7N A;  5A2Q K;  2RVC A;  4G7H F;  4O3M A;  5D4R A;  4YFN F;  4U7B A;  2IW5 A;  5ILU A;  4I01 A;  5LHG A;  4H0E A;  1FWZ A;  4CO8 A;  2ADU A;  5D8L B;  4WF2 A;  1B1B A;  4BHB A;  5DCF A;  3GVA A;  3SXY A;  1YS7 A;  2EFP A;  2XGX A;  1UHM A;  4HAM A;  5D4S A;  5LRR A;  3KFW X;  2JT1 A;  3E6M A;  3M8E A;  3G3Z A;  2NYX A;  5E8G A;  4I02 A;  1G3S A;  2BEO A;  3C18 A;  4KN7 X;  1ZAR A;  2E1N A;  1BI2 A;  2Z5U A;  1TBX A;  1OPC A;  4LD5 A;  1E17 A;  3TQN A;  2ISY A;  1S7O A;  4RGS A;  4P5O A;  4ZZL A;  2BGC A;  3KP6 A;  1EH6 A;  3FMQ A;  3ZMT A;  1TW3 A;  5HS7 A;  1HST A;  4L18 B;  2M45 A;  4UVB A;  4EM2 A;  3NEU A;  3GZ5 A;  1HW5 A;  5EEG A;  3LST A;  1G3T A;  4R8H A;  2CWE A;  1Y0U A;  2GAU A;  1DDN A;  4Z2Y A;  3F8B A;  1U8R A;  4GYG A;  3IKT A;  2LNB A;  1MD0 A;  3WTV C;  4OIQ F;  1YO5 C;  2K86 A;  1JGS A;  1YQA A;  4IRH A;  3BP8 A;  2HYG D;  3WTS C;  4MQV A;  2KRF A;  3KP4 A;  4PCQ A;  2M1B A;  5LEJ A;  4I0B A;  2DK8 A;  3BY6 A;  4P96 A;  4HZF A;  1YLF A;  1L0O C;  5L3F A;  4OMY A;  5ICF A;  1TW2 A;  2ZKZ A;  2DK5 A;  2NNN A;  5KVR A;  2XAF A;  2COM A;  2F5F A;  4R79 A;  2L3D A;  1SD6 A;  4KUM A;  1K7A A;  3R4K A;  3LQQ A;  5LEK A;  3H3U A;  1OYW A;  2EFN A;  4N0B A;  3SFZ A;  4NB5 A;  2XKO A;  4S05 A;  2BE5 F;  2V1D A;  3D0S A;  4CGZ A;  3T8R A;  3GX4 X;  1GVJ A;  2HKX A;  3R60 A;  1ZLK A;  4CZZ A;  4UHT A;  5LLQ A;  4KMU X;  3VB2 A;  3O3K A;  5J8C A;  1B9N A;  1SFU A;  3SZT A;  3IKV A;  1PP8 F;  4UV9 A;  4ESB A;  3CUQ C;  5BPD A;  5H6Q A;  1BI0 A;  3F22 A;  1R22 A;  4EM0 B;  5JFR A;  4EMS A;  1IN8 A;  5FFZ A;  3DPL C;  3IRQ A;  2L01 A;  4Q4Z F;  3ABT A;  1BOA A;  4KIC A;  3KP3 A;  1FX7 A;  1UCR A;  4M9Z A;  3W6J B;  3C3W A;  4BH9 A;  3J81 K;  4KDP A;  4GO1 A;  5HDK A;  3M7G A;  2V1X A;  3ZMV A;  2VOD A;  3WOD F;  5HS8 A;  1LDD A;  5HLH A;  1UB9 A;  4U88 A;  5F1R A;  1R5G A;  2A07 F;  1J7K A;  1O7F A;  1MGT A;  1J2X A;  4CIC A;  1OYY A;  3KE2 A;  1LVA A;  2JTV A;  3WGH A;  3DKW A;  4ZYE A;  4Y13 A;  2P5K A;  4ENM A;  3WE3 A;  2AXL A;  2OQR A;  5TJJ A;  3WTW C;  4WCG A;  1XSD A;  2F5C A;  2P5L C;  2R3S A;  2UXN A;  2XAH A;  3I59 B;  4ZYD A;  5FLX K;  4P9U A;  4OIP F;  2HQR A;  1IAW A;  5D5W B;  2YX4 A;  2PQ8 A;  2EV0 A;  2HQN A;  5AIQ A;  5E20 A;  2OAZ A;  5HDN A;  1U6G A;  3LQR A;  5D5V B;  2NNY A;  2GA1 A;  2TDX A;  1O3S A;  4HX8 A;  2FSW A;  3IWF A;  3U1D A;  3DFG A;  2STT A;  1SD7 A;  1RNL A;  5CVJ A;  5ILS A;  2DFI A;  4B09 A;  3L09 A;  1IN4 A;  5BOX A;  2XAS A;  3CTA A;  3GFJ A;  1YIO A;  1ZRE A;  4Q47 A;  1YTY A;  1O7L A;  5FD5 A;  3IC7 A;  4ZZD A;  1B4A A;  1LJ9 A;  3GWZ A;  3WTZ A;  1ULY A;  2GQQ A;  5DCM B;  1IXC A;  3KZZ A;  2FA5 A;  3NQO A;  2PBI A;  2MLG A;  1XGM A;  5IT9 K;  3DF8 A;  5HLI A;  4HDU A;  5FD6 A;  4OIN F;  5DD4 A;  3DEU A;  4ESF A;  2PJP A;  1DUX C;  3KLN A;  1XGS A;  4UVA A;  2PI0 A;  2A68 F;  1Z7U A;  4M6Y A;  3HYI A;  2Z3Y A;  3ZN0 A;  3I0T A;  3P9I A;  3F8F A;  2CSO A;  3PQJ A;  1FYK A;  6PAX A;  1WKM A;  3HTU A;  3BPX A;  1TNT A;  4OIR F;  4D0P A;  3FHZ A;  2FRH A;  1B59 A;  5K5R A;  3LA3 A;  2MH2 A;  2ISZ A;  2KIF A;  3T1B A;  1X3U A;  3FM3 A;  1C0W A;  3B73 A;  4LLN A;  3MZY A;  2XRN A;  5J8F A;  5D6E A;  3JAM K;  2ZNY A;  4MTE A;  3GW2 A;  2O8X A;  2P5V A;  2Q8K A;  2ZME B;  2D1V A;  1IN6 A;  1W7P D;  4Q5S F;  5LHI A;  1SAX A;  1BI1 A;  4M9X A;  1BIA A;  1RI7 A;  2XRO A;  1FOK A;  5JHU A;  5CVI A;  2XKP A;  3RPU A;  2QYO A;  4EJU A;  2WC2 A;  4HA8 A;  4FX4 A;  3D5L A;  4HLX A;  4A6D A;  2K7L A;  3MWM A;  2PG4 A;  4EV0 A;  2E7W A;  3NRV A;  2H94 A;  2PMU A;  4M74 A;  4IRI A;  3FMS A;  2ZNZ A;  5E1X A;  1G4D A;  3KP2 A;  2LDU A;  2ETH A;  3F8M A;  2FBI A;  3ZMU A;  4U0V A;  2OZ6 A;  5HDG A;  4UNO A;  3LA7 A;  5CVR A;  5LGN A;  3DQV C;  4HQE A;  4LB5 A;  3E6C C;  4G8X A;  4AD9 A;  3DV8 A;  4JQF A;  2DAO A;  5E1Z B;  2L54 A;  3FXR A;  4I2O A;  1D8K A;  3K2Z A;  2OD5 A;  2DT5 A;  5A2Q Z;  3JTH A;  4JBA A;  2A6H F;  2J5O A;  3HRT A;  3VOD A;  2LF8 A;  1BIB A;  5DUI A;  4CHU A;  2MBF A;  4IXA A;  2QQB A;  1XMA A;  4IVN A;  1QQI A;  2Q0O A;  4HLY A;  2WTE A;  4LMY A;  4HX7 A;  3RKY A;  5D6F A;  3CO7 C;  3C1D A;  1TQI A;  4A0Y A;  4P9F A;  4KN4 X;  2FQ3 A;  4L9V A;  2CFX A;  2D2W A;  2M30 A;  4GGG A;  3SQN A;  2DQL A;  4ETS A;  3M8F A;  3WTT C;  4KIG A;  1ONV A;  4ESJ A;  1BC7 C;  5L3D A;  4LK0 F;  2P7C B;  1XN7 A;  4AIJ A;  3M9A A;  1HKS A;  1ZYR F;  2MD5 A;  4RGX A;  2V6C A;  4A0Z A;  3F23 A;  1O3R A;  4M6X A;  1D8J A;  1S6L A;  1MJB A;  2FNA A;  2EJR A;  2VE8 A;  4MGR A;  1LQ1 A;  2D1H A;  4RB0 A;  4A2U A;  4A5N A;  1UST A;  3HUG A;  2FF4 A;  4LG0 B;  2IA0 A;  1QNT A;  1IRF A;  4PGH A;  1S3J A;  2FMY A;  3EDP A;  2ZXJ A;  3MCZ A;  4LK1 F;  1T98 A;  5L3G A;  1W4M A;  4L9T A;  2QVO A;  2KIM A;  2CYY A;  2PN6 A;  3F6O A;  4L9N A;  2EFW A;  3DP7 A;  3O2P E;  2CW0 F;  3H3Z A;  1TLH B;  4WK8 F;  3K1P A;  3LFK A;  3TGN A;  4FX0 A;  1J59 A;  2WWY A;  2C6Y A;  5TRD A;  3KZY A;  5IT3 A;  3CLO A;  3MEX A;  4M71 A;  3ROU A;  1RUN A;  4CDG A;  3C7J A;  3CUQ B;  1J75 A;  1GXP A;  2DQR A;  4ENJ A;  4HOB A;  2CQK A;  4DNC A;  3LA2 A;  1QZY A;  2YR2 A;  4BHP A;  4RS8 A;  4KT5 C;  4KFC A;  2AS5 F;  3U2R A;  1QZZ A;  3TDU C;  1IXS B;  4WXH A;  5F6F A;  4A5M A;  5DCM A;  3KLO A;  2IVM A;  3HOT A;  3P9C A;  1DPR A;  1K6O A;  3F21 A;  4Y17 A;  2M87 A;  3IL2 A;  4DQ2 A;  3HRM A;  4U0Y A;  3FXQ A;  2A6E F;  1E2X A;  3K1N A;  5JR3 A;  5EEH A;  4I0A A;  1VTN C;  4XLP F;  1FP1 D;  3RJP A;  1V4R A;  2HTJ A;  1DPU A;  3J81 Z;  3E6B A;  2Z99 A;  1W7P A;  2JSC A;  4U7D A;  2P7V B;  4ZYG A;  1JHH A;  2XAQ A;  2DBB A;  3I4P A;  1ZN2 A;  4BNC A;  2HGC A;  4EJO A;  4XRF A;  3WU1 B;  1HXD A;  1B9M A;  2KIU A;  2X0L A;  3CDH A;  4L9J A;  4WX9 A;  2R7D A;  2XAG A;  2RN7 A;  1ZHF A;  2PFB A;  4EJW A;  3E6D A;  2F5D A;  3E3V A;  5JVT A;  2BBY A;  2OBP A;  2RGV A;  1FYL A;  2XIG A;  4EM1 A;  4HDV A;  3I64 A;  2KJC A;  1KGS A;  3ML6 A;  2FXA A;  1V3F A;  1FSE A;  1R58 A;  4MTD A;  4UXN A;  2ZME A;  3JSO A;  5AON A;  2Z33 A;  5FLX Z;  5K1Y A;  3QP5 A;  1U78 A;  3FWE A;  5H20 A;  3KP7 A;  1PDN C;  3J80 K;  3AAF A;  2FBH A;  1T6S A;  1I1S A;  3HTS B;  4RB3 C;  1R36 A;  4IRG A;  1U5T C;  2GA2 A;  4HF1 A;  3RYR A;  3V8L A;  1ZAO A;  1UFM A;  2VT3 A;  3IRR A;  3P9K A;  4KIF A;  4XSX F;  4QLC U;  3WTX C;  2EK5 A;  2Y75 A;  3FM5 A;  5L3B A;  1TNS A;  4BAY A;  2JZY A;  3GUD A;  3K9T A;  2O0Y A;  1TTY A;  1IRG A;  1HKT A;  2GIV A;  5E1W