4HVAA

Mechanistic and structural understanding of uncompetitive inhibitors of caspase-6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
247
structure length
238
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Mechanistic and structural understanding of uncompetitive inhibitors of caspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 238
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hvaA00
1ICEA 1SHJA 2CNOA 4ZVSA 3H0EA 4EHHA 1KMCA 1RWNA 4QUAA 2C1EA 1SC4A 3UO8B 4EHDA 1I51A 2HBYA 3R7NA 4D3YA 3KJFA 3S8EA 2H48A 3GJSA 4NOMA 5IANA 3H11B 3R7BA 2CJXA 2QL9A 4NBKA 3UOAB 2CNKA 4QU5A 3EDQA 1SHLA 1RWVA 3DEHA 2H65A 1JXQA 1I3OA 1RHRA 2C2KA 2CDRA 2HBRA 2J30A 3IBFA 4PS1A 4PRZA 1NMEA 1NW9B 4JB8A 5JFTA 3D6MA 2HBQA 5IAKA 3SIPA 4QUJA 4JR1A 4N6OA 4FGUA 5IAGA 3P4UA 4JR2A 3V3KA 2NN3C 5IAJA 1RWOA 1F1JA 3K7EA 2J31A 3GJTA 1SC3A 4IEFB 1IBCA 5IBRA 4ZVOA 5IAEA 1RHUA 1RE1A 4JJ8A 3H13A 2HBZA 1GFWA 1QTNA 1I4EB 1RWMA 3H1PA 3R5KA 2QLFA 1RHKA 1QDUA 2XZTA 5I9TA 1QX3A 3PD0A 4N6GA 4FEAA 1RWWA 2Y1LA 3GJQA 5H0IA 4ZVTA 2FP3A 1RHQA 1RWXA 2XYPA 3KJNA 5LU9A 3KJQA 3S70A 2H5JA 1K86A 2H5IA 4FXOA 3SIRA 4HQ0A 1CP3A 5LU8A 4D3ZA 4PRYA 5IARA 3R6LA 2CNNA 3R5JA 4PS0A 4D3XA 4AWAA 4EJFA 4N6NA 4JR0A 5I9BA 4NBNA 1F9EA 4NBLA 2AR9A 2H51A 4FDLA 4ZVPA 4JQYA 4QU9A 3V4LA 3D6FA 2DKOA 3PD1A 3DEJA 1CVRA 1PAUA 3V6MA 3BIJA 1SC1A 4IYRA 2QLBA 4NOLA 4QUHA 4QUBA 3NKFA 3H11A 4QU0A 1BMQA 2H54A 2FUNB 2XYGA 2J32A 1PYOA 4QUEA 2H4WA 4N7MA 4DCOA 1RWPA 2QL7A 5IC6A 4QTXA 5LUAA 4QULA 2P2CA 3DEIA 3QNWA 1RHJA 4HQRA 4ZVQA 4QUGA 4EHFA 5K20A 3ITNA 4DCJA 5IC4A 1K88A 3DEKA 4NOJA 4EHKA 4N7JA 4EHAA 4JJEA 3PCXA 3E4CA 3EDRA 5IBCA 3R6GA 4ZVRA 4AW9A 4EHNA 2C2ZA 5LUBA 3NS7A 3RJMA 4M9RA 4DCPA 3R7SA 2CJYA 2CNLA 4HVAA 3OD5A 5IABA 4N5DA 1M72A 3GJRA 4NOKA 3D6HA 4ZVUA 4JJ7A 3V55A 5IBPA 4EHLA 2C2MA 1I4OA 2QL5A 1RHMA 2C2OA 3V4OA 4I1RA 4I1PA 4AWBA 3NR2A 3V6LA 4QTYA 1RWKA 2J33A 2K7ZA 2QLJA 3IBCA 3P45A 4QU8A 5IASA 4QUDA 2FQQA 1GQFA 1NMSA 1NMQA 2WDPA 2XYHA 2Y0BA 4LSZA 4QUIA 2XZDA 4JQZA 2H4YA
chains in the Genus database with same CATH superfamily
1F4PA 4KOAA 2XCRB 1RC0A 3NIWA 3PLRA 1YQDA 3BERA 1UXIA 3O03A 2YZ7A 4XWAA 3WGVA 4DQXA 2Z2JA 1O9BA 5L7YA 5D8DA 2FCRA 5EKTA 1TKRA 4B4VA 4DV3B 1P73A 4KYVA 2A0WA 4ZEXA 2XBUA 4KB5A 1JQDA 2LVBA 1WHTB 4G41A 5DK4A 3OLQA 2DUWA 1Z0AA 3R7WB 4BFVA 9ATCA 4RIFA 3DWGA 1DX6A 1OXMA 1TVCA 4N5LA 4QPCA 4QUJA 1PJAA 4JS0A 2BFOA 4II7A 3TQRA 1YIOA 3N0WA 2C95A 4PC1A 1WXHA 4KQJA 1GT6A 3GLKA 3IB6A 3WIOA 5BVGB 3HV2A 1SC3A 2VHEA 3KJIA 3OICA 1G41A 2JB9A 3HJNA 1A95A 3LUJA 4MVJG 1PKXA 2Q9AA 3H13A 4I4CA 5AQ1A 4P58A 5EZ6B 2YN4A 4NECA 3ZDYB 1R9NA 1GTMA 3F1KA 3TI9A 3IMEA 1RR6A 3FSGA 2C5EA 2DSTA 3A4NA 3KHTA 1RQ2A 4E88A 4EABA 5C8ZA 1L8AA 4ZVTA 3V2GA 2RSLA 3X2FA 1WPQA 2F1JA 5DHUA 3K94A 1U6JA 1Y37A 3L5KA 2QRKA 3SDSA 4Q3CA 2D7CA 3E84A 2M6KA 5B37A 4D3ZA 3T9BA 3PQ5A 1PGPA 3L46A 1RYBA 4G24A 3WK4A 3N2NA 5CLLA 3OU6A 1BSVA 3CPJB 1E5TA 5JSYA 3EQ8A 1BMFA 3UT6A 4PSUA 3WGUA 2DUNA 2UV8A 1SOMA 3G7NA 3JR7A 3RSOA 1KJQA 1U5AA 3L7CA 4R0NA 1UMCA 1JAXA 4AICA 2DWPA 1J8DA 1LU9A 2WF9A 3PD1A 5DRTA 3WOVA 1VSVA 1SCDA 4NBWA 5FOXA 3L4KA 3GFFA 1N0UA 3H84A 2CXOA 2P6MA 3PIIA 1L6IA 3W05A 2OE2A 1EKXA 4PZDA 4PN3A 2BMJA 4TV9F 1RFLA 2GDZA 1GU1A 4N5MA 2GFQA 1N9ZA 1D03A 1QF9A 3P71T 2SKDA 4BWGA 1P9LA 3HKDA 4DUGA 3NC1C 4GOOD 3Q3EA 1JZSA 2IPMA 4OLJA 1N5IA 2JLQA 5CA0A 3VU9B 4EHKA 2ZR8A 2RHJA 2GZ3A 4B3XA 2GEJA 1JIJA 3HUTA 1GUDA 3OPXA 1OE0A 1E6MA 1JA9A 1SCUA 3IS3A 3OZUA 5EVJA 5FD8A 3WWOA 4AP9A 3Q0IA 2C2ZA 4B6SA 4CR6A 5JY6A 3Q87B 3NS7A 3RANA 4IDOA 5B53A 3EZ7A 4FIDA 5C51B 3KSZO 3GLSA 4I9HA 1BVYF 1BX1A 1Z6GA 4KK3A 3TOVA 5DTMA 5MN4A 1BS9A 2YYYA 3TAXA 4HBGA 3KZNA 5JQGF 1QHXA 2XA9A 4GL2A 4LQDA 3E03A 2FYTA 3HMKA 4EA8A 5AVUA 3K9LA 5GPBA 5LNK1 2OK7A 2E4ZA 3E9MA 3IUSA 1NSYA 1Y7HA 3EPRA 3PQFA 3T4PA 3T7IA 4OP3A 2BHSA 5K0EA 4BFLA 4GVXA 1Q7TA 1GEEA 2G80A 4E7PA 5KMGB 3EPKA 1NULA 1F6WA 3LVRE 5EUMA 1VE7A 4BJ5A 5LXTF 4Z86A 1BN6A 1TCVA 2XF8A 1VLQA 4U2KA 4AS3A 4G1BA 4EHHA 3KQOA 1N25A 1NURA 2EL7A 3HCEA 4EHDA 2VJQA 4D26A 4UM5A 4NLLA 4D7AA 3CONA 2PUHA 1OWPA 4Z4QA 7REQB 1JLSA 2CJXA 3C3XA 4MQBA 1DC7A 3A2LA 2JFBA 5C8YB 5LIRA 1KI6B 5DHFA 3PQ6A 3AETA 5TDHA 2I2CA 4Y1RB 1OA1A 2BCEA 2B21A 2CMDA 4H77A 1ETUA 4F71A 4LRXA 4O1MA 2VF4X 4L5YA 1J0AA 2JLSA 4BO9A 3H9BA 1I14A 3TQIA 1F8XA 4BP9A 2GPBA 1MV8A 2OWEA 4OGGA 2F8TA 1W59A 4OK6A 1TA9A 4HLUC 2V7GA 1U7OA 1OV4A 2Z1MA 5A1TA 3GJTA 4UU1A 3F8SA 2GN9A 3A0RB 5JI2E 2W22A 1QKKA 2ILVA 5EMLA 2HBZA 1RNLA 3KOXA 1XZPA 1Y80A 2WWIA 5HKAA 1NNUA 4GVLA 1VXOA 4WEOA 2IYLD 2IY9A 3B51X 3HCNA 4I6JA 5F7ZA 5LPNA 4K9MA 2RI6A 1WBJB 1GU0A 4JB3A 4BFZA 5JZBA 5JS7A 3U1TA 5IJZA 1NC3A 1W35A 3G9ZA 4HSGA 1LFAA 5F12A 1KI8A 5FUMA 1PD0A 3L07A 1KY3A 1Z16A 4MVJH 1X9HA 3ICCA 3IXQA 2IS6A 5J1SB 4EMUA 1E8MA 1VXRA 2UVDA 2OBYA 1Z8FA 2ZKIA 3AKYA 3OE1A 5KVQA 1KQPA 4BNNA 2P0EA 2C2GA 1J5XA 3JATB 4MCJA 2TYSB 1PTKA 2ZYRA 1O4VA 2V0CA 1XQYA 4KAJA 4AN0A 5AVWA 4RVFA 2VSNA 3CX6A 3NBFA 4PAQA 5ERXA 4DV6B 4KPFC 4UHBA 4QU9A 4ZP1A 3BBPA 4YMUA 5JJBA 4PCLA 3L01A 1PAUA 1P2BA 4QSMA 3RRJA 3TTVA 