4HVAA

Mechanistic and structural understanding of uncompetitive inhibitors of caspase-6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
247
structure length
238
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic and structural understanding of uncompetitive inhibitors of caspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
total genus 85
structure length 238
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hvaA00
2H48A 4NBNA 4NOKA 2XYGA 2C2OA 1RWKA 2CJYA 1RHJA 4NOLA 4QUGA 5IBRA 3R6GA 4EHLA 4QU0A 4IEFB 1ICEA 3KJNA 2CJXA 4ZVQA 5I9TA 3R7BA 3IBCA 4PS0A 3BIJA 4EHDA 1CVRA 3E4CA 3H0EA 1KMCA 4QUBA 4N7MA 3H11A 3H13A 1IBCA 3RJMA 3PCXA 1GQFA 4I1RA 3V4OA 4EHNA 3R7NA 3EDRA 3NR2A 3R5JA 4QUEA 4N6OA 3KJFA 5JFTA 5LU9A 1K88A 1QDUA 2HBYA 2QL5A 3ITNA 4JJ8A 2WDPA 4JR0A 5H0IA 3V3KA 1RWWA 4EHKA 4EJFA 2CNKA 2QLFA 4N7JA 2H4YA 3OD5A 2QL9A 2XYPA 1RE1A 2C2KA 2H65A 1SHJA 1BMQA 4JQYA 1SC3A 4ZVPA 4NBKA 3P45A 2J32A 3GJQA 3S70A 4JR2A 1RHKA 2CNNA 5IAJA 4ZVRA 5IABA 3KJQA 3NKFA 2Y1LA 1SHLA 1F9EA 4QUHA 1GFWA 3SIPA 1RWPA 4PRZA 5IANA 3D6FA 5K20A 1NMSA 1I4EB 3IBFA 1NMEA 2H5IA 3V6LA 4M9RA 1SC4A 3GJRA 4NOJA 3EDQA 1K86A 3QNWA 4ZVOA 4HQ0A 1RWMA 1I4OA 4ZVSA 3V4LA 4JR1A 4PRYA 3PD0A 4D3ZA 4QTXA 3DEIA 2FUNB 1RHQA 2FP3A 3DEJA 4HVAA 2DKOA 2QLBA 4JJ7A 3DEKA 2H5JA 1F1JA 4FDLA 4QU8A 1RHMA 2H51A 1QTNA 4N5DA 4QUAA 3UO8B 2QL7A 2XZDA 3UOAB 3R6LA 4ZVTA 5IBCA 4ZVUA 4QUDA 2CDRA 3S8EA 4N6NA 3D6HA 4EHAA 4DCPA 1NMQA 3GJTA 2J30A 2HBRA 4NBLA 2C2ZA 4JB8A 4D3XA 2AR9A 2CNOA 3P4UA 2CNLA 3DEHA 5IAKA 3GJSA 4JJEA 4QUJA 5LU8A 4QU5A 5IC6A 1M72A 4AWBA 4N6GA 1NW9B 1QX3A 2J33A 4DCJA 4FEAA 3R5KA 4EHHA 3H1PA 2H4WA 2HBZA 1RWVA 3PD1A 2QLJA 2C2MA 4LSZA 4IYRA 5I9BA 1RWOA 2HBQA 2XZTA 4NOMA 2Y0BA 2XYHA 3H11B 4QTYA 2C1EA 5IAEA 4PS1A 5IASA 2P2CA 1RWXA 4QU9A 4AWAA 5LUAA 1RWNA 2FQQA 1JXQA 3K7EA 1RHRA 1RHUA 4FXOA 3D6MA 1PAUA 4HQRA 4EHFA 3V6MA 5IBPA 4JQZA 4DCOA 2K7ZA 1PYOA 4I1PA 2J31A 4QUIA 4FGUA 4AW9A 1I51A 3V55A 5LUBA 5IC4A 1CP3A 1SC1A 5IAGA 2NN3C 4D3YA 4QULA 3R7SA 5IARA 3SIRA 2H54A 1I3OA 3NS7A
chains in the Genus database with same CATH superfamily
2CXXA 1IK6A 7MDHA 4XFDA 4ODIA 2XUOA 5H1YA 4C4RA 1QQ5A 5IBRA 3LNCA 4K6FA 4DWWA 3HLTA 3PYMA 4N01A 1T1EA 4EVIA 5TPZA 4PS0A 5LBIA 3CNOA 2WHXA 4DBLC 1QPBA 1GTVA 1OI7A 2BHNA 3AEKA 4X61A 5CA0B 1JU9A 1ZOIA 5FOQA 3EQ6A 4R1PA 3RO7A 3I8OA 5I7SA 5GINE 2ZG6A 5JYBA 3PT5A 3VTFA 2P75A 2WVAA 4B83A 4Q4CA 1QWOA 2WDZA 3MWKA 5B7GA 4AP6A 1PFGA 2ETVA 2CNKA 3MB5A 3RBZA 5LMZA 1DKPA 3N9IA 2GFHA 2BMEA 3GUCA 4MNTA 5LIPA 3R3YA 3SHOA 4JQYA 1D2CA 1E9AA 2BVNA 2IF0A 1MEEA 2VI5A 4RCYA 3AHDA 4QXAA 3UG6A 5ILOA 1TIBA 3DZJA 2J5KA 4RBNA 4BTVA 5IULC 2G6BA 2XWQA 3ICWA 5B5SA 4HTFA 2BTOA 5LXTA 2BGWA 2JFXA 3SFZA 3FBGA 3HGQA 3JASA 1PGOA 3VR5A 4C89A 2D5LA 4WXPA 1F8GA 3X2SA 5F3WB 3N8NA 5B1EA 5DCYA 3V6LA 1RTTA 4CLHA 3EARA 1R6AA 1QGDA 1Y5NA 4WOPA 5CDTA 3U56A 4XJSA 5C31A 3RAEC 3F6EX 1KYIA 3V1YA 1DAGA 3E3NA 5K2OA 1PBTA 3OZIA 1SBYA 3IXMA 3FI0A 4NCHA 2EW1A 1P61B 3DJYA 3MJSA 3WG9A 2DWOA 1J2EA 3I2HA 4PSCA 1SKBA 1C9MA 2HKIA 1C1XB 2HHAA 2Y93A 3ZWYA 3CVYA 5BSTA 3QEAZ 1TEVA 1IB0A 3EVFA 4B45A 5DSZA 1AXEA 1VSTA 4EZBA 1GN8A 3SEZA 4A8JB 2PPLA 1A04A 4L72A 4OSEA 2NSDA 5BUQA 6Q21A 1T8TA 2CEKA 2R4QA 1Z0KA 3C98A 3ZI4A 5JAQA 1OFGA 3EZGA 1A5BB 3HRIA 1IEQA 5DLQC 1BDJA 1HT3A 3ZI0A 3WK4A 1Q74A 4TYPA 2B4RO 2QX8A 4AWBA 4ZYVA 2C04A 1W2GA 3PKZA 4O4HB 5GY7A 5E4JA 2PRKA 5KSOA 1DO8A 2YMPA 4C4XA 1O5TA 2JHPA 2R5NA 3KRTA 2IEDA 3N86A 4KIFA 2P9QA 4R98A 1Q7RA 3D02A 3FOFC 3GPLA 3H04A 1X1SA 5EJMA 3QX7A 1LDEA 3W9YA 3CJQA 1Z0IA 1H2WA 2VNIA 3ICCA 5REQA 3G23A 1J2YA 5A0VA 1IG0A 2W2MA 4E4RA 3RRZA 3CPJB 2F43B 4MULA 3VR2D 2ETXA 3EZLA 1QXSA 4KE6A 4KXYA 4N40A 5LXTF 3RARA 3VHXA 3QH4A 3TE6A 1QQTA 2GI4A 3AHFA 4EMSA 2SKEA 2ZBDA 1X2EA 2AJTA 4NFHA 1NM5A 4NV3A 3WLJA 2RD2A 1JFSA 3S68A 1ACLA 3KZMA 3LA6A 1OIVA 3AY3A 4EH1A 1AN9A 3GUHA 3T4UA 4FX5A 1LJ8A 2B8NA 3FTPA 4ZGGA 3JV7A 1P2DA 1EFTA 3CXRA 4M8SA 5E6RB 4A03A 4BYMA 2Q8PA 3F6PA 5HFJA 2AT1A 1Z8HA 2EBUA 3QWIA 3JQRA 1WETA 2ZPUA 4MR9A 2OFWA 4E4YA 1P5HA 1TGVA 3HXLA 1FRQA 3WHKA 5CLLA 1RWKA 3HVKA 4XCXA 1WXIA 1K8QA 2HA3A 3I28A 5IM4A 3IQWA 4UW9A 1H5UA 4W5WA 2PJZA 1H69A 4JLUA 4UVHA 2W6JA 3SIXA 4JKIA 1K7SN 3D54D 1HG1A 2C5SA 4N54A 4O2AB 3LE8A 3UAZA 3PEYA 5AOCA 3L8ZA 4F93B 2JD0A 2QTGA 1IN6A 1M8JA 1U0JA 3C3PA 1W0KA 5KYTA 5KYYB 4GGOA 5JFTA 2H9AA 4JHLA 5IVPA 2OXFA 4KVFA 4EHKA 4MUBA 4RIHA 3EHEA 4TV9B 5IYZF 2B8TA 1QG2A 3OE4A 3PK0A 2Q2OA 5EQDA 1W76A 1N1DA 3L4BC 1RRVA 4XVHA 5DI9A 4NI5A 1R37A 1VE3A 1KVSA 3GT0A 4AF6A 1U2QA 4AROA 2NMVA 3ZV4A 2VZ0A 4QDUA 2O5EA 3I6IA 1Z17A 2ZBFA 2JGDB 3K1AA 3T7JA 4OBXA 3FTQA 4PPYA 1JKMA 3AM3A 1QKJA 4EOGA 2Z08A 2XA9A 5JS6A 2BMJA 1Z6TA 1TA9A 2IS1A 1KO7A 2BELA 2OFXA 4I8XA 2UVDA 4UU7A 4YP6A 2ZI5A 1L5OA 2VHWA 1SCJA 5FL7A 1K86A 1WXEA 2ZJFA 2ACVA 2IYOA 3OE5A 3PXEA 3S2UA 1SB9A 2DYKA 1BDBA 4ZU1X 2FKNA 1GUYA 4FGZA 3SYNA 2RHHA 2QBYB 4KZKA 2ZQZA 4GUAA 4JXJA 1IM5A 5LB2A 5J2TB 4PPNA 5ENDA 1AK2A 2OEPA 1N4DA 4X71A 1FFEA 1NNI1 3WBBA 1LNSA 4ZPJA 1WW2A 3WSTA 1YR8A 3OTHA 4QVKA 2XB9A 1UC8A 2XA2A 4NICA 