4HVAA

Mechanistic and structural understanding of uncompetitive inhibitors of caspase-6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
247
structure length
238
Chain Sequence
b'FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Mechanistic and structural understanding of uncompetitive inhibitors of caspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 238
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hvaA00
2H5JA 3DEIA 3KJQA 4EHKA 3IBCA 2QLFA 2H65A 5IC4A 1SC4A 2CNOA 4N6NA 2HBYA 4ZVUA 3NKFA 1K86A 3P4UA 5H0IA 5IASA 4M9RA 2CNKA 3R7NA 4JJEA 4NOLA 2QL7A 2WDPA 4HQ0A 3R5JA 2FP3A 2Y0BA 4IEFB 1QTNA 4EHAA 5IBPA 5LUAA 3K7EA 4EHDA 2Y1LA 4QUIA 3DEJA 5IANA 4DCOA 1RHRA 1GQFA 4NOJA 4DCPA 2K7ZA 1GFWA 2P2CA 3UOAB 2NN3C 3NS7A 2XYPA 1K88A 1NMQA 5IARA 5IBCA 4JQZA 4AW9A 1RHMA 2H51A 2CDRA 5JFTA 4EHLA 1CP3A 3D6MA 1NW9B 4AWBA 2XYHA 4QU0A 1KMCA 3H11B 1SC1A 3D6HA 4QTYA 1I4OA 2QLBA 4JQYA 4ZVSA 1SHJA 4LSZA 3D6FA 1RE1A 1QX3A 3P45A 3PCXA 4N7JA 4IYRA 1SHLA 5IC6A 2C2ZA 2H4WA 4QUEA 1I51A 2FUNB 2QL5A 1RWXA 3PD1A 3NR2A 4QU8A 2CNLA 4N7MA 1RHKA 5IAKA 5I9TA 4ZVPA 2DKOA 2QL9A 3H1PA 4QUAA 4NOKA 4NOMA 4QU9A 5IAJA 3IBFA 3KJNA 1BMQA 4ZVOA 4QUDA 2HBZA 2H5IA 4EHNA 1RWMA 3SIPA 2J33A 2FQQA 2J32A 3EDQA 4QTXA 1RHQA 1RWWA 3UO8B 1IBCA 5LU8A 1PYOA 4FEAA 4QUHA 4QU5A 1I3OA 2XZDA 3PD0A 3QNWA 1M72A 2J30A 3SIRA 4I1PA 4HQRA 2CNNA 3R6GA 3RJMA 3H0EA 5LUBA 3BIJA 4PS0A 1PAUA 2XZTA 1SC3A 4JB8A 3R5KA 4PRYA 2H48A 4QUGA 4QUBA 4QUJA 4EHHA 4NBNA 2HBRA 3S70A 3KJFA 3H11A 1F1JA 5LU9A 4NBKA 5I9BA 1RWVA 4FDLA 3E4CA 4NBLA 2QLJA 4JR2A 4ZVQA 5IAEA 3EDRA 2H4YA 4JR1A 3V55A 4D3ZA 1QDUA 2H54A 4N6OA 3V6MA 1JXQA 1RHJA 1RHUA 4D3YA 4D3XA 4HVAA 3OD5A 3R6LA 4JJ8A 3GJQA 3DEKA 1ICEA 3DEHA 2CJXA 3ITNA 4JR0A 4AWAA 3H13A 2C1EA 3R7BA 4DCJA 4JJ7A 4ZVRA 1CVRA 4PS1A 4I1RA 1I4EB 4PRZA 4EJFA 1RWNA 5K20A 4EHFA 3V6LA 1RWOA 1NMSA 5IBRA 3R7SA 3V4LA 5IABA 1RWKA 2C2KA 4FXOA 4N5DA 2AR9A 1F9EA 4QULA 2XYGA 1NMEA 2C2MA 5IAGA 4N6GA 3S8EA 2C2OA 2J31A 4FGUA 3GJTA 1RWPA 2HBQA 3GJRA 4ZVTA 3V3KA 2CJYA 3GJSA 3V4OA
chains in the Genus database with same CATH superfamily
1WQ1R 1XDZA 2PQ0A 1TU0A 4HQNA 4MMXB 3UJ3X 5JC1A 4JSRA 2VA9A 1SKUA 5A1JA 2P3LA 5DN6D 1GZ5A 3NTUA 1E2FA 2DP4E 2H07A 5H0IA 4E70A 1E77A 2DFNA 3NLLA 3QVGB 4YRTA 3ZWVA 2CLIB 2N9UA 1XFAA 5C46F 5L7TA 1IEVA 1KJWA 2C7QA 3ZD7A 4U5QA 4EWLA 1UFQA 4CCYA 2XDQB 4KUHA 2YJNA 1RDFA 4MYHA 4HPWA 3BAFA 1MAAA 3PYXA 2FLVA 2PZFA 2HZ7A 2XT0A 1YQWA 2VDUE 4M7OA 3HCPA 3PUHA 3CX6A 1EG2A 1JR3E 2XUAA 2XYQA 1S3IA 5FV4A 2TS1A 1TNDA 2XOEA 4RMJA 2X2EA 1JVSA 4LDQA 4MJ3A 4TLDA 2E4VA 3H11B 4XR4A 2EATA 2NZWA 3GT3A 3IOEA 1YJXA 2C5SA 1EBFA 1MB9A 4HNSA 4Q1VA 3BQ9A 5C4GB 1EP1B 1L4UA 4R69A 2VAWA 2UYYA 2Q9BA 3IEUA 1E2MA 3MVEA 2I2CA 4RM3A 2WPDA 1PR1A 3JD0A 1RT9A 1H05A 4UEQA 1GAEO 3FUWA 2Z8YA 8AT1A 3L7KA 4FOOA 2C5FA 4EMSA 2RJOA 2VPIA 4QICA 2RHMA 3HR7A 1SPXA 4ZK6A 3ANLA 3CH4B 4A91A 3B6EA 2HT1A 1SJ9A 4K6GA 5C5EA 4KR3A 5M29A 2HXYA 4OJYA 2NSLA 2ENWA 1PZEA 3F7OA 3GO4A 1PR9A 1SCNE 1YS9A 5HTKA 3T4EA 1LDGA 5IP5A 1B6GA 2FQQA 1WSWA 4N9WA 4IJVA 1UBCA 2ZWMA 3QOFA 2JJ2D 1GQRA 1RM3A 1NXOA 1GHTA 1P1HA 5CA1A 1VCIA 1USUA 1ZW6A 3CWQA 3HB5X 4Q7MB 1BAPA 4LF6B 1VXOA 2BFNA 3GJ5A 1NXWA 2QW0X 2UKDA 2X8AA 4Q4JA 1GUDA 4UM8B 4G0NA 4DYDA 4IV8A 4IIJA 1OMOA 2PBFA 2ZBRA 3QLVA 3E05A 3PYLA 3BIJA 5FOVA 5GONA 5KI6A 3KQKA 2H0QA 1AKUA 3BD8A 4C76A 4EG5A 2PUAA 3L5KA 4AIIA 2H11A 3KR1A 5BXYA 3GT4A 1ZZGA 4QDTA 4ZRNA 2CXHA 2ZJ2A 3U7HB 3TEFA 2ZRDA 4JI3B 2FNAA 3LC0A 1PI3A 4NV0A 1RPJA 3TLKA 2BF7A 5A71A 3NP9A 1XTRA 1NBEA 3GUHA 3G2IA 1K3TA 2O1WA 3HCNA 1UC5B 2E0IA 3EY4A 3ESAA 3T3GA 4NZYA 2ZR7A 2HPAA 4GO1A 3ITNA 3WK9A 4U3JB 1LF5A 1V3UA 1WXQA 2RJ3A 2PIDA 4MRMA 2GGSA 4F71A 2ZKLA 3SX4A 2EZ9A 1L7QA 3FVQA 2QU7A 4OKNA 3R0XA 4TTIA 3IPYA 5H5JA 4FSXA 2EKQA 2FFJA 2VWQA 1L5SA 1I3MA 1ZSNA 1EHIA 1HZZA 5FULA 4BNHA 5A03A 2Q6LA 3CZQA 4BO6A 1PD1A 2A5LA 2OKGA 4KAFA 1VBNA 1I1HA 2FEMA 3A9SA 2RGNA 4IVRA 5EP4A 3B82A 2NV6A 3RG8A 2WSLA 4J1QA 2OZEA 4XX1A 1Y3FE 3TM5A 4EKYA 4MV6A 1QHFA 2GBCA 3BMQB 4CV2A 3LXXA 3DAFA 4WK0B 2A5JA 3B1JA 3EVZA 3SVLA 1WXXA 3AEXA 4GOND 1NLYA 3WY9A 2F3QA 5C1BA 4FYKA 3N0VA 2H29A 5IT5A 1E6LA 3AUAA 4BMYA 4BVKA 3C6BA 2HWKA 4D4JA 4YQZA 1WB9A 2ZANA 4R2JA 5BMVB 4ZKEA 4C6HA 2ZIGA 4UPDA 2PMCA 2ZCJA 5A0FA 3THSA 4RK4A 3OJXA 1RKUA 2L0XA 4WTOA 3IVGA 1VLLA 3FCEA 3KVOA 3DE1X 3YASA 1DE0A 2IYFA 4QYIA 1WDTA 4RGQA 4YRDA 4EIWA 1ZIYA 2AEJA 3E9CA 4Y2QA 1VLVA 2K2QB 3G8BA 3FI9A 4I55A 2Z09A 3B7PA 4I8XA 4ZCTA 4B6OA 1DUIA 4XGRA 3GLHB 4NMXB 1CZUA 2QJWA 4JK3A 2KW5A 2R8YA 4HTFA 1CEQA 1CUSA 2MT9A 3JVVA 2JBAB 1YRWA 1TX4B 3QWHA 2HV8A 3D3EA 4PBSA 1L5LA 4C4ZA 1XMPA 3AKYA 3OLYA 4KTTE 4D9EA 2DPXA 1YDWA 1MCZA 5F9FA 2PFGA 4IO0A 4HGYA 3W2HA 3BDVA 1S8AA 4DLSA 2C42A 4QUEA 2E4AA 4F4IA 5J4YA 1G6KA 3U1TA 4MGZR 3PNQA 1UAGA 3TE7A 2OFXA 2XVYA 1DIHA 2HLDA 2WG2A 1GG2A 1LLFA 1G7RA 3G6WA 2P78A 1SQSA 3WRWA 4XFJA 1OLSB 3GGSA 3CRVA 4KX3A 2WPNA 2DVMA 3IH5A 1W29A 5JD6A 2AW3A 4OP3A 4KQEA 5FHRA 5BW8A 2O8CA 2IF0A 2EKZA 3HGQA 3ML1A 4W5OA 5AXCA 3MMNA 4D7AA 5IM4A 1S2MA 1C4WA 5HMLA 4D99A 1NOJA 2OWDA 