3V8BA 5BT8A 1LF0A 1N7HA 1NR5A 2E87A 2OHXA 2GESA 4CTKA 2ODEA 3K9FC 1JEYB 2PUCA 1VDMA 4QYXA 1QUEA 3QPDA 5DNCA 1PFKA 3KQMA 4TLCA 3MLAA 2C98A 4G26A 1QFJA 5F3WB 2IUUA 5CD1A 1MC1A 5A5FA 2X8WA 4R9VA 1ZMBA 2ZAOA 3EDYA 4PBSA 5TV2A 1G8PA 3TMKA 1EFKA 2BDTA 1P6XA 2JBAB 4N03A 4Q93A 5HG0A 5I7SA 4JI2B 4XUEA 1VA5A 5JNUA 4Y1GA 5SZHB 2NXCA 5EHQA 3LBHA 2PUDA 2Q3JA 2A3RA 1Y7IA 1CUJA 1TRKA 4ZOLB 9ABPA 3HDHA 4C1NA 5JU6A 3G23A 4C6RA 1YB6A 2FH5B 1WW8A 4XQ0A 5KO2A 4C7OA 4KUEA 2R751 4MYDA 3RIYA 1B14A 2VRBA 2UZ4A 2OCLA 2IV2X 4LI3X 2XMZA 3I2GA 1FP2A 2P6NA 3NHBA 3A0UA 1SQ6A 4YP7A 2RAFA 4M9ZA 3R0IA 1J07A 4I1PA 5EXSA 1GCUA 4DIMA 1DAFA 3T3MB 3ZHSA 1OKKA 2J33A 1UJ4A 3UMGA 2QLJA 5JFGA 4AC9A 4HDRB 3FB1A 3EZGA 5B4TA 5AXBA 1P5FA 5KYKA 4UMVA 2OFXA 2GZRA 3C98A 4LYGA 1AK1A 3HB0A 1YQXA 3OQ1A 4RVSA 4YRQA 3ZXIA 4YPVA 5TRTA 3VC3A 1O87A 3BMNA 3OE7A 4POAA 3BFKA 3KDSE 3KJFA 1IEVA 1VYTA 5HM8A 1FYVA 5HIKA 3WL3A 5KWSA 3W2GA 5TT0A 3K9QO 2TMKA 4IDCA 4XTCS 4EUEA 1RCTE 4M1SA 3QTBA 4PR0A 4EG4A 3HJUA 3HSSA 4PYLA 1OIWA 3GQBB 4QEDA 5CJJA 3WK7A 3D4OA 3E22B 2Z98A 3RI3A 3ZWQA 4J4BA 1QPBA 4M22A 4ENQA 1V3VA 4UVEA 3GAZA 2C4KA 1KYVA 1PJBA 4O4LB 1S4QA 4NU6A 1V26A 4FDAA 1HEUA 4WECA 1EFHA 1FFHA 3CRZA 4BFUA 4J0FA 4P81A 3AR7A 3BWCA 2FUKA 5BSEA 4LDAA 1KI3A 4A4DA 3IBGA 3O8QA 4DLLA 5FKJA 3WG9A 1U6IA 3FJOA 1BA2A 2JEZA 4EKDA 1GKUB 2I1VB 3N74A 2XT9A 1XEAA 4EG8A 5KYXA 5BSFA 2LDBA 3D02A 2ZZKA 5FTMA 4Q4CA 1RWXA 2OR3A 3KZCA 4MIYA 1L3IA 1Z28A 1KH3A 4YCJA 4A82A 3E23A 3VYUB 1VHDA 1KKLA 4DJFC 4ZYTA 3DLPX 1WVMA 4BN0A 2GZMA 4HDKB 3UEOA 1Z5ZA 4FUQA 3CNQS 1HSZA 1J0DA 1D6JA 1P60A 4E1BA 4B5KA 3B38A 4NU5A 1HG1A 4WX2B 5JV5A 3U39A 5K0BA 4LF7B 4DJAA 5DPMA 2Q6LA 2LWIA 1KY2A 2W00A 1Y8AA 4IFBA 2I7DA 3P0FA 4UMEA 4XW2A 1VPLA 3VYTB 1RBZA 1BE6A 2H16A 3GB9A 1X1SA 3UWDA 4CF7A 3ANXA 2N9UA 1RP7A 3HADA 4Q7LA 2Q1UA 3KQKA 4BMPB 1XL1A 3NMUF 1OY1A 2AK2A 2Z08A 1DQYA 3MNFA 2Q6IA 3W6ZA 4I19A 4NOLA 2VATA 5C18A 4YMLA 2O8FA 1D3AA 2CXPA 2A5YB 2EKDA 5TQ2B 2G9NA 1BDHA 3IKVA 5JPCA 3IEXA 3N7AA 4KGZA 3P2EA 4OXKA 5CPBA 1RWPA 2QL7A 5CLQA 1V7PC 4RANA 1JPUA 2V6MA 4URYR 4BPBA 4KN8A 1IOVA 2JANA 2VSQA 2IX3A 2PGDA 4QHYA 5K20A 2HUPA 2YFKA 3LBFA 4GUDA 4NOJA 3T4EA 3HFGA 2BZSA 4B4WA 3L0OA 2Q7XA 4GM1A 4F5EA 3AIKA 1RLUA 1QLWA 1S6YA 1XZJA 2BI8A 3T94A 4D8WA 3T5TA 2OT3B 1S2OA 2VWHA 3HBAA 4Q3OA 3KEGA 4WA7A 3T7EA 4YAIA 3P9ZA 2HMUA 1G18A 5FUXA 1YZ3A 3EQ7A 3RGGA 1YC2A 5ITWA 3F2IA 2PQ0A 4Z0HO 4KQ2A 5HJ2A 3LT4A 2ZK7A 2XE4A 1LGYA 1N2BA 4TWBA 1VP3A 1ZHHA 4C04A 2H9AA 1U99A 2C0PA 4GMHA 4K9DA 4MKGA 1Z0UA 5FWDA 2C9MA 2EJUA 2Y9PB 5DBIA 1FNCA 3OUUA 4AULA 2QAGC 4BKUA 4JEUA 3M3DA 5A4AA 2O2GA 2F9FA 4EMBA 2AHRA 1E58A 4QKQA 2YWCA 4ATNA 2XCOA 4BQPA 1Q11A 2J0VA 3F3KA 4ZO9A 4DRZA 1WXDA 1TJ5A 2JNWA 3SMQA 2LBPA 1YJAA 1SURA 4EGAA 3WLEA 4J3FA 4WXRA 2H1HA 2FP4A 4I5DA 5DOZA 4MGZR 4A0QA 5JOQA 1VJ0A 1Z3IX 3DZKA 2O8EA 1FTWA 1ZM2A 2V6JA 2G7ZA 3DMRA 4MLZA 3AWDA 2GLTA 2ZR0A 1NJGA 5FT9A 1Y34E 2PMKA 3ELWA 5BVHB 1G38A 3K0KA 4GM0A 2HMWA 4O29A 1P7YA 2B8NA 1GKYA 3U1BA 2V1UA 4RHUA 1UMBA 2ZYSA 3SR4A 2GPAA 2I1WA 2I7TA 3I4LA 4YLGA 4BU1A 5KNBA 2N47A 2NN3C 3H2HA 1U3DA 2OVBA 3AVPA 2DPGA 2C77A 2O2SA 4E0BA 4PZUA 4URVR 2HWXA 2NUTA 3EA4A 3EARA 1KIAA 2OM2A 1PLKA 1KXZA 1T2NA 1LKZA 1UFVA 2OBLA 1O95C 4UAUA 2BMAA 3IAXA 1D5WA 1YSCA 4FB5A 1EGHA 2WHPB 3LC7O 4LTNA 4BO0A 3VXKA 4ZCLA 2XB2A 4UQPA 2YRWA 3AX6A 2YINC 2GN8A 5AOBA 1HE4A 4JI8B 2C9CA 3NBMA 5JO9A 1OSNA 3IUQA 1Z36A 2XW6A 4JROA 2IZOA 3JAWB 3ZCRA 4DNFA 4OTZA 3C74A 2NQ8A 221PA 1U8FO 4Y6LA 3TI7A 1I4WA 3SE7A 3R5HA 5ALEA 2FEPA 1R9MA 2O7QA 2AC4A 4MW2A 1A5SB 1WVIA 5FTNA 3UJDA 3VO2A 4N9QA 4NONA 2IXAA 2J08A 2WF7A 1RIFA 5FTKA 1OWNA 1CKEA 4FFOA 3BE8A 4MW7A 5IKEA 3L2OB 4RAOA 1T15A 5KEIA 1T9GR 3LKDA 2DY1A 2QA5A 5JD5A 1XTKA 1CE8A 2AG5A 1V9CA 4ID3A 5EXTA 4HB3A 3O73A 3GDOA 1V1MB 3WIBA 3PEWA 1NUTA 4P7KA 1PGQA 4R2JA 3ZYZA 3GAAA 2P5TB 4ODIA 4ENVA 5JNVA 3IBYA 2E4YA 1E1QA 4PLPA 2FUG1 3SC6A 3VNAA 5K8CA 3A7DA 4JCOA 4JK3A 3FETA 1JKXA 1TO6A 2DPYA 3RIXA 3WGYA 2YC2C 2ASEA 3CRVA 4C7VA 3RJTA 4HVCA 5HQ3A 1WBDA 8GPBA 3G59A 4UCWA 1L8QA 4UNNA 5HYVA 3O47A 3FR8A 2LW7A 1V1RB 3GG9A 3VGPA 5C52B 3USZA 1CRWG 2Q6KA 1SUAA 1KWKA 1O97D 2WG1A 1T2EA 4CM8B 2B6HA 1SUDA 2OG2A 1AKTA 2G67A 1KR2A 4PSKA 2VHXA 3TXYA 3LFHA 1N7GA 4PYJA 1H42A 1KDVA 5AK4A 5E2IA 2VF2A 3TCXB 1R6VA 4INZA 1LLDA 1ETHA 1KZ1A 1P0PA 4NCKA 2Q27A 3SQNA 1KEZA 4P3PA 3REFA 1ML3A 4C0LA 1HE3A 4PYMA 1IDN1 2MDTA 3QMVA 2XMQA 2WB2A 3ER6A 3DR3A 3Q2KA 4UZEA 4EJ0A 1JDJA 1DTEA 1OWOA 4TKLA 1AG9A 4YEDA 3QIVA 3E2PA 1JAHA 2BR3A 2XUHA 2ZREA 2PVSA 4FZ3A 2DFTA 4AKEA 2ZJ6A 1UAAA 1TLTA 5G4KB 2CW5A 4YDRA 1SHUX 3BK2A 1EE9A 3V7UA 1S3GA 3AEUB 1K2VN 1RYFA 3R8FA 2IEGA 721PA 2FMUA 3O8RA 1J97A 2W6MA 1N4DA 3CE9A 3EF3A 3O9ZA 4JD5A 4EZIA 3SQXA 4NCHA 2BD0A 2CV1A 2A33A 2J30A 4A36A 2J8ZA 1T1IA 2OQ2A 3G2QA 4EGSA 2CMKA 4YACA 5CHYA 4ZTUB 2OAP1 3IOMA 3AR8A 3OF2A 2PZJA 3QH4A 4N3NA 4YCMA 3PK0A 2HA7A 1XALA 3Q7QA 4YDQA 5LWHA 3CJTA 3TRHA 1N9KA 1EFCA 2O4CA 1T9HA 2ZROA 1BYUA 3NAGA 1U7HA 1LJ8A 2YL2A 4HRVA 2Z83A 1ZXLA 4IIJF 4X6LA 2M6RA 2WYHA 2O23A 4FLFA 5FQOA 5H4GA 4MRNA 2TECE 4XGIA 