3VU3A 1VSVA 2O1XA 3KUKA 1K27A 2I4IA 2VQ3A 2Y8EA 4OQFA 4H15A 3SC2B 2A84A 1DIAA 2AJCA 1NMXA 3NEYA 3NHRA 4N8EA 3DFIA 5FFNA 3DTVD 3NEPX 1FXUA 2A3RA 1P31A 1GQOA 3H2GA 3ZS9A 1OWMA 2BFCA 1XMPA 4S24A 3WB1A 3FMOB 3T7KA 2HMYB 1B0PA 3TJZA 4D26A 1E92A 3LDGA 4BBZA 3UUWA 4J90A 4E5YA 3MJ4A 4OHFA 1QX3A 4HFRA 1ZISA 2ZVJA 1VI2A 4MV5A 4DOMA 2QAGC 3R4VA 2BE7A 3RHTA 1IOVA 1TW2A 1Q95A 3G2QA 2G9UA 3JYQA 1UH5A 3P32A 3F5DA 4Z9FA 4D57A 1BA3A 3EXEA 4FYYA 4MQEB 1HYGA 2VSYA 1JKJA 1QIDA 2HSJA 2DWPA 3I39X 3MFQA 3DV9A 4MS1B 4NZZA 4R6XA 1KDRA 1RZ3A 2X7JA 1C2TA 1NVTA 4G41A 5JZSA 1IMOA 5ALKA 3A27A 2EJVA 1SUPA 2IYZA 3SEQA 4G1UC 3V8BA 2ZJ6A 3N76A 2O8VA 4EAAA 1ORVA 3LHKA 4EG3A 3IO3A 1HL3A 4MUNA 1XTRA 3B78A 4GP7A 2EX4A 3IPYA 2QDXA 3HRHA 3KBBA 1TCCA 4XWYA 1NU6A 3B5IA 4F8JA 4XUEA 1BX3A 1OVGA 4BVLA 1WHTB 1RLUA 4UASA 2QMOA 4JDPA 4DQDA 3HI6A 3JSXA 2QNRA 4HATA 4WASA 5IK2A 1Y1KE 4NBNA 5AVOA 4TT3A 4F2WA 5BQ5A 4MQMA 2IRWA 5EHIA 3DBHA 1I32A 5G02A 4IJ6A 3BGDA 1DRVA 2MTBA 3UT0A 4UZFA 1H0HA 1U0GA 2OBBA 2QMEA 3T3IA 3JQ9A 3RB8A 3GUZA 3BWCA 1GZSA 2C7OA 1Y42X 5CT9A 1WF3A 2C0PA 2QDKA 3TQQA 4DJJA 4C6TA 2AEJA 1WU8A 1LRJA 2P0AA 2ZSJA 3KFLA 4Z1OA 1V47A 4C03A 2V97A 4P4TA 4YPOA 3G2NA 4XRGA 2P6PA 3E9RA 2WAOA 2ZIZA 1TM1E 3F98A 2ODPA 3L46A 3QX9A 4LV8B 4TL8A 1JIXA 2J6CA 4JL8A 4D9EA 3B6IA 4OGLA 3ZWMA 5AJHA 1WZ2A 2F3PA 1XCLA 3IIIA 1DRWA 4MIEA 2BP7B 1X7HA 4FJ2A 3ZWXA 1H93A 4OYYA 2CZQA 2QZJA 4PZDA 5ALQA 5DHPA 3WLSA 3ROXA 1NM5C 4E1VA 1V43A 3ZCXA 3BRWD 3C24A 5J9FA 4AJ2A 1EINA 4FFSA 1E2LA 3B8HA 4PRZA 1I4EB 1MJNA 4MKGA 5LXTB 2XRFA 3PUKA 3QU9A 1ZJ4A 2OFFA 3KIPA 3OZ7A 4GPD1 3MS4A 5K45A 1SB8A 3I4CA 1J1ZA 1UP7A 2YZNA 1A5ZA 1IY1A 2PIDA 3HR7A 1N75A 1UPXA 4IDGA 4LVOA 4OK5A 4P2BA 5LKRA 3C4QA 4EPTA 4WY2A 5KQRA 4X92A 3TQCA 2W4IA 3Q7QA 3EVEA 5CGZA 4Q21A 5KTTA 2BEWA 4KLCA 5EZQA 4GEKA 2X2FA 1MRSA 5J2UB 3QKTA 3N2LA 1NW4A 3K5HA 1TVMA 3B9QA 3NIBA 1PU2A 5DU2A 2YH2A 5K6TA 1M1YB 2JAUA 3FYUA 1W5FA 1L7EA 2JBHA 1FUYB 3PA8A 1V8BA 1WS6A 4GKVA 1QIKA 4J1TA 2V4UA 3TI9A 6GPBA 5I4KA 2EDCA 1TUGA 3QI7A 3NHUA 4R69A 1KXZA 3WGJA 2P6RA 4BNNA 1H0KA 2K5UA 5BNTA 3GCXA 1YBFA 2QK4A 4TMWA 3ADBA 3O8CA 1SBQA 1ORWA 2JCXA 3A9RA 3PX3A 4HDKA 3I6BA 1MJ5A 1DIHA 2OWDA 2R1UA 3JARB 4HB2A 3V8EA 1OZ0A 3TLCA 3Q7IA 3X3HA 5JMWA 3GZNB 3BSSA 3CFYA 2UV8A 4JAVC 4XQEA 4DA4A 4W5RA 3DVLA 4IDCA 1J56A 1KEZA 1O2DA 2B4QA 2Z56A 2AN1A 1T4GA 3OF2A 2X42A 3R77A 5DK4A 1H6BA 2OCDA 2VYVD 1OF1A 3G5AA 2IOYA 1SU8A 3PENA 4ER5A 2AL7A 2AQ8A 1THGA 3IOYA 4KMRA 1BFKA 1RCUA 1RI3A 5ERXA 1JQBA 3OURA 5REQB 3ZLTA 2I1QA 3RABA 1XYVA 2GN0A 2OQRA 2MYTA 4H3SA 3SEAA 2V0GA 3PEWA 1K97A 4EGAA 2Y1WA 4HQRA 1HG0A 1XR3A 3AV3A 4RD1A 4P83A 4PZPA 4OHOA 4EJ6A 4X62B 2XRMA 1KIMA 1WCYA 4OMUA 3U9LA 3ZKWB 3GVHA 2GOYA 5EQTA 1Z38A 3DTYA 3LS2A 3Q3IA 1SO8A 2BM9A 3HBJA 4PZAA 4PN3A 3FSRA 1DZ3A 1B8VA 3P71T 1QX4A 1X86B 1Z5NA 1WUYA 3IAS1 3K72B 3OWOA 5HHTA 1X7ZB 4OQQA 3TCXB 5E2BA 1ND5A 2Q5OA 2EJUA 1YB2A 3IT0A 1U1DA 4DV7B 3D3QA 5KHLB 4WL0A 4NHEA 1EA7A 4M55A 4FYJA 3FMVA 4NZOA 4S1OA 1T13A 2QE7A 3CKMA 4V0KA 4UC0A 1ZJZA 4G67A 4BBPA 3V4PB 2QD5A 1M7HA 2FQ1A 4CDMA 1BHO1 5DWVA 4ZYWA 1ADBA 1XFAA 4M98A 3V4OA 1I7QB 2FR0A 4NENB 1KFCB 4DNPA 2WU8A 5A7FA 1Z13A 1YR3A 2FWNA 4O2AA 5TY0A 4N3AA 5HMLA 4JR0A 3D3EA 4G5YA 2GM9A 4CTOA 2X4LA 4BL5A 1ZKMA 5G0SA 5CFRA 1TYZA 3X44A 1JSZA 3V00A 3VR1A 3OH8A 2OOKA 4KQWA 5HKBA 1L3IA 2GZMA 2C2KA 3OJWA 4F12A 5HM6A 2I4TA 4ASUD 1X7GA 4G0UA 5AJUA 3PGVA 4JMPA 3W34A 1WXWA 4BNUA 3DAOA 4H4CA 2WKWA 1KOLA 3ZXIA 4XUCA 2PKEA 2FPGA 4M0FA 5TJHA 1WVIA 3BKXA 2PM8A 2W6MA 3VYWA 2VAMA 3WJ2A 4B3RB 5EPOA 3IODA 3SYKA 1VJCA 2I7XA 3D3WB 5ECWA 1TVEA 1OIWA 3H42B 4II2A 3G7SA 1UC5B 3S1SA 3BBLA 1A95A 2AW3A 1A8SA 2QRMA 5ALEA 2OK7A 2IGTA 2VC2B 2WFLA 1B0ZA 1L5LA 2PS3A 2Q3DA 2E5LB 4XOUA 1EU1A 3MJEA 2BI8A 2VVTA 4X3CA 3RS0A 3OFNA 5EKTA 3V3TA 5J4KA 5DNYB 1O5OA 2R62A 3L7JA 3TM5A 3FUUA 2ILVA 5AHWA 2PLAA 3EMBA 3IP7A 5M5BA 1ZOPA 2ZAYA 1E1YA 1YI8A 4J3FA 1W5SA 4I2NA 5G40A 2V6GA 4J0DA 3UJAA 4NZMA 4MQBA 1CETA 1H2EA 2C07A 2GBCA 4JLSA 3TXXA 2O3TA 2DPYA 2X14A 4ILKA 3VVLA 1XA4A 4QFDA 1B3BA 3ZGXA 1U8EA 4XGIA 4CMKA 1YACA 2WKQA 3WYEA 1GQSA 2CFOA 2HRCA 4KVAA 3QE2A 2E18A 1EZ1A 1OTXA 2CJPA 2FDCA 3U7GA 3ZWAA 4JBXA 4G5HA 1I30A 3EVCA 2VAPA 1LSSA 4M76B 1SCBA 2YTZA 2XCRB 1VLZA 3I0ZA 1JQ5A 4LBYA 4HKTA 1UBSB 2QTRA 5JADA 5A3RA 5DTMA 3ZCUA 4MW4A 3KHSA 4BKQA 1Q0ZA 1TRHA 4ZO7A 1RYYA 1QH8A 4G26A 4BO2A 1CJSA 4HGPA 4G1VA 3RT1A 3T94A 5LA6F 2A78A 1N2IA 5JCOA 4A4DA 5DHRA 5DOZA 1PJQA 5EGNA 5DN6A 4GX0A 1PFYA 3W2EA 2GDJA 2XI4A 4V3CA 1M1YA 3FYUB 1I8TA 3ADDA 1TMYA 3FRJA 5AXAA 4UU8A 2IP2A 3KAJA 1JB1A 1FYWA 5CLFA 1XE3A 2XITA 2ZYSA 2OG1A 3LKZA 4M38A 4RA6A 3UAXA 1MD9A 4F0JA 1DLJA 2Z1DA 5C8XA 9GPBA 2DG2A 2J9YB 3IPCA 5JQGB 4CR6A 4EW2A 1GEGA 4EO7A 3OZTA 1IOZA 1NFFA 3FFXA 1QR6A 1F38A 4JBLA 4QNNA 1JVBA 3BGVA 4YMHA 2EGGA 3MOIA 1QVAA 4LS3A 1KOJA 1IM2A 2A2ZA 3FMPB 4IZHA 3KOOA 4RZUA 5EIHA 3T7AA 3T3NA 1BX0A 1W88A 3NUZA 4GDMA 4TYMA 5C4GB 4HEQA 1OHHD 4H7KA 5AW5A 2XA1A 5K8VA 2VDWA 4ZV9A 4OKSA 1LGYA 3NGLA 4Y6SA 1NAHA 1DV1A 1G55A 1GFZA 4NK4A 3REQA 1GJRA 1QHFA 1YULA 2CXRA 2MSDB 5BSMA 2WAAA 