1Y5MA 2WB4A 2VSXA 2BHSA 3W5DA 5LD2B 4URHA 3SK0A 2JJMA 2XUHA 3ODPA 3SWWA 2FPIA 2Z5VA 3L1VA 5JS1A 2MMCA 1U8TA 1IRIA 5ALQA 1ITZA 2FN9A 1MX5A 3F2IA 3HA7A 4N39A 3BA1A 1RAGA 2XZTA 2WD7B 3O2SB 1EGVB 3NBZC 4R98A 1R64A 3NNNA 16PKA 3ZEIA 3FWZA 1UZLA 4EUKA 2HBRA 1SU4A 4OQQA 3CX8A 5JYCA 4WZAB 4BO2A 1NQUA 3FJYA 3WYAA 1P1KA 1ZM7A 3JWJA 3B89A 5EIBD 4L78A 4F06A 2GJAA 4I4CA 4OLHA 1YRBA 4UOQA 4U7WA 4XJVA 2NTJA 1G5QA 4IIYA 2OHFA 4CV0A 1K92A 3KSBC 2POQX 2O52A 2ZR9A 1SC9A 1UK9A 2R66A 2PFKA 3VH3A 3EVNA 1FJ2A 3VPFA 1MEEA 2CVHA 3ECCA 4ZPXA 3WMFA 4L2IB 4ZU1X 4US2R 1UJMA 1DXQA 2HGZA 1RAIA 1R0ZA 1ZOSA 1X74A 2Q4TA 4UU1A 3WLQA 2FMUA 2O7RA 2ZBVA 3T0IA 2GDZA 3V1YA 3E23A 5DJ5A 5F64A 1FMLA 1XNJA 3VR3D 4B3CA 4AP9A 1ZBQA 1QHSA 2E2WA 3MS4A 1D6SA 4OHPA 2R1UA 4CUKA 2I7XA 5EIXA 2HBQA 3R0ZA 1Y9AA 4M1ZA 3WL3A 4C7BA 3F3YA 5H82A 3V3KA 2ATEA 2BP7A 4HLDA 4RE5A 3TFOA 5LYJA 2C7RA 1G8MA 3K9LA 4B4OA 3BCSA 2FW1A 4KE9A 1QC5B 2K6GA 1WD7A 1INLA 3FLMA 1UQUA 3Q9SA 5JYDA 4W63A 2GWRA 3KOOA 1ZEMA 3R3XA 1F38A 1FP1D 4LXIA 2XCTB 1WXFA 4JMLA 4ZT4A 3RYCB 3O75A 1THTA 4IUBS 4NZPA 1U4SA 4WKNA 5JD3A 3BTSA 1A04A 4C0BA 4R2LA 3HYLA 5KQMA 3CF2A 4LNUB 3ZVRA 3FVRA 3WV4A 1EFDN 1F8GA 3JQAA 4V1CB 2C9CA 2LKCA 1T3TA 1Z28A 3AJ8A 5KNLA 3AYXB 5JYEA 4HD8A 3WB1A 8ADHA 1RYEA 4Z3DA 5GM1A 1T3GA 1R4MA 2FE4A 3MTDA 1TK2A 1CE8A 1FP6A 3LU1A 5ES3A 3H42B 2QQ0A 3P94A 1QUFA 2Y3IA 3N8HA 4F04A 2NNWB 2HPZA 1E6WA 1TO2E 1F17A 3RAPR 3AM5A 2NPFA 5IKMA 3NT5A 2C2YA 1Y3HA 3CF6R 3V4RA 3A9VA 2IOYA 5KYWA 2G1AA 1TPZA 4IL5A 1EIWA 2XXJA 3AEQB 1H2FA 5LIPA 4YJFA 1EVKA 4NMMA 1OX6A 3H2YA 3LYHA 3QIAA 3U0VA 1QXSA 4BFYA 3KP1A 4WCVA 4QELA 1Z0SA 5K3DA 1GLNA 2NO0A 4G26A 5B55A 4JJFA 1B15A 4ZPJA 3STHA 5EZSA 1M54A 3PUZA 2IY7A 4LRWA 3IE2A 4YMGA 1GKLA 3ZIAA 5FI5A 1D7AA 4NE7A 3R5HA 4O8ZA 1W85B 4I6EA 1WF6A 4TQAA 5L7WA 2F59A 3ZS9A 2G67A 2FDRA 5E3HA 1A8PA 3RAJA 1KHTA 4UDXX 3JAKA 1USWA 3ZWAA 5EE0A 4W1RA 3F7TA 2D5LA 3N0RA 2J7PD 4FD2A 4JB8A 3T7TA 4D81A 3TAXA 1DXOA 5IRCD 1TYBE 1XU4A 1NRWA 2CNWA 2BE7A 2QE6A 1JPUA 2XDWA 4FHZA 4N5HX 1ECLA 5K51A 1M1NA 3RFFA 4B3HA 2Y1FA 2R68A 5BW5A 1ZGGA 4UFOA 3AUUA 1DMRA 4H7PA 4KGDA 5AW6A 4ER7A 3BH0A 2JS7A 1N6RA 3N0TA 2C58A 3A11A 3NBXX 4PYOA 5JSUA 1FSSA 4BLTA 4K88A 2AN5A 4NMWA 5BUQA 2BFAA 4P3PA 4WBXC 4O4IF 1DAFA 2I3BA 1B93A 4UXIA 4FC7A 4NYIQ 2H08A 1BVYF 2ZJ5A 4II2A 4JUDX 4LXXA 4MYDA 5B58C 1T5DX 3QUQA 1T3HA 5HMMA 2JZOA 2WC1A 4FGWA 2FUKA 4WJZA 3ZI0A 2CXSA 1JQLB 2CVFA 1RNLA 4UBJA 4DWWA 1SNYA 1CS4C 2MSEB 3UF0A 2XRFA 1IHYA 3B5JA 1CT9A 2X5KO 3A1VA 3A7DA 3LT2A 5IKPA 3EZXA 1CUZA 2IP1A 1W25A 2Q50A 5EIOA 3ZWDA 3BMOB 3B3GA 2HJVA 4ZDKA 3CNNA 4FM9A 1TO1E 4F8EA 4HDCA 2VWHA 4FGUA 4NFYA 4AZSA 1OPRA 2QN7A 2YV1A 4B1FA 1QFJA 3G0IA 4BDSA 2HW8A 3IEPA 2B8WA 1CQWA 2AMJA 1DAHA 5BW6B 5C32A 1YFLA 1C7IA 3DT9A 3EBPA 4FHDA 2OXTA 4YUVA 4H3VA 3BHIA 2H5JA 4M89A 3CLVA 4NPCA 3D6JA 2JIRA 1LLDA 2ZJ6A 1TIBA 1CF9A 1J33A 4MVYA 1TXGA 1UPFA 3OIGA 3OOWA 1MH1A 4TMXA 5E2AA 3ZLUA 2X3YA 1TAUA 2WJWA 3LOQA 5D01A 4F5DA 2O4UX 5FPYA 2EFEB 3NEJA 3DZKA 3ONNA 3GEPA 4IDAA 4B7AA 1HL3A 2QAGB 4AY5A 3A6PC 2I8LA 2ZYWX 4YFYA 1P2FA 3HDQA 3K7EA 5EI5A 4AG3A 2FDCA 3T5GA 4DCOA 4ALMA 4C6TB 9GPBA 2V65A 2ZU6A 3U0BA 3P2IA 1GNRA 3H84A 2FMHA 4LV6A 4MW0A 3LX4A 1E3JA 4XLLA 3A1CA 3C7KA 2QRVB 5HUHA 5IMBA 1UMDB 2HRRA 5TARA 3PC3A 5D8DA 3AY6A 4RD6A 2ZDHA 1U1IA 2QTTA 1FJGB 5JSYA 2NU6B 1E64A 3Q8WA 4FSHA 1EX7A 1GUAA 1NBHA 1SXHA 2OAEA 1HQCA 5KS2A 2OC9A 2QTZA 3PD1A 2IYEA 4DKJA 2FQYA 4M8KA 2PO5A 3OU7A 1JV2B 2PZEA 4BBAA 4ZVPA 3GRYA 1OH7A 3VR0A 4ALNA 1KZ6A 1QDLB 4DA0A 4CL2A 1XTQA 2QL9A 1QK5A 1JXOA 5FWNA 2PL3A 3D2LA 3TQIA 4QDZA 1I36A 3WGVA 1AZTA 1H2AS 1OIWA 2Q49A 3BJMA 3MPUA 4X6UA 2QJOA 3AWIA 3PV0A 3DMRA 4FCCA 4LIPD 4BWFB 1SXQA 2G4LA 4QTXA 1X7GA 2OA0A 3SHOA 1ODCA 2E82A 3IAEA 3UMVA 2A0UA 4FQ8A 2ZUSA 5T64A 2IP4A 4ZO4A 3UV6A 1W0JD 2FUEA 3ZDZB 4B2YA 3ODGA 3GRFA 1S2OA 3VH1A 3RSSA 3DEFA 3IODA 1ZN7A 3RJMA 2XCUA 2I3AA 4QVIA 1Z2DA 4K86A 4I4TB 1J5PA 3U3ZA 4V39A 3RF6A 1P33A 1AN0A 2C04A 1C4OA 1DX6A 2ZRHA 4RFSA 3WP1B 1X14A 5JVDF 1Q2XA 4CKWB 1QYDA 2IE8A 3PQ5A 1HYEA 4INZA 1QV7A 3KQOA 4NBKA 2WJJA 4PC1A 5EJEA 1A4IA 3C3MA 1G9TA 3TRJA 1MOZA 4S3MA 4YRCA 5SICE 1WDLA 4K28A 4XAQA 3P2EA 4CL0A 2AZTA 2ZB8A 1U2DC 4MYUA 3N2IA 5CB4F 4UEJA 1F5SA 4TZKA 4BFCA 4LUCA 1R9MA 3FPCA 4JR0A 2G9NA 2XTJA 4LGCA 1L5HB 3RARA 4DCSA 1VKHA 2WTEA 2VCEA 1CS0A 3INNA 2BM9A 4EYOA 2C1ZA 4IUCS 5C8ZA 1SVNA 2HJGA 5J63A 1GAQA 4ZP1A 3A0RB 4CNQA 2W2LD 3S5JA 3LBYA 4OJKA 1M0WA 3UOWA 2OBNA 5IXSA 4IH4A 1OKKA 1H0HA 5AI5A 2W90A 3TLCA 1Z37A 3WICA 1KI2A 4ZCMA 1NQ5A 2C8JA 1IH8A 3LW7A 3CUSA 4FJ1A 3W4KA 4E2WA 3QH4A 1L4HA 1EEHA 1AGYA 1T5IA 1V9CA 4P5PA 2XB8A 4XYEA 1G5TA 5FNVB 1E4EA 1O77A 1TQ6A 4E88A 1F51E 4ETNA 1F6BA 1YR7A 2OOKA 2HC9A 1EUCA 4X8MA 2Q28A 3V5NA 4B45A 3DOEA 2J3DA 3T3MB 3B8HA 3C39A 4TS1A 2E6KA 3B36A 3HXLA 1ZMRA 2RB4A 3NDRA 5B1DA 1NJ8A 4B6RA 3DC7A 3FMPB 4DLNA 3IMKA 3ZLJA 2HHLA 1WTCA 4RGBA 1UT6A 3S0JA 3DKPA 4OQFA 4KR9A 4EKGA 1OX4B 3DULA 4KZKA 3BS4A 3L06A 3WWOA 2HU5A 1OIVA 3AIKA 4DANA 4G4JA 2VXCA 1CF2O 4UM9D 2HRDA 5CVVA 3TL6A 1XZIA 1O0BA 1QRAA 3VTAA 1HLFA 1SVUA 