4D9JA 2J09A 1I36A 1PS9A 4RCVA 1N7IA 2AI1A 3MBKA 2WJWA 2LGJA 4XX0B 2JATA 1XRPA 2II6A 3KXKA 1FBTA 4PANA 4RD6A 3SYLA 4DV0B 4KQGA 2DQYA 3CC8A 1PVDA 1VG1A 1XEXA 5DN6A 3SS9X 1SXQA 4ABYA 3AM3A 4JCCA 3ZE7A 1Y7LA 1S8NA 1T3HA 2GCOA 2NNWB 3GJ5A 4RJIA 1US8B 3FLMA 4IZOA 3R3SA 4JI1B 1QYCA 1MG5A 2OGWA 4RHFA 4CCYB 4I4NA 1GRVA 4RU1A 3OJCA 4RGBA 2I8LA 2P9FA 4OXXA 4AMYA 2CNNA 2CF6A 2YN2A 3ZTYA 2VUSA 4AWAA 4LSGA 4XSGA 3WMXA 2ZWOA 1EJ2A 4HVTA 4X1YA 3H17A 4NBNA 3SX2A 5IAAA 4OQMA 5U4QA 1WKVA 3SQLA 5M29A 5MN6A 3L8EA 3HKEB 1Y3DE 5HJ5A 1V11B 1IJBA 3LIPA 4OF4A 4Y1FA 3GT4A 4HN4B 1IPEA 2Y0DA 3HCWA 5BOVA 2JI4A 2P41A 4A8JC 4B7CA 3A2KA 1TF2A 2TRSB 3TD6A 5D5PA 1RQGA 1Z83A 4PC6A 3UUFA 4ENSA 2YRXA 5M04A 1NXSA 2AD1A 1J20A 2VQDA 1FP4A 1OR8A 3PX7A 3YASA 2GCGA 4BNXA 2O57A 5IVHA 1PSZA 2BH9A 2P5SA 4YRTA 3SPXA 4YRJA 4JYPA 4UDXX 4BCCA 2BGMA 2EXXA 2C3UA 3LX8A 3WQBA 3K4HA 5H5JA 3M89A 4YR9A 5CURA 1CUDA 5BSMA 2G71A 4P86A 4FWTA 1U04A 1IHDA 5L3VA 2IZ5A 1VMIA 4IY1A 4EI2A 3DV2A 4OI1A 3MUOA 4Y9DA 2CZQA 3JQFA 1QBKC 1SA0B 2HDWA 4JP8A 1IVNA 3UMJA 1SXJA 2BKUA 3ZY3A 3PTZA 3C8HA 3PGXA 2YWRA 4RK1A 3UMCA 3ENVA 3KWJA 1HF3A 5AJTA 1DWUA 2JEYA 3W04A 4CCWA 4ZHQF 1VL1A 1MABA 5NULA 1QRTA 1V6CA 3DZFA 4L4RA 3TCKA 4CF3A 2R4QA 1PZMA 2UZ0A 2BONA 3ZG6A 3A1WA 4DR2B 2P3QA 1ENOA 2H0AA 2YXLA 3FWZA 1HDOA 3O92A 1STOA 1FMCA 1X7HA 2V9PA 1GTG1 1BD3A 1ZRSA 3PG5A 4HWGA 1PZEA 3ROZA 2DR3A 1MV5A 1PZHA 4FVTA 3AY6A 1C9MA 4LXQA 4PR3A 1BW9A 5D87A 3M2TA 1PL0A 3W5SA 5FLXA 2VDMB 1RPNA 4NAUA 3X2EA 2Q4DA 4FMDF 1JU9A 1N6PA 3ELYA 2QRGA 3OF3A 1LI5A 4OAPA 1OB5A 1MA3A 1QHSA 3C41J 4F92B 4GP7A 3AERB 1XZEA 1RC8A 2GTHA 2I6SA 4JP3A 1CRQA 3AVYA 1EM8B 4BKQA 1IQPA 4CQMA 2QN7A 4G1MB 2BUAA 4JOSA 3BMOB 4LYJA 1MW9X 1YBHA 2CJWB 1BMFD 1O77A 3WL4A 3ZZ1A 1PJRA 1UP7A 3U19A 4WQMA 1N1MA 2RH4A 4DWVA 3HXOA 5HKLA 3UENA 3EZ2A 5BQ3A 5J9FA 3OE4A 3BC1A 3C2QA 3WYNA 4B3GA 2GZSA 4LZPA 2WUEA 4JLOA 5F9MA 4FEGA 2I62A 4OSEA 4PN7A 3PYLA 1NXOA 3KCQA 4UU7A 1XLTC 4UM8B 1ISIA 4AK9A 5DT2A 4Z4GA 3KVVA 5E0KB 2O0MA 2FP3A 2NU9A 4FP9A 3LJKA 1QGOA 3N8NA 4DUGD 4YX9A 3CNLA 5BUQA 1JJ7A 4I36A 1NPTO 4TRJA 5IDQA 1N5LA 2ROQA 3QPAA 4Y9RA 1CUSA 1ONBA 4FBMA 3OTWA 4IDDA 4CLOB 1LNSA 4M1TA 1CFZA 2R79A 4CIVA 3CNHA 4HQKA 2Q3HA 1NN3A 4B6OA 4HTFA 1NUQA 2E89A 2ZUUA 3E35A 1HT3A 4D46A 1Q20A 4ENRA 1V5IA 5KOJB 3DE0X 2Y1EA 3GRKA 1W19A 1BWQA 2XA1A 3TZBA 1I6MA 3GWGA 1VG8A 3WC4A 3OIWA 2MYUA 4I9FA 4JSYA 3V2HA 4NE7A 3ZIDA 1H2ZA 2ZEJA 1VM6A 3B36A 4CDNA 3UW1A 2GZ1A 2PPVA 1IBLB 3L84A 4ZZIA 2YRFA 1U0NA 1UC8A 5AKGA 1Z88A 2OL4A 2FRDA 3FVQA 1W8IA 3FCOA 4J91A 3PNPA 3NHPA 4N7MA 2IL1A 2CFRA 4BZQA 2YQZA 4LJ9A 2A8YA 5BNWA 1T9BA 3OX3A 4A8JB 2JFUA 2P5YA 2PGLA 1XF1A 1FX1A 4H2DA 4LNUA 3TW0A 4OHYA 5B55A 5AI4A 3TOSA 1M0SA 1WUKS 3K0EA 4ZI3A 2A0UA 2WWFA 1GZ6A 4JBYA 2BFCB 1HV8A 4TZTA 4OHUA 3FD8A 3GL9A 3MQFA 4DUZB 4JV5B 1NW4A 1R6TA 5ESXA 5CDGA 2C4MA 1PJ8A 4F4JA 3RAFC 3I32A 2C7GA 4NPHA 2PO5A 2VVTA 4V3CA 2V58A 4BEJA 2PBFA 5CFNA 2AW5A 3U6KA 3GDFA 2XOEA 3ZGYA 4CNBA 5KOIA 3Q10A 1B2LA 1S2DA 4JELA 4TROA 4X54A 5CPFA 4Y2HA 1KZYC 1EE1A 2AN5A 2JFNA 3D6NB 1MDBA 5LNK6 1E2BA 3WRWA 2XYVA 3PP8A 3QVTA 4EELA 1RBYA 2REQA 4GOMD 5AJYA 3EBLA 3OZRA 4CCSA 4RA6B 4Y2QA 1JJFA 1XTZA 2O2DA 3DHYA 3GROA 1SHJA 3IYLW 2JJ8A 3D7MA 1KQGA 3QENA 4CM9D 1NYLA 2F8MA 3QLUA 1PFQA 1U0TA 1Q1AA 4GKAA 1PS8A 1M2VB 1OREA 4IV5A 4G0OA 1T1EA 1RTTA 2IOHA 4JB0A 2O6LA 4CEJA 1ORTA 4J1NA 1M2EA 1JG6A 4U0KA 3HYTA 4MP8A 2LNDA 5CA1B 4LFCB 3IDZA 2B94A 3JARA 5HFJA 2VNJA 3BB4A 1F2TA 1JHVA 1LZKA 4ESVA 4UPDA 1EDEA 2C97A 5DX0A 5DYWA 4B35A 1PLJA 4Z8XA 3W5DA 2C94A 4EY6A 2NUAB 1QPZA 4I5IA 2B7CA 1SIBE 5K3DA 3G2IA 2B8WA 4KPGA 1INLA 1FX0B 4NFHA 4HQLA 4O4IF 2GEFA 2F1OA 3K9NA 5CJ2A 3VZBA 3AF1A 4BAGA 4V02A 1ENZA 4QE3A 1IRIA 1NBHA 1Y4DE 2AC2A 2PL9A 4UW9A 4V2UA 3UZUA 1TTPB 2BMVA 2P7HA 3DB2A 1U3TA 4MCHA 3IMKA 4CV3A 3VZSA 3LQQA 4G25A 2Y1LA 1XYYA 3MWDB 1MIHA 3O8LA 4I1SA 4JXKA 4N65A 4NQRA 3W3ZB 4S1PA 1C9JA 1PJ3A 3NIDB 2BF4A 4M83A 5HMLA 2OLJA 4XIYA 4JNKA 2QV0A 4IIGA 5CLHA 3QWIA 2GBGA 3AG5A 2PSJA 3DFZA 4DZRA 3ADCA 4MMYB 4KSBA 3ZY4A 5K0FA 4L0MA 5CFPA 1U7PA 3LL4A 3DKKA 2NYUA 3ABRB 3EW7A 3ZOZA 3M34A 3PNBA 5EUQB 2VDPB 3ZTTA 1JPNA 1T3LA 5B3AA 3C5VA 3FOZA 2YVQA 4IHJB 1QIIA 3EHEA 5IVPA 1H1LB 2DKOA 2P2YA 4A6EA 4A8TA 1RQLA 4OSPA 3IAFA 2K6GA 1NVBA 3PF9A 5DF1A 1OKKD 1UDXA 5A7GA 1M7HA 3N2KB 4QGAA 5E4YA 4NHOA 4KJXA 4WN9B 1YR9A 5IYZF 1M2FA 5ALGA 2CYAA 4Y2GA 3VPHA 3SQWA 3H4TA 1PL8A 1JHPA 1ECPA 2FSHA 2RBGA 2ZTMA 3GEBA 2VPTA 4IUYA 4F9EA 1WXQA 2KMLA 4P1ZA 2NSDA 3C5HA 4JT9A 3UAYA 1V2HE 1VMKA 4CLRB 4F2GA 3OE7D 5CIYA 4UJ5A 4S04A 2VUUA 3M6LA 1VSBA 2DULA 1WLSA 3L7DA 4I1OA 1YBFA 2Q3MA 1NWHA 1MF7A 1ZOLA 1O4WA 1TKAA 1IIRA 5THQA 3AIIA 2ZE7A 3WJ1A 1A96A 1JPVA 5AM5A 4PNPA 3WLNA 3TSWA 1IEWA 1XD9A 3GDHA 2WQ7A 4LG1A 3KYCB 1SBYA 2HF9A 1Y6QA 2AOUB 2RD2A 2B9EA 2QD4A 1KJZA 3T3EA 1LF5A 4RTMA 1LPSA 1SXIA 1YKGA 1B26A 3DQZA 4MW4A 4DCTA 1HDYA 4PCVA 2NPIA 4YMIA 2H1CA 4EYSA 1L7MA 4PIMA 3PXGA 4DIBA 2OXCA 3C24A 3IAUA 5LZ4A 1W96A 2BBOA 4F1WA 3BIXA 3WLIA 1NG9A 3DBIA 1B43A 3GVIA 3N0VA 2QGZA 4BNMA 1AXEA 2CB0A 4R2WA 2ORWA 4UKDA 1NV8A 