2QX9A 3NYIA 5YASA 3IQXA 4KXLA 3WMEA 2JLQA 2RH8A 3B36A 2ZPTX 3F4KA 3LPLA 3ZDFA 1SKYB 2BGKA 2ZT6A 4NAUA 4D3SA 3LAWA 5T3YA 3DLPX 1ZN2A 3HSSA 3V9PA 2NTEA 1FMJA 2WABA 3M5PA 3TIGA 2ZR7A 4TXJA 4WK2B 3ZGYA 1NBIA 1SFRA 1N1EA 1P2TA 4WNAB 3FOZA 3IEMA 3HO1A 1ZA1A 3E0XA 3SP1A 3IAM6 5K20A 4HDAA 3AIMA 3O74A 4BO6A 5IJ0B 4C2AA 1L5RA 1CY4A 1HDOA 721PA 3BDVA 3HN7A 4MCAA 2WP0A 1LSOA 2Q4TA 2WJWA 2N9UA 3QXXA 4CLEA 1F4VA 4MLCA 4GKAA 4R9RA 5B1DA 3LUFA 4UTOA 5TV2A 4A2PA 1WU7A 3NJ4A 5CHYA 4ZMRA 3SXUB 2ZOSA 3DE3X 5I7VA 2IYQA 4QJ5A 2O05A 4YACA 3TLMA 3MTEA 5JH7F 5FADA 3J81k 3KR2A 1GXSA 1KI6B 2ZDHA 2XLCA 3JQGA 4KIUA 4OB6A 4B80A 1X38A 4HHEA 4ZGWA 4I99A 4PAMA 5I7UA 4M87A 3F6BX 1FY2A 3ZHTA 4MWEA 4ESVA 2HD4A 2D2EA 1GU0A 4QBGB 4JYZA 3ZBPA 2ORVA 3MT9A 3PWKA 1T6ZA 2AR9A 2XQFA 1N32B 4RANA 1Z4QA 3LYLA 1XNJA 3H9EO 2JGMA 3SIWA 5IC6A 2VTKA 2V54A 2AXNA 4XDHA 4A6XA 1NJ2A 2VF2A 5EHGA 4MGZR 3BTVA 3OX1A 2A9OA 2DPLA 3K09C 4EDFA 2WF6A 4WLOA 1SD2A 2VK1A 2RBEA 6NULA 3I5MA 2B99A 3SX2A 1XMJA 4A7PA 5JS1A 4ETMA 3GAAA 2FX5A 1JHXA 4E11A 1AN0A 1QIGA 1ZK2A 2H7CA 4TLEA 3GN1A 3SZRA 3T8YA 5GVSA 3GI1A 1X92A 3G8AA 1X1QA 5DHQA 1IK4A 1O96A 1PBNA 3PUVA 4BMNA 3KPWA 2FQQA 3ZLBA 1XROA 2I2WA 3ZJVA 3IDQA 4RFVA 1GZ3A 2XQGA 3CEJA 2PX8A 2X9GA 5LJLA 1E1QA 3VPCA 2JFVA 3DL4A 1CUIA 1DU4A 3I92A 3Q10A 3RUCA 5BT9A 5AFSA 1P1RA 1TZKA 2B2CA 3PUHA 3BMCA 3FI9A 7REQA 1QK4A 3NALA 1X8KA 3AEXA 3R5SA 3JSAA 4I4CA 4LWQA 2OMKA 4QJ4A 2R85A 4RZXA 4YPFA 4NS4A 4LG1A 4E88A 5AUOB 1SXQA 3W78A 3ZZUA 2HREA 3GLHA 1K7YA 3DE7X 3NPMA 3TWOA 2D7CA 3LBAA 5BSHA 1PR5A 4F91B 5DLEA 3UPTA 1G8YA 1E18A 1IOWA 2VYVA 2QVLA 3UPUA 5A1TA 3LY7A 1H4VB 1YKFA 3N1UA 2J3JA 3WXBA 1Y48E 2Z3ZA 5IMBA 5A6VA 1KIFA 1C80A 1OPXA 1BQ4A 1JDZA 1A4IA 1W1UA 2VPTA 4J0EA 4MCIA 1RI2A 1NR5A 1V95A 3W1VA 4PGHA 1E3LA 4BWGA 4H31A 1IXZA 3A6JA 4IOMA 1KYZA 4TQ9A 2CXTA 1MEOA 1SBIA 4K9LA 1X9IA 1W36B 2A9QA 2I54A 3REFA 3KPUA 4HV4A 4LXUA 5IU6A 2HEGA 1E1RA 1ZW6A 1SEPA 3F2IA 4R0MA 1JQKA 5KTOA 2W2LD 4C0BA 2QA5A 1FP4A 1Z12A 2VPYA 3UQYS 3WS7A 2NZYA 3H05A 4J91A 3SQOA 5LD2C 3AIIA 3DOFA 5D8DA 3ROQA 1RJWA 2NU6B 1M5UA 4OIFA 5ALSA 2P7HA 3PQ7A 3V1NA 2H5EA 3J7AC 4DLTA 2FPMA 5HUJA 2PE5A 5E6RA 4EA8A 4C3OB 1BFUA 3UUEA 3W8DA 1DQYA 4EP1A 2IU4A 2JCBA 4MR9B 3L7YA 4RWZA 1FP7A 4HXGA 5JJBA 4R5HA 3HPQA 4RSMA 3Q6MA 2DFTA 2GCPA 3JQ6A 4W1PA 1M2EA 1YZFA 4DUPA 1FF9A 1ZIOA 2UYCA 4CEHA 1KS9A 4AY3A 2JC3A 3HJGA 3RC3A 3BWMA 4EARA 4FNMA 3TOCA 5I9NA 3BG5A 3CSUA 4DV4B 1C4XA 6ADHA 4IWYA 4BN5A 1UBHS 2WE8A 3HEAA 2WWTA 3RD5A 1Z6AA 2QL7A 4FINA 1EP1B 3F5QA 3FTDA 4F85A 1EWRA 2XZLA 2BGRA 4DABA 1WCXA 3TKAA 4DQ0A 1IVYA 1FDWA 1N9GA 1OWOA 2EKPA 1H2HA 1ZIYA 2F8MA 2J07A 1RCTE 3CUVA 3PUJA 4QU5A 4FK8A 3BXXA 2B69A 2ZSUA 4EHHA 2A5JA 5BY2A 5JVDF 4KGVA 5DRYA 5A02A 1F8FA 1THZA 1PDVA 4MCHA 2DUUA 2QD1A 1E3WA 4UHFA 4UREA 1BWQA 2WF7A 1UMBA 2OCKA 2VK2A 4P4UA 4WOJA 4HK4A 4TVSA 3OIVA 4XW2A 4GYYA 4KEAA 2HHJA 4M8KA 5AKGA 3CIOA 4PBTA 4ISBA 4M1YA 3M8KA 2I29A 3DAGA 4U02A 3INYA 1RHUA 4K28A 1L5GB 1ADJA 2WINI 2BKEA 1N2JA 1ZVQA 3U4MA 4FFLA 4NU6A 1JXMA 1E1CA 1L1QA 4IXTA 1HYHA 2K7ZA 2IW3A 3FNFA 1REQA 3CTPA 1W0CA 4H0CA 4BGIA 2PYZA 1QBGA 2H1CA 3EJ6A 3BWYA 4DM3A 4K0RA 2D1RA 4ZFNA 1VJRA 3A9UA 3P9KA 3D0OA 3R7NA 2V74B 4EG6A 2O50A 3DTTA 2C57A 3EULA 4WWHA 3EYWA 2O8FB 2EWWA 2YHBA 3D43A 3KR9A 3T52A 1I3KA 4FZVA 2V7WA 2BFBB 1JALA 5L4NA 1QH9A 3FR7A 5JZMA 1DKNA 1JBKA 3E2PA 1AQ6A 4TRNA 1KMCA 4N7MA 4IOJA 1CV2A 3A06A 4LUCA 1MEJA 3ENKA 4GYKA 4PGFA 2I2AA 5CDGA 4YBRA 4ZCMA 1DRKA 2ROQA 4L02A 5U4QA 2D4AA 3ADKA 3DZIA 4R8LA 3UW3A 2FKAA 3JYLA 4PHGA 1MB4A 1ONBA 3PQEA 2YFHA 2R97A 2C2WA 1ECPA 3B6EA 2X9VA 4RSHA 2BC9A 4X8MA 5A6SB 1NIJA 4PO3X 3IBTA 3WNDA 5C1BA 3ZBQA 1BU8A 2GJ4A 1NKSA 4LXTA 5BO5A 4R2HA 5FTMA 1SVOA 2CKDA 2ZTHA 5HDBB 1ACJA 4FYPA 3TAUA 3MCTA 4A23A 3GRFA 2ZIEA 1O4VA 1U98A 5EERA 2MDTA 2EATA 3C43A 5KOJB 1CB0A 5CT8A 2A0WA 1PWHA 4L5JA 3M1AA 2LW7A 3T61A 3MT8A 5HRUA 1M67A 1MX5A 3EE6A 3X2FA 3WFJA 1BKSB 1KY3A 4O0MA 4Q1VA 3BORA 3RTBA 4KXQA 4RQBA 3NONA 5HIMA 2GEUA 2Z5GA 3HNPA 3RBXA 1Z22A 1DQNA 3NHZA 1UT6A 1FYFA 3I53A 2FZ5A 4H7PA 4OLFA 5BRAA 3KELA 5C7OO 2HC9A 2VZEA 3TUIC 2ODTX 4C7VA 4ZVNA 3F73A 1XLWA 1TZ2A 2ZB8A 3TD6A 1R4NA 1Z29A 4HZUA 2H4JA 3B3JA 3SE7A 2ERYA 2WE7A 1IAQA 3BAFA 1NMZA 3RBVA 5KNDH 3W9BA 1XRPA 4UBJA 3MJRA 1ZJWA 1C5KA 2MMCA 1EK0A 3UJ7A 3PC7A 4ZANA 2FPLA 3QFRA 4FYIA 4HZGA 3FYDA 1R0RE 1M66A 2AWOA 2MSWA 3CCCA 2PMWB 2R9VA 1M3SA 3MM4A 4GMGA 5CUQA 4C3ZA 4QJ3A 4YCLA 2XCUA 2BP7A 4U4AA 4GBGA 1DQZA 4MTCA 5LOVF 2ZXEA 3EUAA 1NW3A 1ZH8A 2GEKA 4X64B 1AS0A 2I4MA 1D1SA 3DD5A 1QZZA 1FS5A 4TTSA 4RMNA 3ZDQA 4F06A 1O94D 2AFVA 4LCEA 3L4SO 2CNDA 3MIIA 3SJCA 1KY2A 3H6KA 1S8FA 4M0DA 2PJUA 2KI5A 4WFQA 1CYDA 2X0IA 4U3JA 4H2DA 3OOEA 4OYHA 4G0VA 3FKSA 2CCKA 1VCIA 2QN9A 3SZLA 4C0KA 2PA3A 3GGCA 3D81A 1U1EA 2DBRA 4IVPA 3FLMA 4UVIA 5KYWB 3C2QA 3QV2A 4QGGA 1HGXA 4IICA 3GAZA 1OUMA 3U5TA 2EGUA 2A57A 5G53C 2L17A 3PUIA 1GARA 3EPJA 1M1YE 4BQNA 4HDMB 4I1YA 2RCYA 1XAJA 1GPMA 3VRHA 4ARZA 2XE4A 1BAPA 3CGWA 5J2UA 1AHPA 1BH2A 4UNQA 2O8CA 2I6SA 3A4LA 3L0ZA 4GFDA 1EG7A 1UXGA 4GBMA 3V4SA 5FUMA 3A11A 4YMUA 