3UK6A 1YVDA 1LPBB 1TJ4A 1GFIA 1FFYA 4X1YB 4DM3A 2BFDB 5EIBC 3JALA 3FCAA 1N5LA 2PVCA 1AH2A 3F1KA 1J2JA 4KQIA 5EKSA 3UIEA 4B6FA 2GJKA 1N2BA 4WLVA 5BSHA 2PYIA 1HKHA 3EK2A 3K0FB 4IIBA 2YMQA 4MI1A 1EUZA 4KXUA 2ZXUA 1YZHA 1DG9A 3WJAA 3AU9A 2YWDA 2VRWA 4DE5A 3HY3A 3NATA 4UEWA 4DRXB 1SHLA 4ZHQB 3PPIA 3CB4A 3F3KA 1VM6A 2I4OA 2MOKA 3F3MA 3A4VA 5LMZA 3ZDFA 2NU7A 1V6SA 4KGXA 4O0LA 4DDUA 2QVZX 2AXNA 2V9ZA 1CRZA 3RC9A 2CZGA 4O2AA 1GTVA 5FPPA 2G07A 2AX4A 4GLLA 4ZV7A 5IDYA 3SQMA 3T5TA 4O6VA 1ISHA 4ZVOA 2FZ4A 3WIEA 1IVNA 2V5VA 2B1JA 2LR0A 2ZU0C 2JCVA 3R5XA 1FRFS 2H06A 2J32A 3AERB 4L3WA 2BFCA 2VK4A 4V02A 5FAXA 5JNUA 5TS2A 4HDSA 5CX1A 1OSNA 1MAUA 2XE8A 4KQ2A 5E6SA 1IAVA 4M1YA 4RQUA 4BEWA 3O4FA 4OGKA 3L1UA 4ZAWA 1C3XA 1HLGA 2PA0A 4D9MA 4ZZIA 1QYWA 3AJDA 4IDPA 4EFLA 1X70A 3TSYA 1QU2A 2O8FA 1E2DA 3GT0A 2CXUA 3B1ZA 4RYDA 5EXPA 2VCHA 3GX1A 5FCDA 1UXOA 2Z08A 4AULA 3K8YA 4GR5A 3WWPA 5C35A 1EP3B 1ORIA 1SU7A 1BCRA 2I9PA 2W83A 4B7UA 5B6IA 4JLNA 4ADSG 5CFRA 4UW9A 4MGKR 1Q1QA 1DT5A 2OBBA 4CFSA 2EG9A 3AG6A 3EWNA 4RLSA 3D3NA 1DV1A 1JLLB 5AM4A 1QTRA 1R50A 3UT5A 2IYUA 4BO3A 1ZINA 2PNFA 2WILA 4HG2A 1JWLA 2CSXA 2HN9A 4RTNA 1XCOA 3OM0A 2HMYB 2WTNA 5FQOA 5H68A 4R16A 3WDKA 3WXBA 4UOEA 4EJSA 3GYGA 2ZWVA 3C41J 1XNGA 3FBTA 1AB5A 1FNMA 2AYYA 1KJYA 2AGVA 1PJQA 4A10A 4BKRA 3NIGB 1NLFA 2J3KA 3L7AA 2HHCA 4EJFA 1CY2A 2ETVA 3KQYA 1L6RA 1U5CA 4PYKA 5E1MA 1II8A 1IMOA 1PQPA 2CFRA 5B12A 2OKCA 1UH5A 2DPLA 3D0OA 4K9MA 2P77A 4I1IA 1XELA 3HJFA 3KTAB 2DECA 4FR5A 5U1PA 3U3JA 3DO8A 1UXIA 3VOBA 2Q8NA 3E53A 2JVIA 3RT9A 1T43A 3MWFA 1EJ2A 4BLWA 4D46A 2C54A 3FPJA 2MSLA 3ZDRA 1R4ZA 1LJLA 1KDYA 3MJHA 5ALVA 5BSTA 3GLTA 2PH3A 4EY6A 4ZYTA 1HY3A 2VPYA 4GDFA 2G72A 1G41A 1YBFA 3FKJA 4K87A 4MAAA 5F12A 1ADFA 2QX7A 4ENRA 4QPJC 4Z1MA 4HNGA 1VSVA 1Y6RA 3GPDG 4B6QA 4G5HA 1FRVA 3ZH2A 1FFGA 1KI4A 4QODA 3AHCA 1VPTA 1EBUA 3L93A 4ZMRA 4M0FA 3R5JA 3T35A 3TLEA 3IXLA 2BCGY 4MV7A 5DK4A 4TYWA 3O8CA 1TZJA 1PU2A 5L3RA 3MJSA 4R6WA 3KYCB 4UUOA 4C4XA 5LZ4A 3DHWC 1BDIA 1KY4A 2NZYA 2ZT7A 2I71A 1VCHA 4X95A 1QVWA 1P6UA 2R8RA 2VJLA 2HSGA 4LGMA 5TIIA 2XQVA 2MYNA 1KYTA 3I2GA 3ER9A 5EPOA 4BN5A 2C5AA 3HLTA 4QU0A 4RCYA 3VDXA 2NVBA 4PAWA 2XMPA 3FNQA 4OXKA 1F48A 2FFRA 4TVKA 4AJHA 1UMKA 2R6R1 4N7JA 3KYJB 5PNTA 4K6MA 4CL3A 2WR8A 2Q7OE 1MC1A 4Y2VA 4BV8A 5LA6B 1SUCA 1MC4A 4C9BA 4LRQA 4I1YA 2QTAA 3WGNA 1OZGA 2D74A 2I7DA 4D4MA 1FFWA 5FT9A 2FETA 1GA4A 1NBME 1Z7EA 2BEVA 2C97A 2H4XA 3HM2A 5GM2A 5HDBB 3SFZA 5CA0B 1BS1A 1Y3IA 3WL4A 2HCRA 1U5BA 2FPRA 4CLRA 2WKQA 3JYOA 3EFBA 4OGWA 4UNIA 3ZDYB 2PUDA 4IPTA 1QMPA 2WHEA 1VJDA 2Q3EA 4KXLA 4BRZA 3LLCA 4AZTA 3C8UA 4N76A 4JOBA 1PEKE 2FRDC 2Q5IA 5HK8A 4S1TA 4MUXA 4CCWA 2IUEA 3PI7A 5T4EA 2HIAA 2V6GA 2ZXFA 4YJDA 5JWRA 1L7XA 2XGMA 3URKA 4AUEA 3IOBA 1TLTA 3BICA 3RVLA 3M6VA 4OI1A 1L4MA 1YMQA 1RKXA 2IEIA 3AIIA 4MP8A 3NB0A 5THKA 3R9IA 4A0QA 3TPCA 4H7JA 1C7EA 4CN9A 1MVNA 3WLTA 2Z58A 2IEDA 2K5UA 2BFPA 1OV4A 1U0JA 3NC4A 2DETA 3TIFA 1QIJA 3FRJA 1HH4A 3F8SA 3E8MA 5ALKA 3OTIA 5G0SA 4Z5XA 3DQQA 4ZRMA 1VL8A 5FR2A 3RYHB 5ADVA 3WFZA 1KFEB 1SXJD 2OBMA 1SELA 3Q3VA 2R6AA 1VYTA 3P4YA 2IYOA 4Q01A 4DUPA 4KITB 5JBQA 1W34A 2AXPA 3ONEA 3OZEA 2CDBA 3NBUA 2BGGA 1W49A 3OD5A 1ZU4A 4XWAA 4B2PA 1R6AA 2WT4A 3SOZA 4BNVA 4DT1B 2IU4A 1YE5A 3OZBA 2CMHA 1A8UA 3ELYA 1AKQA 3T54A 3ZNOA 2F55A 1CQPA 2IYQA 3L3BA 3T5AA 4FC6A 5JSZB 5K0EA 3EVGA 5JISA 2B69A 1DAEA 4UHBA 4TKUA 3QTLA 4FXOA 4TTTS 1RIFA 3K1JA 3V4ZA 4AURA 4LV5B 3BWXA 3PGA1 2J5XA 1CY8A 1RXSA 2QDKA 2QX9A 3DDHA 3H5TA 2AWOA 4CJXA 2YZ7A 4L8YA 4JD5A 1Q5PA 2QRZA 2O8NA 5K0LA 1ECBA 3JZFA 5JS8A 5CHYA 5P21A 3FOCA 3UM9A 4Q9IA 3KJQA 4QOGA 2ZIEA 4QOHA 5A4JA 5A7FA 1H0RA 3ACDA 2JGKA 3H75A 5DT9A 3ZDQA 1PJSA 4YV1A 4Y6LA 2OTCA 5KYYB 1SUEA 4I1VA 4U7HA 3W9YA 1D2MA 1AXGA 4A8JC 1KO7A 1OFTA 1XZJA 2A94A 4LJKA 4RZ2A 4MV0A 4N3GA 5DX8A 5FTWA 1LNZA 1N9KA 1LK5A 1Z5ZA 2GAFA 3OCXA 2Q5LA 5BYKA 1KEVA 1HNZB 3R5TA 5C4MA 2HNBA 2JC3A 2P27A 2V55B 3JVIA 3UHOA 2DFPA 4QUIA 4KK3A 5HBRA 3EIQA 4BMDA 3BD9A 4DJFC 3JR7A 3ME5A 2WWFA 3TTUA 5REQA 1Z3CA 4KKXB 2HNKA 3GUYA 4KPUA 4TYNA 3C16C 3COZA 4E5PA 3JS5A 2JFVA 3TSZA 1ACJA 3KSRA 2PPVA 4DIBA 3PFWO 4FMDB 3NTQA 2DBVO 4BATA 1ACLA 2OCXA 4GP6A 4RYLA 1ZJ5A 3DZDA 3D54D 1MENA 1N8KA 2E4ZA 1ZM4A 4BTLA 3FHTA 4Q4AA 3W2GA 4GOXA 4MHTA 5JZ9A 3C5WP 2D5AA 5FFNA 2OT3B 1A69A 2EF0A 2F1IA 5KOYA 4R2MA 3VOAA 4I1UA 3W7VA 2PH7A 4IX1A 3IPLA 4H4EA 1DX4A 4GZ3A 5IVKA 2GYYA 2JH3A 2ZJZA 1Y4UA 2C57A 2DKOA 1NATA 4F12A 2AXEA 2ENUA 4WIAA 1N2JA 1GU7A 2J4CA 2WHXA 4IHAA 5IWCA 3HI4A 2EGUA 1MQSA 3IEXA 5BV1A 3X1DA 1RCTE 4U2FA 1E1MA 1U11A 5JJLA 1FEZA 2F64A 2J08A 2DC1A 2HR1A 1NE2A 1W4BA 2YIMA 1ZY2A 1MOSA 4EO7A 1GTZA 4E12A 3EBOA 4QSMA 5A9TA 5KMGB 1FX0A 3O82A 4PVCA 1JIKA 3QVLA 3BCRA 1AX9A 2ZZMA 1Q44A 2M6LA 1BH2A 2HXSA 1D8TA 3C6ZA 2OYRA 1CRQA 2GBIA 3KNZA 3VKGA 1V3QE 4AX8A 4LMRA 4QHTA 3ND6A 4XIIA 1TF2A 4M22A 4PS0A 4PZ0A 1HNXB 4LF7B 3H9QA 3FYUC 5ECGC 1X19A 2PZBA 4S2UA 1E4YA 1X7ZB 1J2YA 3DFMA 1N8TA 4QDKA 3W5SA 4ER6A 1C2YA 1Z75A 5T8KA 5HK9A 3HUFA 1NF9A 3KTFA 4P83A 2HMSA 4UUAA 1I2CA 2JFYA 3CO0S 5DXFA 3AUSA 3B3AA 5E8RA 3TNFA 2EV9A 