1PG0A 1DRUA 2H9IA 4Q9IA 1JYFA 4F06A 1HLGA 2AI2A 1JE1A 1TECE 2H1FA 2JLCA 2Z30A 4HKTA 2EQBA 1VKRA 2IXTA 4WCVA 1G5QA 3X43A 1D2NA 4GLJA 4QFMA 4KPUB 2D0OB 4KACA 4XM1A 3OTOB 2DT5A 3GA5A 2HBRA 3A6JA 1G4HA 1O8BA 3OZSA 2Q3CA 3WP0A 1H2RS 2RGUA 3B20A 4W9NC 1TCUA 5J40A 3KDAA 1ZOIA 621PA 4EZBA 2DHCA 4YUVA 1I2CA 1OX5A 1GPDG 3LC1O 4PO3X 4QLAA 1QH8B 1PJTA 3ONWA 5CXSA 1Z13A 5CLGA 4YAJA 1IM2A 3H2GA 4DZTA 2XUKA 3JV7A 4XYBA 2GPNA 1CNFA 2F43A 4S05A 1MOZA 1J8YF 1HDCA 1R6BX 2F48A 3AR9A 1RMYA 2PKQO 1GLGA 1COZA 1RWMA 1L9KA 2HOQA 3FHCB 3MS7A 4J6FA 1K3FA 3M1IA 2RHOA 1NBWB 3IAM6 1TYAE 1PBNA 2L69A 3NBKA 3RROA 5D85A 1HOTA 3V8PA 1SUFA 4D4JA 4HNRA 3K6SB 2GK6A 3L8DA 4J9UE 4OQXA 1PS0A 5FUBA 2PGNA 3VR5H 4FN5A 1KSGA 1YZNA 1YTLA 3G89A 4HHEA 2PBLA 3IVRA 1FYEA 2D13A 4LJRA 4Q3AA 5KC9A 4MS3B 2PYDA 1TQDA 4FR5A 3VVMA 1UBEA 1XRLA 5JROA 3EXIA 5EJ6A 4EQ6A 5KYVA 1USVA 4N54A 3W9BA 3VYRB 4MR9A 3E4DA 3PR2B 4NBSA 4ROSA 4B7AA 1Q57A 1WV0A 5ECGC 2ZUFA 2FETA 4B2YA 2CDCA 3IT1A 1OXTA 3MIIA 4CMHA 4C29A 2ZWVA 1AHNA 2OZKA 1QZUA 2X8JB 1Z62A 3GUHA 1P72A 3HVHA 4CV2A 1N34B 3UV3A 2W2OA 3IQFA 3L7LA 2APJA 3UMVA 1XCBA 4UNRA 3R24A 3MJEA 1KZ7B 2ZRIA 3P52A 3ZD9A 4C22A 4TMZA 1K8ZB 1O6GA 4JYMA 1JDSA 4DQUA 4Z4IA 3I6MA 2W8BA 3G8BA 2H2DA 1UKYA 2P0AA 2PUJA 1BJKA 1ZFNA 2X6QA 3E8MA 3EDRA 1KY4A 3ZV5A 2V8OA 1VE1A 5LD2C 5C1BA 1Q95A 3AK4A 2LZ0A 1Q7GA 3ZE6A 4QGSA 5JZSA 3I1FA 4MRMB 3CZ4A 1TU3A 3Q6MA 5FRDA 1MC4A 3E1KA 4J0EA 5DWQA 2Z09A 3JY6A 3EUAA 1ZD3A 2W6JA 2XCSB 4XIGS 3GFQA 1EESA 3DBRB 2VZ0A 1AT1A 4MVJA 3U26A 1RZUA 1NN0A 2B82A 4KWIA 3ROEA 3T54A 4B4UA 1D6SA 4Z7NB 1DOHA 4MGIR 2PWBA 2V7BA 4KSCA 1TMOA 1NAIA 1YNOA 3FDZB 2GM3A 4WEQA 1JHDA 3NHKA 1EX6A 1F5SA 5REQB 5C1IA 3A1TA 1SZJG 1G8MA 3PITA 5JI3E 3G0HA 2PY6A 4KJZA 3EHDA 3JYHA 3U6BA 4F3NA 1G7RA 1SBIA 3MT9A 3BJIC 3JWJA 5T67A 1NY5A 4H7IA 4RF4A 2ZJ0A 5D00A 4MWBA 1P6UA 1QZTA 1JQEA 1V8OA 4D56A 3KQNA 4DNPA 3WKEA 5LMZA 1L8OA 1B93A 2G28A 4RIGA 4MKXA 4BWFB 1EBBA 1J22A 3AFNA 2Q9BA 1F2VA 3M1LA 5AK3A 2WWXA 3PRHA 1P0CA 2OBBA 2XX3A 5GP1A 2I7XA 2B20A 1RKQA 3QVWA 5IF3A 1DI0A 2EARA 3DLCA 2H52A 2OFWA 3H5IA 4N3BA 4AF6A 3HXMA 1DAGA 1E1RD 2IIQA 2C04A 1MX1A 2X19A 1G17A 2HREA 2O2CA 3DBHB 1R8XA 1ZU5A 1E3MA 2Q4TA 4EX6A 4LDPA 3QW4B 3W6NA 3LCVB 3HUUA 3MGBA 5AKEA 1X74A 3CTMA 2AEMA 2F59A 4HFJA 2VDRB 3QELB 3MRSA 5CD9A 1QO9A 1K6MA 4EG5A 1Q83A 2QG6A 3B3FA 3VTKA 4CMEC 5FH9A 5KSPA 4BB9A 5ADWA 4CETA 2HA3A 2A9FA 2OZVA 2XZTA 3I04A 4KNWA 2QOEA 3IRVA 1FA9A 1E1QD 5HGXA 1A9TA 4KW7A 3LXRA 1UDRA 3T52A 2OCDA 1ZCBA 4C9BA 4H7JA 2WZCA 2C54A 2PXHA 1C1DA 4L02A 1Z6YA 5EP3A 3FMPB 4CFZA 4UM9B 3T12A 1IL0A 3DMGA 3VAZA 1II8B 4I1VA 1YACA 3R20A 4FXOA 1L8XA 3B1ZA 4DXAA 3NEJA 5FA8A 4IUDS 3U3RA 1UR5A 2JJYA 4B80A 4UTPA 1LLQA 1GG8A 2XWSA 2AR0A 1SCIA 5JY1A 4J2OA 2XRYA 3AZPA 2FDRA 1DQPA 4NCIA 2BWJA 2D0PB 4ZAGA 1HXHA 1Z38A 2DCMA 4Y2TA 3G5UA 3UVEA 1BE8A 2IH5A 1LJUA 4HN2A 1KAMA 4G1FA 4N12A 5CX4A 4O4HA 2GXUA 1FU7A 3H75A 4HB4A 1U8CB 1N0HA 1CVRA 5FCDA 3FFXA 2ZTVA 4YK7A 3ZJYA 1LUAA 4IJQA 1AUOA 2R97A 2YXPX 2P9HA 5ECWA 3IUJA 4O5AA 4AF7A 1OXKB 4HNTA 2AFIE 1YOVB 1A2BA 4M0MA 1EQ2A 3DL2A 1QK3A 1HC7A 3JQ8B 1ISPA 2I67A 2IZ7A 4QTXA 2KSQA 3ZY2A 5C5EA 4D45A 1JDVA 3W2TA 4D3DA 2JJQA 4AKGA 1XVLA 3F74A 1WIWA 1JKJB 1A97A 2L19A 3EZYA 1TRHA 3WGIA 4WCFC 2X0IA 3PQ2A 1LQUA 2WHXA 4HNAA 2FG5A 4MMXB 3FCXA 1X7YB 1QC5B 2QM8A 2K5UA 3G6KA 3P5BA 3D6UA 4YAWA 3WLPA 4RLFA 4AG6A 2JIZA 2VCHA 3BG5A 3DOCA 3JQ7B 3H8WA 4UNQA 4EVQA 3TE7A 1JIXA 4ENUA 1Q0PA 4XKJA 4AUMA 4DWJA 1FBNA 5DCLA 1UBTS 1I7NA 2DQ4A 3W5UA 4NYJR 1YMVA 4D79A 4F8JA 5B4UA 1USWA 2WTEA 2AN3A 2H59A 3A2NA 1P7CA 3MN1A 1E98A 3IPCA 4QPNA 1DKLA 2YR0A 4TXMA 2IJGX 1D2HA 2C7OA 5A9TA 2P75A 2B1RA 3DA8A 2LIPA 5BW6B 4ZQGA 5BWMA 3EDOA 3RYFB 4BO7A 2QHXA 4OYYA 2XY4A 2OYSA 3NP7A 3COZA 1DDIA 4IZ6A 5J4VA 2HCRA 2Z4SA 1WUJS 4TT8A 3L8FA 3LTNC 1GL6A 1RXCA 2C83A 3OCVA 4RMHA 4O2LA 1I51A 1K06A 5HZKA 1SY7A 1YU9A 1Q1GA 4ZK6A 4HNUA 1C3OB 4DIUA 1TT5A 1DZIA 4FGWA 3DL7A 4LV5B 4QGFA 2OFPA 4AJKA 5BV2P 2W6NA 5DP2A 1J39A 2DB3A 3P9IA 5SZIA 1N36B 3ZY6A 1CLEA 1OGJA 5GQSA 2FX2A 5E6RA 4YWJA 4R98A 3DH0A 3F96A 3O3OB 2WKRA 1VBMA 5J4HA 1SPBS 2UYGA 4L75A 1TO1E 3FR7A 4O4IB 1E5VA 3I6BA 3T1QA 2EHJA 1ZGBA 3H8VA 3HVJA 3UOWA 1QTRA 1D4ZA 2ZUSA 4M0DA 4WBNF 3AOEC 3W5JA 2YIVX 1U0GA 1XDUA 1UKAA 3LDHA 5G1NA 1UJ6A 4UMDA 1XJCA 4P4SA 5G41A 3N0TA 5K0ZA 1T91A 2J3KA 2G9UA 3HR4A 5DVZA 4ZCTA 1BE0A 1TM4E 2B61A 1USUA 2HD4A 4NENB 4MV3A 4X45A 2O8VA 4CJXA 1PJ2A 3CE6A 1REQB 1EFRA 1FQJA 3QKUA 1RQRA 1TZMA 2JH9A 1JDNA 1OZGA 3EAGA 4WXYB 4TQ9A 1I7DA 2CWDA 2HDOA 3O4VA 4ZT2A 4BX0A 5HBGA 2XE7A 5JS1A 3R5JA 4D9IA 1SVOA 4OMCA 4JXZA 2PFSA 2IZ0A 1IUPA 1XDGA 4P4TA 1N2HA 2FSPA 1XUOA 2XMGA 3TIVA 4F8EA 4O4JB 1P2SA 3BGVA 3LKVA 3IDQA 2H2IA 2WMOB 2FR8C 1QP7A 1CUZA 4NJMB 4S1OA 3SC2B 1N2XA 1V45E 1IZYA 3AEKB 4NDZA 3AIMA 3CUTA 5TX7A 3AJ9A 2B1GA 1FYFA 2P68A 4QUKA 4YV0A 1QAQA 2BDEA 2XOXA 3OHSX 1R6UA 3C4QA 1FUKA 1EJ6A 2R2AA 4BV9A 3RSLA 3SYTA 5HS6A 4C2BA 3MF4A 2CVZA 2OZLA 3DZCA 3D7RA 4JDPA 1ZOPA 3N70A 2Y93A 3SEAA 3HM9A 2ANCA 4D96A 3ECAA 3H65A 3LFTA 3PUKA 2D2FA 4UOEA 1X7DA 1FFDA 3OCJA 5BR7A 