A;  4GXO A;  3I58 A;  4YG2 F;  4RB2 C;  2D45 A;  1D5V A;  4OU0 A;  4AWX B;  4G6D A;  2XAJ A;  3WGI A;  3I5U A;  4M9S A;  5FO5 A;  1K78 B;  1XDU A;  2DI3 A;  3SHF A;  1HW2 A;  2B0L A;  2RNJ A;  3JSP A;  2CGP A;  2GWR A;  5IT9 Z;  2G7U A;  3ZPL A;  2H6C A;  3QRF F;  1O3T A;  3HSE A;  3E5Q A;  5CJ9 A;  1KYW A;  2MLK A;  2XHK A;  1P6R A;  1P2F A;  1ZH5 A;  2QBY B;  1ZRD A;  1WWX A;  1SD5 A;  4MHG A;  2VBZ A;  2EV6 A;  1ZGA A;  5D5U B;  4PGG A;  1T0F A;  3R61 A;  3DPT A;  3ULQ B;  1QPM A;  4OIO F;  2FE3 A;  3H92 A;  5DYM A;  2IJL A;  4HV6 A;  4O6J A;  5DUK A;  1MJA A;  3WTU C;  1KQ8 A;  3WGG A;  1BBY A;  4WXC A;  4N9I A;  3R6S A;  1BN5 A;  3ZN1 A;  1YW7 A;  3BOQ A;  4UV8 A;  3O6B B;  3R0J A;  1J0R A;  2MC3 A;  1LEB A;  4CYD A;  1R5H A;  3QAH A;  3JTG A;  4G7O F;  2RC4 A;  1YW9 A;  1WRJ A;  1ZGJ A;  4I09 A;  5D5X B;  1L3L A;  3FXU A;  2VN2 A;  1LB2 A;  2LF7 A;  5CVU A;  1AOY A;  1IW7 F;  3G73 A;  3ECH A;  3RI4 A;  3KP5 A;  3GFL A;  1LDK B;  4EJT A;  2UXX A;  5K5O A;  3RKX A;  2RQP A;  1J5Y A;  4A12 A;  1Z6R A;  4RGR A;  5FGM A;  4LG0 A;  3VEP A;  1P92 A;  4RAY A;  2GXG A;  3REO A;  2CG4 A;  2EA4 A;  1R00 A;  1QBJ A;  2L4M A;  2Y48 A;  2E7X A;  2QEN A;  4AIK A;  1I27 A;  1REP C;  2X4H A;  3TO6 A;  3FMR A;  1P4W A;  5BS6 A;  2HOE A;  1HSJ A;  1U3E M;  5JI6 A;  2O6G E;  1H9G A;  1IF1 A;  1GXQ A;  1R1U A;  4UVC A;  1B6A A;  1U2W A;  4GYI A;  5E8I A;  2UWM A;  2XVC A;  4G6Q A;  2OQG A;  2QQ9 A;  2VXZ A;  1SFE A;  3GF2 A;  2BYV E;  3Q5F A;  4R1H A;  3CUQ A;  3TKY A;  1LNW A;  1P4X A;  3WE2 A;  2MH9 A;  4N9H A;  2P6T A;  1MZB A;  2FNP A;  5FFX A;  2YU3 A;  1Z1D A;  3RYP A;  5ICE A;  3EYY A;  4EGZ A;  3WU0 A;  2O3F A;  3T5X A;  1MDM B;  1S7A A;  3EUH A;  2P6S A;  4YFK F;  3I54 A;  3MFK A;  2V1U A;  1MJ9 A;  3LAJ A;  4E70 A;  3V7R A;  3VOE A;  4IF4 A;  1LEA A;  2IT0 A;  2E1C A;  1T38 A;  2YX7 A;  3DXJ F;  4IHT A;  4L0Y B;  4JK1 X;  3ZMS A;  1YW8 A;  3HHH A;  4BQA A;  1T2K A;  3S2W A;  1F4K A;  2KJB A;  1W5T A;  3EYI A;  1XDS A;  4EGY A;  1JE8 A;  2VC1 A;  1PP7 U;  2VBY A;  5L3E A;  5LRS A;  4RGU A;  1AWC A;  4OOI A;  3L00 A;  1HW1 A;  2PEX A;  1YYV A;  3PFI A;  1XCB A;  3TO7 A;  1QO0 D;  2QUF A;  4WWC A;  3B02 A;  3ERE D;  4ASN A;  3BDD A;  4ENN A;  3N97 A;  4BHC A;  2G9W A;  2IA1 A;  3BWG A;  2VE9 A;  3TOB A;  2HEO A;  4LJZ F;  5E18 F;  5F64 A;  3R0A A;  1XSV A;  1SD4 A;  2GXB A;  2W85 A;  4GCV A;  4BXU A;  1YFH A;  4ZYH A;  2ACJ A;  2P4W A;  2VT2 A;  4YII A;  1STZ A;  4IPA A;  1SMT A;  2VBX A;  4L5J A;  4MEY F;  3ELK A;  1Z9C A;  3ECO A;  5ICC A;  2VON A;  2ESN A;  1SFX A;  3BRO A;  4NHJ A;  3L9F A;  3OV8 A;  1Q1H A;  2KKO A;  3I59 A;  1RIO H;  1HQC A;  5H6R A;  1TQP A;  1O57 A;  2K4J A;  3F6V A;  1W5S A;  2QQA A;  1XCV A;  2HS5 A;  4UUV A;  2IP2 A;  2H27 A;  1FY7 A;  2WV0 A;  4FT8 A;  1R1T A;  1G3W A;  1XD7 A;  2ZCW A;  4MEX F;  3U9G A;  2R7F A;  5DDG A;  1FSH A;  1XB4 A;  1K78 A;  3LWF A;  1OMI A;  5LGU A;  2DPD A;  2ZO4 A;  3IWZ A;  1IUY A;  4I98 B;  3KCC A;  2IA2 A;  4PZJ A;  2PLY A;  3EQL F;  3K0L A;  3TDZ C;  3F8N A;  4LB6 B;  4M73 A;  3RIR A;  2A3S A;  2QBY A;  3IHU A;  4ENK A;  5KK1 A;  5DD8 A;  1IZ1 A;  4YFX F;  3K69 A;  5J6X A;  2OA4 A;  1R23 A;  3CJN A;  4HQM A;  1OR7 A;  2DO7 A;  4NQW A;  4AIH A;  2RKH A;  1ZG1 A;  2LSO A;  1HBX G;  4KYW A;  3BPV A;  5CVV A;  1WI9 A;  4MQ9 F;  3Q9S A;  1F9N A;  2M5W A;  1I5Z A;  2EFQ A;  3LAP A;  3W6K B;  2A61 A;  2OZU A;  2STW A;  3I71 A;  2EWN A;  2ESH A;  2MA3 A;  1ZG3 A;  1Z05 A;  3HOS A;  5LGT A;  1IXR C;  2Q2E A;  1CF7 B;  2EA2 A;  3QU6 A;  3RKW A;  5BQT A;  2W57 A;  4ON0 A;  3Q9V A;  2HR3 A;  2JPC A;  3F3X A;  3V7C A;  2W84 A;  3GO5 A;  1U5T B;  5HS9 A;  2O61 A;  3EET A;  3FX3 A;  4YIF A;  2JPB A;  5DV5 A;  1CGP A;  3JW4 A;  3J80 Z;  1FBU A;  2XUB A; 
#chains in the Genus database with same CATH topology
 2DA6 A;  4BY7 J;  3QPH A;  3B6A A;  1IV6 A;  2XB0 X;  1OCT C;  4KA4 A;  3I53 A;  5A2Q R;  2A69 F;  2COB A;  4RAZ A;  4ZJZ A;  2R0Q C;  2HOT A;  3S2H J;  2HXI A;  3HRS A;  3KEO A;  4ZH4 F;  1Z6T A;  4BYY A;  3V4G A;  2XV4 S;  2NRA C;  2R7U A;  3K7A J;  3GEZ A;  3K70 C;  5DEQ A;  1XMK A;  4G7Z F;  4IKF A;  3K4M A;  2I8D A;  3WG9 A;  1ZR2 A;  3OS0 A;  2CO5 A;  4PSX A;  4P55 A;  3EUH C;  1OYI A;  3QPT A;  4GDF A;  2FEZ A;  1QU3 A;  4HF0 A;  3PQK A;  5LHH A;  3T0Y A;  2JA7 J;  3GLX A;  1KZH A;  4ZTJ A;  3GTG J;  2EV5 A;  5J4Y A;  1H0M A;  5ICG A;  3HSF A;  1A6I A;  5E79 C;  3FKI J;  2LK2 A;  2F4I A;  2JRT A;  4Y15 A;  1OCO H;  3CJR B;  2JQ7 A;  4CCL A;  2DMN A;  5E17 F;  1WZ2 A;  1FEX A;  4XMY A;  2FBK A;  3TO9 A;  1IDY A;  5IP6 A;  4HST A;  1YX3 A;  5DS9 A;  1F1Z A;  4KNY A;  4XN3 A;  5BPI A;  1BC8 C;  3QYF A;  2HFH A;  1I39 A;  2DLL A;  5CYV A;  4AUX A;  4M3B A;  1Z3Y A;  5F0C A;  4FAS D;  1SVM A;  4XLE A;  1KU3 A;  5AIP A;  2Z9O A;  3DBH B;  4B3A A;  2RDP A;  2LTP A;  2DMT A;  4G9Y A;  5LBQ A;  2EPF A;  3CES A;  3F72 A;  4FE7 A;  1SFK A;  2HVQ A;  3Q3S A;  4IZZ A;  1BJA A;  2ICW G;  3Q0U A;  1XGO A;  2HZD A;  1FPQ A;  2KMU A;  2YSR A;  1SMY F;  1FYM A;  3GFM A;  4F92 B;  2EZI A;  3OYD A;  3A01 B;  2ZBK A;  4LFU A;  1WQ2 A;  4I99 C;  1B8I B;  4NDL A;  1FIP A;  1ON2 A;  1BI3 A;  3PUF A;  4LLG F;  3GXO A;  3ABK H;  4F7Z A;  4BQO A;  3FDY A;  1BW5 A;  1ACI A;  2DT6 A;  4HV5 A;  3S14 J;  3JRC A;  3M1C A;  1BJZ A;  4DBQ A;  3HSR A;  1WJC A;  3M1E A;  2IRF G;  3ZR8 X;  3GYH X;  3CC7 I;  1HLV A;  2ZJ2 A;  2K4B A;  5EDN A;  2OJE D;  3RTR A;  2DW4 A;  4LIT A;  4HBL A;  2HNH A;  3HM5 A;  1XSX A;  3OMY A;  4U0W A;  3HOU J;  3TED A;  4J01 A;  5BNG A;  3ZQ7 A;  3HOV J;  2VOP A;  3CO6 C;  4V19 K;  2P0T A;  3F0C A;  3I4M J;  2DTR A;  2PMH A;  5M3M J;  2E2J J;  3F9K A;  4TV7 A;  3OYA A;  4A3J J;  1O3Q A;  1MDM A;  4XID A;  5GPA A;  3FBI B;  3GZ6 A;  2L7M P;  2BW3 A;  3KYD B;  2Y2Z A;  4C30 A;  1ZLJ A;  2QGU A;  2QSF X;  3DTE A;  1WGX A;  2J5P A;  2LYC A;  3E5U A;  3ABU A;  2FU4 A;  3V8J A;  3KET A;  1IN7 A;  1WH7 A;  1VQ9 I;  1ON1 A;  4O5V A;  3DLL F;  2HQA A;  3MKL A;  2HXO A;  5DTD A;  2HWV A;  3CCQ I;  1MKM A;  2X1D A;  4OMZ A;  4AVP A;  3J7A O;  3ZMZ A;  1G3Y A;  4EQQ A;  2VOO A;  5L3C A;  2E60 A;  1HDP A;  2VKV A;  1X1A A;  2QWW A;  3G71 I;  1I6H J;  1I6X A;  4I76 A;  3OY9 A;  2JVG A;  4UB8 C;  1DGW Y;  1FLI A;  1YS6 A;  2RV8 A;  3RQI A;  2ELH A;  5HLG A;  2VC0 A;  2JVH A;  2K27 A;  3HGG A;  3RPQ A;  1KQ0 A;  3IAM 2;  3RDI A;  4MNU A;  3SZG A;  3H35 A;  4S04 A;  2V9V A;  1YHQ I;  2GZW A;  