3FFAA 1NP6A 1UK6A 3ETGA 5LC1A 2I33A 1KAMA 2B5VA 2IUFA 2WJZB 3D7RA 3EOZA 1A9RA 1C7FA 1DIRA 3NWOA 4RE6A 1KIAA 1JG7A 2QLMA 1JTEA 1ZPDA 5CM9C 5DLDA 4UMFA 2NW6A 8OHMA 2E5LB 2WE8A 1V8BA 3AY7A 3E7DA 3EF1A 3EXFA 4MKIA 4ON9A 2X4DA 4GIBA 4X93A 4JLJA 4LX8A 4YIKA 1YB4A 3RWOA 1ONPA 3OZAA 3JATA 3L8EA 4N5MA 1KU0A 5IYZA 1TTHA 2REXB 3CLSD 3EXHB 1FP7A 3AJRA 1LRLA 4D4IA 5AVYA 4DZZA 1AU9A 1XU7A 3JQ7B 3NHMA 5BORA 5CA1F 1D1PA 1X8LA 5AW8A 2ZYAA 1Y3AA 3C7AA 1QLJA 3UH1A 2J4DA 1LI4A 3AL2A 4IIJF 4L16A 5IFKA 2YXLA 1LV8A 2FAXA 2G0TA 3ICPA 4EO9A 2VHZA 4KWCA 4BGEA 1SFRA 4RD3A 2PMDA 4RK7A 3LQRA 1T6YA 4L51A 1PR2A 4OMUA 1T2FA 1SQ6A 3L82B 4PNZA 1B16A 1CJSA 2FPMA 5TPZA 1ZK1A 2PKWA 5AKJA 1X7XA 1FZQA 3UANA 1ZXBA 2WTMA 2XCLA 3B12A 3IAHA 4CF4A 2K7FA 3WMGA 5HCUA 2HFKA 2R8PA 3ADOA 4DRYA 1JT9A 4TXLA 3ICCA 2D7DA 1OLUB 2ERXA 4QA9A 1Z63A 1ZSYA 2P4HX 1JUDA 1NQAO 4M60A 4W9RA 3FSEA 3RODA 3SKYA 1FX1A 2X0EA 1CLEA 3IILA 1MRSA 1WULS 1QRSA 5IT9A 2AE2A 3HZHA 3ER6A 2KB0A 3IP7A 2HK8A 4L95C 4EPWA 4EVRA 2XE7A 4YP7A 4GNKA 4ZDIA 4XSGA 3P9NA 3UW3A 1Y1SA 5LQRA 3QVWA 1BW9A 1XWIA 2I80A 5KCMA 3RH0A 2QLBA 2V7QD 2RGYA 1V7QA 3CG4A 1PDVA 3LBAA 4TLEA 3V1TC 1P44A 4WOBA 2Z6UA 1IEWA 4JQSA 1QHHB 4GOKA 3DOCA 4ME6A 1YR1A 3MT8A 1NG9A 2XXAA 1TQ8A 2H4WA 4J3JA 1AHIA 4KIUA 1K2WA 4FNGA 4KHZA 2JL1A 4P4SA 1RWXA 5IZCC 4XXHA 3R8CA 5CD9A 4B76A 4MUAA 3DAOA 1RQGA 2QQFA 4HNAA 3TG8A 3LWNA 1E6UA 1Y8QA 1AMNA 2GF0A 1RQRA 3QU2A 1TIPA 4Q3EA 4CMKA 5K8JB 2FRVA 2Q46A 4TUYA 2X1LA 5E7IA 1N2EA 2VNAA 1R5BA 4C0SA 3K2EA 5HRUA 1OWNA 2WSSA 2GEJA 5BSFA 4EZIA 2XB2A 3UO8B 2P2NA 1PQ4A 3I12A 1J9EA 3SM3A 1XJ0A 1GPLA 3W6NA 2ISSD 3IQGX 1Y5LA 4J2TA 2HXGA 4I55F 4M9SA 5FF9A 5DOZA 5ELLA 3RJ9A 1DELA 2J30A 2GZAA 2DU8A 3KPYA 4XGNA 4Y2XA 3Q98A 4QBGB 4F4DA 4YT5A 5EC8A 4JYBA 1WHTA 3FKQA 5FAKA 2UXBB 1T6ZA 3AB8A 1WW3A 2ODBA 4CN8A 5KVVA 4JLKA 1EDBA 2DAPA 3AF5A 1YAHA 4YH1A 1XD8A 1Y8ZA 1IQPA 3M1LA 1XR3A 5TX7A 1IBMB 5K4HA 3H3JA 5BR4A 2ZRAA 3JQBA 1NBWB 2XOKD 4JLPA 2AD1A 4N0EA 1XX6A 2QAIA 3QEJA 4FZ3A 4FT4A 3OZGA 4YP9A 2FN4A 1M6WA 3MWLA 1E7SA 1FDOA 3ASYA 4MGHA 2VHCA 2DQKA 3HKBB 5DNAA 4Z4IA 2MYUA 3MIZA 3H5AA 5TMEA 3K96A 1UBLS 2VTKA 4B4KA 2HIGA 4A16A 1CETA 1G6HA 1NY6A 3ND7A 3H4TA 4XIFA 2JK1A 1IB0A 5DFAA 4OXNA 4AL4A 1GD1O 4N6GA 2C2OA 4B0OA 2ADFA 2YYZA 3WWEA 5LMNB 1ZUWA 2CV0A 5CH8A 1BJKA 1E5LA 2P9BA 3WGGA 3CC8A 3T3EA 4AG6A 2GXQA 1R0BA 2GPYA 2MR5A 4YNBA 2O2YA 1JTFA 2OVFA 4MROA 3IHWA 1UXGA 4IAOA 2JFZA 3ULKA 3OHSX 2BM8A 2PRKA 1OAAA 2H1SA 3AM1A 1BQ3A 2UXCB 4B8YA 5FBQB 4LI0A 1FDIA 4NZOA 1DJLA 1M2NA 4Y18A 4C05A 1G20A 1L9XA 1R8JA 3RD5A 5LQAA 4R2KA 3L49A 2OV8A 4LCJA 2CYBA 1NIJA 3ROZA 1JQ5A 2DSNA 1QH8B 2J9XB 3FXAA 4D0NA 1FA9A 2PSJA 4D3DA 5BVGB 4US1R 4HGZA 2N0SA 1JVBA 1HX7A 1SPBS 5EEHA 4P7GA 3EYWA 3MF4A 2VTBB 1YRYE 1IM5A 3DV0A 4KE6A 4TRMA 1NVWQ 2HMWA 3UUWA 3ZHBA 4XRGA 2MTBA 1BYUA 3CQ9A 4QXAA 2HYIC 1LY1A 1IWPB 3EASA 1Z74A 2MYTA 1HYHA 3A1UA 2QVCA 1U90A 2GAJA 3EGEA 3ZQKA 3T7KA 4F93B 1KXZA 4KLAA 3TI7A 3TCKA 5LA6F 3BCHA 1VDZA 4MUEA 2BEWB 4XDGA 1XJQA 5DP1A 2VEOA 5IM5A 2AF3C 3UUEA 4BIIA 3OLQA 1YRLA 2IPAB 2RCNA 4GRDA 2BVNA 3FGNA 3N2EA 4UAVA 1XMVA 3W8EA 3LA6A 4P54A 4EUHA 1U0OC 2ORED 1N2XA 4ZAYA 1T2AA 2IIBA 5JT1A 2VRCA 2PMKA 3PEEA 4FCTA 4RABA 1JDSA 1KEEA 1XLVA 4JA2A 3T7RA 3SC4A 1QQ5A 2E4YA 3QELB 3K09A 3DFUA 1UBHS 3UV3A 5H3CA 1SZPA 1A98A 5J9FA 2OK8A 5KKAA 5KU1A 4FNMA 2ZUDA 3U56A 4FS3A 2QSYA 1YO6A 4PWZA 2I4IA 2P6OA 1RAEA 1DDIA 3M4XA 3NOOA 4KBYA 3E6AA 4PF1A 6Q21A 4LFBB 1JF8A 1GV1A 3E7WA 1ZGHA 3GZNA 1U3UA 3MT7A 4ILEA 4EBBA 2ZSUA 1HGXA 2ASVA 1ZH4A 2DKFA 4EKNB 4E0BA 4KXWA 2SKEA 4HRXA 2AJDA 2CVOA 3C98A 4D9CA 4AI6A 2OWEA 1MO5A 1QH1B 3N6VA 4B40A 2OPHA 1MZPA 2D1YA 2C7OA 1FJXA 3Q87B 5LM3A 1X38A 4HDNB 5CPFA 5K03A 2JA1A 4HK4A 4OTZA 2PD3A 4QFMA 1N2IA 3I9V1 4GMXA 5C0OE 1CJCA 1ZAYA 1FUEA 3T7AA 1YV9A 2WTAA 5F23A 3MFYA 1SB9A 3GDWA 4TN1A 1XMIA 4YEDA 2CJWA 4BYMA 2VAMA 1ABBA 3T3NA 2NYAA 2JGDA 1EK0A 1EZZA 3MQ4A 5FUMA 3MRVA 1RTTA 3MTIA 3DTVA 1H2RS 3QPVA 3VZPA 1K6IA 1DZ3A 1R3UA 1E4OA 4RA9A 5H9VA 4DBZA 3GGPA 4XVUA 4MO9A 6YASA 4TRNA 3J80A 1E1RD 1YACA 1GZDA 1OU0A 1VG9B 4YONB 2W8BB 2ZYIA 2G9VA 1IJKA 4KFUA 4AC9A 5I7FA 1NN5A 1W47A 4UCQA 3PKJA 1FUIA 3K0BA 4ZAVA 1DPFA 1T5HX 2D1FA 2QM0A 1T6XA 3DCYA 4OA5A 2FEXA 1AO3A 3OWXA 3VSEA 4PICA 1P39A 2HRZA 2PUHA 3HR4A 4R40A 2YCLA 5E1DA 2Y6VA 1V9LA 2P4EA 3LUFA 5JASA 2Q3LA 3FN4A 3I6BA 1PFVA 3UGQA 5K01A 3A9UA 2F3SA 3QFFA 1TECE 3GJ4A 4NXNB 3F97A 5I4BA 1PS0A 1FMCA 1NFQA 1L8QA 2X7HA 2PKRA 3MINB 4XB6B 1LDYA 5C8YA 2EP7A 3T6KA 4NU8X 2F6RA 3MJCA 1YMUA 3H4VA 5G1OA 3UMSA 2FLKA 4YDQA 4AN0A 1UJ5A 2IS1A 4MP6A 3DZCA 4MZDA 4P98A 3K9WA 1A2QA 2QTCA 3ET5A 1I14A 3MWEA 5DLPA 5IBQA 1I6LA 4C3ZA 1B7GO 1DBRA 3VX3A 4OQNA 3ICOA 4ZYVA 1HT1E 2GPWA 2C7PA 2Q9CA 3OA2A 2UZIR 1Y8RA 1FPMA 1KERA 3KQLA 2LCQA 1WWKA 4J0CA 3JYLA 3BTOA 1E0JA 4JL6A 4CPDA 1VL2A 1AKTA 2GCIA 2BGUA 2XUQA 3CVOA 4NE9A 1ZIXA 4EMBA 1G1AA 4IZOA 2HQSA 2XMCA 2BBWA 3M6FA 4R01A 4AX4A 4BVGA 4BFXA 1QZXA 5FOSA 4WLUA 3UAVA 1DC7A 1H93A 2ZJ7A 3CLSC 4RAQA 2WICA 5TF4A 3R75A 3D0RA 4FYWA 5IDWA 3F6CA 1JQBA 5DV9A 3G68A 1FDUA 1GT91 4AUKA 2QD2A 