2QZ4A 1EKXA 4R1NA 5B2FA 1GYRA 1X7WA 4E6PA 2MIIA 4G8BA 1NWHA 2JL1A 3CH6A 3GDOA 1Y3FE 2GPJA 3G0IA 4FYWA 4MDEA 1H2RS 2EQ5A 3O82A 3VNRA 4ATNA 4K0KB 3R3JA 1ARZA 3EDCA 3RS7A 1BJTA 4G56A 5CNKA 2YVQA 4FXPA 2R3SA 4TT3D 5CBKA 4RACA 2ZSDA 2JH9A 3SBEA 4CJXA 5HKKD 3KKMA 3QBTA 3AIKA 4JZYA 3AVVA 1RRMA 1INLA 2Q9AA 5BVHA 5L7TA 4KR7A 2ZYWX 4YI5A 3LH5A 5KNCA 3AY0A 1ML4A 3A3NA 3TPFA 3VSDA 4Z1MD 3ZXXA 3NUGA 4ETIA 4F3NA 4BJ3A 5BP7A 1EB9A 1YZLA 5ALFA 5E7QA 4LJAA 1XMOB 4OXIA 4JYBA 2JFFA 1XTKA 1UJ6A 4YRQA 1DSSG 4W6QA 1EUCA 1OXSC 1KE2A 3EGOA 3Q8XB 4EB6A 3HMQA 1HFEL 4AZTA 3QKIA 5HQJA 3DEYX 4N12A 4S2UA 3BCRA 3I1YA 3NEAA 5B2ZA 1HNWB 4P3PA 4YCMA 2BFOA 5JO0A 1XTUA 2QYSA 3OU7A 1KSJA 1U7DA 1FYDA 2AZXA 2X1HA 1G6KA 3KUDA 3P0EA 1RE0A 3CEAA 4FP9A 2KLBA 4HMQA 4MS3A 2LVBA 4LA4A 5EN4A 1U0HC 3VO9A 5FH9A 5F64A 4NBRA 1EDBA 4F3RA 2JJ1D 5MFZA 1YNSA 1YUMA 2F1KA 1D7OA 4Q9KA 3BKWA 1A71A 1G3RA 4ZEWA 2IH4A 3WGMA 3S6JA 1WZNA 2GNAA 2ERCA 3KYDA 3KZCA 3QVKA 3VR6H 4ZI7A 3R6LA 4AZVA 3SYTA 4MYRA 1OMOA 1QQBA 1QHXA 3L5KA 1RRGA 3UKDA 3D7KA 2XX3A 3F5MA 4NEGA 2H1OA 2XUQA 3EIQA 1KH1A 2OSBA 3PQ8A 2GSDA 2WD9A 3CX8A 4J9VA 4ND7A 5G3YA 3T54A 4LJKA 2IW1A 1QF9A 1N9GB 1NIPA 2YW2A 4LCJA 4PCAA 2A5YB 3HZZA 3CYFA 2QGNA 3PHCA 2IWHA 3I5XA 2PXAA 1NXOA 1RYFA 1RWVA 1LV8A 2QX7A 2YY5A 4MICA 1H05A 4PHTA 5BW8A 2WKRA 3PCRB 2TMGA 4C0HA 5TXGA 3CVUA 5EE9A 1DWOA 1W4ZA 2H0AA 1HC7A 3SQWA 5ALHA 2HWXA 4U2BA 3OM8A 3CURA 1NW6A 2SKCA 1ZUHA 4R8SA 3TRDA 3WOHA 3A6GA 5HBGA 4PQFA 4R83A 4H6XA 5JJLA 3HL4A 5EY5B 2GPAA 2Z1NA 1P2FA 1ZD3A 4DEXA 3WL7A 1ENPA 2JAOA 1DIGA 1V3UA 2RGRA 1EVLA 3GNSA 2PU5A 4R2XA 1J7JA 4EUKA 5CH8A 2R8OA 3ADCA 1DAIA 3RNOA 2FRVA 3HM9A 1I9CA 1Z16A 1PR4A 2F67A 1MC1A 2RB5A 2NU9A 5K3AA 3F67A 1WDLA 4K2HA 1SQ0A 1IHXA 4ZXFA 2IPAB 3AB8A 4YMLA 3LXXA 1IN1A 5FDFA 2K7FA 3KSRA 3M9LA 2VWPA 5CTJA 3W5AA 1XQVA 2TMYA 3F74A 5E2IA 3RAJA 1PEYA 5ADUS 4MPDA 2HK7A 4JQSA 1V11B 4L5YA 4TWJA 5BNZA 4KFSA 3HXPA 2NO4A 3WMRA 4GMFA 3PGKA 5DV9A 3QUCA 1KSGA 3PHLA 4YRIA 3UJBA 3V2HA 5JDIC 2XTZA 4WTOA 2ZWIA 3KP1A 1NBMD 5THXA 2FX2A 2LRHA 2EYUA 4JLKA 3BHNA 1RWQA 1UJNA 5HF8A 1L7QA 1P8AA 5DO9A 2C7VA 1P5FA 1EQ2A 2RAFA 4L5IA 1A8UA 4DR3B 4NCNA 4MV3A 5JBIA 1YDMA 4C22A 1DJQA 4BRSA 4B4WA 4RZ3A 3PNSA 3L01A 4EW6A 2OT3B 2OP0A 3BRCA 2OHFA 4D4GA 1GUBA 3ED1A 4B7AA 3ZHYA 2H4HA 2LCQA 1EBFA 4EW1A 3RM3A 3T5PA 3R5HA 3RSFA 2IZ1A 1V7ZA 4GLFA 4MHSA 1RLJA 1AS3A 2EEPA 1I80A 2UYYA 5D7NA 4QTTB 4A0HA 1E4OA 2XOEA 4QTZA 4BRWA 2VDLB 2BKXA 2YHAA 1A9OA 4I7EA 2BI4A 5LP6B 1SBCA 1YS4A 2R4TA 1T91A 4TMYA 1DINA 2LZ0A 1GUFA 4LJ5A 4RVNA 1NW5A 3RIHA 1UT5A 3QYPA 3UYKA 4ZKDA 1VL5A 2Q4EA 3KKLA 3ZW8A 4R0NA 4Z99A 4D4MA 3QXHA 3TZLA 3HCNA 4YHBA 1RACA 1R0WA 3WXMA 5ADVA 2HA7A 3HH8A 4EX7A 5CAEA 2R1ZA 1I5RA 4TKLA 4FFMA 4LHYA 4ISCA 1T34A 3BDAA 3SKXA 1O6GA 3CR7A 1X42A 4AN0A 2C4NA 4MHTA 4P0QB 3LT4A 3QOWA 3TH5A 4Q7MB 3RS5A 3FUVA 5GGXA 2B1IA 1KAGA 3UOAB 1G42A 1BA2A 1GNVA 4P38A 2GEBA 3MWEA 4X45A 2B5VA 4RHYA 4UZSA 5E0KB 2OAEA 2R11A 1W8DA 4GPZA 5KVSA 1RI5A 3GJTA 3VPAA 1J5EB 1G291 4Q9AA 1Y3AA 1H65A 1T4CA 4FQ7A 3K9QO 5E4YA 6ABPA 5AQEA 1W85A 4DPLA 3PT9A 2PLNA 4GOKA 2WWXA 3IB3A 3L8FA 3DDHA 3ESXA 4HEHA 4HF7A 5ENZA 3D5TA 4H7EA 3FVWA 3L1KA 3L7MA 4TS1A 4XD7D 621PA 3DCYA 4I9GA 4MR7A 2Q3EA 3DL7A 1RWOA 3U7QB 2DKNA 4JC4A 4GL4A 1NUUA 3N2NA 3CISA 1XLTA 2ZR8A 2DETA 1AGRA 3HB0A 4TMKA 1OC4A 3M6IA 3HLYA 3UUFA 1OXBB 1GZVA 2QN6A 2ORYA 1UPFA 1I3MA 2Q3MA 3UJ3X 4RTSA 1Q7BA 1Y5IA 2KB0A 4YO8A 1ADFA 1ISFA 4O25A 3E2IA 1UBNA 3EGEA 3MGKA 3FTEA 4M86A 4M8NE 1VL2A 3L0IB 3L7BA 5D1NA 3L7LA 4QHSA 2IV2X 2YJZA 3SIRA 4JEHA 2PMDA 3WY9A 1JG2A 2UU9B 1WMFA 1X70A 5EC8A 2C8KA 4G0PA 1XPOA 1U1GA 1EHYA 4BMVA 4EG8A 4ENRA 5A7GA 2OV2A 1Y9DA 3EK2A 3F7NA 4MVJE 1WSDA 1W34A 2C7PA 1EVIA 4M89A 2PGOA 4B17A 5BNIA 1ESZA 3KB6A 1M6VA 4EHDA 5KJFA 3T1HB 1ZICA 2O57A 3VM6A 2UZ1B 4EL5A 1QAMA 3ZR4B 2JHFA 3H83A 3PEVA 3VU9B 3OE7A 1E8MA 4RVGA 3H7IA 3SBOA 3WAKA 1XTBA 2ZWAA 4EJSA 4JI0B 3CRQA 5F9HA 1KU6A 3KQNA 2QU7A 2W2TA 1CDEA 5DXJA 4PSUA 2GKGA 3MC1A 2FSPA 4UUNA 3QOFA 2FFRA 1BH6A 1GNTA 1V9LA 2YVAA 1O08A 3M5DA 4RH3A 3NV9A 2EG9A 3JD1A 1DC7A 2IDKA 2Y1XA 3H5IA 3OFKA 3PSHA 4U2KA 1TQ4A 4BOYA 1U8XX 4EL0A 4YRMA 2F48A 4Z3OA 4QDOA 4CQMB 3UC9A 5ER6A 3GFRA 1XXHE 3W3AH 3A4NA 3BH0A 1CRPA 3HBAA 3DZCA 5FOSA 1SXHA 1DRJA 4DMRA 5HFAA 3OLYA 4F5YA 2Z4TA 2FP4B 1PRYA 3UK2A 5JZVA 3CMCO 4RV9A 3ZDBA 1TNDA 4BO3A 4OX9Y 1ONOA 4H27A 2HNAA 2XD9A 4QOSA 1XPJA 2GASA 2NZ2A 4WY8A 3HUFA 4YWJA 1S5PA 1ZNWA 3VFDA 1O94C 5KTYA 2IZZA 3JTMA 4TWAA 5COAA 5E6SB 5KREA 1EE9A 1XU4A 3IB6A 2OZLB 1IQPA 4HQ0A 8GPBA 4R41A 2FJPA 2PFGA 3IAHA 4IM7A 4RKQA 3U3JA 4E3ZA 1W93A 2EBHX 4DA7A 2Z04A 1EIWA 3DUFA 1ZHFA 1FNSA 3O3OB 2WSMA 2OVBA 4MV7A 1H4QA 2J8ZA 2WP8J 3WK5A 4TMXA 5JFGA 4LWPA 4C7OA 1B42A 4N5HX 4K40A 2V96A 3M3HA 3ZXSA 1DEAA 5IM5A 4QGAA 5FWYA 3EYAA 4UHJA 1W4CA 1CP2A 5F21A 3ZH2A 3M7IA 2ID7A 2PVSA 2ZB2A 4RGYA 3H3JA 4ZO4A 1XC7A 2WSSA 5C3UA 1NI5A 3IBGA 1M10A 4IH4A 1VYVA 3ZD6A 4F2DA 3L1HA 4XPIA 2NAFA 2B61A 3IAXA 1FSFA 4AB1A 2NACA 2O2ZA 1BXKA 1NHWA 4ED9A 1UAAA 4ZGBA 1PD0A 1JUDA 1VJGA 2AOTB 4M1OA 4NR0A 4L57A 3HFJA 4IG4A 3WKEA 1HI9A 