3CD6 I;  2VB6 A;  1WPK A;  4A3G J;  4UY8 I;  3BJO A;  1RQ6 A;  2CV2 A;  1G6N A;  1DGR M;  1DQU A;  4NBQ A;  2E1M B;  4Y3O A;  1E3O C;  2KP6 A;  1FBS A;  3KEQ A;  2LKP A;  4ZYA A;  4HW0 A;  2IPQ X;  2H09 A;  1JHF A;  2HZT A;  2NAZ A;  2NVU B;  3JAM Z;  1HKQ A;  3G1L A;  4YRV A;  2FOK A;  4L0Z B;  2JRM A;  4DZP A;  2HOS A;  2Y0M A;  1YG2 A;  2O03 A;  4LGW A;  4PUS A;  3RKQ A;  3LSR A;  2VIX A;  5EG0 B;  1KYZ A;  3C2B A;  1PUE E;  1XC5 A;  1QVU A;  1P7J A;  2YUS A;  3ZCO A;  1KU2 A;  1ZRF A;  4A0X A;  4BJ5 C;  2CUZ A;  2XF5 A;  3HIF A;  1R1V A;  1R7J A;  2CRG A;  4XBF A;  1GHC A;  2D5V A;  1J9I A;  1VQ6 I;  2EIL H;  1JXS A;  4AC0 A;  3TBI A;  2LH9 A;  2LD5 A;  1LDJ A;  2ZSI B;  3BR5 A;  4RB1 A;  1MMG A;  1WJ5 A;  2XAU A;  1W7P B;  2VJ5 A;  3QYB A;  4FHT A;  4QWQ A;  2KDO A;  4YIR X;  1K79 A;  2OTJ I;  3L2R A;  3H0G J;  3ISP A;  3ABM H;  5KAF C;  1IUF A;  2RNG A;  4EVI A;  2A5Y B;  3C2H A;  3OYE A;  2K02 A;  1FBQ A;  3V8K A;  2EBI A;  2OCC H;  3T8T A;  1KQ9 A;  2YPR A;  1AA7 A;  1FOW A;  4HF2 A;  2L4A A;  1OR7 C;  4PDK A;  3ZP5 A;  1A04 A;  3FZV A;  1FZP B;  5M3F J;  2LC2 A;  5FJ8 J;  3N4M A;  5ERI A;  2Y9Z A;  2LY1 A;  1YRN A;  4I7H A;  3V7S A;  5ILV A;  4BJ6 C;  3A52 A;  1FTZ A;  1N25 A;  1HDD C;  5HLT A;  3HHG A;  5K7Z A;  1KA8 A;  5E3L A;  3QPL A;  1FNN A;  1I1G A;  1JTX A;  4KIB A;  2H6B A;  5FKO A;  3VSL A;  3COA C;  1OKR A;  2QLZ A;  3E5X A;  1WSU A;  3H0D A;  1NHA A;  2DTZ A;  1BW6 A;  1EH8 A;  2UZK A;  1RZ4 A;  1XGN A;  1S8N A;  3RZD J;  1EV7 A;  1TWC J;  1H9T A;  3OOP A;  1X19 A;  4XSZ F;  3VFZ A;  3QOP A;  4E7H A;  1DP3 A;  3TOA A;  3CQZ J;  5HVQ C;  4HX4 A;  3QU3 A;  3KEY A;  4Q48 A;  2HTS A;  2HDC A;  3FBN B;  3SZP A;  4E6K G;  2ZJQ F;  4AID A;  1FC3 A;  3QP6 A;  4N4O B;  5BMZ A;  1P4A A;  4G94 A;  3BZ6 A;  3J80 R;  1E3H A;  2OU2 A;  3Q0V A;  3W6V A;  1UG0 A;  2E71 A;  3JRG A;  4BQQ A;  2QZ8 A;  1Z77 A;  3K1M A;  2EFO A;  1ZRC A;  2F5E A;  1BM9 A;  4HYE A;  2VBW A;  4B4C A;  2DXI A;  4BXX J;  2AXT C;  1V5F A;  2EZK A;  2UUZ A;  1U9O A;  2L2O A;  3FF5 A;  1VND A;  1GV5 A;  1S29 A;  2BV6 A;  3NAU A;  1TQM A;  2CFO A;  1IN5 A;  1T39 A;  1RUO A;  2P8T A;  2NS0 A;  4XLN F;  3MVP A;  3CJQ B;  3HRU A;  2DMU A;  1RKW A;  2DPU A;  2MVT A;  5K5Q A;  1WJD A;  3L7W A;  4K2E A;  1F5T A;  1Y56 A;  2HKO A;  1JUS A;  1UHW A;  4HSR A;  4CXF A;  3MZH A;  1DP7 P;  2W24 A;  1VQM I;  1MBF A;  4C9Y A;  4YEJ A;  4XKW A;  4C3I J;  4RMN A;  1Z91 A;  2DU9 A;  2V79 A;  1JKP C;  4M72 A;  2V9P A;  4OAY A;  1TC3 C;  2PMZ A;  1QGP A;  2QM3 A;  4XOT A;  2ZME C;  3CUO A;  4AU7 A;  5CLS A;  4EJV A;  1U8B A;  3G1M A;  5HOO A;  2DFF A;  4WXD A;  5FB2 A;  5D8K B;  4IHS A;  1D3Y A;  3BG6 A;  1Z7L A;  4IJA A;  3S8P A;  1KU7 A;  2L02 A;  2RQQ A;  1IRZ A;  3DKX A;  4FE4 A;  3JRD A;  1HA8 A;  1ZG5 A;  2FML A;  3F8C A;  2XPU A;  2VL8 A;  3EUA A;  2M8E A;  3BJ6 A;  5ED4 A;  1ODD A;  2F2E A;  1USS A;  3L2C A;  3PIO F;  3DTK A;  3K4L A;  2ME0 A;  2MD0 A;  3MAJ A;  2KLO A;  4LLL A;  2HYF A;  2WA0 A;  1KU9 A;  1FP2 A;  3S93 A;  3ZMD A;  1S5L C;  3VYU B;  4XKV A;  2ZC2 A;  2G7H A;  2P0W A;  1MNM C;  2LG4 A;  1UEL B;  4F93 B;  1FT9 A;  4N4N B;  3MQ0 A;  1EH7 A;  4C3H J;  3HOY J;  3AL0 B;  3CME I;  1CF7 A;  1D1B A;  3E97 A;  4A6E A;  2JWT A;  2R5Y B;  3WTY C;  1U5T A;  3BJA A;  3NAR A;  1VF9 A;  2IS1 A;  2EB7 A;  4KMF A;  3GFI A;  2ZFW A;  1NH3 A;  2W25 A;  3IUO A;  4L5I A;  2L5Q A;  4B8X A;  3OS1 A;  3P7N A;  3HOW J;  1I3Q J;  5FLM J;  2H8R A;  3LL7 A;  5A2Q K;  4XRS G;  5IT9 R;  4A3F J;  2RVC A;  4G7H F;  3BT9 A;  4O3M A;  5D4R A;  4YFN F;  4U7B A;  4AYB A;  3S1R J;  5CQG A;  2IW5 A;  1LKX A;  2I5U A;  1T08 B;  5ILU A;  3OR2 C;  4I01 A;  3PJR A;  2F4M B;  5LHG A;  4H0E A;  1FWZ A;  4CO8 A;  2ADU A;  5D8L B;  4WF2 A;  1B1B A;  4BHB A;  3OOU A;  3GCM A;  4E7J A;  5DCF A;  3GVA A;  3SXY A;  1YS7 A;  4XL9 A;  3AKZ A;  2EFP A;  2DFH A;  4A3I J;  3P5J A;  4L5E A;  2XGX A;  2E5N A;  4D9J A;  1UHM A;  2CU7 A;  4ITV A;  3LSM A;  4BQN A;  1A31 A;  4HAM A;  5D4S A;  5LRR A;  1ETV A;  3KFW X;  3IH4 A;  2JT1 A;  3E6M A;  4M3G A;  3M8E A;  4XOP A;  3G3Z A;  2NYX A;  2VI6 A;  5E8G A;  4I02 A;  4XIC A;  2IGN A;  4E4H A;  1MMS A;  1YIT I;  3S1N J;  1G3S A;  2BEO A;  3C18 A;  4KN7 X;  4BUP A;  1ZAR A;  2E1N A;  1BI2 A;  3BG9 A;  2Z5U A;  1TBX A;  1UHS A;  1OPC A;  5GAE J;  4LD5 A;  5B1B H;  1E17 A;  1W0U A;  1FIA A;  2WAD A;  3TQN A;  2ISY A;  4BY1 J;  1S7O A;  4RGS A;  1Y39 A;  2BXY A;  4P5O A;  5DM7 F;  4ZZL A;  2BGC A;  4LOC A;  3KP6 A;  1EH6 A;  3JAM R;  3FMQ A;  1P7I A;  3ZMT A;  4BEH B;  4U87 A;  1TW3 A;  5HS7 A;  4IHV A;  1HST A;  4L18 B;  2M45 A;  4UVB A;  1NTC A;  2O7O A;  4EM2 A;  3AG4 H;  3NEU A;  4XM3 A;  3A01 A;  4II3 A;  2K40 A;  3GZ5 A;  4CCK A;  1B8I A;  1HW5 A;  3A0B C;  2JK3 A;  3LST A;  5EEG A;  1G3T A;  1MMN A;  4R8H A;  1VQ8 I;  1QVT A;  3CZ6 A;  3QOD A;  1UZC A;  2QF7 A;  2GIZ A;  2CWE A;  1Y0U A;  2GAU A;  1LPQ A;  1DDN A;  4Z2Y A;  5GAH J;  1HC8 A;  3F8B A;  5F04 A;  1U8R A;  4B1R A;  1H88 C;  4E7S A;  3BR1 A;  4GYG A;  2R7X A;  1T8I A;  1XS9 A;  3IKT A;  2LNB A;  5H2F C;  1MBG A;  2FJ1 A;  3ESW B;  1MD0 A;  2DOA A;  3WTV C;  4OIQ F;  3JRI A;  2XGD A;  1YO5 C;  3IAS 2;  2K86 A;  1JGS A;  1F43 A;  1YQA A;  2I10 A;  4IRH A;  3BP8 A;  2HYG D;  1FOY A;  1MH3 A;  2PJR B;  3OYB A;  2QKL B;  3WTS C;  5GP9 A;  4MQV A;  2W4S A;  4MFD A;  2KRF A;  3KP4 A;  4PCQ A;  4Y7N J;  1YJ9 I;  2M1B A;  2ZXI A;  3S3N A;  5LEJ A;  4I0B A;  1APL C;  4IHW A;  2DK8 A;  2ZJR F;  3CCJ I;  2E5Z A;  3BY6 A;  1Y8Q B;  4P96 A;  3OYH A;  1PJR A;  1NK3 P;  2KQR A;  1W36 D;  3DPU A;  1F36 A;  4HZF A;  1YLF A;  1L0O C;  2XGC A;  3KYC B;  2R7R A;  4XN0 A;  5L3F A;  4OMY A;  3J7A Y;  2DMQ A;  2XF6 A;  5ICF A;  4H4K C;  1W0T A;  1TW2 A;  3TP3 A;  4IOC F;  2ZKZ A;  2DK5 A;  2NNN A;  2GOX B;  5KVR A;  2XAF A;  4FTH A;  2COM A;  2F5F A;  1R4M B;  1N75 A;  1TT0 A;  2K9M A;  3ZQQ A;  4R79 A;  2L3D A;  2E34 A;  3NWS A;  1VZ0 A;  1SD6 A;  2JA5 J;  4KUM A;  1VQ4 I;  1K7A A;  2EIK H;  3R4K A;  4FET A;  2X1E A;  4CH7 A;  2BOL A;  1UMQ A;  3LQQ A;  5LEK A;  3M3Y J;  1ZGW A;  3H3U A;  2OCE A;  4HNT A;  1FTT A;  1OYW A;  2EFN A;  4N0B A;  3SFZ A;  4NB5 A;  2MGQ A;  2XKO A;  4S05 A;  2BE5 F;  2V1D A;  3D0S A;  3H9G A;  4CGZ A;  3T8R A;  1R71 A;  3GX4 X;  1GVJ A;  4PJ0 C;  3U21 A;  2HKX A;  5EG0 A;  3R60 A;  3CCR I;  3QOE A;  4HRI A;  1ZLK A;  3A0H C;  4CZZ A;  3E1S A;  4AM3 A;  2BY2 A;  1K83 J;  4NC8 