3PEWA 1P1RA 1RWMA 2I4LA 2O3SA 3RT7A 3EDYA 1SK8A 1SURA 2HX1A 5K4AA 4FFMA 4IV5A 1HNNA 3IPXA 1MOQA 3ROTA 3TYXA 2JH9A 2JHAA 3KJIA 3L18A 3COSA 5EMKA 1WZNA 1HURA 4B71A 1KRXA 1QG0A 2QUBA 4LZZA 5D1HA 2JHFA 5EJ7A 2XKKA 2XADA 4BBZA 1R37A 4F96A 3RRYA 1ZMTA 3B5EA 2VF2A 1NSTA 4JBLA 5EHQA 1R66A 4FW8A 4QXPA 3PLNA 1HOXA 1QIIA 4YVFA 1H8HA 2NZUG 5KTRA 3VTKA 3F49S 2YY6A 4RF4A 1KSGA 4MOWA 1KIFA 2ZSFA 3R9XA 4U6SA 5BSUA 1T29A 2YVQA 1XAJA 4I08A 2ARKA 4B6SA 2BFFB 4PHFA 4B33A 5I9IA 1IZ7A 1MB3A 4A6DA 1CVIA 4HEA1 2CYCA 1G2IA 1T91A 1W2GA 3GZ4A 3MLAA 3H8VA 4DSOA 3IAM6 1A7JA 2OR3A 2GJ8A 4LJSA 4AZ3A 5AKEA 1DOHA 3ASUA 3B7WA 4IS2A 4LRTB 1JJAA 1U94A 4WV3A 1Z8HA 1IHUA 4OYLA 3W9BA 1MGOA 1ONOA 5AW3A 5JMWA 2F62A 3N2ZB 1KE2A 3OTOB 1OLXA 3IPRA 1CR2A 1NNSA 1Q1GA 4R68A 2E5FA 4R9VA 3MLBA 2QNRA 3GQBA 3GT7A 4ALLA 3GVIA 3OIYA 3BH6A 4GYJA 1VHQA 2BEJA 1ISMA 3ROFA 5SYAA 2CGEA 4H1VA 1ZL2A 3D2BA 3KSMA 3T1QA 4FLMA 1Z4PX 5T6BA 1P17A 5JXIA 3G2OA 1J2EA 5EXEA 5E2IA 1MQ8B 4WX2B 3OZVA 2P9ZA 3ZX5A 1V1MA 1K7FB 2WUGA 1TCCA 5LD2C 1EWTA 4JZYA 2BDEA 4HOYA 4PQFA 4UBKA 4PSCA 3CT6A 2W6JA 4FDAA 5D3MA 3GLRA 5KQGA 2HSEA 1S8OA 2XIQA 4WESB 2I6FA 2R8BA 2C95A 1W88A 2Y1GA 3GLVA 4WPGA 4ZEOA 4BO5A 3BXZA 3GC6A 1TTQB 2FWMX 5AP9A 3U1VA 3WGOA 4B5LA 1B76A 4PM4A 3IL2A 1T1GA 1BHJA 4RHTA 1K8RA 1R5OA 2PRIA 4KMRA 1F7VA 2YIDA 1IULA 4FE3A 4MW2A 1KYYA 5KJFA 2WB2A 2G36A 2WWWA 4QXQA 2P8SA 2C78A 3ONVA 3CEJA 1M3SA 1K6MA 2AMFA 3RTEA 4JODA 4MX8A 1OV6A 2ANBA 3C6QA 2JKYA 4HI0E 3WGQA 3A1NA 1OFGA 5K8UA 4K6OA 2X9GA 3GA5A 2R4QA 4S0XA 3HMKA 3S29A 4G37A 1GL7A 1VRVA 4JSYA 1XUOA 3D02A 3OQIA 2I4TA 2HI0A 4HADA 3V1MA 1JEYA 1YJQA 1T8UA 3S1AA 1T4DA 5LWHA 4AKGA 2PSFA 2ATIA 4JP8A 4RXUA 3P0EA 4G09A 1G8HA 2O14A 4XDYA 5IZ4A 3DBLB 4MR7A 5CX4A 2YQ5A 4Z0PA 1XTBA 1GQOA 4AF6A 1ONBA 3K0EA 3BE8A 4G25A 1JMKC 5AJTA 1GPH1 1QCDA 3CXRA 4PTLA 3D7SA 3X44A 5KTOA 5LP6A 3H6KA 3WLSA 3ESZA 4W9MC 3IIEA 4PLGA 1O94A 2JLVA 3KAKA 1J8QA 1TJ5A 1Q3KA 3DL2A 4O59O 3GG9A 1NYQA 3QVXA 3REGA 3VBEA 5GZ6A 1U0BB 2VQSA 4YO7A 4QVGA 4QQRA 2PRSA 1C9NA 3EB9A 3WJ7A 2BFOA 3C7TA 3CLTD 3DDSA 3PDCA 4IHKA 3L8GA 4N7BA 4X5OA 5JD5A 4BC1A 1SG0A 3S70A 5B6PA 3B6MA 4YB8A 1COZA 3ELUA 3O8QA 1OXXK 5F7JA 5KOIA 4F7WA 3U4QB 3CURA 3PYMA 1I7NA 5BRNA 2EJVA 2EL7A 2AG0A 4PAQA 3I9FA 3NHLA 5CIWA 3QWIA 1XMOB 2EJWA 3EG9B 2DQSA 5CB6A 2FUG1 1GTMA 5WRFA 3BB3A 4LK3A 5KJEA 3VYUB 4FD3A 3GA7A 3V4FA 1DBSA 4Y9RA 4OHWA 4EPVA 2H1OA 1QX4A 1Y81A 3GIDA 4MHSA 4LTNA 2VA8A 5DHUA 3GFBA 4DSTA 3QA9A 3TW0A 3FOEC 2NV2B 2VVTA 4BOYA 2YHBA 2ZJ1A 2C9DA 3DMDA 4D9FA 1NUQA 4RPGA 3VPBA 1RWKA 2GM5A 5TMBA 1ZONA 2DB3A 1V26A 2GOYA 3TGWA 2M98A 1KK0A 3EFOB 1U9IA 3ETDA 1EGHA 3OX3A 2HPVA 3PNOA 3U81A 5T4FA 2NWQA 3QEKA 2ZIVB 2B21A 4RK0A 4YAJA 3D6NB 5AJZA 4WVFA 4XIGS 1RWPA 1XQ9A 4MIEA 3H05A 3UMBA 3C3XA 3FZGA 2QNBA 1WR8A 4MRRA 3NWBA 2Q1XA 5LSAA 1KYXA 4WQMA 1XPRA 4LF9B 1JSCA 1NKTA 1X1EA 2VP4A 3D81A 1C9EA 3B48A 1M66A 4HB2A 1N36B 4NCJA 3AF0A 1II0A 4X65B 3O9MA 4R51A 3RGWS 4M9RA 2JD0A 2Q4BA 3OY7A 2YC2C 3GCGA 3EPRA 3Q6IA 4LWZA 4P7BA 4ENVA 3L41A 5C3UA 5L4SA 3IMEA 4NRDA 3GIWA 4ZOLB 5IUKC 1D2CA 1PR0A 1P19A 3NAQA 4GQIA 4N9QA 1JJFA 4X45A 2K7ZA 3Q3JB 3PDWA 4QRHA 4A15A 2J3IA 4R9SA 1SVSA 7REQB 2J0UB 2QM7A 2C99A 3UAOA 1U4NA 2CCKA 3K5PA 4YJ3B 3UT0A 3CEHA 1HWYA 4O4LA 4COKA 1XKTA 1AQIA 4FHCA 1EFAA 3R6WA 1JFFB 1RYBA 2BHNA 5HNKA 2VDKB 3PQCA 2HF8A 3FYSA 4NF2A 1TKBA 5LB2A 2R2GA 1ZD1A 1Z07A 3BM5A 4FUQA 3EW9A 1H0KA 1T34A 3BZBA 1TZ2A 2O48X 4LJ9A 1KMMA 4R83A 2BJWA 4MPTA 3U6BA 1RD4A 3FWNA 3DOUA 4YV2A 1CUBA 2FVXA 4RTOA 2I76A 3QP9A 3AY3A 2WM8A 5CBPA 4JP2A 3N39C 2WJ4A 4BX0A 1FQOA 3TIIA 3LT4A 1MBZA 4F6RB 3ELDA 4YACA 1KZYC 1RW4A 2YVLA 3JQAD 1M7BA 4WZBB 3HQ4O 5AICA 1D0SA 4G4SO 1GZ7A 1UUFA 4RTKA 4UTNA 2BKVA 2VHUA 2CDNA 3PIIA 4RM2A 2NO1A 4D9HA 2I1QA 2CLLB 2AQHA 3HPQA 1O0SA 3PRYA 5ALXA 3NVAA 4KQHA 5JRZA 1U7OA 4C87A 4B85A 3ETLA 2NUTB 2VOEA 4FYVA 1N2CB 4QUBA 2QAGC 1Y1TA 4JJIA 4XJTA 1WTAA 2FG5A 1L5MA 3L2OB 3E82A 1C7RA 4MVJP 3VRHA 2HGSA 1RM0A 4L5CA 4ZVQA 1YBAA 4P1ZA 4TS4A 5FWXB 5HQ3A 1PV4A 1L0BA 1GGFA 2QI9F 1QIKA 3AHGA 4YHBA 1ZH8A 3TOSA 3FGOA 4MYSA 4GHWA 2CXXA 1DCFA 4JIGA 3UJ6A 2R7LA 3CUKA 1UOEA 1ECGA 2YVUA 4G5QA 4UTZA 4QYTA 3TQCA 2WVGA 2WJYA 4YMHA 1K7EB 5A6SA 4G1VA 1Z68A 2BFBB 1NXTA 1OD6A 1PJ2A 1R4NA 1WUJS 4I14A 2AL7A 2XBUA 5TQ2B 2M32A 1HNWB 3GXOA 2HU8A 3EZGA 2FQ1A 3VNQA 4CM3A 1H5NA 4RAOA 5CXQA 1PZXA 4M9UA 3SQWA 4J8PA 5EKUA 5JALA 3IVRA 4ZT3A 4ZI7A 4BBPA 4WH0A 4EA8A 3K0CA 4OATA 5AM5A 4BO9A 2PX3A 4EEZA 5AVSA 3NGMA 2QE7A 2IH2A 1PJ8A 3FPGA 4EB0A 1LNSA 1VL1A 4GX1A 3ZV6A 5I4KA 4AQYB 4C4OA 5H83A 3JQ6A 3MTGA 4TN5A 1G7TA 2HO4A 1TUBA 4UUPA 4BKOA 5KUTA 1ZGBA 2Z3ZA 5FFMA 3ABOB 2E49A 3HBFA 3OFSA 3G13A 1UJBA 1XALA 1O97D 3P96A 3TEJA 4QT4A 5IHPA 1HL7A 2AHOA 3E9QA 3IMCA 2VJMA 4KQCA 3OH8A 4F4FA 3G6KA 4XVHA 4C04A 5A5EA 2ZYVX 2HAEA 3Q88A 3QY0A 5AKYA 1IJEA 4ABTA 3ZGZA 3D4BA 3TOCA 1YI0A 1W96A 2Q41A 2RD2A 4B4DA 3O8OA 5K3FA 3TJZA 4WMLA 4BWGA 1E1NA 2P9HA 3PC4A 4Z86A 4ZCQA 1QR2A 2ZAMA 1JSRA 4FFWA 5MF6A 3THYA 4QM6A 1GPBA 1RLJA 4ZCPA 1WBJB 2X0RA 4PYLA 2I4MA 3NT4A 4AO7A 3DUFB 1L8XA 3UFBA 4ZTBA 4O1IA 3IOYA 