3C70A 1KVQA 4PX3A 2GWHA 1QLHA 4EUSA 1VBKA 4V0NA 5KNDD 4BGDA 2AR0A 3BTSA 3G8BA 2CKMA 2YDXA 3F7TA 2CUNA 3GJ6A 3UH0A 4ONEA 3CRVA 3ZHSA 4UMVA 5ALUA 3WQSB 4OUDA 5J2TF 2XKJE 1WKVA 4LXGA 1IWPB 2VOJA 3UWSA 4A8HA 1SIUA 1E3JA 4E2WA 3X1ZA 3SVTA 4CIVA 4YONB 4JODA 2RGEA 4I4IA 2NQTA 2H2DA 1CUBA 4YC7A 2H07A 4ENWA 1OJLA 3G2PA 5B64A 5CDFE 4A6EA 3AVYA 3LPMA 2VP5A 2QM3A 3EHDA 5D84A 5GOTA 1POXA 1BCSA 3FWZA 3EXAA 2ZCUA 1D4ZA 4KNVA 4V0SA 2BCGY 2ZXFA 1G63A 4FDAA 5EXDA 4YIHA 4PC2A 1Y9JA 2OUKA 5FLKA 5ICEA 2B4KA 2UXDB 5TLSA 2V5UA 4K87A 4UHCA 4YJHB 5EG5A 4DA0A 4OQ4A 1VA5A 2NXEA 4XGQA 1YR6A 5LUBA 4R1UA 1M2GA 3SHTA 4IW3B 4C5CA 2VZLA 1JG4A 2BWJA 5CT4A 3KCNA 1P2VA 4BO4A 5JNRA 1THTA 1IJFA 3LIIA 1XN1A 4QDTA 2BV3A 2EFEB 4W5HA 3U40A 3ONVA 4B44A 3P20A 1JEOA 1JI3A 1GFIA 1Y82A 2FFJA 4RY2A 2CLFB 2LWIA 4URFA 1PK9A 2VLIA 3JD3A 5MN6A 5F76A 2GM4A 1N0IA 3KG2A 4MVJI 5HW0A 5B36A 1ZU4A 4KQFA 1K88A 5DX1A 1JFRA 4C2TA 4BNIA 2ZIWB 4KIWA 3MWJA 1MFZA 5J1SB 2XHZA 5TQ2A 3JAKB 2GZRA 2I1LA 3QZUA 4IGFA 4BFSA 3NM4A 3K70C 3OZEA 1GIAA 1KJJA 2H6EA 2NSLA 2Z2JA 1FFGA 3OQVA 3DAFA 2BY4A 1YZ3A 3FGZA 3TCNA 2OCXA 3DHWC 1E2UA 4D4HA 1G5QA 4YRKA 5BXQC 5JG7A 2R8EA 3D4OA 3H4VA 3AL0C 3IP8A 2ECPA 1FVOA 4NYIQ 2OXTA 1PI3A 4N0EA 1ONSA 1U0LA 3S5UA 1O57A 3TUJC 1L5SA 1CR2A 5DT9A 3GF4A 3QHAA 1X0VA 5COBA 4M8LA 4LZAA 1LBHA 4DUGA 1QU2A 2W6ZA 4BVFA 5J4LA 3D7SA 4OXQA 3T1YB 2GO1A 4Z49A 5AUQA 3HB4X 1VB3A 2H1VA 1SC6A 1RI4A 4JXKA 3T38A 1NF9A 5CCEA 4WH0A 3NFRA 4DV5B 5CG2A 4DV2B 1G6Q1 3BRQA 3V33A 2VJPA 2G4VA 2VA8A 3ZCTA 3HWWA 1KZGB 4I5DA 5EWJB 1ABFA 4BQIA 3EEYA 2FZCA 2OGWA 2WHRA 3R7LA 4RJIA 1OASA 1QIEA 1EDEA 3R3VA 2ZRBA 4G0MA 4LBWA 1ZNQO 3UJ6A 4DNFA 1NFRA 1L4MA 1C7QA 3DEAA 3UHOA 1HLDA 1T4DA 5HJEA 3WK9A 2B20A 2PSSA 2R48A 2OBNA 4FS3A 4UQPA 2GTPA 4KKVA 4NLLA 4EO9A 2QXTA 1HTWA 5K6AA 5HS6A 2KWIA 5CXXA 1VYHA 3GLHE 3L07A 1L1FA 3MTAA 2ZTSA 5JH7B 5KOJA 2EW8A 4V0OA 1IM8A 2YZMA 4E2FA 4PTYA 3ABQB 1NE7A 1NQTA 2Y0BA 1TKCA 2XYHA 4FSDA 3PFGA 2IX3A 1EGMB 5IJWA 2EJWA 1RQXA 3K0AA 3BJRA 5FTKA 1JKXA 2WR8A 2ZRJA 4CIAA 3A7EA 1EXMA 3GDWA 5JXJA 3T41A 4I4NA 3ZBTA 5CFQA 3EWIA 4EY5A 2B83A 2QB5A 4R05A 3GW8A 4OJTA 2OFPA 1N8SA 4IFTA 1NJGA 1XA3A 1R0LA 3NTOA 4IH1A 1K6JA 4N49A 2NXCA 5JD3A 3RLIA 4DHEA 3SLKA 3AZQA 2R2AA 3RFXA 4CMIA 5H59A 1BJKA 1CUXA 1RQNA 3F7OA 3E53A 3GBSA 5CB4F 1YU6A 1J7KA 3K9NA 4JBGA 2JK0A 1CR6A 3MJDA 4AJEA 1IHOA 2QV0A 3WP1B 1R74A 5ALXA 5CM8B 4FJ1A 3ZUPA 4L8YA 5TGTA 4Z8YA 1T5DX 3RU2A 2YHUA 1KDOA 3DC7A 1WXHA 1YJCA 4TKMA 3MUOA 2QPTA 3C1AA 3C14C 4Y6PA 1WDKA 3WB0A 4J2TA 2G77B 4OB8A 2GKSA 2VJOA 4I50F 2QP9X 4KTVE 1BQ3A 1Y8RA 4M0EA 1GDHA 1L5HB 3NH9A 2A30A 3IELA 2JGRA 1CHNA 2GO7A 1GKIA 2VP0A 3GDFA 3IALA 4GH5A 4Q00A 4XSGA 5E8JA 3PGA1 2ZTUA 4EJSB 4BRZA 4GP9A 3AF2A 4GZ5A 2FZLA 2G08A 1UM8A 1UJ2A 3N8HA 3VOBA 1B0UA 3EOBI 1JPUA 3QVLA 2GDZA 3DWFA 3OZGA 3PTLA 3GBVA 4EPXA 3RWMB 2ZSIA 4KN5A 1EFLA 1QFJA 1XZJA 1IJEA 1RHKA 2K2WA 3VJMA 4BUJA 2PRZA 3PR1A 2HIGA 1NVXQ 1ZA2A 2WYHA 4XX1A 2FLVA 4QUHA 5LWQA 4CZ2A 4RETA 4OXYA 2RHGB 1L8QA 3KQHA 4TTTS 3A6EA 4ZT5A 4ARUA 1QFZA 4ZQFA 4EK9A 1VGQA 1B2LA 3RE1A 1E7RA 1U3DA 1Y6QA 3K0FA 2FN9A 2QVBA 1DKLA 1KI7A 4D4KA 4FD3A 3VR6A 1KZ6A 1U7HA 2D1TA 1LI7A 2A92A 2IITA 4HRYA 5L3QA 1SA0A 2K6GA 4PV7A 4YUZA 3E48A 4P4GA 2MSKA 3PR2B 3S7ZA 2YXEA 3A4TA 4BNVA 3I9NA 3JYPA 4LCBA 4RTNA 3G2KA 1KI8A 1UL1X 2FA9A 1SUSA 1SXJB 2NUBA 3DEKA 1VHLA 5AK6A 5FNZA 3MMNA 2IYFA 4A15A 2DH6A 4IFEA 4OJQA 1T2DA 3TNYA 3G6WA 2I6FA 4N3CA 4NBVA 1JFTA 1QO0A 2FPPB 3DZHA 5LN1A 2MSLA 2IPOA 5LYYA 5FO0A 1LBTA 3SVZA 4ITVA 3U44B 2AYZA 4KTTE 1GGNA 1SMKA 1PGPA 5L4LA 1VI6A 4DLNA 1JDPA 2CLCX 3E4DA 1P5JA 1LD3A 2E37A 1NDHA 2VF8A 3LV8A 3VOAA 3EMDA 1VHQA 3FNBA 1J2TA 2O0KA 3FF1A 4E7OA 5FI1B 1UBGA 3WIDA 1KEUA 2EAUA 2W42A 1E7SA 2FDXA 1Z0JA 5J5VA 3DBOB 4U9HS 3I1IA 1GRNA 5F2NA 4D3FA 3ZGLA 4KDRA 2JW5A 3CNLA 1AUVA 3AF6A 1K5HA 2V9ZA 1EZZA 4QT0A 4IF6A 2D7DA 2X5NA 2IEIA 1ZZGA 3IR7A 1U9JA 3CRZA 2W4MA 3OLWA 2XLBA 4H1VA 2AFIE 1O87A 1OI3A 5DOVA 1V25A 2QM7A 5GM2A 2HWUA 4DR4B 2ZIXB 3P96A 3M4YA 2XNSA 2C83A 3QVSA 4IRXA 3HKBA 2J4FA 2I34A 2XCLA 3LPAA 4K9QA 3NBAA 1N4AA 1I2CA 3KALA 4YJHA 4CKEA 5IT4A 5CCXA 2IT1A 5LQAA 4YJ2A 2XY4A 2RDMA 1RAFA 4YNBA 3WYGA 3TZKA 4W8OA 1GTMA 4RMGA 4MUYA 1LCIA 2ZSEA 1XF1A 3AEQB 4BLWA 1M5RA 2RKBA 4PZ9A 1OCEA 1FW6A 5K8IA 1TYBE 4B35A 2A4KA 4IZOA 4JSTA 3TSAA 2VR1A 3QX8A 1CUCA 2AYXA 2JS7A 5CA1B 2HWYA 2P9BA 2II6A 1UJ5A 5TQ0A 3SJBA 5JE8A 3Q9SA 5BV8A 1B26A 1ZCFA 3VYUB 3E7FA 3CUWA 2B5OA 5AI9A 3RWOA 3H84A 5ALZA 3R75A 4JELA 2Q1TA 5IVIA 1Z15A 3HCAA 1O9HA 3DFFA 4U2EA 1EG2A 3G3EA 3KHKA 4Q37A 1ULBA 3UM9A 4YMSA 5EP4A 4C4AA 3G1TA 2WJ3A 1NPDA 2Y1CA 3O1LA 4DIBA 4NCBA 1HT1E 2JLRA 4I4TB 4MWCA 4I9FA 1TPYA 5AR1A 5B6JA 2H2AA 1W30A 3NGMA 5L51A 2G5PA 4OH7A 1KZ4A 1ODKA 4KU4A 3S99A 3UV7A 2DXIA 3UJNA 4BWFB 3T9EA 1S7GA 4G8DA 4AP9A 4KGDA 4YEDA 5ESWA 3U26A 1P2SA 3FCYA 4KQ6A 5DGIA 4CNBA 4A6DA 4HEA1 4KITB 3WGHA 1QC5B 3WAJA 4AO7A 4LDQA 5LP1A 1P19A 1Y9EA 4G0YA 4C5BA 1CR1A 2HA4A 4MHOA 2CVFA 1YWGO 3M83A 4H9GA 3K35A 2F00A 5CLHA 4QQKA 4MKHA 1SEVA 1H3NA 2OTCA 2VJYA 4QREA 3RSLA 2NO7A 1N0HA 3LQ2A 4G0XA 