A;  5B5E C;  1EA3 A;  4UHT A;  5LLQ A;  1PUF B;  4KMU X;  5E3N A;  4A3M J;  3VB2 A;  3O3K A;  5J8C A;  1IG7 A;  1B9N A;  1I50 J;  1SFU A;  3SZT A;  3IKV A;  1PP8 F;  4UV9 A;  2ELJ A;  4ESB A;  2KZV A;  3CUQ C;  5BPD A;  2O5R A;  5H6Q A;  1Z67 A;  2KRC A;  2N8G A;  1BI0 A;  4ANJ A;  4DOZ A;  2XPV A;  3F22 A;  1R22 A;  5IPA A;  1Y6I A;  2HPI A;  4EM0 B;  4PJL A;  2M4G A;  5JFR A;  4EMS A;  1IN8 A;  2L0K A;  4P1W A;  5FFZ A;  2VXD A;  3DPL C;  5C3E J;  3IRQ A;  2L01 A;  4XLF A;  2VQG A;  3BZC A;  4Q4Z F;  3ABT A;  1BOA A;  2AHQ A;  3OL3 A;  2PMZ N;  1X3Z B;  3HKZ A;  2JUC A;  2VKH A;  5EF6 A;  4KIC A;  3KP3 A;  1FX7 A;  2L7K A;  2F6C A;  3MMY B;  5EGO B;  4UB6 C;  1UCR A;  5FKL A;  4D7N A;  4M9Z A;  3OYN A;  4GFB A;  3RZO J;  2L7F P;  3HC7 A;  3W6J B;  2QSH X;  3C3W A;  5HOD A;  4XKB A;  2JSP A;  4BBR J;  4BH9 A;  4RAG A;  1AKH B;  3J81 K;  4KDP A;  4GO1 A;  5HDK A;  2M7B A;  3NWT A;  3M7G A;  2CQN A;  1MND A;  2V26 A;  2WAF A;  2V1X A;  2WAE A;  3ZMV A;  2VOD A;  1V5G A;  3WOD F;  5HS8 A;  4DJA A;  1LDD A;  2NOJ B;  1FOX A;  5HLH A;  1UB9 A;  1Z3X A;  1T95 A;  3FIW A;  4DYQ A;  4U88 A;  5F1R A;  4HNU A;  1R5G A;  2EIM H;  1J7K A;  2A07 F;  2R5Z A;  1O7F A;  4Y52 J;  1MGT A;  1J2X A;  4CIC A;  3CCM I;  1OYY A;  1D1C A;  3KE2 A;  1LVA A;  1S7E A;  2LVS A;  5J4V A;  2JTV A;  3HUG B;  5HNF A;  1WJA A;  2Q1Z B;  3WGH A;  3RSN A;  3L1P A;  3DKW A;  4ZYE A;  1LE8 A;  4Y13 A;  2P5K A;  2B9S A;  1ZTR A;  1ZQ3 P;  4ENM A;  3WE3 A;  2AXL A;  2ZXH A;  3LSG A;  2OQR A;  1VFC A;  5TJJ A;  3H1C A;  3WTW C;  4WCG A;  2CUF A;  4XKC A;  1NG7 A;  3GTQ J;  1XSD A;  3ZOB A;  1DU6 A;  2F5C A;  3SJM A;  3LSI A;  2P5L C;  2R3S A;  2UXN A;  5F27 A;  2XAH A;  3I59 B;  4ZYD A;  5FLX K;  2X6Y A;  4P9U A;  1MBK A;  4OIP F;  4AYB N;  2HQR A;  1GLN A;  1IAW A;  3LSJ A;  1OCZ H;  5EJC A;  5D5W B;  2YX4 A;  2PQ8 A;  3W2V A;  2EV0 A;  2HQN A;  2V7F A;  3A03 A;  2IS4 A;  5AIQ A;  5E20 A;  4UUS B;  2BXZ A;  2B7E A;  2OAZ A;  5HDN A;  2QCO A;  3FXO A;  4BU2 A;  1U6G A;  2VPR A;  3W3C A;  2R92 J;  3LQR A;  3L2W A;  3ONQ A;  2HQ5 A;  5D5V B;  2NNY A;  3G1O A;  1X2N A;  2GA1 A;  2TDX A;  3O8G A;  1O3S A;  4HX8 A;  1HF0 A;  4F52 A;  3S15 J;  2FSW A;  3IWF A;  1JKO C;  3U1D A;  3DFG A;  5F1J A;  4NUB A;  2LBF B;  2V4J C;  3TW6 A;  1O4X A;  2STT A;  2TRT A;  1SD7 A;  2X6X A;  3BQZ A;  1IJW C;  3VWB A;  1RNL A;  4F3Q A;  3ASN H;  5CVJ A;  5ILS A;  2DFI A;  2Y0S A;  4DIQ A;  4B09 A;  3L09 A;  1IN4 A;  2EZH A;  5BOX A;  1K6Y A;  1S72 I;  2IS2 A;  2XAS A;  3CTA A;  3GFJ A;  1YIO A;  1ZRE A;  4Q47 A;  4BKX A;  1YTY A;  1EKE A;  1O7L A;  2K9Q A;  3LSH A;  3IC7 A;  5FD5 A;  4E7Z A;  2KFD A;  4ZZD A;  2BHY A;  4J00 A;  1B4A A;  3OYM A;  2YS9 A;  1ETX A;  1LJ9 A;  3GWZ A;  1MNE A;  3Q0W A;  1MMD A;  1WJB A;  3PL8 A;  1J09 A;  3WTZ A;  4BL0 B;  2IS6 A;  1ULY A;  2GQQ A;  5DCM B;  1IXC A;  4RDU A;  1R9T J;  2M2E A;  3KZZ A;  2FA5 A;  3NQO A;  2PBI A;  2MLG A;  1E3P A;  2CQX A;  3E7L A;  2LP0 A;  4JX6 A;  1XGM A;  5IT9 K;  3DF8 A;  5HLI A;  5J1U A;  5FD6 A;  4HDU A;  4OIN F;  5DD4 A;  3DEU A;  2EZL A;  2X9D A;  4ESF A;  2PJP A;  4KJZ A;  1DUX C;  3OS2 A;  3CF2 A;  1LFB A;  1XG1 A;  3KLN A;  3ZQG A;  1XGS A;  4UVA A;  1EF4 A;  2PI0 A;  2A68 F;  2BVM A;  3SDB A;  1Z7U A;  4M6Y A;  3HYI A;  2Z3Y A;  3ZN0 A;  3GTO J;  2EIN H;  3I0T A;  3P9I A;  3F8F A;  2CSO A;  1VQO I;  3PQJ A;  1FYK A;  4IOA F;  1X4O A;  6PAX A;  1WKM A;  2WB1 N;  3HTU A;  3BPX A;  1TNT A;  4OIR F;  3AG3 H;  5JHF A;  3GTK J;  4D0P A;  2E2I J;  1M1E B;  2NXN B;  4RM3 A;  5M5Y J;  3FHZ A;  2FRH A;  2IBD A;  1B59 A;  3JR9 A;  5K5R A;  3CC4 I;  1VI0 A;  1JUP A;  1SC7 A;  3LA3 A;  2MH2 A;  2ISZ A;  4PFO A;  2KIF A;  4DYC A;  3T1B A;  3V42 A;  1X3U A;  4MO7 A;  4FIS A;  3FM3 A;  1JI8 A;  3BQY A;  1C0W A;  3B73 A;  3TP0 A;  4LLN A;  3MZY A;  3G2B A;  2XRN A;  2BHZ A;  5J8F A;  2QQ8 A;  5D6E A;  3JAM K;  1UG2 A;  4NC6 A;  2ZNY A;  4MTE A;  3GW2 A;  2O8X A;  2P5V A;  2Q8K A;  2R7Z J;  3VYT B;  1Y8R B;  2WAQ A;  2ZME B;  2D1V A;  1IN6 A;  1W7P D;  2DA1 A;  1YX5 A;  4QSH A;  1IDZ A;  4Q5S F;  5LHI A;  3S1M J;  1SAX A;  1BI1 A;  2E1M C;  2CV0 A;  4M9X A;  1G59 A;  1BIA A;  2BVL A;  3HPH A;  1RI7 A;  2XRO A;  1FOK A;  4BS9 A;  1ETK A;  5JHU A;  5CVI A;  3OYG A;  1AU7 A;  2XSJ C;  2FQ4 A;  1ETQ A;  2XKP A;  3RPU A;  2QYO A;  4EJU A;  2WC2 A;  4HA8 A;  4FX4 A;  2EH3 A;  1MIJ A;  3D5L A;  1GDT A;  4HLX A;  4A6D A;  2K7L A;  2X6O A;  3MKW B;  3MWM A;  3FKJ A;  2PG4 A;  4EV0 A;  4A3B J;  1QZE A;  2E7W A;  2JA2 A;  3K4K A;  2XSD C;  2A5W A;  1VQK I;  3BTC A;  2PJR A;  1UAA A;  1ITY A;  3OYL A;  3NRV A;  1RR7 A;  5TIS C;  5IYB J;  3KPH A;  3JRE A;  2H94 A;  2PMU A;  4M74 A;  4IRI A;  1MW7 A;  2LKX A;  3CCV I;  3FMS A;  3DU6 A;  2ZNZ A;  3CJT B;  5DM6 F;  5E1X A;  1G4D A;  2LDU A;  2ETH A;  3KP2 A;  3F8M A;  2FBI A;  1JKQ C;  3ZMU A;  4U0V A;  2OZ6 A;  4DGW B;  4BBS J;  1OCR H;  2F48 A;  2ELK A;  5HDG A;  4UNO A;  3HKZ N;  3LA7 A;  2HDD A;  5CVR A;  3JCU C;  4XON A;  5LGN A;  3DQV C;  4HQE A;  4LB5 A;  4IQJ A;  3E6C C;  1K4T A;  2VQC A;  1WCM J;  4G8X A;  4AD9 A;  3DV8 A;  2ECB A;  3BCB A;  3BTL A;  5GAG J;  3G6E I;  2HVR A;  4KIT B;  2CUJ A;  2IGM A;  3CDI A;  4JQF A;  4II2 A;  2DAO A;  2E35 A;  5E1Z B;  3JRF A;  2L54 A;  1YJN I;  2A05 A;  3FXR A;  4I2O A;  1D8K A;  2L9V A;  3H5R A;  2HOA A;  3K2Z A;  4XLA A;  2OD5 A;  3CP2 A;  2DT5 A;  4MIM A;  5A2Q Z;  3JTH A;  4JBA A;  5C4J J;  2A6H F;  4A3L J;  2J5O A;  3HRT A;  3VOD A;  3ZQF A;  3TL4 X;  4D5C A;  1IGN A;  2DCE A;  2LF8 A;  2LY2 A;  1BIB A;  4KT6 A;  5DUI A;  4CHU A;  4PK4 A;  2MBF A;  4IXA A;  2DA4 A;  2QQB A;  3J7A W;  1XMA A;  1TT5 B;  4IVN A;  3D1N I;  2F5V A;  1QQI A;  2H8W A;  2WY8 Q;  2KRH A;  3EUK L;  1Y1V J;  3I55 I;  2R7S A;  2X48 A;  2Q0O A;  4HLY A;  2WTE A;  4LMY A;  2XF7 A;  2JA6 J;  3SEZ A;  3OR1 C;  4HX7 A;  3LNQ A;  3WU2 C;  2BY1 A;  3RKY A;  3LMM A;  5D6F A;  3CO7 C;  1TL8 A;  4LIV A;  1JUM A;  1MBJ A;  3C1D A;  1TQI A;  1SVL A;  3HB9 A;  4P9F A;  4A0Y A;  1VQL I;  4KN4 X;  1MBH A;  2FQ3 A;  4L9V A;  2CFX A;  5K7F A;  2D2W A;  3PO2 J;  2M30 A;  4GGG A;  3SQN A;  2DQL A;  4A3D J;  4ETS A;  3OSF A;  1TWH J;  1A35 A;  3M4O J;  3M8F A;  3WTT C;  1WFX A;  5J40 A;  4KIG A;  2W7N A;  3JRH A;  1ONV A;  1NK2 P;  4ESJ A;  1BC7 C;  4RA2 A;  5F0H A;  4M6V A;  5L3D A;  3S1Q J;  4B43 A;  2Z16 A;  4LK0 F;  5HNH A;  2ZFU A;  4BDY A;  1H8A C;  1LUJ B;  2P7C B;  2LR8 A;  