1L4BA 3CPEA 5A3VA 2VNKA 4DPMA 5JCZA 1EVYA 1W52X 2AZMA 3LP5A 1DFIA 1KGDA 3HABA 1WXGA 3L6UA 2EBFX 4DYHA 4Q15A 4NARA 3R40A 3DWEX 3O31A 2VAPA 1UMCA 3IDZA 1H2EA 2RMKA 3KOYA 4PXYA 3I8OA 4HLUA 5JS6A 3K9BA 3TUJC 4ONEA 3I4CA 4R8KA 3ZWWA 4HB3A 3IC5A 2J6BA 4M4SA 1EHCA 3QZUA 2I54A 1DQNA 2WYUA 2XRMA 2WJAA 2OHJA 3VC3A 4Z49A 4QUDA 2XUZA 5F9HA 4MR9B 3LYUA 3PUIA 2FPPB 2MINA 3HO6A 1CIJA 1PS8A 1CW2B 5AM2A 1XZLA 4XTCS 1LCIA 3A31A 4P3KA 1LQTA 1ZWKA 2AC7A 4X24A 3UGKA 1SVMA 1WEHA 1NY5A 3TQRA 3F6EX 2BISA 3I37X 1YDFA 1V5EA 2VPXA 4DB2A 3RIEA 4DNQA 2UZ4A 1Z8NA 4MIYA 2GZ1A 1V71A 3PPYA 5AMXA 3IERA 2OO7A 2X40A 4CG3A 4RC9A 2O57A 3HGTA 5LJIA 2AOTB 4NG4A 2H7VA 1LTQA 5FUVA 3SNKA 3WKDA 3BWVA 4QGSA 5H8WA 3V6MA 1ABEA 2FZVA 4P3XA 4LZPA 5CXSA 3HJAA 4PZLA 1HZJA 1WY5A 4RSGA 3GLGB 3CN7A 3COPA 1MG0A 4J7XA 1FSPA 1O7JA 1BJTA 3T61A 1I3LA 1QIFA 4MPPA 3WQRA 4GAEA 2FU5C 2D0PB 3A3NA 3I4FA 3KKLA 3NAZA 5B1IA 3RASA 3X1MA 1YUBA 4JI5B 4BB5A 5AW1A 1NVEA 4ZYZA 3E18A 2GO7A 4V0KA 1PX2A 2QXUA 2IELA 5AI9A 1S1MA 2DPMA 1XKXA 4NCNA 3Q3CA 1MIOB 3K1ZA 5CMLA 3GRUA 4BO1A 3DXXA 3P4XA 4RZXA 1J0BA 1SA0A 3VR6A 1I5EA 4MKHA 4DUZB 1A1VA 5TGZA 3ZK7A 3HNRA 1C30A 2II6A 4JLOA 4MQ5A 3SC6A 3TWOA 1EJ0A 3WWDA 2Y76A 3H5OA 4E3WA 1GRQA 1FTSA 1NJFA 1O2DA 2O50A 3AW9A 3BCUA 1IY2A 1NMYA 2W71A 3G7SA 3D7LA 3HUTA 3LVQE 5H02A 5LDDC 3LSYA 3PU6A 2OVBA 4YDSA 4HNRA 1QHEA 4I5DA 4GKJB 3PNVA 3GGJA 2NXWA 2NLOA 3OT5A 4ALIA 3A0UA 3CRNA 4IJ6A 2G4CA 3FVTA 1EUDB 3N2KA 2K2WA 2HJWA 3SJZA 4AT1A 1DKOA 3JVUA 4MTLA 3R7NA 4R7ZA 3QXXA 4NCBA 2WUVA 1JFSA 1LTHR 5J58A 3KQWA 4OQ4A 1RE0A 1TM5E 4D9GA 2EERA 3I1FA 3LLUA 4RVOA 4E32A 2CL0X 2Q3BA 5HR5A 1KWGA 1XYYA 2O0MA 2P5TB 4EHAA 3CLTC 4F86A 1GNSA 3K4HA 2GZHA 4U9IS 4OBWA 4QXRA 1L7NA 1SC6A 1RADA 2ACVA 2AEFA 4L8GA 1M2HA 3VBCA 1SOVA 3IURA 3JQ9A 4LC1A 4O08A 1SKAA 4BQPA 4DCUA 5IYZF 1SZDA 3TQQA 2O3JA 2VP0A 2EF1A 2D3TA 3N3AC 2GPSA 2PMWB 3U40A 4H7KA 1CWUA 3F6RA 5EQTA 2A59A 5BRJA 2A14A 4PZZA 5CNMA 3VNBA 1ZDMA 1UJNA 3WZLA 1YK1A 2JJ8A 2J87A 4S1PA 3NOXA 4WY5A 3REOA 5IS2A 3G88A 5KZMB 4W99A 4IYRA 421PA 5DNUA 1M8GA 5EQDA 3FNEA 3L6RA 4IHJA 1QB8A 1N0WA 1JKJB 2XLBA 4JUCA 5AYVA 4FN4A 4M46A 4MWCA 4CMAA 2D1RA 3QBTA 1S6YA 1D8AA 2P8JA 2RGCA 1UK7A 3L07A 4M0EA 4TTAA 4WCFA 2RHTA 3EGXA 5JXGA 3GPCA 1CRPA 4XUDA 1AF7A 3BGOS 2YCBA 2IH5A 4CMBA 4GI5A 1J8VA 2ES4A 2GK7A 1TEVA 1UINA 3OCUA 1DBQA 4AMZA 6REQA 3SAJA 1D4AA 1CBUA 1PJ3A 3K1AA 1SCQA 1A2BA 3D8NA 4UULA 5CK5A 3OLXA 2UZ1B 5E7MA 2OP1A 1DWUA 1MX9A 3HWRA 5EYPA 2R7NA 3IKMB 7MHTA 3ZWMA 1N57A 3TLGA 4I2NA 2X0DA 5KYNA 2H2GA 4N3BA 2VUIB 1RAFA 5KTSA 4M9QA 5DN9A 1DG3A 4FDVA 4R1QA 1KJZA 5J5AA 2BT4A 2VXOA 1E4VA 4BGIA 4DLTA 2H48A 4U7JA 4NJEA 2CHVA 3F9IA 1QOZA 2B4RO 3GOQA 1VG1A 3PK0A 5F35A 3KEGA 3QVTA 4KV7A 4L0CA 4MS3B 1ND5A 2ORVA 1EZ1A 3EDRA 4GVPA 1QZZA 5TF0A 3TFWA 1MC5A 1DC3A 2GJSA 3UMGA 4G0MA 2PYZA 1EFVA 4JL5A 4RPKA 2Q5OA 4CLOB 3RUAA 3MJ4A 4HVAA 4CFZA 3RYFA 1ZAKA 1NPTO 3SC3A 3JSXA 3D3KA 1SM4A 4B8WA 1DCTA 3LAWA 1PT9A 1XIVA 2JHCA 1N1DA 2P35A 3CPJB 1WDWB 1TM2A 1DEXA 1T0IA 3LDHA 4TUYF 1YXMA 4IOMA 5FOXA 1RRMA 1RWNA 1JGTA 1THMA 3H5RA 1J9ZA 1SQFA 3B60A 1PV1A 3ZBQA 4B2LA 5GMOA 1LC3A 4AXXA 4CKXA 2B34A 2EW1A 1N5MA 1ZGCA 4MKXA 5AFSA 4GPD1 5TE9A 3IYLW 4NJMB 4Q3DA 4BZZA 5J4HA 3AU8A 3ZBTA 4C2UA 3MGGA 3E5RA 1Q15A 4ZVKA 1FW8A 1T10A 1Z2PX 4ARCA 2CJYA 2X3UA 1CLUA 3W8FA 3CZCA 1I1QB 2SNIE 3E48A 3CNQS 3VGJA 4A0FA 1WPGA 2NVUA 3S2YA 4LBWA 3BX1A 2J1LA 2QVYX 2GLXA 2WNIA 5DBOA 1SC4A 1WB6A 4KODA 5GIOE 4N41A 1ODJA 2AFVA 5FJIA 1IMJA 4BMSA 2OMEA 2IVFA 3T7CA 3CKKA 3O95A 3GJZA 5EWJB 1EX9A 2EDAA 5HKKD 2ZTLA 3IQDB 2IVZA 1KMIY 3AI7A 1RJ9B 1WV1A 4N5IX 3SC2A 5E3IA 2A1UB 1PL6A 3HC7A 2QZ4A 4EYEA 5FUQA 2WWRA 2Y1LA 4DIDA 4ZOLF 4EK9A 1Q2UA 5IANA 4KAAA 3CUEF 1N78A 5E2BA 2NN3C 3B6KA 1E0SA 3NS7A 1KMHA 3IT2A 2QN3A 5CW1A 4OAPA 1E9RA 4YJ3F 1JZQA 3M6MD 4HHEA 4A1FA 2JAHA 1GR1A 4HX5A 3PL1A 4D26A 1GGMA 2BF4A 3SJUA 2JGNA 1ZSVA 3HYRA 3FDZA 5JFGA 4FZRA 4L57A 1R15A 1WCWA 4DWJA 2AUMA 4WHMA 3KYDA 2AOUA 4IDEA 2GAOA 1B0ZA 4G0OA 4QFDA 1KPGA 3W06A 1AXRA 2ZJ3A 4C88A 4EVSA 3DQPA 3NETA 1VL6A 3MWGA 4IFEA 1S9HA 1YASA 4W9NC 4LMBA 2O2DA 1RQ2A 3OE5A 4OH7A 1KDZA 4Z1MD 4KG7A 1EGAA 5IDXA 3D5EA 4C6SA 1YOVB 5SYNA 1GNQA 4JBNA 3B3QA 1CZNA 4P38A 4KREA 1PNVA 4JEUA 3LDAA 4WDQA 4DZTA 1YQ9A 2P7HA 3IQFA 3R1IA 4OXXA 5L3SB 3NP7A 5DHTA 3GFVA 4HS4A 4PLVA 1U7WA 2G04A 3KE9A 3F2VA 4HFNA 4PYNA 1G1MA 5ETJA 1LKZA 4KE7A 2C20A 3E4DA 3FBGA 4B31A 3AV3A 3WSWA 5ALHA 2PL1A 3GZTB 2KQUA 1H5QA 3WJ1A 5CIYA 2WM2A 4FYIA 2XCRB 4G8BA 1SVLA 4J0KA 3U7EB 3HCCA 3X3HA 3KELA 3SR0A 2XNCA 1QLWA 2O6LA 2ZSDA 5CD1A 1XTSA 1YT5A 3GN2A 3NOVA 5IJZA 1O97C 1YJBA 1ZH6A 3BILA 4YJ2F 3TQTA 3B53X 1H9BA 4RGYA 3KQPA 3WRYA 4YCNA 2VRNA 2H8GA 5JLJA 2R9VA 3HNOA 4MDHA 4LJYA 4MQFB 1RWVA 2YFHA 4W5WA 4W5HA 3QQ5A 4EMTA 3GPIA 4IVNA 3ACCA 3WGMA 4AO6A 3IULA 3OWHA 1GCOA 1JFVA 2XUJA 5C1IA 1WZ2A 4FMBB 3MYYA 1E2BA 5JANA 2FSVC 2H1CA 3R6LA 4DR3B 5I7SA 3PXGA 1E3DA 2BGIA 1I7QB 1MB2A 1PE0A 4Q9LA 4JLWA 4KYTA 1AK2A 4P3NA 5FPTA 5EHNA 5CLFA 1L5RA 1Y1KE 4QZVA 1XBTA 3U80A 2Z1MA 2I65A 3EA5A 4Y2SA 5DM4A 4IRMA 3RIYA 1V7ZA 4R1MA 2JFBA 