1OLUB 4HQFA 1KBQA 1MFPA 2FI1A 3LKZA 1UBCA 3RJMA 1FRZA 4EO9A 1K7XB 1ZI6A 1TZJA 3X1YA 4DCSA 4KYIB 2ZBDA 4CL8A 4IH1A 1Z0FA 3BF8A 3N1UA 1Q6YA 5FBHA 4NYJQ 4ARUA 2NAFA 2JAQA 4DANA 3CKKA 4QXAA 2VJDA 3HCRA 1BGWA 1ZLYA 1SVNA 2WZQA 3KV1A 4PFSA 1V71A 2JIBA 3U5TA 2B7LA 3OMWA 4KREA 1LB1B 3S8MA 5CG1A 2IRWA 1EYZA 1QFSA 3DEYX 3EFHA 4QATA 5FF9A 4IG9A 1RACA 4I55A 3TLGA 4EGCB 4FD2A 5JCXA 2F3QA 2XT6A 3SSAA 1ICEA 2FZKA 2C2XA 1OLSA 2Q5JA 4IZIA 5BOSB 3R9XB 1DCMA 5F9FA 1NVXQ 4UBJA 4MUIA 3NIBA 2O0HA 1HFWA 4MAMA 4NABA 4QOSA 1U2RA 1FTQA 4M49A 4V24A 1M6YA 4BAZA 2WTUA 3F0TA 3WLJA 5GWXA 1VBFA 4Z0TA 3LT1A 2Z43A 4DLUA 4TWAA 1P2VA 1ZI8A 2DF8A 3AR3A 3WTBA 3I8XA 5HOEA 5JECA 5LDDC 5EIEA 2CFSA 3KUCA 3GLFE 2YOFA 1M6VB 1QVZA 3H1BA 1XTTA 4XOIA 3HSYA 5F51A 4Q4AA 1KPHA 2GBLC 2Z9CA 1HRDA 1Y9AA 4H3HB 1Z68A 3ED1A 4DPLA 5FFFA 1BDMA 5BW8A 1RDFA 1TVMA 2VWGA 4DARA 3PJRA 1OVGA 3C85A 3FZQA 5F3RA 3S2GA 4ZFNA 5FBRB 5WRFA 1BMTA 1NTRA 2IUTA 3RG2A 1UFRA 1U4NA 1NLUA 3BN3A 4PFJA 4YC7A 4OYRA 5FOVA 5G40A 3D3WB 4LGYA 1F0NA 2R1TA 1ODCA 4Q82A 1BWPA 5KYWB 4Y0AA 4E3WA 3W5CA 1ADGA 3HN2A 1CQIB 5DHAA 2ODBA 3U7IA 2G4LA 3IX7A 4B09A 2YS6A 5F2EA 3LWDA 1X0XA 1RM0A 4XPIA 4DGQA 4FGZA 3EGDA 3AP3A 2DQZA 4PRKA 3JZIA 5LCXA 3QXXA 1UK8A 3P20A 3SLGA 1KI2A 4DDTA 1ZAYA 2PZBA 4UCXA 2P9QA 1E2IA 2ZJ3A 1Q1NA 1UT6A 1EGAA 1QGAA 2PKWA 1IY9A 4UUPA 5JAQA 4BXOB 3C7CB 1ESEA 1MUUA 2OCIA 2VAWA 4WNYA 5F52A 1JR6A 3OJXA 1P0FA 3JQGA 3K53A 4OBEA 2ZULA 1E2KA 5JALA 2ZITA 2E82A 2PJUA 4PLHA 1QDEA 2Y9MB 2E37A 2HZBA 2YY7A 2IHBA 3PFBA 4G5RA 4P8RA 5DNWA 3UXYA 4M8NE 3UHFA 5AW1A 3HU5A 4FYHA 4K0RA 5D51S 1H23A 2FFQA 2EWVA 1YVDA 4PFKA 2COKA 2R25B 3OP4A 1YK1A 2HIAA 3R3JA 3EE6A 4YJ3A 5JDCC 4DQVA 1DTWB 1HURA 4D3FA 4LVCA 1Z34A 5C46F 1CUCA 3K0SA 4REMA 2VP5A 3UBMA 1Z0ZA 3EWSA 4AMBA 3MPUA 1QKJA 3WHIA 4JJEA 1ZMRA 1YKFA 2FQXA 4LECA 4MKIA 3RC7A 5DULA 4TLLB 3EBPA 2LP4Y 1RAIA 4KSYA 4LTDA 1OYOA 3ELDA 3IPLA 4EYQA 2K7FA 3KB1A 2FHPA 4RHTA 4LDNA 4FI3F 3TRJA 4YQFA 3GLFA 1F8UA 2AJTA 1P0IA 3F9IA 4D4MA 2GBFA 2VHUA 4F60A 4NZOA 4QO8A 3VR1A 1G19A 5J4KA 4JYZA 3HUFA 1Q2UA 2NZWA 3MWEA 2QTGA 4M9QA 2W8ZA 3K96A 3PU6A 1SKQA 3NTXA 2AN4A 2JRCA 4AKSA 3USES 5HF9A 1YE3A 1XMPA 1XL0A 1C4WA 3LHKA 4WOPA 1KL7A 2WJPA 3H3FA 3SHWA 1GZUA 3PNYA 2QUKA 1PFWA 4BEBA 2HQOA 1CY8A 2W0MA 2PX5A 3GGPA 1VLJA 1ZVQA 4L8VA 4FFSA 3PGMA 3VSEA 1HR0B 4I81A 4LBVA 1RSZA 1KH2A 4LWQA 3GRZA 2IP2A 4PSCA 2I9PA 3I8SA 4F5DA 4J7CA 2YASA 2ONJA 3EVZA 5CBPA 2PAFA 2HJVA 1ZNXA 2DBRA 3FFTA 3I37X 4LV8B 3AILA 1V35A 4ZRNA 4DG8A 4FFMA 3SM9A 4RK7A 5KI6A 1DT3A 5JVDF 5JWHA 5AVZA 1WD7A 2W0SA 1R00A 2OZPA 3E3NA 3Q98A 4LF5B 3V8EA 2JJMA 2HAEA 4X3PA 2H65A 3HJAA 3KE8A 1DKNA 3CZMA 4GR9A 3VX4A 1AK9A 3IP9A 5FLEX 1JQLB 4TLDA 4CKCB 4RZIA 2PZFA 2EG9A 2ZJ2A 4D0RA 5CK5A 4PZLA 4FNAA 3C8UA 1U4OA 2ZTHA 4Q66C 2NMVA 3IIEA 1QRUA 2D8MA 3A1UA 1U90A 1FVFA 2C0QA 2D3TA 2CHVA 2IYNA 3KJGA 3S27A 1W2HA 2ONZA 1XZNA 1MNQA 5I7WA 1P44A 3NWBA 4J2TA 1FU4A 2XB6A 3PD0A 2GSWA 3FGPA 1J1UA 3VUFA 3NHUA 1B7GO 1MTZA 1GPUA 1L1EA 1TTHA 2YCBA 7YASA 3F3YA 4OAOA 4QYIA 3LIIA 4MUMA 4U6NA 5EKDA 4DF3A 3EVDA 5AW6A 3VHXB 2D5CA 4KX3A 5LU9A 1HEYA 4I4TB 4FMBB 3JWPA 2BJVA 1C7JA 1U65A 2WFLB 2Y76A 4R01A 4GX0A 5JNWA 4XX1A 2OHOA 1CZRA 1E32A 2IEDA 3HI4A 3VVCA 2HFKA 2W58A 3AFMA 4YUZA 1V37A 5T8KA 3GCDA 3O3CA 2J9FA 4LUCA 3Q3JB 1VYVA 1ZMTA 2QT9A 4R2IA 4HYEA 5K99A 1WCIB 2VYVA 3BE4A 1HSOA 1YUBA 1C9YA 4HOYA 1LXCA 3UJNA 1N2IA 1QR6A 2DC1A 2AJBA 5KSWB 1AGPA 4IFEA 1WHSB 4R7ZA 4L57A 8AT1A 3ZBTA 4WY2A 2V55B 3LUDA 1OMOA 3EDMA 3ZWVA 5FPPA 1TIPA 3GUYA 3E15A 3QV2A 4B32A 4EI8A 1ZITA 2C58A 4MQLA 2QTVB 1KE1A 1P45A 3DVAA 6ABPA 2VZLA 1FF9A 5IJ0A 3AG6A 3OE5A 3O7MA 3BB1A 1EBUA 2JH3A 2Y1DA 2XDWA 5LZ7A 4B2PA 5IJ9A 4O3FA 3A4VA 2H2HA 1YS7A 5ALHA 3ETGA 3Q7TA 4PC3A 3W79A 3FFAA 1ZONA 3UJHA 4DBVO 1IXYA 1MHTA 3VDQA 2GTPA 4TX1A 4KPEC 1N2JA 1ODSA 1XB2A 1XG5A 3HZHA 1CR6A 4JBGA 5C4MA 5CNKA 1C29B 3PYXA 1YQEA 3HUEA 4O6VA 4V1CI 1Z15A 5F2KA 3W3AH 4QGHA 4JSRA 4RQAA 1GXSA 2O8BA 1OGYA 2JI8A 2OXIA 3QYAA 3Q8LA 3ROPA 1V1JA 4A5OA 2JI6A 3PYMA 5FUVA 2GPWA 5K3BA 2H4XA 2I2AA 5CB4B 3LAWA 3T3IA 2O48X 2I8CA 3KSMA 3R76A 3E5NA 4IW3B 4B43A 3L0PA 4DMLA 3D7LA 2Y05A 1IOZA 1YHZA 4MWGA 3SC3A 2VI5A 1KI4A 3HKBB 3EGCA 3ITEA 3LCUA 3Q8MA 2XYHA 1UBHS 3R3XA 3JZDA 1JG4A 3OCZA 5EE9A 3TEJA 1CY0A 2Z2ZA 3DULA 3RYTC 3LZCA 3GNLA 2BZGA 3HBNA 2ABWA 5GGXA 5JCJA 1EB9A 1W48A 3HXTA 4AQYB 1C3XA 4G8DA 5JEDA 3UAGA 2PV0A 1IZ7A 2EDCA 3C7TA 4OV6B 3WV4A 3CRRA 2F9LA 4EG1A 2P77A 3RLIA 3D7SA 4IGEA 2MYPA 2RK6A 3SVTA 4MUBA 2UVQA 3C16C 5TQ0B 3ON5A 3U7HB 3INGA 2JPDA 4KQCA 2J3IA 4QJBA 1GQYA 2I6FA 4OJNA 1K6JA 5DW3A 3QXCA 2V0NA 1FFCA 2XZPA 1NONA 3ZH2A 4MGEA 4DG5A 4DY6A 3GLRA 3L77A 1G6KA 2HHAA 1GNQA 4FFLA 5L40A 1EGQA 5J2TB 1KPIA 3K0AA 4RD1A 4BP8A 4ZU6X 3WMGA 1C8VB 3J81k 2BV3A 2PX0A 2ZRNA 3R5SA 3WJAA 4Q7JB 1S2IA 3OSZA 4WL0A 3CN9A 3H3XA 3MWFA 5ILQA 5GIPE 3NM6B 3KLNA 4GKJB 2WHRA 4PF1A 1LPOA 5DYNA 3BJZA 2GEUA 3R7FA 3EG9A 1JTVA 1FRFS 4QIHA 4A8HA 2X1MA 4MRRA 1IE3A 1X0VA 3H7AA 4N5NA 2V5AA 3PUZA 7GPBA 3M2PA 3KPYA 4AXXA 1X1DA 2GWHA 3D5TA 5K6TA 3V42A 1SU7A 5TC4A 2DBVO 5FO1A 2F8SA 