1XN7 A;  4BE2 A;  2M34 A;  5EGO A;  3FK6 A;  4AIJ A;  3M9A A;  3SEQ A;  2R7T A;  4KIS A;  1HKS A;  1ZYR F;  4NC7 A;  1AKH A;  2MD5 A;  4RGX A;  2V6C A;  4V2G A;  4A0Z A;  3F23 A;  3KZI C;  4PSW A;  1O3R A;  3DLA A;  4C3J J;  2HI3 A;  4M6X A;  1D8J A;  1S6L A;  4E7L A;  1MJB A;  2RAE A;  5CKT A;  1YJW I;  1MSE C;  2Y0S N;  2FNA A;  2EJR A;  1R49 A;  2K5C A;  2H1K A;  3L2Q A;  3S3O A;  2VE8 A;  4GRI A;  1E0E A;  4MGR A;  1LQ1 A;  3K4N A;  2D1H A;  4RB0 A;  4A2U A;  4B47 A;  1WI3 A;  4A5N A;  5JVG F;  1UST A;  2MZ4 A;  4OWR B;  3HUG A;  3HL2 A;  4E7K A;  2FF4 A;  2MSY A;  4LG0 B;  4CCM A;  1D0X A;  4BE0 A;  2IA0 A;  4OAZ A;  1D5Y A;  2NOG A;  4CZC A;  1SVO A;  1QNT A;  2H1L A;  2JMW A;  1IRF A;  4PGH A;  1YRN B;  1S3J A;  2FMY A;  3BR6 A;  3I56 I;  1D1A A;  3EDP A;  3JRA A;  2ZXJ A;  3MCZ A;  3WHB A;  4LK1 F;  1T98 A;  2QSG X;  4D7M A;  4CYC B;  1OFC X;  5L3G A;  1W4M A;  4RAF A;  4XRS A;  1WJE A;  3I4N J;  4L9T A;  2QVO A;  2KIM A;  5B1A H;  1HOM A;  2CYY A;  2M3A A;  2PN6 A;  2KT0 A;  3F6O A;  4L9N A;  2VQH A;  3GTP J;  3OL4 A;  2EFW A;  2NVX J;  4FQG A;  3DP7 A;  3O2P E;  4XOR A;  2CW0 F;  2ZJP F;  1FJL A;  4UUS A;  3H3Z A;  5KAI C;  1TLH B;  5GPC A;  1VQN I;  4QPO A;  1JJ6 C;  4WK8 F;  2DJN A;  3K1P A;  1W5C C;  5FKK A;  3LFK A;  3TGN A;  2WB1 A;  4W97 A;  2FX0 A;  4FX0 A;  1J59 A;  2WWY A;  2R7O A;  2W82 A;  2C6Y A;  3KZY A;  5TRD A;  3BC8 A;  2DA5 A;  2KIS A;  5IT3 A;  1JKR C;  2O9L A;  4LIU A;  2LBF A;  3CLO A;  3GZN B;  2EIJ H;  3MEX A;  2VJI A;  4M71 A;  3ROU A;  1P9Q C;  3CMA I;  4RLQ A;  1RUN A;  4CDG A;  1R4N B;  1K4S A;  3C7J A;  3CUQ B;  1YE9 A;  2MFZ A;  1J75 A;  1UJ8 A;  1GXP A;  2DQR A;  3ZQI A;  4ENJ A;  3RPU D;  3OIP A;  3A02 A;  4HOB A;  3HJE A;  1G8X A;  2CQK A;  2K3F A;  4DNC A;  3LA2 A;  2R7V A;  1QZY A;  3H5A A;  1B72 B;  1TWA J;  3PNY A;  4X0G A;  2YR2 A;  4BHP A;  4RS8 A;  4ABZ A;  3IV5 A;  3D5R C;  4KT5 C;  3GTJ J;  3CLQ A;  4ZTF A;  4QTR A;  4KFC A;  2AS5 F;  3U2R A;  1QZZ A;  4BE1 A;  1FMV A;  3TDU C;  2WAQ N;  1IXS B;  3ZRG A;  4WXH A;  3CCL I;  5F6F A;  1QHG A;  2LFB A;  4A5M A;  5DCM A;  2ECC A;  3DCF A;  3KLO A;  5EZH A;  3VYS B;  4RLF A;  2IVM A;  3HOT A;  3P9C A;  1DPR A;  1K6O A;  4JX4 A;  3FXM A;  3F21 A;  2LLK A;  3HDD A;  4Y17 A;  2M87 A;  3QYE A;  4V2F A;  1RES A;  3IL2 A;  2XRL A;  2CH0 A;  3ASO H;  1WHU A;  1RPW A;  4DQ2 A;  3HRM A;  4U0Y A;  5FRN A;  3C2G A;  3FXQ A;  3CMM A;  3IH2 A;  2A6E F;  1D0Y A;  1E2X A;  3BG3 A;  3H5N A;  3K1N A;  5JR3 A;  3CCY A;  5EEH A;  4I0A A;  4XRM A;  1VTN C;  4BAC A;  4XLP F;  3GLL A;  1FP1 D;  1R5I D;  2MYS A;  1JTY A;  1V4R A;  2HTJ A;  3RJP A;  1DPU A;  1BR4 A;  3J81 Z;  1OLT A;  3E6B A;  3HXL A;  2Z99 A;  1A6Q A;  2OTL I;  1W7P A;  2JSC A;  4U7D A;  5FLV A;  5B66 C;  5FRM A;  5GTH C;  3A2K A;  2P7V B;  3W2W A;  1SEU A;  1JT0 A;  2HU9 A;  1GVD A;  4ZC3 A;  4ZYG A;  1JHH A;  2XAQ A;  3K70 D;  4CSW A;  2DBB A;  3I4P A;  1ZN2 A;  4BNC A;  2HGC A;  5CQE A;  4EJO A;  4XRF A;  3WU1 B;  1HXD A;  1B9M A;  1XX5 A;  2KIU A;  2X0L A;  3CP8 A;  3CDH A;  3H9J A;  1BL0 A;  2O8K A;  4L9J A;  1ZKG A;  4WX9 A;  1JJ8 C;  2R7D A;  4BXF A;  4XK4 A;  2XAG A;  3LSK A;  2RN7 A;  4HPQ A;  3SFI A;  1ZHF A;  2PFB A;  4EJW A;  3E6D A;  3A4C A;  3KYL A;  4I6Z A;  2M7A A;  1JT6 A;  3FXK A;  3QWL A;  3PFY A;  2F4O B;  2F5D A;  3E3V A;  2VKD A;  5JVT A;  2BBY A;  2OUM A;  2Y69 H;  5LFA A;  2OBP A;  2RGV A;  1FYL A;  2VKE A;  2M4K A;  2XIG A;  4EM1 A;  4HDV A;  5C4X J;  5E3O A;  1IV8 A;  1SFO J;  3I64 A;  2KJC A;  1KGS A;  2RRE A;  3ML6 A;  2FXA A;  1V3F A;  3PSF A;  1FSE A;  1R58 A;  4MTD A;  4UXN A;  2ZME A;  3JSO A;  1IC8 A;  2FD5 A;  5AON A;  2Z33 A;  3DEE A;  2OC6 A;  5FLX Z;  1OCC H;  5K1Y A;  2EQR A;  3QP5 A;  3CCE I;  2JUG A;  1U78 A;  3BLY A;  2GXA A;  2XDV A;  4JX5 A;  3FWE A;  4D1Q A;  5H20 A;  3KP7 A;  1PDN C;  1A36 A;  2R7W A;  5FRO A;  3J80 K;  1OIS A;  3AAF A;  2E2H J;  2FBH A;  1T6S A;  1I1S A;  3HTS B;  2PX9 A;  2DT7 B;  3FXL A;  1V54 H;  4RB3 C;  1R36 A;  4IRG A;  1U5T C;  2W00 A;  4RBO A;  2GA2 A;  4DZJ A;  3MKY B;  4HF1 A;  3RYR A;  2LRD A;  1D0Z A;  1RKT A;  3V8L A;  1ZAO A;  1K61 A;  1UFM A;  2L9N A;  2P81 A;  5JLW A;  4RM2 A;  2VT3 A;  3IRR A;  4CCN A;  2JA8 J;  3ZQL A;  2W48 A;  1VQP I;  3P9K A;  4KIF A;  3K10 A;  2V1N A;  4XSX F;  4QLC U;  3WTX C;  2EK5 A;  2Y75 A;  3FM5 A;  5L3B A;  1TNS A;  1SAU A;  2JZY A;  3GUD A;  4B48 A;  3K9T A;  4BAY A;  4CCO A;  3MD2 A;  2O0Y A;  1TTY A;  2DFE A;  1IRG A;  1HKT A;  2GIV A;  2K9N A;  3AFH A;  3BTI A;  5E1W A;  4XNF A;  4GXO A;  3I58 A;  3MKZ A;  4YG2 F;  2NS7 A;  4RB2 C;  2D45 A;  1D5V A;  1QRY A;  4OU0 A;  5B3S H;  2DA3 A;  3K2A A;  4AWX B;  4G6D A;  2XAJ A;  3WGI A;  5CPR B;  3I5U A;  4M9S A;  5FO5 A;  1K78 B;  1XDU A;  2DI3 A;  3SHF A;  1HW2 A;  2B0L A;  2RNJ A;  2GOM A;  3JSP A;  2KDZ A;  2TCT A;  2GWR A;  2CGP A;  5J3L A;  1YI2 I;  4X6A J;  5IT9 Z;  2G7U A;  3ZPL A;  3FHN A;  2H6C A;  2X51 A;  3QRF F;  1O3T A;  1TZL A;  3OYJ A;  3HSE A;  2XPW A;  3E5Q A;  5CJ9 A;  4J19 A;  5K7H A;  1KYW A;  1VQ7 I;  1WVR A;  2MLK A;  2XHK A;  4XLC A;  3OYC A;  1P6R A;  2CW7 A;  3O8H A;  1P2F A;  1ZH5 A;  5F08 A;  3HPG A;  2QBY B;  3W2A A;  4W1U A;  3TMO A;  1ETY A;  3RCO A;  1VQ5 I;  2Y30 A;  1ZRD A;  1MBE A;  1WWX A;  3G4S I;  1SD5 A;  4MHG A;  3S2D J;  2DA7 A;  2BY3 A;  2VBZ A;  2XC7 A;  2R5Y A;  2GBY A;  2CJJ A;  2X85 A;  5IYC J;  4B3X A;  2V6E A;  1W1W E;  2AQE A;  2EV6 A;  2G0E A;  4NQW B;  1ZGA A;  3OYK A;  2Z2S B;  5D5U B;  2M0C A;  3VPR A;  4PGG A;  5EYR A;  2GLO A;  1T0F A;  3R61 A;  3U1K A;  3DPT A;  3GTM J;  3A1Y A;  1OCP A;  3K4B A;  3ULQ B;  1QPM A;  3BCA A;  2L7Z A;  2CV1 A;  4XR6 A;  3BG5 A;  2HVS A;  4OIO F;  2FE3 A;  1BR2 A;  2X1C A;  3H92 A;  5DYM A;  1H89 C;  4M3E A;  2IJL A;  1X58 A;  5FKM A;  4HV6 A;  4O6J A;  5DUK A;  1XPX A;  1G2H A;  1MJA A;  3MZ8 A;  3MN2 A;  4UUT A;  1POG A;  3WTU C;  1KQ8 A;  2E19 A;  5IY5 H;  3AG1 H;  2DOD A;  2Y9Y A;  1T56 A;  1BBY A;  4WXC A;  4N9I A;  3WGG A;  3LSP A;  5EEA A;  3R6S A;  1BN5 A;  4D5F A;  1BA5 A;  3ZN1 A;  1YW7 A;  3BOQ A;  4NNJ A;  4UV8 A;  3O6B B;  3R0J A;  1J0R A;  2MC3 A;  3OYF A;  1LEB A;  3ZGK A;  4CYD A;  2R4G A;  4JYK A;  4IL6 C;  2Q2E B;  1R5H A;  3QAH A;  3JTG A;  2K85 A;  4G7O F;  2RC4 A;  4ZDO A;  3E0J B;  1X3W B;  1YW9 A;  3OWT A;  1WRJ A;  1ZGJ A;  3K6G A;  1QHH D;  4I09 A;  2IXS A;  2OF7 A;  5D5X B;  1LFP A;  1L3L A;  3DTI A;  3FXU A;  4DBR