3BWYA 1VSTA 5DM2A 4J1SA 3QLUC 1QQAA 2YZ2A 4G0XA 3SDZA 2DM6A 1GGHA 4UAGA 5JQGB 2B0CA 1A77A 1UKVY 3LIIA 1ECCA 1TT5B 3NHWA 3RC7A 1VCMA 1BRTA 1OWPA 3H9GA 5HTOA 4LBYA 4KQ9A 2ET6A 1YDGA 3FOWA 1KQNA 4C2AA 4P82A 4ML3A 3G5LA 4QYIB 4WVLA 3QVKA 2HA2A 1OT5A 3BREA 2XMQA 4G2TA 5IJ9B 5LMUB 1O5IA 1DWOA 4C3UA 2V0NA 3KJEA 4Q4LA 1KR2A 1C1DB 1XO1A 5B1SA 3QVMA 4KH0A 1CZKA 1U0RA 3K16A 3LT0A 3JAWA 4TWIA 1A9YA 4MCIA 1E98A 3P2KA 4Q9NA 5JW6A 3RJ5A 3TJRA 3E22A 3S7ZA 4CEJA 4EHDA 2JFQA 2QR2A 2WSBA 3DZIA 1CIVA 2G7MC 2I8CA 1VOTA 2JFFA 3JWIA 3VDNB 3ZV7A 3AM4A 4YRNA 5HF8A 3UHAA 4DV5B 4DCGA 4CTOA 3PR3A 4JUIA 2OXEA 4MWBA 1NMQA 1UL1X 4TLBA 1XQXA 1Z5PA 3D43A 5BQ3A 1UP4A 1A2KC 3BHMA 2I6UA 2QTVB 3PQFA 4RVCA 2NUPA 3KWLA 3DPIA 1SCUA 4U4AA 4XR9A 4QRIA 3RDPA 4E5YA 3JTEA 4Y9DA 1E3IA 4LE2A 4JYPA 2VSYA 1X86B 3CRW1 4BO0A 3EC7A 3LA8A 2JANA 2X77A 2BH9A 3KD3A 4JVNA 2AV6A 4EL0A 3GBPA 4RMGA 4YAEA 4C0QC 1P4GA 4YX9A 2YJTD 3SD7A 4OB6A 3EIEA 3HRIA 2ZS8A 3EXHC 4O4HB 3VPDA 3OZIA 1RHKA 4BC0A 4YI3A 5KX5A 4EI9A 4RSRA 3J81k 4KE8A 3W6ZA 4AZ0B 3UYKA 2ZT8A 2QVBA 1XZEA 1QH9A 2GN0A 3DE2X 4D56A 4G65A 3F90A 5HFAA 4ZXFA 3WWZA 2A84A 2PX6A 3UV7A 5JJKA 4YCJA 1JDBB 4IZ6A 2ATXA 1NUHA 1P0CA 3MD0A 5HKLA 4BVHA 1MEJA 2EIHA 4Q1BA 1R9JA 2O1XA 4QAJA 1T6NA 4J49A 4JKYA 4H0NA 4WUTA 1NVUQ 4B6EA 2ZS9A 4TMVA 2O0LA 2P9CA 5IUNC 1UZMA 3VR5H 3OX4A 4IEEA 1WCIB 4NU0A 5ABPA 3CJQA 4PR3A 3IT1A 1QHIA 1T36B 3FCUB 1XYGA 5LUBA 3KYBA 2PA3A 2B4KA 4LK2A 3EAFA 1W1UA 5EWLB 1VJ5A 4CT4B 2LCFA 3GRRA 4IIDA 1WVGA 4EG3A 2P9YA 3B9QA 1DO2A 2QA5A 5TDHA 1JDJA 4Y1RB 3AL0C 4GBGA 4P81A 3N2LA 3WYEA 2IPXA 3MMZA 2E9SA 1P7PA 4Y6RA 3UQYS 2YWGA 5AVQA 4UE2A 4L7QA 4MITA 4ZO7A 2H1RA 1XMSA 3KB6A 1X7WA 2Q2QA 3UYLA 3FOFC 1P72A 3WYFA 2ZJYA 5HPYB 1EFRA 2WHQA 3LY8A 3QFCA 1R3DA 3ZD6A 3OLVA 4TL6A 4Z99A 4CM5A 3HKEA 2IZ5A 4RY2A 5K4GA 4P33A 2Y6UA 3FPBA 3O1IC 2CL7X 2JLYA 3BJRA 2GN8A 2CF6A 4MR8B 3CEPB 4O3MA 3RPEA 3I2HA 3LZCA 1IQRA 4DMGA 4KN5A 3S2ZA 1ZNYA 1RXEA 1XKQA 3Q4GA 2WWIA 4L4YA 1E61A 3C4QA 2BYTA 4YUAA 2R5NA 2N47A 3L9XA 5FA8A 1YKSA 3D7MA 4KU4A 5EQJB 4N54A 3U5ZB 3M6WA 3PGMA 5G02A 3HKCA 4C7KA 3S5UA 1YBMA 3GVHA 2A1TS 4CCSA 1Q19A 4Q47A 5CDTA 5B7PA 1YF3A 4P9NA 2J4FA 4QX6A 4KBGA 1WU8A 1YK0A 3EYAA 2O8EA 4F85A 5D3ZA 5DIZA 1HDIA 1V3VA 2VI5A 5GJVC 4J0GA 4LHYA 5FBWB 2IYPA 3E7PA 3Q6NA 1R4MB 3CX3A 1I9GA 4FOSA 4ARBA 1P75A 1FTNA 4FYJA 3A4IA 3BWDD 1Z7BA 1XNHA 2OCLA 1GEEA 4GRAA 4TSFA 1KQPA 4C7JA 5EFZA 4OF4A 4EGQA 1DAMA 5J23A 2RHLA 1G8FA 1DL5A 1KAEA 2YY7A 3D3WB 3D8BA 1FXWA 4I4IA 3MUOA 4KDRA 3NBFA 3UG6A 3ZVNA 1KKLA 1Q91A 3DD5A 3CINA 4J9UE 3L4JA 3UY4A 2FCRA 4CI0B 4K9SA 2GEFA 1C3EA 4TLMB 5AK4A 3CVJA 1EZ4A 2J59A 2QGFA 2QZ9A 3IHLA 2V6JA 5GVSA 2PBLA 1U2TA 4N0MA 1DWQA 5EKXA 3AHEA 1WVIA 2V7EA 2XSZA 5DM60 4PZPA 3LBIA 5AVVA 3VHXA 2E87A 2GF9A 4G5FA 9LDBA 3UK1A 1I51A 1KDTA 1ESMA 1WAMA 2PH1A 3P2MA 5BUCA 2ZBFA 2IOQA 2SKCA 3PXUA 3L0IB 2QAJA 2QUHA 3DGFC 5GINE 1LH0A 1FLNA 4ND8B 4Q34A 3DCNA 1EDZA 3JPYA 1TCVA 2XKJE 3QITA 3QLEA 4XGKA 2WVHA 4OSOA 3PX7A 2C94A 1R0RE 1R6VA 4W1QA 4O2BB 4UEOA 1Z13A 3JU3A 1SN7A 1Y7IA 1JHOA 1MDBA 1ZCBA 1JLHA 3TQSA 4J0HA 3T52A 1L4FA 1Z7WA 3L4BA 2G40A 4XM2A 5DGIA 2BPOA 2YV4A 1U02A 1YCGA 3C3KA 1WKCA 3JQFC 3NTVA 4H35A 1MQ9A 1S4QA 1D9XA 1JHDA 2JCXA 1U8FO 3BXEA 4JI7B 1IXSB 3H9JA 2V8OA 1SUBA 1U6KA 3C5VA 3D4OA 3HB0A 1FSFA 3OIDA 4KAJA 4LJAA 4PTZA 5LZ8A 4AICA 3ZZ1A 1KOGA 3QVOA 4K8RB 3OEEA 1ZO8A 5J4KA 2PXAA 3V34A 4WADA 2CLKB 4FGSA 4L73A 1TEXA 4BUZA 4RJJA 3F6SA 2VP5A 3QKWA 2X8BA 4TT3D 1TCUA 2HCFA 4WKGA 3RUDA 3NM4A 1QK3A 2QJTA 2FZCA 1FFEA 1OYYA 1UQTA 1YQEA 2WV9A 5JAQA 2PUCA 4P4LA 5SZJA 2BRUC 3U4IA 4UCXA 4MWZA 3N75A 3K9NA 3K2IA 4R3UC 4LYHA 4WBNB 3CLRD 4XX0B 3OX1A 3T1OA 3TDMA 4DQLA 3SYKA 2ZZKA 1E1QD 4JOQA 4MS4B 1V2HE 2B2CA 2C07A 3CUYA 4NFLA 2H0RA 5LP6F 4PSAA 3UMMA 2WFLB 3JRXA 2A9KA 1ODKA 1N1MA 2C4NA 2KE5A 2WJIA 1VGRA 3PHBE 3OPYB 4M6WA 3VU0A 1U2SA 5EAIA 4HXEB 1H94A 3GVXA 4X1IB 3W1WA 1PJZA 4ZEMA 5DNDA 1DJMA 5AXAA 3H99A 4HNQA 3K0AB 2AFIA 2WMOB 3Q15C 2Y1KA 3HN7A 4WNAA 5AK6A 1CZHA 2XGOA 4EL5A 4F56A 2CK3A 1U7ZA 2VOJA 3O92A 4BNYA 4V24A 3N2NA 4I19A 5D6OA 5ALGA 5A5FA 5E6UB 5UKDA 1XRSB 4HUQB 3PS9A 3VKUA 4C2TA 1CQZA 1OB2A 2GYWA 2QR5A 1XLUA 4BFZA 3I58A 3GOHA 2C2WA 1O9GA 1NJ5A 5MHTA 2HREA 4JLBA 4G36A 3PITA 4M87A 1RS0A 4RDHA 5B7NA 1A82A 3GGCA 4ZDWA 3PRKE 1NW4A 1WPXA 3HBNA 4M2LA 5L7YA 2JAUA 2Q5JA 4NCXA 2QT0A 4RJTA 2WF5A 5LOVB 3C8HA 5SZKB 3ZU2A 1FDTA 1CFZA 4EHBA 3ZLBA 1JQKA 1P8AA 2KPOA 2W6CX 1CP3A 2XYRA 4TWRA 3TL3A 1F4PA 4JENA 1USVA 3NFYA 3EIUA 3HJRA 3ETNA 4Q21A 1YD7A 2B8NA 4D4HA 1AKEA 3W5VA 1USKA 3PZBA 1XZBA 4CG2A 3KKQA 4PRKA 2FR0A 3GFFA 5BWMA 1G8KA 2AX3A 5KNBD 4JHXA 3EQ9A 1ZJ4A 2D7CA 1L5FA 3EISA 2XV1A 2ZJAA 4Y7CA 3VDRA 1AHNA 1X7YB 3E58A 1Y6FA 1AV6A 3EUWA 3EIXA 1ELOA 4MUGA 1UC8A 1QFZA 4RHFA 3UAXA 2FMFA 4GE3A 3S55A 1XJWA 3VI3B 5DN6A 1KE1A 4TXJA 1TT7A 3ZCQA 3VU8A 4JU9A 1DIGA 4YV7A 2R4TA 2X15A 1CHNA 1RHQA 3LK7A 2PLWA 4CKBB 5K7SA 2ZTVA 3FDIA 2OD2A 1QP8A 4IKOA 1IBCA 3H1FA 2VYCA 1EQAA 2ZAOA 1HEIA 1FSZA 3ZKWB 4V0QA 5B57C 2D2XA 4L76A 1G21A 2DUNA 3H1AA 4XPIA 1YQDA 2V97A 4GGPA 3OCCA 4O4LF 4D9KA 