1UOPA 5F7OA 3F6CA 2WVHA 3ZDAA 1BDJA 5KWJA 3NP9A 1CJCA 3E9DA 3K09A 2W6JD 1MJGA 1NXXA 1U2DA 4FQ8A 3IMFA 2DUMA 3G8YA 3KUXA 3WHKA 2JFVA 2AW3A 1N33B 2HMYB 1N5KA 4YJDA 3NGLA 4EY4A 1I6WA 4UASA 5EMKA 3CLUC 1QOQB 3HU2A 4K28A 3NKVA 2R5WA 3OZVA 5FNVB 3SS8A 5TMPA 1RVV1 3E7FA 3L8HA 3LCJA 4PY2A 4QUEA 4XUDA 5IC6A 3HJTA 5K8JB 2IGBA 1F7VA 4M55A 4WLOA 3RBAA 1DBQA 2YNMC 4QXQA 4RQTA 1XVAA 4UU8A 2FPKA 3THXB 1F06A 4CKEA 1R12A 1YFKA 4BLQA 2LKDA 2FEOA 4QRIA 5A9SA 4B3TB 2ETXA 4JITA 3V8MA 4DM7A 2BGKA 5C4IA 5K0GA 1XX6A 1Y1KE 1XU4A 2VRCA 3BT7A 4S1NA 1E5LA 3IIIA 5AICA 2FZLA 2R6CA 5JMOA 5LMUB 1JXOA 2DPMA 2PCLA 3V4VB 3TQOA 1L4LA 1EQUA 2OCAA 1XBTA 2R5FA 3QVSA 5EIBD 1WZNA 2FPWA 3K4PA 4RHYA 4XGKA 5JCOA 3G88A 3UFBA 1Z37A 2WAOA 4HAYA 1X92A 2P7IA 4WJKB 1JDBB 4IR7A 3PVCA 5I51A 3IPAA 1RHMA 2C2OA 3KKZA 3PC8A 4IVNA 4MUJA 2W98A 3CRMA 3Q6IA 2Y8EA 2GN2A 2JIRA 1T9DA 1NUAA 4IO1A 2W2MA 4MEBA 3LYHA 3EGOA 5BRNA 1U7WA 1J4AA 1QFXA 5EIHA 3D4IA 3V32A 3LQKA 4E22A 4PC2A 1B0PA 1Z29A 3FUUA 3KYJB 3DZJA 4M1YA 4G67A 1G8JA 5COQA 1E96A 5FYDA 4BGEA 3A26A 5LQAA 1N0IA 2ZI9A 2ONKA 4IEEA 1GILA 3CO0S 3C6KA 2EBUA 4W82A 3WIDA 2OORC 4GLFA 1GZVA 3KAPA 4HB0A 1JFTA 3K1AA 3TR0A 3WAGA 2OXEA 4JEHA 5B58T 1VG9B 3GZTB 1NSFA 4EKEA 2J5RA 3LBYA 4ND8A 4TSFD 3FBWA 1C7FA 3KTDA 3HWWA 2ZT6A 5H70A 2H00A 2Y92A 3TLBA 2KWIA 2RGAA 2WVJA 2HBQA 2M98A 2EKZA 1YJXA 4TRRA 1IULA 2C03A 4L5AA 4G0WA 1EVJA 1UEXC 1SCAA 4M6WA 5SY6A 2ZE8A 4LC0A 4AURA 2ERYA 4NK5A 4Z8YA 4TYPA 1KVQA 2HJGA 3ETDA 3H2JA 1VSTA 1WY5A 4TS9A 5C4GB 5JXGA 1ZCFA 2IVZA 2JZNA 3MJTA 1I4EB 4M9SA 3WKCA 4I6EA 2KE5A 4AJLA 5B6JA 1U9ZA 3GJZA 9LDBA 1XZLA 4DJDC 3CUWA 1HNZB 2VCYA 2FN9A 2A9QA 3WSWA 2XCIA 1FU8A 2FPXA 3CURA 1HDGO 1C4OA 3NOOA 1X8JA 4QLOA 1DLIA 4KN6A 2DG2A 2IUEA 4LJYA 3QQ5A 3OBIA 1KMIY 4V39A 3FOFC 1M5RA 4MPTA 1T1JA 2O5CA 1DAIA 3A1VA 4XRRA 3DKPA 1QH9A 4FHDA 4QJIA 1AO0A 1X77A 2VJBA 2JIZD 2VSYA 5F98A 5CFOA 2A78A 1YS9A 2CD9A 2ESRA 3BFVA 4UE3S 4ZRDA 1HDXA 3RFCA 3TBFA 1XXHE 4FHFA 3Q88A 4FR2A 2EP8A 2FJPA 4ER5A 1MT0A 1X7XB 4EYOA 2VDWB 1MENA 1H5UA 1PF7E 5F1PA 1NJ1A 3OIGA 3VSDA 5LOVA 3L7AA 1D07A 1NJFA 3NHLA 2IIBA 2IW1A 3CEHA 1ESCA 1ZESA 3H99A 4UUAA 4YJ2B 4ZO8A 5HQJA 2EP7A 3BSWA 3WSTA 3TZQA 4U5XA 3VTAA 4TMKA 2WOJA 2AYXA 4LJSA 3OZAA 3SLRA 2ZZNA 1Z5GA 2WG2A 4G6ZA 1UEJA 3ZHBA 5D1NA 3ENZA 4ZARA 5EJ7A 3OFVA 4GC5A 4G8BA 5AQEA 1ZVJA 2PS3A 4R1SA 1IIBA 3NW9A 3OPNA 4NULA 5AXDA 4ZCMA 4F3YA 1I2DA 1U0RA 1NVAA 2IHKA 3ZLTA 2PH1A 3QHPA 3S68A 1Z0SA 3IP5A 1Z08A 1U0JA 2HF7A 3I64A 1GYPA 4HGOA 2PWZA 1X9GA 1ZDMA 3RASA 3P2KA 4HRAA 4UOZA 4DMRA 1RP1A 1UT8A 3DZ8A 4R54A 1IXSB 4A0FA 1B8NA 1ARZA 1KDZA 1FFAA 3ZHZA 4DEVA 5JAIA 3GJRA 2DZDA 5T6BA 2H6EA 4WCFA 3VR5A 4BLUA 2Z6AA 3ULKA 4P7FA 1AY0A 5LL6P 2G40A 2V98A 3LY8A 3OPYB 1U9CA 1O96B 2R5NA 4RPCA 1LBQA 4AECA 2MR6A 1Z2AA 1R0YA 2NADA 2YHIB 3IAM1 3MWLA 4HNSA 2AOWA 5IT5A 2NU7B 4TXJA 2BEWB 3TTXA 2OHJA 4D6YA 3N2IA 4ZU1X 1NMSA 3P97A 4CL3A 2VIIA 1I5RA 3QOWA 2GRAA 3IDFA 3NZEA 1L7RA 4H1WA 1W4RA 4LOHA 3DONA 2ZP1A 5J5AA 1ZUD1 2FAXA 1RADA 5GONA 5JVDB 5JJIA 1OFUX 3TX2A 1UF9A 3RHTA 3ZBUA 1IAQA 4V1CA 5GMOA 1NRJB 1NFFA 3D3EA 3MLBA 3DAFA 2WWTA 4IYJA 3LE8A 1EX1A 1RWVA 4LY9A 1Z6XA 1C9EA 1XXHA 2X5NA 4JUCA 3R6TA 1J9EA 1XCOA 4KXQA 1GAWA 4D4KA 1T5OA 3BMQA 1MX5A 3MYRA 4XIIA 3WICA 4ARBA 1P4GA 4GWLA 2B83A 1M3SA 2V74B 1JN0A 2R6ZA 3AXTA 1ZOOA 3PNVA 4FKBA 1WCV1 1Z4PX 2XNCA 4K9SA 3ZDBA 1I5EA 2GUWA 2QGNA 3RTGA 3AJEA 1GPBA 4R41A 1RJFA 2ZB3A 4MB2A 5ADHA 5H02A 3L0CA 4BNLA 2JI9A 2VK4A 4B6EA 3DZIA 1A9ZA 2PGAA 4EJSB 1I1OA 2VP0A 1NY6A 4YLYA 2WD7B 1AF4A 3A6ZA 3E0QA 1QAMA 3CZRA 3PJEA 3UJBA 2XUIA 2AOTA 2WTBA 3R6WA 1XCLA 5K1ZA 3ZIUA 1ZX1A 2IKQA 4G5SA 4EMSA 3OC6A 3DBLB 5TPZA 4GOJA 1K08A 3WXBA 2BISA 3M4JA 2WK1A 3NTVA 3P5SA 4X1KB 1AQNA 3FLBA 4MYSA 1XMQB 4YJGA 5BNIA 4Y30A 1ZH6A 3ESZA 2WAYA 1BEEA 3I9NA 4B7ZA 3R3WA 5HZMA 1Y8RB 4BVAA 4GKKB 1WZCA 5B1HA 3EWNA 4KK4A 4F1JA 4OMDA 1DHTA 3JR3A 3BIJA 4PHHA 5E7JA 1TAQA 1WCXA 5C5IA 1GQQA 1M2HA 3HMQA 1GPYA 1R5NA 2DWQA 3MTEA 4TSKA 3WRYA 3R6DA 4PV7A 2DFDA 1N2ZA 2CHGA 2X0KA 3QUAA 4HK4A 1Z5VA 4MQEB 5B12A 3ASUA 5JDIC 1FCJA 1UPCA 3R7WA 1RZRA 2PMBA 1CVLA 4KH0A 2VJOA 1ZISA 4UBNA 3SE0A 3RADC 5LMNB 1MQSA 3G85A 4C6TA 4CF5A 1EA7A 4CM4B 3KR2A 5LQMA 1R0RE 1SB9A 3WKBA 5BVGA 5EP1A 2JCSA 4ETIA 2GGSA 3I39X 5I47A 3CIOA 4QASA 4XLTA 3FDJA 5AVOA 2WB4A 1AIPA 4BDSA 2HH9A 4LXHA 3BZBA 1Z2CA 4Q4HB 3TFQA 2H31A 2FX3A 4LPKA 2HXYA 4ANFA 5K6AA 3I12A 4KYTA 4GI7A 4ND6A 4OHWA 2GM9A 4HAZA 1EX9A 3M5WA 1JSLA 1ODTC 4AMGA 4GR4A 4C21A 4B34A 3LOPA 3W1VA 3MEQA 5L51A 4URFA 3K70C 2MYNA 3HYRA 3IV7A 4CUZA 4UTVA 4DLSA 5A5DA 1YAJA 3ESXA 2HC9A 3KHUA 5EWMB 2QJWA 3IJ5A 3N8DA 4UUMA 1RXEA 3AHFA 3OIFA 2IWRA 2PR2A 3BHMA 1T13A 1TE2A 1ZVVA 3O0DA 3N7UA 1PTJA 1P4HA 1DPFA 3E61A 3WL5A 4ROTA 1VGRA 4NNJA 1TMKA 4O25A 1AO3A 2UUBB 1HT2E 1FDSA 4KWCA 2I1LA 1HKUA 3V5NA 1DQSA 3KHKA 3PSHA 4CMJA 3K35A 4D99A 2X7XA 3LU1A 1Z5OA 4M54A 3OM9A 4PG8A 2CE2X 1RXIA 3FVVA 5D3KA 2RHGB 3B9RA 1W36D 1UZNA 1D2CA 3T9EA 3CEJA 1M0WA 2PT9A 1JH8A 2JFWA 2OUIA 3BGWA 3GMSA 3E9ZA 3EZLA 3HO6A 4IVQA 1KQNA 2I6XA 4LZLA 5DMXA 1PYGA 3W5BA 2FMKA 3KKLA 