A;  3S17 J;  2VN2 A;  1LB2 A;  2LF7 A;  5CVU A;  4BJT A;  1SAN A;  5IYD J;  1AOY A;  2K3P A;  4F91 B;  1IW7 F;  1X2M A;  4YEL A;  3G73 A;  3AG2 H;  3ECH A;  3RI4 A;  4G12 A;  3KP5 A;  3GFL A;  3HOZ J;  2DYR H;  1TWG J;  2HPM A;  2ID6 A;  1LDK B;  3DEW A;  4HEA 2;  4X1E A;  2VJJ A;  2GM4 A;  4EJT A;  1Y1W J;  2CUE A;  5KNL A;  2DDA A;  2R93 J;  1BOB A;  2UXX A;  5K5O A;  2Y31 A;  3RKX A;  4HNV A;  1WH5 A;  4BEH A;  2RQP A;  1J5Y A;  4A12 A;  3CDL A;  2KHM A;  5TGT A;  2NVQ J;  1Z6R A;  4RGR A;  5FGM A;  4LG0 A;  3VEP A;  1P92 A;  4RAY A;  4CA0 A;  2GXG A;  3REO A;  1U0J A;  2CG4 A;  3BG7 A;  1YOV B;  2EA4 A;  2KZG A;  3CCS I;  1R00 A;  3UR3 C;  1QBJ A;  2L4M A;  2Y48 A;  1T33 A;  1WJF A;  2E1O A;  2E7X A;  3J81 R;  1X1D A;  2OV7 A;  3FXJ A;  2QEN A;  4AIK A;  1I27 A;  4CYC A;  2QEX I;  1REP C;  2X4H A;  3TO6 A;  4IQ4 A;  3FMR A;  1P4W A;  5BS6 A;  2MAB A;  1ZR4 A;  2HOE A;  2FUG 2;  3IH3 A;  1HSJ A;  2DJI A;  1U3E M;  5JI6 A;  2O6G E;  1H9G A;  2IEK A;  1ORK A;  1IF1 A;  1GXQ A;  1R1U A;  4UVC A;  1ZEL A;  2L9S A;  4XQF A;  1GT0 C;  3DBL B;  2R5Z B;  1B6A A;  1U2W A;  4GYI A;  2X6W A;  3ERM A;  3VYR B;  3ABL H;  5E8I A;  2MW8 A;  2UWM A;  2A6T A;  2XVC A;  4G6Q A;  2OQG A;  4IHX A;  2QQ9 A;  2XB5 A;  2K9S A;  3K4J A;  3J7Y J;  2JJ7 A;  2VXZ A;  5FKN A;  3VSK A;  1LE8 B;  1SFE A;  3GF2 A;  1HCR A;  2ME6 A;  4C2M J;  2M35 A;  1XTA A;  2BYV E;  2KIQ A;  3PIP F;  3Q5F A;  3HGY A;  5IP9 J;  3TW7 A;  2DYS H;  2ZSH B;  4R1H A;  3CUQ A;  2X98 A;  3TKY A;  1LNW A;  4AVZ A;  1YIJ I;  1P4X A;  3WE2 A;  2MH9 A;  3CCU I;  2JN6 A;  4CUG A;  4N9H A;  1B72 A;  2VUM J;  3DKY A;  3GTL J;  2P6T A;  5FLX R;  5IP7 J;  1MZB A;  2MC4 A;  1DU0 A;  2FNP A;  5FFX A;  4A3E J;  2YU3 A;  3BZK A;  4HG2 A;  3WHC A;  2QKM B;  3QQA A;  1Z1D A;  1PVE A;  4DW6 A;  3HZJ A;  3RYP A;  5ICE A;  3PO3 J;  1ETW A;  9ANT A;  2IAI A;  3EYY A;  3HEF A;  3WU0 A;  2O3F A;  4EGZ A;  3T5X A;  1MDM B;  1GUU A;  1S7A A;  3EUH A;  4IHY A;  2P6S A;  2YU9 J;  4YFK F;  2BW3 B;  3I54 A;  2WBM A;  4CCJ A;  3MFK A;  2LKS A;  2V1U A;  1MJ9 A;  4BDZ A;  4F55 A;  3KIO A;  2WY7 Q;  1FMW A;  1MH4 A;  2KPM A;  3LAJ A;  4PFP A;  4E70 A;  4JOM A;  3V7R A;  1CQT A;  1OJL A;  3VOE A;  1N78 A;  1X4P A;  4IF4 A;  1LEA A;  2FOW A;  5J47 A;  5GTI C;  4JP0 A;  2IT0 A;  1OQY A;  1KON A;  2E1C A;  1T38 A;  2YX7 A;  3VDX A;  3DXJ F;  4IEJ A;  1MSF C;  4IHT A;  4LG3 A;  4L0Y B;  3FIS A;  3ZQC A;  4JK1 X;  3ZMS A;  1YW8 A;  3HHH A;  2CQ7 A;  1PUF A;  4BQA A;  1T2K A;  1ETO A;  3S2W A;  1R6R A;  2ID3 A;  1F4K A;  2DMP A;  2KJB A;  1W5T A;  5LD2 C;  3L2V A;  3HOX J;  3EYI A;  1ZK8 A;  1XDS A;  2HYJ A;  4EGY A;  1JE8 A;  2VC1 A;  1PP7 U;  2VBY A;  4A3K J;  5L3E A;  2MG4 A;  5LRS A;  3B6C A;  4RGU A;  1AWC A;  4OOI A;  3L00 A;  1ENH A;  5J1R A;  2DDB A;  4IX7 A;  3OSG A;  2E36 A;  2LMD A;  3RQ4 A;  1QPI A;  3M8J A;  3D5S C;  1HW1 A;  3I9V 2;  2PEX A;  2BZT A;  1IO2 A;  1YYV A;  3PFI A;  3IP4 B;  1XCB A;  2NS8 A;  3TO7 A;  3JRB A;  3H3V K;  1TP4 A;  1QO0 D;  4EAT A;  2DN0 A;  3GBG A;  2K9L A;  4BGD A;  2QUF A;  4WWC A;  3B02 A;  3ERE D;  3H36 A;  2VJ4 A;  4ASN A;  2B63 J;  3BDD A;  5EZG A;  4ENN A;  3N97 A;  1NG6 A;  2NVT J;  1X1B A;  4BHC A;  2G9W A;  2IA1 A;  3BWG A;  2VE9 A;  1Z21 A;  3TOB A;  2HEO A;  2CQQ A;  4LJZ F;  4G6T B;  5E18 F;  2LRE A;  5F64 A;  3R0A A;  1XSV A;  1SD4 A;  2GXB A;  2W85 A;  3BR2 A;  1V55 H;  3N05 A;  4GCV A;  4BXU A;  2BY0 A;  1RRJ A;  1YFH A;  4ZYH A;  1V5E A;  3OIQ A;  1IRX A;  2ACJ A;  2P4W A;  3SDG A;  3PUB A;  2M0M A;  2VT2 A;  3LOC A;  4YII A;  4M3D A;  1STZ A;  4PJJ A;  4IPA A;  3CC2 I;  3AL0 C;  2CS3 A;  1SMT A;  3S32 A;  1ERD A;  2VAS A;  2VBX A;  1LVK A;  4L5J A;  4MEY F;  3ELK A;  3CF5 F;  1Z9C A;  4A69 C;  3ECO A;  5ICC A;  3DWL E;  1T0F C;  1EJ9 A;  3I3L A;  3BR0 A;  2VON A;  2ESN A;  2MUN A;  3SYT A;  5IOZ A;  5KCM A;  1PYV A;  1U9N A;  1SFX A;  3BRO A;  4EEF G;  3HBL A;  4NHJ A;  3X2Q H;  3L9F A;  1I3A A;  3OV8 A;  3S3M A;  1Q1H A;  2KKO A;  3I59 A;  1RIO H;  2WV1 A;  1HQC A;  5H6R A;  3H9Q A;  1TQP A;  2HDW A;  2M9H A;  1O57 A;  1X1P A;  2K4J A;  3F6V A;  2ZB9 A;  1W5S A;  2QQA A;  1XCV A;  2HS5 A;  4MLO A;  4UUV A;  2IP2 A;  1A5J A;  2H27 A;  2LOO A;  1FY7 A;  2WV0 A;  1RET A;  2OPT A;  4FT8 A;  1R1T A;  4M3F A;  3QPS A;  1G3W A;  1XD7 A;  1Q1V A;  1RC9 A;  2ZCW A;  4MEX F;  3U9G A;  2R7F A;  5DDG A;  1FSH A;  1XB4 A;  1K78 A;  4A3C J;  2IGO A;  3PSI A;  3LWF A;  1N77 A;  1OMI A;  4QPQ A;  4PJN A;  2DOF A;  2KL4 A;  4DYR A;  5LGU A;  3K4C A;  2R7Q A;  2ZO4 A;  3IWZ A;  1MMA A;  2DPD A;  1IUY A;  5M5W J;  4I98 B;  4E7I A;  3HG9 A;  3KCC A;  2XGE A;  2IA2 A;  4PZJ A;  3UKG A;  2PLY A;  3EQL F;  1JGG A;  4S0H B;  3K0L A;  1BR1 A;  3TDZ C;  2V9K A;  3F8N A;  4LB6 B;  1QA6 A;  2IGK A;  3FK7 A;  2AO9 A;  4A93 J;  4M73 A;  5C44 J;  4ZDL A;  2CMP A;  3RIR A;  2A3S A;  2W1O A;  2QBY A;  3IHU A;  4ENK A;  1Z0X A;  5KK1 A;  5DD8 A;  1IZ1 A;  4YFX F;  2CW8 A;  2M8G X;  3K69 A;  2ZXW H;  3KX2 A;  5J6X A;  2OA4 A;  1R23 A;  3CJN A;  4HQM A;  3L2U A;  1OR7 A;  2LY9 A;  1AHD P;  2VPL A;  2DO7 A;  3OYI A;  3ZQH A;  4B44 A;  1LFU P;  1TWF J;  2QA4 I;  2Z1D A;  1S9H A;  3OIO A;  4NQW A;  4AIH A;  2RKH A;  3WG7 H;  1X1C A;  1ZG1 A;  5E3M A;  2LSO A;  4Z6Y A;  1HBX G;  2VLA A;  4KYW A;  1W36 C;  5IOY A;  3BPV A;  5CVV A;  1GV2 A;  1WI9 A;  4MQ9 F;  4XLH A;  3Q9S A;  2NVY J;  1RR8 C;  1F9N A;  3DU5 A;  4C2U A;  2M5W A;  1I5Z A;  2EFQ A;  3LAP A;  3W6K B;  2UV1 A;  3GME A;  2A61 A;  2AQF A;  3PM1 A;  4PJM A;  2OZU A;  3J7Z I;  5KHD A;  2STW A;  3BR3 A;  3I71 A;  5J1Y A;  4ZDP A;  5M5X J;  5F0F A;  4Y33 A;  2EWN A;  2ESH A;  2DOE A;  2MA3 A;  4C2T A;  2L9R A;  1ZG3 A;  1Z05 A;  4MFE A;  4Y4R A;  3HOS A;  1Y0N A;  3BTJ A;  5LGT A;  3CMY A;  3ZXS A;  1IXR C;  2Q2E A;  3M07 A;  2VQL A;  5GAD J;  1CF7 B;  2EA2 A;  3LFU A;  3QU6 A;  3RKW A;  2W57 A;  4ON0 A;  5BQT A;  3Q9V A;  2HR3 A;  2JPC A;  3F3X A;  2DA2 A;  3V7C A;  3UNG C;  2W84 A;  3EPZ A;  3GO5 A;  1U5T B;  5HS9 A;  5JLX A;  1XMX A;  3DBR B;  3PNT A;  3EET A;  2O61 A;  3FX3 A;  3PNV A;  4QIW N;  4YIF A;  2JPB A;  4IO9 F;  5DV5 A;  1CGP A;  3JW4 A;  3J80 Z;  3S16 J;  1FBU A;  2XUB A;  4FCY A; 
#chains in the Genus database with same CATH homology