1C1YA 3HA5A 3QUBA 4DIEA 3PNPA 4F92B 1G6OA 4LVOA 3AHHA 3AKEA 4LTMA 4PO1A 1I7PA 2C7BA 2WI8A 3B6ZA 3ND9A 4M3NA 3GCXA 3V1UA 4CM6A 2Z6QA 2I55A 3JQ8B 1J70A 3SX2A 4EA9A 2P9GA 1HYBA 1ULUA 1Y8CA 4MLPA 4RMHA 1Q1ZA 4ZFNA 5CDSA 4PANA 4AQDA 4ZXPA 7GPBA 4RQAA 4KLRA 3TR6A 5LWQA 1KFCB 4LCBA 3SIXA 3HK2A 5EG5A 1S7CA 3KL4A 3OJCA 1G6Q1 1X8XA 4MVJI 4HSGA 4EX7A 1OZFA 1WIWA 1C81A 3HVUA 3TE6A 4YUWA 4CT0A 4HRVA 3H1TA 4D92A 2GK6A 6ADHA 1RC0A 1UAYA 4KNWA 3BHJA 4OY3A 3RT1A 4XB1A 2XECA 1QHXA 3OZ7A 1R10A 2NYRA 4HXGA 3KHTA 1FPQA 4WY8A 4PEVA 4Y67A 4N0QA 3UKJA 4RULA 2G88A 1QNLA 4KO8A 5JCOC 2AJCA 3EXIB 2ZBGA 5G0UA 3SYTA 1YS1X 2ZPUA 4YRRA 5K3BA 3LPAA 2V4ZA 3D5QA 4LC0A 3ZWNA 4YAUA 3GNLA 4IMPA 1KQOA 4MW4A 2HV9A 5IEBA 5IC4A 1QF9A 2GUWA 2XDYA 1YVRA 1YFZA 4E3ZA 5EL0A 4NHOA 3ZE8A 4KSBA 4PFSA 1NP7A 1TVKB 1P2VA 2FZEA 2YYSA 2O5RA 4PPYA 2QL7A 2PMBA 4YJHB 2WZCA 3GDHA 2OD7A 4PPFA 5EMJA 3LX6A 4C0AC 4XWKA 3SICE 4HEHA 2V03A 4R05A 2CLHB 1U8XX 2YVKA 4XUGB 3REQB 4CF7A 4HWTA 4J94A 5C31A 4BNFA 2OHVA 2OZVA 5LLDA 5KWSA 4UUNA 4EPYA 3H16A 1UOOA 3QJ5A 1K68A 4CEHA 1ZCZA 5L3QB 1H3NA 4R2WA 3RFUA 4AAYA 3ORYA 2EFGA 5T57A 1NDUA 4QDUA 6GPBA 2D0IA 3QYAA 1TTTA 2IU6A 2Q99A 3K6JA 1IY8A 3NKVA 4BGVA 5ALZA 1A0OA 1ULHA 5TXGA 1BXRA 1PNOA 2DY0A 4RETA 4WNCA 2XKAA 3BERA 2H2DA 3SHQA 5F7OA 4O4HF 2AG5A 1D1QA 3Q5GA 3L8YA 1SBHA 3H83A 1SHTX 1NC1A 1ZK2A 3OFVA 1NV9A 3OT1A 4TV8B 5DM1A 4HDSB 5CX1B 1OBCA 3IP8A 3ZUGA 2G83A 1MB0A 3F5DA 3O1JC 3NRJA 4OGFA 4WEOA 1ONSA 3EPPA 2B1QA 2Q3MA 3OZTA 1RRKA 2PUBA 4BL5A 2GHIA 1FBTA 4R0MA 5A4AA 1L1RA 2J33A 3KB2A 3TD2A 2ZXEA 2E55A 1S96A 2Q62A 3ROGA 1YGPA 2IYZA 4PGGA 4XWTA 4EY8A 2QYOA 1TFUA 3IBSA 4U0JA 2PQMA 4HR7A 5LNK1 3IKTA 1X87A 4JFRA 3UATA 2RH8A 1D2AA 5BVHB 1WZEA 2BCEA 3AEKA 2XWQA 3CXUA 1SVOA 3LYAA 3OI7A 5EQFA 2XNHA 1YR6A 3L04A 4OO3A 4UC0A 3GUZA 3V3TA 2ZI3A 1NU6A 1KAHA 2D4HA 1U2DA 3FJ1A 3HEMA 1L4NA 1S5PA 5AW4A 3WNQA 3ZTYA 3RHFA 2QPLA 4GP9A 3LWBA 3BDAA 3E4CA 4LKOA 4P34A 5EINA 1N3YA 3CBQA 4D3ZA 3LO5A 3KFXA 5DP2A 4TLAA 5IVIA 5KNDA 2C9BA 5MN4A 4UMDA 3JZIA 1RI1A 1DG1G 4H3SA 1G8PA 3P2JA 4MA5A 3T5DA 1JAHA 2B4TO 1XDUA 3IB3A 4F8JA 3ZIUA 3CNOA 3NNSA 3M9XA 2OORA 5JCXA 1BMTA 3PLRA 5JECA 1FP4B 5JAZA 2EWVA 3HV2A 3WL5A 3MK31 3UFXB 4FWIB 1LBHA 4PSDA 4W8OA 5GTDA 2BGMA 4V2UA 3CHYA 1YR2A 3QW4B 2WIFA 1IDOA 1BOOA 4IQ8A 3PJEA 1A7KA 1TMOA 4IQ0A 1J22A 1DB3A 2ZRQA 3SHFA 4DHWA 5HSGA 4RDCA 5C37A 3V80A 2F4NA 1XK6A 2EBHX 2KYRA 4FCWA 3CLUD 3SMQA 1Z4LA 3E2MA 4DS3A 1F8FA 5KNDD 1P4AA 1N1EA 1C0PA 3W05A 4RH0A 1H8HD 4GKAA 2JCYA 3ENKA 1UBJS 3NH6A 1QZUA 4HLQB 1JNXX 1VPVA 4CMIB 4UHJA 1F4LA 1NVKA 1W0CA 1W19A 3RE1A 1KDRA 1Y8AA 3N7UA 2NXNA 1BMDA 4PHCA 3FROA 5HJEA 1YR9A 2O06A 4IVPA 2JAPA 3WNBA 3R4CA 1IN6A 3NKFA 3U13A 3K92A 4ZJPA 2P11A 3B1VA 4FYHA 4QDOA 1WUHS 2RHJA 3CONA 1JWBB 4FFDA 5AJUA 1BH6A 2BM0A 2PRZA 3B9PA 1N92A 5IVPA 1E9VA 1F7UA 3H86A 3KVYA 1AT1A 5AK0A 1ESDA 1M33A 4DMLA 5A9SB 4I50A 2P79A 1Q84A 3NHRA 5AM0A 3OE1A 4JS0A 1RM5A 4PR0A 4LQ4A 3CIOA 5JE8A 3PXEA 5LDHA 2HMAA 5JI3E 3NRBA 3WQSB 1PBNA 4Y6QA 3COWA 3I34X 3V2HA 1YZKA 4EQ6B 1UOQA 1SZJG 3E9RA 1V35A 2RAPA 3UHJA 4B3BA 3B1KA 1NPDA 3WK6A 5HYVA 5LBUA 3PVZA 1DI0A 4Y2RA 3CLRC 3JV7A 5JZOA 4YMWA 2F17A 1JKMA 3PFFA 1KEPA 1VA4A 1VI6A 2XCIA 3PWTA 3WLIA 1T6BY 1THZA 1EGMB 1UBTS 1WLSA 3AEUB 2FUNB 3KLPX 4JJAA 4QPDA 2UVDA 1Y6GA 1JEAA 2QBYB 1AGRA 1TEHA 5IJWA 1VHDA 5DIFA 1N2HA 1TYAE 1I8TA 2UUPA 3GHHA 4UVIA 1IB6A 1JLSA 2VHVA 4K03A 1KP2A 1O8BA 3E1GA 1TU3A 3ZCTA 1H6AA 1V4BA 5COAA 3KVNA 4ZYLA 4AO8A 3DE3X 4B17A 1QRTA 1Q0UA 4KSYA 3GA0A 4MW6A 3VR4D 5GZ3A 2X2FA 1L3BA 3RBVA 2IHYA 2OV3A 5K8CA 5E7QA 1PZFA 1QIHA 3KKZA 4O2BF 3I5XA 4WE3A 4CODB 4Z4QA 4Z4CA 3TX2A 5KREA 3IMFA 4R2HA 2X8LA 4HTAA 3SJAA 2G71A 3KIPA 1GUBA 4BN4A 1JDPA 2RONA 3DFKA 3UB3A 2EYQA 1DDOA 4J6FA 4LHEA 3ZYCA 2EL9A 3DOHA 3HA3A 4ZQHA 2VQDA 4ZOEA 4M0KA 4PYJA 2HHHB 2ONCA 1QYVA 5EJ2A 3R5KA 1JQ3A 4L6AA 4N1AA 1KI1A 4YJGA 1WD5A 2VFAA 1C7ZA 1PWYE 3W8RA 2BL4A 3ZWQA 2BGTA 1E2IA 1IUOA 2PVPA 3BF7A 1NX6A 4O1MA 5JLAA 4M98A 3UMFA 4ZVVA 1XQ6A 4CDGA 2BH2A 1C1XA 1KHHA 1WQ3A 1I0LA 2AFHA 3M9WA 4MRNA 3UQZA 4IHJF 4M0LA 3GN1A 3MM4A 1HDYA 3ZU3A 1J8DA 2QX8A 3U37A 2RJNA 1FTGA 1Z0DA 3P19A 4R9RA 2XVXA 3CW9A 1NX9A 1U2PA 3HS3A 1AQJA 5BN5B 5KNCH 5JXHA 2VRBA 2MR6A 2VUHB 3QG5A 2FWJA 1N6OA 1ZW1A 2X8JB 3PFBA 3DQZA 1J0DA 2VHWA 1LFDB 3NHKA 2XGJA 4L8VA 1H9AA 8ABPA 3I9JA 1XD2B 3IBYA 3R7AA 1XQ1A 5CEFA 1Q21A 2IEYA 2A3NA 4C4SA 3QENA 2AMLA 4G1UC 1JG3A 4OQPA 5JNRA 2RHOA 4IOLA 1SUDA 1N0UA 4B4WA 4PVDA 1OFHA 2QD4A 5AUNB 4WLNA 5L45A 1LSUA 1ORWA 4RZIA 3PDIB 5DW0A 3ZE9A 2QDXA 2X42A 1YB1A 1RI5A 1VRWA 1VTKA 2PS1A 5NULA 1A9XA 4C1BA 2P1RA 2O7SA 2P9TA 2ZVDA 3A26A 1ACMA 2HPHA 3EC1A 1QSGA 4G07A 4W5JA 1W36D 1OXBB 3NYIA 4WBNA 4COOA 2YMMA 4MYTA 1LJ8A 1I2BA 2J7PA 4EABA 2WIBA 4JUFA 2KS6A 2OESA 3HCWA 4PG7A 2ODEA 2MIIA 1WO8A 3W5IA 1WMSA 3RHZA 4B74A 1JJVA 4C0LA 4MWDA 2B92A 2XMGA 3RUEA 1WKBA 2WUFA 4D4LA 2J6IA 3I53A 3JX9A 3DVLA 4L27A 2D06A 2FZWA 2PGNA 4F4JA 5C1DA 5FLXA 2ZSBA 2PAAA 2PM8A 4CMJA 3DEJA 3L05A 2QZSA 1W87A 4LMPA 4NOJA 2IEAA 4R54A 1EESA 1PGPA 1Q7BA 5EWMB 3PBKA 2ONJA 1C1HA 1W5FA 1VFPA