1DRJA 3IKJA 2IITA 1R6DA 3U7FB 3OZWA 1W29A 2CVPA 1LWOA 4IIYA 4PG4A 2HCFA 1I4LD 1C9KA 2RI1A 2VTVA 4X9XA 2FPUA 1CFJA 5FL3A 2EQ5A 3VU9A 2PGIA 2KX7A 2ZBPA 5A3QA 5K2OA 4UPEA 3HO1A 1VI2A 3ICPA 4BKOA 1R0WA 1BGXT 1JLKA 5JFOA 1BVHA 2O2IA 3ACBA 4G36A 3R5KA 3ORFA 3PC3A 2QLNA 4S24A 1FUEA 2BMWA 1EK5A 4S0ZA 3NWJA 4BMVA 4CIXA 2WNSA 4DWWA 1J21A 3HC7A 2QZPA 3BKWA 3AM5A 3MD0A 3BSYA 3PQDA 3VKUA 1C0EA 1XLUA 2WU1A 3C7DB 3ECSA 4TL7A 4P38A 5DV9A 1T5HX 3KYIB 1VPWA 2LUOA 4WLVA 3FVRA 4RTNA 1PJSA 3RUIA 5DYGA 4MV7A 2CDBA 3JQ6A 4Q3KA 1NKSA 4XUGB 1QRSA 5JYBA 5KMGA 5JS2A 2ZYIA 3RVOA 3KBBA 3KLOA 3LLVA 1WZIA 4GRDA 5HTOA 3BIWA 1HE5A 3GFRA 4MV4A 2BHTA 1ISRA 4G9EA 3O4RA 2ZG6A 4CQJA 4JKOA 3CJQA 1YJ8A 7REQA 1XU9A 1Q3HA 2QW0X 2IF0A 2JIQA 4Q1FA 2H4WA 3OOEA 5C8YA 1JHXA 1T8UA 1KI6A 1N8NA 1XRJA 2O5VA 3UKDA 4Y1RA 8ATCA 1JR2A 1HYGA 3PPVA 4L4UA 5FL7D 2I5PO 1YVRA 4IS2A 3FCAA 3PUIA 4L95C 5EXXA 1DBSA 3WIUA 3PE4A 1RJ9B 4J94A 2CL0X 4FCCA 1T4GA 5ABPA 5DMHA 1Y98A 4TQGA 1W4CA 5AK0A 5K05A 4E6PA 1NUHA 1HZZA 1Q1ZA 1QVRA 5TVGA 1GSOA 1BQ4A 5IBQA 3R1IA 1PN3A 3AL2A 1KI9A 3M6UA 4L9SA 3ADDA 5A2GA 3MJVA 2XUDA 3DFIA 3UC5A 3ZU5A 3DE4X 3PWKA 1Y82A 4U5QA 1RWBA 3BULA 4GYJA 1L4BA 2CLHB 3AHDA 3BAFA 3A10A 4DXDA 1ZKMA 4E14A 3H6GA 5HZGA 3A1NA 4F46A 2RHBA 2P35A 3ID6C 1YZHA 4FBLA 1K6EA 4K88A 4C89A 1IY1A 3LLMA 2GF2A 3JATA 4UFNA 4B3CA 1CJVC 5DK6A 3KRTA 3QVOA 2F00A 3NX4A 4NATA 2H5LA 2QJTA 5KQRA 3DZHA 2NO0A 5LZ2A 4DBLC 3UJCA 3W4JA 3IA2A 1QYRA 4Q48A 5ED0A 2M6SA 1AV6A 4FS3A 2B1QA 2P9CA 2B78A 2ZS9A 3W9UA 2Q5IA 4XQEA 3F90A 1DUIA 2A9KA 1RS0A 3MGAA 4DQ0A 3SHQA 2PK3A 4BLTA 3NVMB 1BOFA 2VYVD 3WLSA 5LB4A 5DYIA 3ZNPA 1EU1A 2WE7A 2WD8A 1KQFA 4U7JA 4BTVA 3VOTA 2JBAA 1LQ2A 4DSNA 4MV5A 3H5AA 1KYQA 1N5JA 4BRWA 1XVVA 1NNI1 1UJCA 4NU0A 3I9OA 1SKMA 3ZJ5A 2JAXA 4L3WA 1HNNA 2ATCA 2CDAA 4HQ6A 2G8LA 2G7MC 4ZOLA 2O4UX 1YOBA 3W8DA 1TC1A 3MGCA 3GEEA 1C9DB 1PG2A 3NNNA 2JVIA 3G0GA 5FA6A 3C3CA 3ICVA 4C43A 2VAXA 4IQGA 1H6AA 3ZN2A 2G1JA 3S70A 2XZOA 3D6JA 4WT7A 4MDYA 1LY1A 1MH1A 4YP5A 1CP3A 2EFDB 3LX4A 4NH4A 4Q19A 4XFKA 3KALA 3RSQA 3X2SA 1BOOA 4M87A 1O5IA 1ESNA 2B4RO 2PUTA 3JQQA 3W5VA 4YUYA 5JXJA 1ORWA 5IDXA 2OZEA 2Q0XA 5BYBA 4HDRA 3RYHB 3BHJA 4YNBA 2WW8A 1YS2X 5LJIA 1X7ZB 2QL6A 5E2AA 4JDUA 3C14C 3OUTA 3FB4A 4J16C 1TYCA 2DUJA 4BUJA 3EEBA 1G64A 3PZRA 4LMBA 1LV7A 3H5WA 4XGQA 5IG2A 4HXYA 1TOAA 1HDEA 1P61B 2CLMB 3AT1A 3M9XA 2G0NA 3RK1A 3Q5DA 5LR6A 2CFOA 4JJ6A 3FKSA 1B76A 2CVFA 2AI3A 1BS1A 4EITA 3T9CA 2PGXA 3U7QB 4R31A 3H5NA 1BXKA 1II9A 4M9CA 1PR4A 3UN1A 2RHLA 4TV8B 2JFYA 3E22A 3ETLA 1F0YA 1S2LA 3ABOB 1ZIXA 5CFZA 1XZAA 2WSYB 3LX5A 3S81A 2REOA 1V8PA 3S0JA 4O4LA 5TNXA 1H9BA 1UBNA 5DNDA 5H80A 4DMMA 2A1UB 4ZYZA 4UC0A 2ODPA 3RREA 1EA5A 2IUYA 3EPHA 2JL1A 1W5FA 2BMDA 2GYUA 2P9JA 5FTWA 2W93A 2QN9A 3GEMA 4IIVA 1KJIA 521PA 2XVMA 4GZ3A 4IGIA 4INPA 2NZ2A 2I3GA 4J8PA 4D6PA 5HPYB 3V8QA 4MHTA 1XNRB 5DIZA 1X7WA 2DR2A 4Z6KA 1UJBA 2HDNB 4LX8A 2WOOA 2YMLA 3A1FA 3K30A 2A7XA 1E79D 1ZJ6A 3DMTA 4AD8A 4X8MA 4EJMA 1NASA 5DGIA 2G1UA 4HDKA 1NI5A 5E3HA 4QNMA 1MFZA 3NHMA 1WCYA 2J0EA 4WNIA 2OBXA 3H16A 3T0FA 1MBZA 3CNBA 4H08A 3RGWS 5C81A 1W9HA 3ZWPA 4E94A 2ZDGA 2HDHA 2R8EA 2RHHA 4KE8A 2GJKA 2YWGA 3Q12A 1E2PA 1WD5A 4FD3A 4U7HA 2F3SA 3GZNB 4KMMA 3TR5A 1V5EA 1RI5A 3QHQA 4JLKA 3T5CA 1M1XB 3RS3A 2CNKA 1FDRA 5K5EA 2VXBA 3UMBA 2NIPA 2EX1A 2NNLD 2V59A 2ZXFA 3RSSA 3QFRA 3EJWA 5AIAA 2X4LA 5TQ2A 1PUXA 5IVDA 2QTHA 3HP4A 2RHMA 3V8VA 1DAEA 4OM7A 5AVKA 3QY0A 1KEPA 3PEVA 4NMMA 5LQKA 5JAPA 2XIJA 4MS1B 4P08A 3WK9A 1L5WA 3GCZA 2NGRA 4ZMBA 2W4MA 3LVQE 2IBMA 1SPXA 1FNDA 3R3YA 1P81A 1WV1A 3S28A 2IQ5A 1HBJA 4X66B 1Y48E 1LS6A 1ZN7A 4IOMA 3O84A 2G1AA 3KUKA 4A10A 3SG0A 2Q9UA 3PEUA 2G09A 3U31A 3QFSA 2AG6A 1W87A 1RCFA 3LOQA 1R0CA 3OEWA 5C35A 2GBCA 2HYDA 5A03A 1NR7A 2NQTA 3M49A 4JYAB 2GARA 2XE8A 5ICGA 3U4MA 3F6EX 5FX2A 5CT5A 5H3HA 2AVNA 1L5FA 4ARSA 5DEOA 5EP2A 3UKOA 1G42A 4CTOA 3TZEA 1XJQA 4RFSB 4TWIA 4AJNA 1A76A 2ZIEA 3DBOB 3D0QA 4ZAFA 2DX7A 1YJQA 2W6QA 1FPMA 4F91B 3T15A 1XT6A 1ODIA 1ADYA 1FP6A 4ER6A 4ZCIA 1QS0A 1RRPA 1C3VA 1XTRA 1ZM4A 4L4YA 5G0TA 4Q12A 3NV7A 4EJFA 2ADOA 3D2AA 2YVUA 3M0EA 3OCUA 2A67A 4G1VA 3DQPA 1IM8A 4KO2S 5EUBA 3QUCA 3NOVA 5C80A 1ZPDA 2IUFA 3DFUA 1O8CA 3FOWA 3QMMA 4RY8A 2FW8A 4UHDA 1ZU4A 4ZCQA 4KOEC 5FHQA 1E9RA 3CUEF 3EN0A 5GGYA 3ICQB 3WXMA 1W5EA 2JIMA 2JH8A 3CNEA 2WM2A 3S1LA 2BH2A 2XITA 2NLOA 5D3MB 3VH4A 4YHHB 2ZRGA 1TM7E 3L1UA 2J32A 2Q4BA 1SVUA 4H17A 4RGVA 4UTOA 4WH0A 4CGZA 4F8YA 2ZLBA 3A31A 3TK1A 1X7GA 1UXGA 4Y8VA 4EUHA 1TTQB 1KEWA 4YONB 2PRJA 3D2LA 5LA6B 5C9ZA 3TSAA 1XE3A 5C3UA 1F38A 3O2QB 3CY6A 2BTQB 3ESRA 2OD7A 3NBAA 1U7DA 1Y63A 1CUBA 1Z75A 2ORYA 2ZUDA 5IBCA 3BBLA 1YIAA 2WJJA 2B1IA 2GN0A 2HK9A 3FMIA 3AYXB 3VA7A 2YHBA 2BHRA 2P9GA 1DTSA 1TT7A 3CUSA 2RGNC 2G1PA 3IT2A 1I5OA 1ZL0A 2DHDA 1T8YA 1D6NA 2XGGA 1Y4UA 4O4HF 4DA8A 1N6OA 3LGXA 3SGLA 2DUUA 3EXHB 4AROA 1V8DA 4JJ7A 3I4CA 4U9UA 2WHPA 2C5BA 1D7AA 1GZ3A 1M83A 2ID4A 3JALB 3Q8WA 3WBJA 1RWQA 1NM5A 2GQ0A 3LF2A 2XVZA 4GH5A 1S9HA 2JGFA 3VBEA 1ABEA 1ZKDA 3OZ7A 3OCYA 1RWKA 3JAWA 4UREA 4UU0A 5IT9A 4FJ0A 2AN1A 2CGEA 1QK4A 