3GCDA 3WIUA 1OE0A 3GRAA 4RK6A 3PL1A 4ID9A 2QJFA 3GH1A 1JFFA 3VHQA 3H18A 4TSRA 3EAFA 2EQBA 1UOPA 1N0UA 5F1PA 4MUJA 2I91A 4D0GA 2IU3A 1EGQA 2HCBA 4WZZA 1CJBA 5D00A 3S55A 3E7WA 5DM1A 3A3PA 4XVUA 1JDVA 2PX6A 4R1SA 1LDYA 3VNVA 2HB6A 3C48A 3PICA 2C2ZA 1YUBA 3QW2A 4HX5A 1OVMA 2IP1A 4RMIA 5JJKA 2BH9A 2DZDA 3OO1A 2E4YA 1DWQA 2HJWA 1LF0A 4IINA 1X77A 2V7BA 3EZNA 3DUWA 1TYEB 1DKUA 5DM2A 5H83A 2HA6A 3KV3O 4LSWA 1JXAA 3K0FB 4MV0A 4RMHA 3IKTA 4TXHA 4PC7A 1LLDA 1QG6A 3HFSA 3EXHB 3C8ZA 1NZFA 2C3UA 3A05A 2GBGA 4FN4A 1IE3A 5BV0A 2YDYA 4BO7A 2CYAA 4EQ6B 4J6FA 4LYFA 4CLOA 1T8YA 3U9SA 2AWNA 1ZM9A 3R3SA 2D0DA 3HDVA 4YGXB 3HFRA 4OFBA 1EWVA 4RXTA 2BL4A 5JR3A 1ZP6A 2GVDC 1ABEA 1TQ2A 1UMKA 3QLEA 3WYCA 2HLNA 4YXWD 3UJDA 5DSXA 1F8XA 1FTNA 1G8MA 2BM8A 2O7QA 2Y92A 2CLKB 5MN5A 3CVWA 1TYAE 3B1KA 4NU0A 4XGRA 2CMKA 1TJPB 1KKMA 2HQBA 1Y81A 2OGTA 1BU5A 1G8HA 4HAZA 1DO2A 1J49A 4OV6B 4XA8A 1R10A 1LLFA 2VUTA 2C2OA 2PUFA 1QDLB 1A9RA 1EGAA 2GT1A 4HNGA 4I55A 2L0XA 5H81A 3TRFA 4AFNA 5GIOE 5KI6A 2IDMA 3KYCA 3UGJA 3AU8A 4NKRA 1N3LA 3TX6A 2CJXA 5I9TA 3DFKA 5BWLA 1ZD8A 1PZXA 2B4TO 3A8TA 3IBCA 2UZ0A 5I7OA 2YKGA 4CM4A 3NIDB 4XYLA 1HFJA 1D2EA 3TVTA 1TO6A 5DSTA 4DVJA 2Q5JA 2E7ZA 2PLWA 4OREX 3ZWNA 1BEUB 3VH1A 1V8ZA 5PGMA 2FJUA 5F7OA 2GJKA 4UU0A 1QS0A 2QMUA 2XSZD 4XWKA 3AUJB 2UXCB 5H0IA 2RGXA 3OEED 3ORSA 1EK5A 1N8KA 4Q9DA 1N5JA 4AZ3A 2V5VA 1NATA 5FAXA 1H9CA 1IPEA 2VPXA 2V59A 3E35A 4N1AA 1ECFA 2JGKA 4MS4A 4XUGB 4AIIA 1WBJB 1XGKA 2WWYA 5CP8A 1OAOA 2AUTA 4A8PA 1QRSA 1AV6A 1ZGBA 4RPHA 1Z83A 3E1SA 2VSQA 3EGDB 1MF7A 4YR7A 1IUOA 3MCVA 2ZJ2A 5KJCA 4Y2RA 4DIKA 2HSEA 3CW2A 4JP1A 2ZP1A 3V8NA 2C5FA 1GZ5A 3CBGA 5E7JA 2IBTA 3DDWA 1GGKA 1L0BA 1YCDA 4NVRA 2CDAA 5A4AA 3TUZC 3FPKA 1RS0A 3FLAA 4IRMA 4WFJA 3B89A 2M1ZA 4RA9B 3FUXA 4BMXA 3SK0A 1E96A 4WLVA 3L0YA 1E20A 1RKBA 1OV6A 3U13A 5JV5A 2R44A 1EFPB 4IZ6A 3ZD7A 4LX0A 4PYIA 4PG8A 1T9AA 5H8WA 5JCPA 4CYMA 4RL4A 4FT4A 4B8ZA 4E2XA 2FGJA 4P33A 3LP6A 2H4ZA 3WLIA 4TV8A 1T9GR 3IFSA 3SKVA 1G19A 4C08A 3HJHA 2OK8A 1ZFNA 2GM3A 1M5TA 4JNCA 3IS3A 2IP4A 1BRTA 4IR7A 5GIPE 4HWGA 5EE0A 3LSTA 4XQ0A 5KQSA 5IRCD 1RMQA 1TKAA 1KL7A 3AXSA 1P44A 3BA1A 5AW2A 1C1DA 4OMCA 2XBUA 3NMUF 1JFLA 5KKAA 3MB8A 2XIJA 5JQWA 4QUJA 2F8LA 2FNAA 1MFPA 2JD2A 4GQBA 1FXSA 3SY8A 3E0QA 4MWGA 1B6TA 1I3CA 3KFXA 2ZIUB 2V6IA 3X43A 2VOEA 1ODTC 2YW9A 3QWFA 3GGDA 3A28A 1VECA 4HQNA 3KWLA 1MAAA 4ZALA 5FBLB 2NU8A 4BNTA 2Q6LA 1LDNA 1WSWA 3EMVA 3PB3A 5FR2A 4H7FA 3L6RA 3EWAA 1WPRA 4BDTA 1NJSA 3C87A 3FLEA 4LOKA 4YS6A 1VRWA 5A5VA 2AEMA 1IBKB 4DYVA 5KJ6A 4D4JA 1B41A 5JVDA 4Y6QA 4L4SA 3T7DA 4H08A 2ZR0A 2EZ9A 1RHRA 4YB8A 2I2XB 1PYGA 3O8OA 1SKUA 1PNVA 2ZKLA 3B5EA 4UPDA 4P81A 3TGLA 2O3RA 1ZR4A 1D1TA 1S89A 2A5DA 2ASEA 2AQHA 1URPA 2VTVA 3V7WA 1KEKA 1I1OA 4P58A 4BFXA 4YRPA 4US1R 5HTOA 3LOPA 1D1PA 1MVOA 4YJFB 4J4TA 1SXGA 2V6FA 4BBAA 4BLRA 1J21A 2BW0A 3K53A 2GK6A 3QE4A 4NENA 4FFBB 1LXCA 2DQSA 3W4JA 1FRZA 2OUIA 4LDAA 3LBYA 3QVOA 1DEKA 1W96A 1QDEA 5CVTA 3T0GA 2WYUA 3MUEA 4DDTA 4U6SA 1UFQA 2WYOA 4HJXA 1HEIA 2X7XA 5JUWA 3GT4A 1IN8A 4QFBA 4X85A 4CEIB 1P8JA 5C81A 4JLOA 1GRCA 4UXIA 2DH5A 4A6PA 5HVNA 1MGOA 1PL6A 1YZYA 2XT6A 3LOQA 4JEMA 4OUDB 1BVRA 2EP5A 1YUNA 5EMLA 2O52A 3IAAA 2CSXA 1U6KA 4IMJB 4KNYA 5E3HA 5IFLA 4WNYA 4BLOA 3NV7A 3EDYA 3MVEA 4AVYA 2VDUE 4QGHA 3OHMA 5KDOA 1TEXA 1K7CA 5JALA 2LIPA 4TTRA 2NSJA 1XJ0A 5HIIA 5LLDA 3BT7A 1MIOB 4CTJA 3THXA 4YJGA 2X0DA 3INNA 4EFKA 4HX2A 1UWLA 4FSXA 3FNEA 1CW2B 5DULA 2QMHA 3LDUA 5FNVF 4W1QA 5HPYB 1LTQA 2IE0A 3FXAA 3RJZA 1M1NB 2YICA 3ESZA 4HDNA 4UFOA 2XUZA 1GA4A 4YCNA 4V1CI 5L6MB 1KERA 1NQVA 2AG8A 2EEZA 2JCSA 2YY7A 3DULA 3E9MA 1XLUA 3ME5A 2V58A 4HUQA 4WK0B 2JVIA 5JSQA 2PKYX 3HWRA 4N65A 1Z5GA 4LC1A 1T2VA 1XU9A 3RVQA 3MGCA 1PZGA 2Y6UA 3CM0A 1G21B 3VMMA 4B82A 1IBMB 2NP7A 4AU1A 1UF9A 1V41E 4YRBA 4LQDA 2H5LA 2OBXA 5EL0A 4C4YA 1RJDA 4D9JA 1UEJA 4PEVA 4TVBA 2DHRA 2AX3A 2OXRA 2WW8A 4DZZA 5HKAA 4IIJF 2IYAA 1GTZA 2QLBA 4U5XA 5E4TA 1AKQA 5HA5A 3PNLA 2J08A 4KO4S 1DWPA 3IUJA 4G5XA 3SHFA 1DAPA 5B57C 3WBKA 1UK8A 1U8FO 1V8OA 1ULTA 4CR8A 2PSDA 4LYJA 5K03A 1EWQA 4Y9DA 1KI4A 3KQQA 3AR4A 5C51B 3L8YA 3GEDA 2CMDA 1D4AA 1F14A 4C4PA 5JT1A 3ZLUA 2OC9A 1PS9A 1RMTA 4RKFA 3DE2X 3VI4B 2GAAA 1NSFA 3GD5A 3KQWA 1M0TA 2O9JA 3M6FA 4K9NA 4W63A 3SSMA 4UUMA 2R7NA 1QHSA 4EFDA 5KSWB 2C2MA 1Z08A 3MK31 5KNCD 4EECA 5LKAA 4R51A 1L6IA 4WSOA 3H2YA 2ZZMA 1VIYA 4QGSA 4JOCA 5JQGA 5F12A 3ABZA 4PWYA 5EWLA 1QZ3A 5KBYA 5CH3A 1RIIA 4AJKA 1WVMA 3EVNA 2GCGA 1KO8A 1PKXA 2VXOA 2DPHA 4ZQHA 1Q0PA 3EA4A 4MYSA 1ZVJA 1FJGB 3EZXA 1M0EA 2V8BA 2BFAA 4YGYA 4KQXA 2Z4SA 4J0GA 3VKWA 4FWTA 2XKAA 5DGTA 3JW8A 1D7AA 5DNWA 3X1YA 4B7XA 1CVLA 2OHJA 4DLSA 3KPJA 4A36A 3JZIA 1Q50A 1PT9A 5CB4B 3M4XA 3SF0A 3P2MA 4L9WA 1QFXA 2DX7A 1JA0A 4JA2A 4ZA2A 3G1UA 1DIBA 1E2PA 1A2KC 4B3FX 4N5IX 3D2BA 4OX9B 6PFKA 2XKKA 3TW4A 2PH3A 3OUUA 4W1RA 2HV8A 3NBMA 4CIDA 4CF7A 1J4AA 3DPUA 3DQQA 2EFJA 3AVPA 5T5QA 3KTOA 3RRBA 3AM1A 2QPAA 3ZNOA 1X1BA 2R8RA 2ET6A 4XWGA 3ER6A 4P4SA 2I7TA 3MD9A 1XJQA 4JLJA 3AG5A 1X74A 3L6OO 4K6HA 1X94A 1R12A 4Q9HA 2YV5A 4ZOBA 5AJVB 1KE1A 4LF4B 5KTKA 2Z0MA 