 3QPH A;  4KA4 A;  3I53 A;  2A69 F;  4RAZ A;  3HRS A;  3KEO A;  4ZH4 F;  1Z6T A;  4BYY A;  3V4G A;  2XV4 S;  2NRA C;  3GEZ A;  5DEQ A;  1XMK A;  4G7Z F;  3WG9 A;  2CO5 A;  4P55 A;  1OYI A;  3QPT A;  2FEZ A;  4HF0 A;  3PQK A;  5LHH A;  3T0Y A;  3GLX A;  2EV5 A;  1H0M A;  5ICG A;  3HSF A;  2JRT A;  4Y15 A;  5E17 F;  2FBK A;  3TO9 A;  1F1Z A;  4KNY A;  5BPI A;  1BC8 C;  2HFH A;  2DLL A;  5CYV A;  1KU3 A;  5AIP A;  2Z9O A;  2RDP A;  4G9Y A;  5LBQ A;  3F72 A;  1BJA A;  1XGO A;  1FPQ A;  2YSR A;  1SMY F;  1FYM A;  3GFM A;  2ZBK A;  4LFU A;  1WQ2 A;  4LLG F;  1ON2 A;  1BI3 A;  3GXO A;  4F7Z A;  4HV5 A;  3HSR A;  3M1E A;  2IRF G;  3GYH X;  2ZJ2 A;  2K4B A;  3RTR A;  2DW4 A;  4HBL A;  1XSX A;  4U0W A;  3ZQ7 A;  2VOP A;  3CO6 C;  2DTR A;  2PMH A;  4TV7 A;  1MDM A;  1O3Q A;  3GZ6 A;  1ZLJ A;  3E5U A;  2J5P A;  3ABU A;  2FU4 A;  3V8J A;  3KET A;  1IN7 A;  1ON1 A;  4O5V A;  2HWV A;  1MKM A;  4OMZ A;  4AVP A;  3J7A O;  3ZMZ A;  1G3Y A;  4EQQ A;  2VOO A;  5L3C A;  2QWW A;  1I6X A;  1FLI A;  1YS6 A;  2RV8 A;  2ELH A;  5HLG A;  2VC0 A;  2K27 A;  3RPQ A;  1KQ0 A;  3RDI A;  4MNU A;  4S04 A;  2V9V A;  2GZW A;  3BJO A;  1G6N A;  1FBS A;  3KEQ A;  2LKP A;  4HW0 A;  2IPQ X;  2H09 A;  1JHF A;  2HZT A;  2NAZ A;  3JAM Z;  1HKQ A;  2FOK A;  4L0Z B;  2Y0M A;  1YG2 A;  2O03 A;  4LGW A;  1KYZ A;  1PUE E;  1KU2 A;  1ZRF A;  4A0X A;  3HIF A;  1R1V A;  1R7J A;  4XBF A;  1GHC A;  1J9I A;  1JXS A;  1LDJ A;  4RB1 A;  1W7P B;  4FHT A;  4QWQ A;  1K79 A;  3ISP A;  4EVI A;  2A5Y B;  2K02 A;  1FBQ A;  3V8K A;  3T8T A;  1KQ9 A;  2YPR A;  4HF2 A;  2L4A A;  4PDK A;  3ZP5 A;  1A04 A;  3FZV A;  1FZP B;  3N4M A;  5ERI A;  4I7H A;  3V7S A;  5ILV A;  3HHG A;  1KA8 A;  1FNN A;  1I1G A;  4KIB A;  2H6B A;  3COA C;  1OKR A;  2QLZ A;  3E5X A;  1WSU A;  1NHA A;  1EH8 A;  2UZK A;  1RZ4 A;  1XGN A;  1S8N A;  1EV7 A;  1H9T A;  3OOP A;  4XSZ F;  3VFZ A;  3QOP A;  3TOA A;  5HVQ C;  4HX4 A;  3QU3 A;  4Q48 A;  2HTS A;  2HDC A;  3SZP A;  1FC3 A;  3QP6 A;  5BMZ A;  1P4A A;  4G94 A;  3BZ6 A;  2OU2 A;  2QZ8 A;  3K1M A;  2EFO A;  1ZRC A;  2F5E A;  1BM9 A;  4HYE A;  2VBW A;  3FF5 A;  1S29 A;  2BV6 A;  1TQM A;  1IN5 A;  1T39 A;  1RUO A;  2P8T A;  2NS0 A;  4XLN F;  3HRU A;  2DPU A;  5K5Q A;  3L7W A;  4K2E A;  1F5T A;  2HKO A;  1UHW A;  3MZH A;  4CXF A;  1DP7 P;  2W24 A;  1Z91 A;  2DU9 A;  2V79 A;  4M72 A;  1QGP A;  2QM3 A;  3CUO A;  5CLS A;  4EJV A;  5HOO A;  4WXD A;  5FB2 A;  5D8K B;  4IHS A;  1D3Y A;  4IJA A;  1KU7 A;  2L02 A;  1ZG5 A;  2FML A;  3F8C A;  2M8E A;  3BJ6 A;  5ED4 A;  1ODD A;  2F2E A;  1USS A;  3L2C A;  3MAJ A;  4LLL A;  2HYF A;  1KU9 A;  1FP2 A;  3ZMD A;  2G7H A;  1FT9 A;  3MQ0 A;  1EH7 A;  1CF7 A;  3E97 A;  4A6E A;  3WTY C;  1U5T A;  3BJA A;  2EB7 A;  4KMF A;  3GFI A;  2ZFW A;  2W25 A;  4L5I A;  4B8X A;  3P7N A;  5A2Q K;  2RVC A;  4G7H F;  4O3M A;  5D4R A;  4YFN F;  4U7B A;  2IW5 A;  5ILU A;  4I01 A;  5LHG A;  4H0E A;  1FWZ A;  4CO8 A;  2ADU A;  5D8L B;  4WF2 A;  1B1B A;  4BHB A;  5DCF A;  3GVA A;  3SXY A;  1YS7 A;  2EFP A;  2XGX A;  1UHM A;  4HAM A;  5D4S A;  5LRR A;  3KFW X;  2JT1 A;  3E6M A;  3M8E A;  3G3Z A;  2NYX A;  5E8G A;  4I02 A;  1G3S A;  2BEO A;  3C18 A;  4KN7 X;  1ZAR A;  2E1N A;  1BI2 A;  2Z5U A;  1TBX A;  1OPC A;  4LD5 A;  1E17 A;  3TQN A;  2ISY A;  1S7O A;  4RGS A;  4P5O A;  4ZZL A;  2BGC A;  3KP6 A;  1EH6 A;  3FMQ A;  3ZMT A;  1TW3 A;  5HS7 A;  1HST A;  4L18 B;  2M45 A;  4UVB A;  4EM2 A;  3NEU A;  3GZ5 A;  1HW5 A;  5EEG A;  3LST A;  1G3T A;  4R8H A;  2CWE A;  1Y0U A;  2GAU A;  1DDN A;  4Z2Y A;  3F8B A;  1U8R A;  4GYG A;  3IKT A;  2LNB A;  1MD0 A;  3WTV C;  4OIQ F;  1YO5 C;  2K86 A;  1JGS A;  1YQA A;  4IRH A;  3BP8 A;  2HYG D;  3WTS C;  4MQV A;  2KRF A;  3KP4 A;  4PCQ A;  2M1B A;  5LEJ A;  4I0B A;  2DK8 A;  3BY6 A;  4P96 A;  4HZF A;  1YLF A;  1L0O C;  5L3F A;  4OMY A;  5ICF A;  1TW2 A;  2ZKZ A;  2DK5 A;  2NNN A;  5KVR A;  2XAF A;  2COM A;  2F5F A;  4R79 A;  2L3D A;  1SD6 A;  4KUM A;  1K7A A;  3R4K A;  3LQQ A;  5LEK A;  3H3U A;  1OYW A;  2EFN A;  4N0B A;  3SFZ A;  4NB5 A;  2XKO A;  4S05 A;  2BE5 F;  2V1D A;  3D0S A;  4CGZ A;  3T8R A;  3GX4 X;  1GVJ A;  2HKX A;  3R60 A;  1ZLK A;  4CZZ A;  4UHT A;  5LLQ A;  4KMU X;  3VB2 A;  3O3K A;  5J8C A;  1B9N A;  1SFU A;  3SZT A;  3IKV A;  1PP8 F;  4UV9 A;  4ESB A;  3CUQ C;  5BPD A;  5H6Q A;  1BI0 A;  3F22 A;  1R22 A;  4EM0 B;  5JFR A;  4EMS A;  1IN8 A;  5FFZ A;  3DPL C;  3IRQ A;  2L01 A;  4Q4Z F;  3ABT A;  1BOA A;  4KIC A;  3KP3 A;  1FX7 A;  1UCR A;  4M9Z A;  3W6J B;  3C3W A;  4BH9 A;  3J81 K;  4KDP A;  4GO1 A;  5HDK A;  3M7G A;  2V1X A;  3ZMV A;  2VOD A;  3WOD F;  5HS8 A;  1LDD A;  5HLH A;  1UB9 A;  4U88 A;  5F1R A;  1R5G A;  2A07 F;  1J7K A;  1O7F A;  1MGT A;  1J2X A;  4CIC A;  1OYY A;  3KE2 A;  1LVA A;  2JTV A;  3WGH A;  3DKW A;  4ZYE A;  4Y13 A;  2P5K A;  4ENM A;  3WE3 A;  2AXL A;  2OQR A;  5TJJ A;  3WTW C;  4WCG A;  1XSD A;  2F5C A;  2P5L C;  2R3S A;  2UXN A;  2XAH A;  3I59 B;  4ZYD A;  5FLX K;  4P9U A;  4OIP F;  2HQR A;  1IAW A;  5D5W B;  2YX4 A;  2PQ8 A;  2EV0 A;  2HQN A;  5AIQ A;  5E20 A;  2OAZ A;  5HDN A;  1U6G A;  3LQR A;  5D5V B;  2NNY A;  2GA1 A;  2TDX A;  1O3S A;  4HX8 A;  2FSW A;  3IWF A;  3U1D A;  3DFG A;  2STT A;  1SD7 A;  1RNL A;  5CVJ A;  5ILS A;  2DFI A;  4B09 A;  3L09 A;  1IN4 A;  5BOX A;  2XAS A;  3CTA A;  3GFJ A;  1YIO A;  1ZRE A;  4Q47 A;  1YTY A;  1O7L A;  5FD5 A;  3IC7 A;  4ZZD A;  1B4A A;  1LJ9 A;  3GWZ A;  3WTZ A;  1ULY A;  2GQQ A;  5DCM B;  1IXC A;  3KZZ A;  2FA5 A;  3NQO A;  2PBI A;  2MLG A;  1XGM A;  5IT9 K;  3DF8 A;  5HLI A;  4HDU A;  5FD6 A;  4OIN F;  5DD4 A;  3DEU A;  4ESF A;  2PJP A;  1DUX C;  3KLN A;  1XGS A;  4UVA A;  2PI0 A;  2A68 F;  1Z7U A;  4M6Y A;  3HYI A;  2Z3Y A;  3ZN0 A;  3I0T A;  3P9I A;  3F8F A;  2CSO A;  3PQJ A;  1FYK A;  6PAX A;  1WKM A;  3HTU A;  3BPX A;  1TNT A;  4OIR F;  4D0P A;  3FHZ A;  2FRH A;  1B59 A;  5K5R A;  3LA3 A;  2MH2 A;  2ISZ A;  2KIF A;  3T1B A;  1X3U A;  3FM3 A;  1C0W A;  3B73 A;  4LLN A;  3MZY A;  2XRN A;  5J8F A;  5D6E A;  3JAM K;  2ZNY A;  4MTE A;  3GW2 A;  2O8X A;  2P5V A;  2Q8K A;  2ZME B;  2D1V A;  1IN6 A;  1W7P D;  4Q5S F;  5LHI A;  1SAX A;  1BI1 A;  4M9X A;  1BIA A;  1RI7 A;  2XRO A;  1FOK A;  5JHU A;  5CVI A;  2XKP A;  3RPU A;  2QYO A;  4EJU A;  2WC2 A;  4HA8 A;  4FX4 A;  3D5L A;  4HLX A;  4A6D A;  2K7L A;  3MWM A;  2PG4 A;  4EV0 A;  2E7W A;  3NRV A;  2H94 A;  2PMU A;  4M74 A;  4IRI A;  3FMS A;  2ZNZ A;  5E1X A;  1G4D A;  3KP2 A;  2LDU A;  2ETH A;  3F8M A;  2FBI A;  3ZMU A;  4U0V A;  2OZ6 A;  5HDG A;  4UNO A;  3LA7 A;  5CVR A;  5LGN A;  3DQV C;  4HQE A;  4LB5 A;  3E6C C;  4G8X A;  4AD9 A;  3DV8 A;  4JQF A;  2DAO A;  