3BYZA 4PE5B 4BEVA 3L0YA 1P2GA 4TVKA 3WZ2A 2EW8A 4XVUA 3ZDQA 2W2LA 2Z04A 3FMGA 1FFWA 4DR4B 2V96A 4CKXA 3WHPA 2KYRA 3GVXA 3H2IA 3VJLA 1YIDA 2RGCA 2QJFA 2DHEA 3G7SA 3ONNA 1D0VA 5K0CA 1S3SA 3CBGA 1X1QA 4P33A 2ASVA 3H1FA 1V1MA 3E82A 2TMDA 5TARA 1ZM7A 1W581 1ZNZA 1TK3A 2PRKA 1RPTA 2QT0A 3LBNA 3OZGA 5KHLB 3LUPA 3EJ6A 1HL3A 2QZZA 5H9VA 1PHRA 5DGCA 1JI3A 5T7BA 2J07A 2OQRA 4WKOA 1EFPB 1T9GS 4WVFA 4EW6A 3D3NA 2Z8YM 1LNZA 3EIXA 1CDEA 1W1WA 4Y98A 4ZGGA 1THZA 1EX7A 1RE1A 5IUJC 1UEIA 1QKIA 3W3AA 5C7IO 3H9UA 3ND7A 1KA9H 1X70A 3OO0A 5KTSA 4GI5A 7ADHA 1V1RA 3HN7A 1T1RA 4G5QA 4BTEA 2ZSBA 3VNSA 1BDBA 1U81A 5I9TA 3U13A 3RC8A 5EI5A 1A3CA 2A84A 3RVLA 2WSMA 5KQGA 5KQPA 2PUGA 2WJ4A 5E95A 2IS2A 5GOTA 2YVAA 2HFJA 3B52X 3V97A 2JVKA 4YTEA 5TEVA 1PNQA 3UFXB 1ST2A 1O57A 3EFEA 5AM3A 3OQJA 2DU8A 1TJ4A 2C9DA 5JXWA 3HI6A 3I1IA 5IARA 2C5HA 4H4DA 5BWCA 2HB6A 5LXTA 4Q7MB 4QM7A 3DPUA 4FSHA 2BN4A 4JLPA 4XGNA 3DUFB 4YP1A 4V0RA 1C0LA 2XRFA 1JAZA 1MKYA 3KXLA 3RYIB 3VR5D 4RFVA 3A6HA 4B85A 3DOEA 3QLEA 3FSJX 4KH1A 1S2GA 4BFCA 1SC9A 1D4OA 4HXFB 3HR8A 2IEAA 3K1ZA 3KT3A 5G4KA 4Q34A 3NRCA 4OATA 1SC1A 1B16A 2ZUTA 3C3EA 1PI3A 1K9VF 4E1VA 1T8PA 1XWWA 2ZRKA 3FPCA 4TUYB 2V7QD 2OUKA 3VNUA 1C8LA 3KEQA 1PT9A 4MYCA 2GBIA 4E2WA 3AONB 4BRZA 2P1RA 2VPZA 3I0ZA 3B7WA 4EOGA 4WNAA 4WK0B 1UT5A 2GWRA 3BVPA 1A9SA 4FYPA 4IZHA 3A3KA 5EVCA 4ZAVA 2XGOA 3P9NA 3B53X 2BE7A 3DDZX 3QXGA 2BGIA 3IVGA 3FNFA 3QX8A 4Z9AA 2Q3DA 1QIKA 2W6PA 3GEPA 4B8WA 3Q7IA 1TUBB 4FR0A 4KWEA 1KVUA 2AV6A 5P21A 5GTDA 5LN1A 2ZRCA 3WGMA 1JIQA 4XJVA 3ENWA 4FYKA 4LYAA 5IJWA 1U1DA 3I62A 1TXGA 2XR1A 4MI6A 5T6MA 3RRFA 3OTHA 2FG6C 2C57A 4FONA 2PJRA 1X87A 3KAJA 4P6VF 2BOVA 3DKIA 3L6DA 4XX0A 1GR0A 4FHZA 5AFSA 5LQCA 4D98A 1WOMA 1O7JA 4I3FA 5CR9A 1M0TA 4JMPA 2Q8PA 3G8AA 1CR0A 1EVQA 5SZJA 2FN7A 3DAGA 2YZNA 4IDEA 3PDWA 2B99A 5JD3A 1UBRS 3ADPA 4AF8A 4FNGA 1US8A 5AVQA 1LX6A 5JFTA 3GX1A 4ML3A 4QOGA 3OF5A 5IXJA 1S89A 1V4BA 4GSLA 3DP7A 2GZAA 1JEJA 3HDVA 4YT8A 1RPZA 4L8WB 5AJWA 2HEIA 4M4SA 1OCEA 3TIXB 3Q15C 1GA6A 3ZJ4A 4E21A 2WM3A 5CEEA 2DTXA 1KYWA 4HX2A 3HKEA 2XI4A 1Z82A 3MRXA 4IGFA 4XM2A 4YN3A 1V11A 3MS2A 2E4AA 2HWYA 4NV1A 4ND5A 1N2OA 3JQAB 1AA6A 3BEOA 3BXXA 2VAPA 4MWZA 4YQEA 3BF7A 5GV8A 3RUDA 3JAKB 4O02B 5TPZD 4DOMA 2I4MA 2UU9B 2CXTA 2KB0A 2BFBB 1TEZA 2QT1A 1AHHA 4G0NA 2XMDA 4PAOA 2EZUA 3RHZA 3TNYA 3K32A 5CVJA 2B0JA 1FL9A 3FROA 2FVXA 3G3EA 4PWZA 4RS4A 4QL3A 1Q0ZA 4I55F 4WMLA 3A6PC 2WNIA 1CQWA 2ZU0C 1BXGB 4IF4A 4ZT5A 3R3ZA 1N5DA 4U7DA 4LMAA 4XJXA 2QUIA 2B1JA 2AUTA 4JHXA 2X76A 2W2NA 4YAOA 4U3JB 1Q0TA 4H6PA 4JBNA 4WBXC 1RZRD 1ACMA 4NH0A 4GBED 4DJTA 1ZINA 1ZGAA 4EB0A 4Q01A 1GFZA 3ZU6A 3R0QA 3AHJA 2VBFA 2HT6A 3TZ6A 4RVGA 5AW0A 4I4IA 1D09A 4YA6A 1B3BA 1J8FA 2I2BA 4HDNB 1KTIA 2VJYA 4LFBB 1MCZA 2V7PA 3MJRA 4IDNA 4AJJA 4JJGA 1EUQA 2CHUA 3VPDA 1E62A 3OQPA 2QZSA 2XNDA 4X41A 4NMWA 5EWLB 1YR2A 1F9EA 3KTFA 3D8TA 2X7HA 2MWMA 2JDIA 1FNBA 2X86A 2XNHA 1K92A 4COKA 3FLEA 3OT4A 2HJHA 4L85A 4MROA 4RL6A 3JQEA 4E5NA 4Y2YA 4MWDA 3I5AA 4P5PA 5G3ZA 4KMRA 4MQFB 4E7OA 4BX8A 2VHVA 2IIPA 3AERA 3SXUB 1SZPA 4EX7A 4HPXB 1ZS9A 3PICA 4KAXA 4KFSA 4ZZ3A 4JC0A 1EFVB 1EM8A 4FUTA 3WGLA 2RC6A 4UUBA 4BQNA 2QRLA 2JZCA 2ZR7A 3BMOA 4JOQA 4F12A 5A0VA 3URMA 3TRDA 2CJWA 3CV3A 4N8EA 4AZTA 3BL8A 3RSFA 2ACVA 1ZNYA 3QSGA 3FSRA 3LDUA 2YCLA 4OXQA 3RU9A 1NJ2A 1UQRA 4X7BA 3P9SA 1BRTA 3GFTA 3OJ0A 4MRPA 3E81A 3OECA 3ZQKA 5EJFA 4DIFA 1PD1A 3OD5A 4X63A 1KRWA 1FOEB 1Y5NA 3B1XA 3DPIA 1FW6A 2ATIA 1Q15A 3V55A 1FRNA 4GX1A 3C6MA 4K9QA 1ISJA 2JVJA 4OD0A 5LJLA 4ZZ0A 3P0EA 2WICA 4N01A 4Q3NA 2XHZA 4QYTA 2B36A 4YJ3F 5EPEA 4QBKA 4DLNA 4CLOA 2VP9A 3PUJA 1D0IA 5FADA 1E5QA 3VQTA 2DBQA 2PEZA 1G5IA 1MAHA 4P5EA 3VDXA 4EECA 1GSIA 5D1HA 4YH1A 3D0RA 4YJFB 2VYQA 2IHYA 2IODA 4HWOA 3D3QA 4YB8A 2ZVJA 4B7XA 5SICE 5TMBA 4QG3A 4OHXA 3CS3A 5KOJA 3GLIA 4H59A 2Q1WA 5AVJA 4YCDA 1A8SA 5M3BA 1E2EA 2C5GA 2AEEA 1W5AA 4IG4A 2OO5A 3C1UA 1A2OA 3F5FA 2NVUB 1E3DA 2PT6A 3DDNA 4YCLA 4DLKA 1XPUA 3BFPA 1T9ZA 3GT0A 4RLQA 2Y2VA 4LOJA 4ZI2A 2JRLA 1U28C 1SU4A 4HUJA 5BSHA 4F04A 1VCOA 3PEYA 1QMPA 1BCRB 3BJEA 3WYDA 4I08A 5A0TA 4NG4A 2HRBA 3Q7EA 3BXEA 821PA 1OZ0A 2Y4NA 3FTPA 3NBXX 2QVXX 3PL1A 4YJHA 5BR4A 5HRCA 3O8OB 1V7CA 4GDFA 1NXWA 3ZYCA 4KFTA 1K8RA 1OZHA 2A5GA 2AZTA 4LV6A 3RV3A 3SJZA 4JEIA 4IEFB 4G97A 1U3VA 5IBRA 5GADl 2VDJA 4ZIRB 3R3VA 1XAHA 5D7NA 1QUFA 2WDZA 2F1RA 3EZXA 3BIOA 5F2NA 2HSDA 4CKZA 3RV4A 2BFCA 1XMXA 3OM0A 1SELA 5L3QB 3RHSA 1LLCA 1HFKA 4M0PA 3DGEC 5F76A 4ETNA 3RT7A 2GR9A 4NESA 2EJWA 3E5MA 3PXDA 4K7JA 1ZP6A 5CDUA 4WKCA 4YBZA 2OCGA 4GZ5A 3A9TA 3FNBA 3GELA 1YI8A 4ZCSA 3SIRA 4TM8A 2DRIA 1YZGA 4WTOA 1UC5B 5I7VA 3DF9A 3OVMA 3ZWOA 2ZJ4A 3TVDA 3R4CA 1E9BA 5BV8A 1FRVA 2WZDA 2ZCUA 3AUXA 3SY8A 3U37A 4NI5A 4DSAA 1QLHA 1JHZA 1G3UA 2O6HA 3BRWD 4P93A 4MIOA 4RA6A 3V1LA 1FSZA 1WL8A 5C5DA 3L7KA 2OHGA 3D6FA 1AGXA 1POWA 1YRYE 4XH9B 1BTOA 1V2GA 1P0QA 1A9RA 4BVGA 2OV1A 4CHTA 1M2VA 2YFHA 3AI7A 5AP9A 4UDNA 3UTCA 5H3LA 3STTA 2QYSA 3FIUA 3VR6H 1HH4A 2ZI6A 4RCYA 5J2UB 2QENA 2ZPUA 5CA1A 2DT8A 1PK8A 5C8VA 4RJ2A 1QPGA 3KJZA 10MHA 2G9VA 1H2WA 1I24A 4FIZA