1TMKA 4H7JA 4R7TA 2MHCA 2AE2A 1K6IA 2TECE 4NNJA 4OGGA 1SXIA 4NSNA 4QYTA 2FXVA 4QYIB 4Q48A 1GR0A 1PJTA 4WOKA 4E15A 3S70A 3TR0A 1Z7WA 5DYNA 1EZ4A 1IZZA 1SUIA 3TX2A 1FNNA 2AF3C 4ZU3A 3JXEA 3QTLA 3ZV5A 2W71A 4B7UA 1ZIXA 4JC5A 3HCOA 5KYNA 1TPZA 2H8KA 4AWXA 3ZTTA 1QRDA 2G0NA 1FNDA 1RPZA 3TM4A 3UJ9A 3W4KA 4B6EA 4YECA 2CV2A 2PUEA 3RYFB 3BXEA 4R2MA 2GEJA 2R96A 4AT1A 3ONEA 3RTGA 1V5FA 4BNLA 5C37A 3UAOA 4HWOA 2QBYA 3AUUA 2C54A 2ZRQA 4UM9B 1C2YA 1M74A 4CKCA 3OOYA 1JV2B 5CDFA 1R1DA 4D92A 1E3QA 1OREA 5ALJA 1MMFB 1C7ZA 2RGDA 1NASA 3U7IA 4BNZA 5JZOA 1UWCA 5KX5F 1IQ0A 5AICA 1DTWB 3F9RA 3MGAA 1FYXA 2BJVA 5COQA 4NMLA 1VDZA 2CJWB 1AMUA 1CY6A 4HO1X 4LGMA 2PDAA 2GAIA 2I87A 2E4XA 1R8JA 3COJA 2BSAA 1QLWA 1JLLA 2BEKA 1DHRA 2QHXA 2XMGA 2ZVDA 3EEIA 4YQZA 5DTRA 3SC2A 1F9AA 4DJAA 5ICGA 3CNEA 4ND5A 4Z4IA 2MMGA 2ZUEA 3QFTA 3FDJA 4YIKA 4BP8A 4GXTA 2AG5A 2GARA 3PIIA 3RI3A 4G5QA 3GA7A 1DAOA 2AH5A 1CS4C 5BR4A 4LW8A 2ZWPA 4IJMA 1BDHA 4RENA 4QBIA 3UWOA 5ELXA 1JR6A 5FTLA 3DP7A 2J3QA 2QTVB 2I2BA 2PD3A 3OP1A 4KREA 4IHJF 3FFBA 2QENA 1JEQB 2WHQA 5FWDA 1JEAA 3ID6C 4C30A 5CFNA 5KYXB 4ZZ3A 3RW9A 2HA2A 3T4EA 3ZWOA 1QKKA 4LOAA 1F8UA 1VFNA 1WE2A 3NVDA 4GZ6A 2C7RA 3CWQA 5SYNA 2ORWA 2XGOA 3GT3A 1VM6A 4S1TA 4TRRA 4YRFA 2V3WA 4JJGA 1CJMA 3Q8WA 2BR3A 5EIOA 1KR2A 3LKBA 5DXFA 3BCSA 4D79A 4IAOA 3U4IA 4BCBA 4HN4B 2PAFA 2UDPA 3FCOA 1KKLA 1DHTA 4N4AA 4NE7A 3PCTA 2VDOB 3VH2A 2NQ8A 3OD1A 4R9VA 4C3VA 4HS4A 3IVXA 2HHHB 1MDBA 3KVYA 4FWIB 1IVSA 2QAGA 4GDFA 2X9QA 1ZOOA 2DWUA 4RPJA 3CO0S 1IMJA 3W1EA 3K9WA 4HLNA 5LZ7A 1K8YB 5T64A 4XWAA 1L8XA 4FNAA 4J94A 4EO4A 2BGGA 5I9SA 4WIAA 2W2OA 3R5JA 3I9JA 4UQLA 1C1HA 4GMXA 3ZH9B 4B1FA 5EIEA 4AKGA 4JJ8A 1OH8A 1DDOA 4KQGA 4QRHA 1TTTA 3LG2A 2C9MA 5LQCA 1SKAA 2IY8A 3LF1A 1TJ4A 3MAGA 2ISSD 3B1YA 1U9IC 4GI7A 1JMYA 1ECBA 1EXVA 2YINC 1OYVA 5JHGB 1V3TA 2XE6A 4ENTA 1PZEA 1D3AA 1HETA 3JX9A 4RH1A 5LD2B 4YJ3B 4Y0VA 4KO2S 2XDYA 2R5WA 2VT3A 2VTDA 1WQ3A 1X80A 4LJSA 4TROA 3ZGOA 1IATA 3E82A 3PZBA 4BNMA 3KOWA 3NBXX 1I1QB 2OSVA 2VJMA 1IEVA 3BA6A 3LLCA 4AYWA 4CKEB 4DG5A 2XB2A 1B1CA 4KOEC 1KK3A 1WXDA 2F90A 4I8DA 4X1IB 1P60A 5SICE 2PL9A 3DH0A 5BW5A 1IC6A 2YWGA 3FA2A 1VLLA 1NWCA 3N2KA 4LNHA 4URYR 1ODSA 2C8LA 1T10A 3I0NA 2ADOA 5KVVA 5LPNA 3VKHA 1T25A 4EB8A 3EEQA 3DV2A 5T6MA 2M98A 4QYSA 4W9MC 3FPAA 4HWKA 1QFYA 4IJ5A 3MTIA 2AA3A 3D5EA 4OOEA 5ABPA 1BRMA 5CA1A 1BSVA 2SCUA 3GG9A 3UJ8A 1E9RA 1II9A 1QTNA 1Z6ZA 2Q3FA 1ODIA 1AV7A 4N5DA 5AKEA 5F23A 2GTHA 1WWKA 1QCDA 2P0YA 2V4ZA 3LECA 2WG0A 1BCRB 4I36A 1TADA 3FAZA 4BJHB 5KWJA 2WUGA 3G1WA 1OAKA 1PJ2A 3ESDA 4OHMA 2EG5A 4N6NA 5E2AA 2QNBA 2OAP1 3QENA 1FNBA 3AVWA 3N5KA 4BECA 3NHSA 3P9ZA 1PDOA 5JNLA 1Z2EA 3FMFA 3D6TB 1VL0A 4M88A 1DARA 3FCCA 2B6NA 1FTGA 2JZCA 2XUAA 1J8QA 1UT8A 1XKQA 2CXHA 1NSYA 2O6LA 5D3ZA 5HFNA 1HM5A 4EI9A 1NOIA 4QEKA 5CLJA 5BQ3A 1DC3A 1W0KD 1HY3A 1R9JA 2W7TA 5EKSA 4Q9NA 4NJMA 1U2PA 2COKA 3I9KA 4FI3F 4X1YB 1V5GA 1K9VF 2QGZA 2RHTA 1G60A 1JAHA 3H16A 3NTRA 1SVIA 5CIYA 3W5IA 4ZKEA 5FQOA 1E6WA 2VYND 2WTAA 3R8XA 3BD8A 4LV6A 1Q15A 1YE8A 3Q3JB 4D25A 1V3VA 1ZOLA 4AWAA 3KXKA 1KWKA 1N9KA 3TTUA 2IY9A 1QR2A 1VMEA 1WUJS 2DFVA 4R5MA 3RRMA 1TC1A 4Q9JA 1VG1A 3GCWA 3QWBA 2IDZA 1QMGA 3HSYA 1CKEA 2JHCA 3CF4A 4DQXA 3HK2A 4TWRA 3DKIA 4QXMA 2OYCA 1WAMA 5EZYF 3FPFA 1H8HD 2FG5A 4ZMSA 3QFFA 4KH1A 1SHTX 2YVUA 2EHJA 2VTEA 3OT1A 3OCVA 1XMSA 1WUTA 4LQLA 3D7NA 2REOA 3JYNA 1BKYA 4JWKA 4LDZA 1RHJA 4QX6A 4Y2HA 4FHZA 5DN9A 1OXVA 3TIXB 4AZSA 1NQUA 2XOKD 3ULKA 4CKWB 5E95A 4FSHA 4I1UA 3U39A 1EM6A 4A0GA 4REQA 2PA0A 2Q6IA 2Q1UA 5KCZA 1PFVA 4ZYXA 4ZHQB 1B15A 3JQ8A 2CXOA 5C5CA 3E9YA 3DM5A 2B1RA 1UXJA 3BGSA 2CLOB 3EXHA 1Y1TA 1G8FA 2PR7A 3I0MA 4URWR 3QP9A 2O59A 2XIQA 2O2GA 2PHZA 1G2OA 1MPTA 2W6OA 3VHRA 1OV4A 4G5RA 5HOQA 2CBXA 2NVBA 2PQ2A 4CKXA 3GMDA 1WUKS 1HH4A 4KUEA 4RHTA 5CJJA 4NV1A 3ZVRA 4LX8A 1VIVA 1R2QA 2PGJA 1UJBA 2B9EA 4GSYA 2YQZA 4XYGA 2QL9A 4M1ZA 5HGJA 3ZWBA 3VO1A 4JFAA 3VHXB 1NC3A 1XQ9A 2HXSA 1FLNA 1QYDA 3M34A 1SCUA 1YJQA 2BEUB 4XPZA 3RKSA 4MDYA 1D2GA 1HDCA 3RIGA 4EF5A 5IABA 2EKBA 3H8VA 3NTUA 4J0JA 1QVVA 4MVJM 5G0VA 4Y0AA 2FQXA 2GAJA 3PGMA 3P52A 4DR5B 1I6WA 4KSBA 2BGJA 4S35A 1UKBA 1JMVA 2Q6VA 5I7RA 1YS2X 3RH0A 1NUQA 1SGWA 3KAKA 5HUQA 1E66A 4J1QA 3RWBA 1U7WA 2CV0A 2A88A 1Y5LA 2FVYA 1G66A 4MUIA 2QQGA 2J7PA 4PYOA 1NONA 4KIGA 5JSKA 3B20A 3OIFA 5IEBA 3SD7A 2AVNA 3KFVA 4HN2A 1Y8CA 2XQJA 3EGVA 3LPNA 5GVRA 1SOWA 2YXLA 3M6AA 1Z2OX 2GJ9A 4LJ9A 4B7CA 2I4RA 5JDCA 4RJLA 3EA5A 5A7HA 521PA 4Z4CA 2KE5A 3EGIA 4RHXA 1RXVA 3FKJA 1DKRA 5FORA 2HSDA 4EHAA 2Z2ZA 4L0CA 1XXHB 2CLDX 2Y6VA 3O2JA 5DNEA 3L43A 3WGNA 1NF2A 2QAJA 3FHLA 4YCDA 3NWJA 5ENVA 2WMDA 1TAGA 4J8PA 4DBVO 4QZVA 4JCCA 5DNUA 4DXDA 2X0NA 5ALTA 4ZRDA 1YK1A 2HO4A 2GF0A 1LBEA 4ZT4A 5G2OA 3SNKA 3PNOA 2HU8A 1MKYA 1N7GA 2BHLA 4G37A 5EAIA 3A9SA 5IBQA 3A9TA 3SGLA 4QSHA 1M2OA 2IHVA 2XUFA 3DMHA 2O8DA 1UP4A 2ZIFA 5EXTA 4YP9A 3OC0A 1AF7A 5H4HA 4ARZB 3O8BA 1Q3HA 4X0EA 4JI1B 3CS3A 3MTBA 5FOUA 2VUSA 5TMBA 3ONNA 1C9YA 1L4KA 3NM6B 5HQTA 5KWEA 1YRQA 4O4HA 1F48A 3ZV6A 3HUTA 5D6OA 2R79A 4RF5A 1WOMA 3HL0A 3IUYA 1SKYE 5EPEA 1NVKA 