5E1Z B;  2L54 A;  3FXR A;  4I2O A;  1D8K A;  3K2Z A;  2OD5 A;  2DT5 A;  5A2Q Z;  3JTH A;  4JBA A;  2A6H F;  2J5O A;  3HRT A;  3VOD A;  2LF8 A;  1BIB A;  5DUI A;  4CHU A;  2MBF A;  4IXA A;  2QQB A;  1XMA A;  4IVN A;  1QQI A;  2Q0O A;  4HLY A;  2WTE A;  4LMY A;  4HX7 A;  3RKY A;  5D6F A;  3CO7 C;  3C1D A;  1TQI A;  4A0Y A;  4P9F A;  4KN4 X;  2FQ3 A;  4L9V A;  2CFX A;  2D2W A;  2M30 A;  4GGG A;  3SQN A;  2DQL A;  4ETS A;  3M8F A;  3WTT C;  4KIG A;  1ONV A;  4ESJ A;  1BC7 C;  5L3D A;  4LK0 F;  2P7C B;  1XN7 A;  4AIJ A;  3M9A A;  1HKS A;  1ZYR F;  2MD5 A;  4RGX A;  2V6C A;  4A0Z A;  3F23 A;  1O3R A;  4M6X A;  1D8J A;  1S6L A;  1MJB A;  2FNA A;  2EJR A;  2VE8 A;  4MGR A;  1LQ1 A;  2D1H A;  4RB0 A;  4A2U A;  4A5N A;  1UST A;  3HUG A;  2FF4 A;  4LG0 B;  2IA0 A;  1QNT A;  1IRF A;  4PGH A;  1S3J A;  2FMY A;  3EDP A;  2ZXJ A;  3MCZ A;  4LK1 F;  1T98 A;  5L3G A;  1W4M A;  4L9T A;  2QVO A;  2KIM A;  2CYY A;  2PN6 A;  3F6O A;  4L9N A;  2EFW A;  3DP7 A;  3O2P E;  2CW0 F;  3H3Z A;  1TLH B;  4WK8 F;  3K1P A;  3LFK A;  3TGN A;  4FX0 A;  1J59 A;  2WWY A;  2C6Y A;  5TRD A;  3KZY A;  5IT3 A;  3CLO A;  3MEX A;  4M71 A;  3ROU A;  1RUN A;  4CDG A;  3C7J A;  3CUQ B;  1J75 A;  1GXP A;  2DQR A;  4ENJ A;  4HOB A;  2CQK A;  4DNC A;  3LA2 A;  1QZY A;  2YR2 A;  4BHP A;  4RS8 A;  4KT5 C;  4KFC A;  2AS5 F;  3U2R A;  1QZZ A;  3TDU C;  1IXS B;  4WXH A;  5F6F A;  4A5M A;  5DCM A;  3KLO A;  2IVM A;  3HOT A;  3P9C A;  1DPR A;  1K6O A;  3F21 A;  4Y17 A;  2M87 A;  3IL2 A;  4DQ2 A;  3HRM A;  4U0Y A;  3FXQ A;  2A6E F;  1E2X A;  3K1N A;  5JR3 A;  5EEH A;  4I0A A;  1VTN C;  4XLP F;  1FP1 D;  3RJP A;  1V4R A;  2HTJ A;  1DPU A;  3J81 Z;  3E6B A;  2Z99 A;  1W7P A;  2JSC A;  4U7D A;  2P7V B;  4ZYG A;  1JHH A;  2XAQ A;  2DBB A;  3I4P A;  1ZN2 A;  4BNC A;  2HGC A;  4EJO A;  4XRF A;  3WU1 B;  1HXD A;  1B9M A;  2KIU A;  2X0L A;  3CDH A;  4L9J A;  4WX9 A;  2R7D A;  2XAG A;  2RN7 A;  1ZHF A;  2PFB A;  4EJW A;  3E6D A;  2F5D A;  3E3V A;  5JVT A;  2BBY A;  2OBP A;  2RGV A;  1FYL A;  2XIG A;  4EM1 A;  4HDV A;  3I64 A;  2KJC A;  1KGS A;  3ML6 A;  2FXA A;  1V3F A;  1FSE A;  1R58 A;  4MTD A;  4UXN A;  2ZME A;  3JSO A;  5AON A;  2Z33 A;  5FLX Z;  5K1Y A;  3QP5 A;  1U78 A;  3FWE A;  5H20 A;  3KP7 A;  1PDN C;  3J80 K;  3AAF A;  2FBH A;  1T6S A;  1I1S A;  3HTS B;  4RB3 C;  1R36 A;  4IRG A;  1U5T C;  2GA2 A;  4HF1 A;  3RYR A;  3V8L A;  1ZAO A;  1UFM A;  2VT3 A;  3IRR A;  3P9K A;  4KIF A;  4XSX F;  4QLC U;  3WTX C;  2EK5 A;  2Y75 A;  3FM5 A;  5L3B A;  1TNS A;  4BAY A;  2JZY A;  3GUD A;  3K9T A;  2O0Y A;  1TTY A;  1IRG A;  1HKT A;  2GIV A;  5E1W A;  4GXO A;  3I58 A;  4YG2 F;  4RB2 C;  2D45 A;  1D5V A;  4OU0 A;  4AWX B;  4G6D A;  2XAJ A;  3WGI A;  3I5U A;  4M9S A;  5FO5 A;  1K78 B;  1XDU A;  2DI3 A;  3SHF A;  1HW2 A;  2B0L A;  2RNJ A;  3JSP A;  2CGP A;  2GWR A;  5IT9 Z;  2G7U A;  3ZPL A;  2H6C A;  3QRF F;  1O3T A;  3HSE A;  3E5Q A;  5CJ9 A;  1KYW A;  2MLK A;  2XHK A;  1P6R A;  1P2F A;  1ZH5 A;  2QBY B;  1ZRD A;  1WWX A;  1SD5 A;  4MHG A;  2VBZ A;  2EV6 A;  1ZGA A;  5D5U B;  4PGG A;  1T0F A;  3R61 A;  3DPT A;  3ULQ B;  1QPM A;  4OIO F;  2FE3 A;  3H92 A;  5DYM A;  2IJL A;  4HV6 A;  4O6J A;  5DUK A;  1MJA A;  3WTU C;  1KQ8 A;  3WGG A;  1BBY A;  4WXC A;  4N9I A;  3R6S A;  1BN5 A;  3ZN1 A;  1YW7 A;  3BOQ A;  4UV8 A;  3O6B B;  3R0J A;  1J0R A;  2MC3 A;  1LEB A;  4CYD A;  1R5H A;  3QAH A;  3JTG A;  4G7O F;  2RC4 A;  1YW9 A;  1WRJ A;  1ZGJ A;  4I09 A;  5D5X B;  1L3L A;  3FXU A;  2VN2 A;  1LB2 A;  2LF7 A;  5CVU A;  1AOY A;  1IW7 F;  3G73 A;  3ECH A;  3RI4 A;  3KP5 A;  3GFL A;  1LDK B;  4EJT A;  2UXX A;  5K5O A;  3RKX A;  2RQP A;  1J5Y A;  4A12 A;  1Z6R A;  4RGR A;  5FGM A;  4LG0 A;  3VEP A;  1P92 A;  4RAY A;  2GXG A;  3REO A;  2CG4 A;  2EA4 A;  1R00 A;  1QBJ A;  2L4M A;  2Y48 A;  2E7X A;  2QEN A;  4AIK A;  1I27 A;  1REP C;  2X4H A;  3TO6 A;  3FMR A;  1P4W A;  5BS6 A;  2HOE A;  1HSJ A;  1U3E M;  5JI6 A;  2O6G E;  1H9G A;  1IF1 A;  1GXQ A;  1R1U A;  4UVC A;  1B6A A;  1U2W A;  4GYI A;  5E8I A;  2UWM A;  2XVC A;  4G6Q A;  2OQG A;  2QQ9 A;  2VXZ A;  1SFE A;  3GF2 A;  2BYV E;  3Q5F A;  4R1H A;  3CUQ A;  3TKY A;  1LNW A;  1P4X A;  3WE2 A;  2MH9 A;  4N9H A;  2P6T A;  1MZB A;  2FNP A;  5FFX A;  2YU3 A;  1Z1D A;  3RYP A;  5ICE A;  3EYY A;  4EGZ A;  3WU0 A;  2O3F A;  3T5X A;  1MDM B;  1S7A A;  3EUH A;  2P6S A;  4YFK F;  3I54 A;  3MFK A;  2V1U A;  1MJ9 A;  3LAJ A;  4E70 A;  3V7R A;  3VOE A;  4IF4 A;  1LEA A;  2IT0 A;  2E1C A;  1T38 A;  2YX7 A;  3DXJ F;  4IHT A;  4L0Y B;  4JK1 X;  3ZMS A;  1YW8 A;  3HHH A;  4BQA A;  1T2K A;  3S2W A;  1F4K A;  2KJB A;  1W5T A;  3EYI A;  1XDS A;  4EGY A;  1JE8 A;  2VC1 A;  1PP7 U;  2VBY A;  5L3E A;  5LRS A;  4RGU A;  1AWC A;  4OOI A;  3L00 A;  1HW1 A;  2PEX A;  1YYV A;  3PFI A;  1XCB A;  3TO7 A;  1QO0 D;  2QUF A;  4WWC A;  3B02 A;  3ERE D;  4ASN A;  3BDD A;  4ENN A;  3N97 A;  4BHC A;  2G9W A;  2IA1 A;  3BWG A;  2VE9 A;  3TOB A;  2HEO A;  4LJZ F;  5E18 F;  5F64 A;  3R0A A;  1XSV A;  1SD4 A;  2GXB A;  2W85 A;  4GCV A;  4BXU A;  1YFH A;  4ZYH A;  2ACJ A;  2P4W A;  2VT2 A;  4YII A;  1STZ A;  4IPA A;  1SMT A;  2VBX A;  4L5J A;  4MEY F;  3ELK A;  1Z9C A;  3ECO A;  5ICC A;  2VON A;  2ESN A;  1SFX A;  3BRO A;  4NHJ A;  3L9F A;  3OV8 A;  1Q1H A;  2KKO A;  3I59 A;  1RIO H;  1HQC A;  5H6R A;  1TQP A;  1O57 A;  2K4J A;  3F6V A;  1W5S A;  2QQA A;  1XCV A;  2HS5 A;  4UUV A;  2IP2 A;  2H27 A;  1FY7 A;  2WV0 A;  4FT8 A;  1R1T A;  1G3W A;  1XD7 A;  2ZCW A;  4MEX F;  3U9G A;  2R7F A;  5DDG A;  1FSH A;  1XB4 A;  1K78 A;  3LWF A;  1OMI A;  5LGU A;  2DPD A;  2ZO4 A;  3IWZ A;  1IUY A;  4I98 B;  3KCC A;  2IA2 A;  4PZJ A;  2PLY A;  3EQL F;  3K0L A;  3TDZ C;  3F8N A;  4LB6 B;  4M73 A;  3RIR A;  2A3S A;  2QBY A;  3IHU A;  4ENK A;  5KK1 A;  5DD8 A;  1IZ1 A;  4YFX F;  3K69 A;  5J6X A;  2OA4 A;  1R23 A;  3CJN A;  4HQM A;  1OR7 A;  2DO7 A;  4NQW A;  4AIH A;  2RKH A;  1ZG1 A;  2LSO A;  1HBX G;  4KYW A;  3BPV A;  5CVV A;  1WI9 A;  4MQ9 F;  3Q9S A;  1F9N A;  2M5W A;  1I5Z A;  2EFQ A;  3LAP A;  3W6K B;  2A61 A;  2OZU A;  2STW A;  3I71 A;  2EWN A;  2ESH A;  2MA3 A;  1ZG3 A;  1Z05 A;  3HOS A;  5LGT A;  1IXR C;  2Q2E A;  1CF7 B;  2EA2 A;  3QU6 A;  3RKW A;  5BQT A;  2W57 A;  4ON0 A;  3Q9V A;  2HR3 A;  2JPC A;  3F3X A;  3V7C A;  2W84 A;  3GO5 A;  1U5T B;  5HS9 A;  2O61 A;  3EET A;  3FX3 A;  4YIF A;  2JPB A;  5DV5 A;  1CGP A;  3JW4 A;  3J80 Z;  1FBU A;  2XUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...