5CBPB 3RRJA 1JTVA 3O4HA 1USVA 5F1YA 4I1VA 4X7MA 2XVMA 5AVZA 2LP4Y 3QV1A 5I8WA 3T34A 3BZBA 3C8MA 2GVNA 4WGGA 4B48A 1GRRA 4NECA 3D9QX 1G20E 1U4SA 3INTA 5AM1A 1ZXLA 2G9NA 4N41A 4DIMA 2XZOA 1C3VA 1YJAA 1VJ5A 3K9GA 1AH2A 3V7FA 1IQUA 3QUQA 2P4UA 3PHHA 4X1YA 3ROPA 3CGGA 3B2QA 3ANYB 5KQMA 2X5KO 4AXBA 1XHEA 1J8MF 1Z25A 3FTNA 3L0SA 5FP0A 1LZKA 4PQRA 1O6BA 3I34X 1YTUA 1HDIA 1TK2A 1JF8A 1YVRA 3CNQS 3JQAA 1SWVA 4QOJA 2M9MA 1BEEA 5CH5A 3TL2A 3UV3A 3ITNA 5HS4A 1VKZA 1M7GA 1VHTA 2CZCA 4G5OA 1Z56C 4UE6A 1T35A 4AJIA 1N77A 3I2JA 4BMSA 4K9KA 1PE0A 1WB5A 3BC1A 3SVLA 2DVMA 3IX7A 4X84A 1Z7GA 1YD7A 1DG1G 3IPAA 4KODA 2PR2A 2XSZA 3NANA 1A9XB 2Q9UA 1KJ8A 3HVIA 4XFKA 3GOHA 3TZHA 3N70A 2QTMA 3QMPA 4N8SA 4J7UA 3AJAA 3TMAA 4NE2A 5BR1A 3PIDA 1C29B 4XWOA 1XB2A 2EP7A 2GTIA 5BQPA 3E9EA 5J63A 1AUOA 4MW2A 1MC8A 1L5QA 4G0OA 1HL7A 3KQKA 1QU3A 4KPYA 4BE7B 2ZDQA 3CWZA 5HSGA 3IBFA 5K5EA 1A3CA 3OX2A 1XCBA 3OY2A 3IERA 3QK7A 3QXGA 4WZBB 3ZVKA 4Z51A 3OQBA 5L40A 4WA7A 3TGPA 1A8PA 1ZJ6A 1LQUA 3DNPA 3V1UA 5CB6A 3PVCA 1QIMA 5LQSA 1VZ2A 1PJLA 2I6UA 3D64A 2WI8A 3O9ZA 3L0DA 3FWPA 2X40A 4PRKA 5E3IA 3GLFA 2AJDA 2E4WA 4G2TA 5JNWA 1V5WA 1YZUA 4CMCA 1W6RA 3HEBA 4IIJB 4G1CA 3WMFA 5A4DA 2CV1A 4BV3A 1E9SA 1BOOA 2VT7A 1AHIA 5BN3A 4LAFA 5HUHA 4OHXA 4B4VA 3MQ4A 1GL6A 1Q91A 1DC4A 4FMBB 4RK4A 1GXSB 1KI6A 3FNRA 1PNRA 2DERA 3OFJA 4RLFA 4KQIA 4NBLA 1FUUA 4OHZA 3IT3A 2C9OA 4MW9A 5DW0A 3WK8A 3OZVA 4D3XA 1KP2A 4CXMA 5AJXA 4N47A 3KSAC 2RIRA 4MVXA 5CB8A 1L7VC 3NC1C 3THXB 4Z9BA 1XMQB 3EXG2 1JNXX 3DAYA 3QE9Y 2J33A 2ATVA 3AJRA 5HTKA 2J6HA 2RGWA 4TQUS 1LFAA 6LDHA 2DECA 3MWLA 4JBHA 2X1VA 4TZ0A 1IN7A 3FZNA 4AUEA 3E03A 3ESCA 2GZ2A 4NG5A 3LWBA 4AY6A 1VE9A 2DU8A 3OLXA 1WMBA 3QX3A 3EOAI 3C5HA 4N5MA 2P30A 2ZDGA 1PJRA 3NVMB 1T3TA 4M54A 5DWDA 3TB4A 1PK7A 3KYBA 1AGYA 3TEMA 1NRJB 1Y5MA 3LUJA 1G21A 3ADPA 2CB0A 1ZO8A 4MCJA 1CDOA 1TU0A 1TK9A 4QIHA 3H5OA 2ZYUX 2XT9A 2PGDA 3EAQA 3KVNA 4PO8A 3TLJA 2P5YA 1V9CA 3OZRA 1J06A 3LVBA 1RPAA 3TZEA 2PT6A 2VXBA 1O96B 3ZXUB 3ZZMA 4CT5A 1SVWA 5AOVA 2CK3D 3WIVA 1KJNA 5JIBA 2XJ4A 4WHMA 3KE9A 5LMUB 3O4VA 5CA1F 4TUYB 1NOKA 4FHGA 2VDPB 3E9ZA 4B81A 3UXEA 5DI3B 4AMBA 2DQYA 1YS9A 3B7WA 4PBSA 3MCWA 3PFIA 4H4DA 1LRKA 2QR2A 4FOSA 2KLHA 3N2ZB 1N34B 1JKFA 2HCTA 2VAVA 2JLUA 1TYCA 4P08A 2XYRA 1F3LA 3UZUA 2BM0A 3T1TA 4JA0A 4K7JA 4ZIRB 2OKGA 3EFBA 1ELOA 2YOGA 2OHHA 2KW5A 2VH1A 1IY8A 3M89A 3D2AA 3GZNA 4ZP1A 3TW0A 2X1MA 3KKKA 2P6UA 4Y6RA 1EQAA 2PS1A 3GDGA 2ZT5A 1ULUA 3CV3A 3PD7A 4MVJD 4Y2YA 4EHNA 1W5TA 4F5WA 4PYJA 5H7XA 4ZI2A 1BOFA 1E6UA 2V65A 3JQ8B 3ZCVA 4M6WB 3G13A 4FLMA 3IP5A 1YAJA 5LQKA 1X9GA 3G2IA 4LWZA 5EWLB 1JHDA 2X4GA 3FCEA 3KUCA 4IIBA 4EJ2A 3GA0A 4D96A 2OESA 4KLZA 4TN1A 1CB7A 4MPPA 2ZU6A 4WXEA 4P4LA 4DADA 4DTIA 4QVGA 5A4KA 3MJFA 3EDOA 1K8RA 1MRNA 1W0JD 3PS9A 4CVNA 1WPQA 1DB3A 3A7DA 3LHSA 5C53B 3UJHA 5FLXA 3ESQA 4V38A 4DJFC 3ESRA 4WNIA 4JVLA 2FVXA 2GXSA 5BYKA 4AJOA 2JAHA 1KSFX 3BL8A 3U3RA 4G1MB 2G63A 4I50B 3NTXA 3FPSA 3F3MA 4MDHA 3GFBA 3TSYA 4PG4A 1X8XA 1SBZA 5A4JA 1EEXB 1ZNYA 3TLBA 1EX1A 4DRXA 3M4JA 3B52X 1Y3IA 5FOTA 1BWRA 1YRYE 1QRUA 3WO1A 4PLGA 3W2FA 4A5OA 4N0MA 1MCZA 2C5LA 3H2HA 1FRVA 2G3YA 1DPFA 1CHDA 2ZIXA 4C7MA 1USKA 3E70C 4R8MA 3HDYA 4EYSA 1YKGA 2XH8A 5FD8A 3DHYA 1OAOC 4W8HA 3RADC 3JD0A 1ZIDA 3P9XA 3KXDA 4P7BA 1VG8A 2BM1A 2F64A 3AILA 5FB3A 1B74A 2IWRA 4L2IB 3P0JA 2JRCA 3FZYA 3BEDA 4KR3A 4UATA 1GA1A 4R3WA 2CDBA 3HA2A 5T4FA 2F1OA 3NHPA 4NDAA 1DPGA 1ZR2A 4PU0A 5KNLA 3PF9A 4FBGA 1AF4A 2CCJA 2H4WA 3OHSX 4JLMA 4RELA 5C1IA 4IS2A 3ZW7A 4XX0B 1UZLA 3JAMA 5A0TA 2A9PA 1XZHA 4QD3A 5TPWA 3SZOA 3CR8A 1P2UA 4FW9A 1CQJA 3W4IA 4RHUA 2BFDB 4M0LA 4ZYYA 2C78A 3TZCA 4LFAB 2X5XA 4QLOA 2I62A 2XMCA 4B3HA 1VLHA 2GZ3A 4GI3A 5I48A 3C74A 4FOPA 4QU9A 3ROZA 3DPIA 1T5SA 5CIWA 4Q4AA 4C4OA 5EJ6A 3OCXA 2EL9A 2PD6A 2J9ZB 2QQEA 3RFCA 3LM8A 1SH7A 4JYMA 5H9VA 3QELB 2XVAA 1EHCA 1ISGA 4MB6A 4Q4JB 1M33A 2VCEA 1GUDA 1M2VA 5A0FA 1WBDA 4TYYA 3KQSA 1ID8A 1W35A 3HDQA 5GMOA 4BB6A 2VIIA 2TYSB 1Q92A 2IS4A 2COUA 1UC9A 2Z3WA 4IIGA 4L1KA 4OKIA 1YHYA 3BIXA 3VKVA 4MUAA 1NBME 3CF2A 3D4PA 3LQKA 5JWHA 3GMSA 1ESDA 1SELA 1HRKA 1TF2A 1RSZA 4BO1A 1XNHA 3E22A 3CLHA 2GPTA 4CTKA 4UMFA 1NQAO 4GPBA 1ZH2A 3ZCQA 5C35A 3Q8LA 2PZAA 2XVYA 1ESEA 4JSYA 5ESXA 1LI5A 3ER8A 4AQDA 2HRBA 1UK9A 1F7UA 3NR2A 4NU5A 3HV0A 2R7AA 1Z4NA 4RIIA 1T9ZA 2E55A 2Q9BA 3RHSA 3KKQA 1QH8B 4J0KA 5T57A 3KPYA 3U7RA 4HYEA 4QEDA 3P4YA 3UCFA 2JFHA 3WIEA 4A3SA 2ZJOA 1GGHA 1MTZA 3CR3C 4K9OA 4YYEA 4F5DA 4QOGA 5IFKA 3EIHA 3W3ZB 2VNAA 4JP5A 1U7OA 1FUKA 5AW4A 3I76A 4IUYA 4ND8B 1ZGGA 3JR7A 1JX6A 1B76A 2J7KA 3OSZA 3PG5A 4PHHA 4Q3LA 5L7YA 5A6SA 4D3DA 1O6FA 3HKCA 4I1SA 4JR2A 3MS2A 1Z45A 3R40A 1NF8A 4X1KA 9ABPA 1NXWA 4IOKA 3LUHA 4KWIA 4YJ3F 4HTAA 4BB9A 4R40A 4AI6A 1Q1ZA 3ZDRA 1D07A 1F2VA 5IJ9A 1W4RA 3K9FC 4M9RA 5TRTA 5B3AA 2D13A 3Q0EA 2C84A 5JS2A 4DJEC 3HN2A 3C1OA 3SN6A 1MQSA 2EP8A 2FRDC 4CLOB 3IL2A 4XIYA 4LSGA 5C8VA 4M83A 3VQTA 4UFPA 5BORA 1UBEA 4QODA 3I6QA 2AI2A 2HW8A 4AM8A 3KTFA 1RAIA 4IEIA 4Z7QB 5MN4A 2HR1A 1P3Y1 4BZQA 1Q3TA 3BICA 1UKVY 2ZZKA 5HRCA 1GAEO 3ABSB 3VR5D 1XN4A 3FRHA 4CM8A