4HVAA

Mechanistic and structural understanding of uncompetitive inhibitors of caspase-6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
247
structure length
238
Chain Sequence
b'FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Mechanistic and structural understanding of uncompetitive inhibitors of caspase-6.
pubmed doi rcsb
total genus 85
structure length 238
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hvaA00
4JJEA 3RJMA 2CNOA 1RHJA 2H4WA 3KJNA 4ZVSA 3UOAB 1RWWA 4QUJA 2H65A 2K7ZA 1RWKA 3EDQA 4JR2A 4QU8A 3KJQA 4N7JA 4EHLA 3BIJA 5I9BA 3V3KA 2CNLA 3R5JA 2H4YA 2QLFA 1RWPA 4QUGA 5IARA 4EHHA 2XZDA 2J32A 2WDPA 1KMCA 4N6GA 1CP3A 4AW9A 2J30A 5LU9A 2HBYA 4AWBA 4ZVQA 2CDRA 3R7SA 1NMEA 1RE1A 1RWOA 3NS7A 3P45A 3P4UA 3D6FA 2CJXA 5IAEA 4FXOA 2QL7A 2H48A 4IEFB 4LSZA 5LUAA 4NOJA 3S8EA 3H1PA 5IBRA 3DEIA 4DCOA 4EJFA 1QX3A 1RWVA 4ZVTA 1SC4A 4ZVUA 1RWXA 4PRYA 2DKOA 3D6MA 3D6HA 1NMQA 2H54A 4QUEA 4QUDA 4JR0A 4EHFA 3PD0A 4NBLA 4NOMA 3V6MA 2XYHA 2NN3C 3H0EA 1SHJA 2HBZA 4JJ7A 4QU9A 2FP3A 5I9TA 2CJYA 2XYPA 5IC4A 2QL9A 1RHRA 2QLJA 2C2MA 1GQFA 4M9RA 3NR2A 2QLBA 1RHQA 3OD5A 4HQ0A 1BMQA 5IAJA 4ZVPA 5LU8A 4PRZA 4FGUA 1I4EB 3EDRA 3IBFA 4EHNA 4DCPA 1RHUA 1M72A 1IBCA 4JQYA 4EHAA 4AWAA 2H5JA 2FQQA 1F9EA 4N6OA 5IASA 1NMSA 3PCXA 5IAKA 2H5IA 4NOLA 1RHKA 3SIRA 3GJSA 4NBNA 4DCJA 3H11B 2J31A 3K7EA 3R6GA 5IAGA 3DEHA 3IBCA 4QTXA 4HVAA 1PYOA 1GFWA 3E4CA 4QUAA 1JXQA 4NBKA 3R6LA 3GJTA 4QUBA 1ICEA 1K88A 4ZVRA 2H51A 3PD1A 3QNWA 3V55A 4NOKA 4FEAA 4JQZA 4ZVOA 5IABA 5JFTA 4QU0A 4N5DA 1NW9B 2C2OA 2P2CA 1QTNA 5IC6A 2C1EA 3S70A 1K86A 5IANA 1I51A 1SC1A 3R7BA 4PS0A 1F1JA 3R5KA 1SHLA 4I1RA 5IBCA 3DEJA 2HBQA 4JR1A 4FDLA 2XZTA 4IYRA 3R7NA 4EHKA 5IBPA 3V4OA 3V4LA 1CVRA 1SC3A 2Y0BA 4D3YA 2AR9A 3DEKA 3GJRA 3H11A 4QU5A 3V6LA 5K20A 4D3XA 4EHDA 1RHMA 3UO8B 1RWMA 2Y1LA 5LUBA 3SIPA 4I1PA 4JJ8A 3ITNA 4QUIA 2CNNA 2FUNB 3NKFA 4HQRA 3GJQA 4JB8A 2QL5A 5H0IA 4N7MA 4PS1A 2HBRA 1I3OA 4D3ZA 4QULA 2C2KA 2J33A 4QUHA 2C2ZA 1I4OA 4QTYA 1QDUA 1PAUA 4N6NA 2CNKA 2XYGA 3H13A 3KJFA 1RWNA
chains in the Genus database with same CATH superfamily
1ZHHA 1G18A 1VBKA 1KK2A 1R74A 4FGLA 1GIAA 2P4EA 3LBNA 1SPXA 2AMLA 4DLYA 1DJLA 1K27A 1RWKA 4KO4S 4QPNA 1QIEA 4PO1A 1CUXA 4E12A 4ESHA 4DGSA 1TM3E 1VSVA 2YV5A 3F98A 1SRQA 4JUFA 3K0KA 4R2MA 3ELWA 4LHZA 1OX6A 1JG7A 2BEVA 5FBHA 2XZLA 1R9MA 3V00A 4ZCQA 3E7FA 4D81A 4ZYUA 3AF1A 3NJ4A 1LX7A 2OILA 3OO0A 1E99A 4OV6B 5BSFA 2BFCB 4JXZA 2WJZB 3H0CA 4WFIA 1KDOA 5ISMA 1EFRA 1VSQA 5EYPA 2AJBA 1EEXB 2MSDB 4MP3A 2WF5A 3EUAA 1WXDA 3G59A 3L2OB 3G8YA 4M2LA 3BIXA 1IOLA 4KPEC 4P7KA 1HTWA 4WK0B 2HGZA 2UZIR 2R5FA 1LLFA 1LJLA 2AFIE 3AR5A 1EDEA 3ITDA 4GMDA 4KH0A 5IT0A 1I0IA 5ILGA 3GGSA 2CV0A 4RIEA 4HFRA 4DEYA 3W5BA 3DO5A 4IH9A 1RM3A 2C31A 3V8NA 3L6DA 1ZXBA 5TXGA 1JLLB 3D7MA 1I0LA 3K31A 2CLDX 2DQYA 2VA8A 3BMOB 4L74A 3O1LA 3PT5A 3G5AA 1F8XA 3OJCA 1E92A 4MUGA 4OXRA 3X44A 5EWJB 4B74A 5KPJA 3S8YA 1S3GA 1V5IA 1H2XA 1QVRA 2O2CA 4V0RA 4BO7A 4DCNA 5IAAA 4TYMA 3O93A 3JASA 1ZL2A 2WOJA 2ZU6A 3LG2A 5AJWA 2NZ8A 4NU6A 4QECA 1RS0A 3L6CA 4M1ZA 4Q15A 2N42A 2HLDA 3KP1A 4ASUD 1U8YA 1NE7A 1FBTA 5TVGA 4GPBA 5ALMA 3MWEB 4RULA 1S2GA 4Y1RA 3KE9A 4C4YA 5JY6A 1H23A 1O5OA 4YRNA 1PR0A 3MD9A 4MGKR 3GWGA 1BEUB 4I5DA 2BIFA 2GBGA 1N2XA 2RAFA 4JP8A 4PO8A 2C9OA 1KDYA 3ORHA 3QOWA 2Q5LA 3K9FC 5E6UB 3FFBA 3HCBA 5JQGA 3ED1A 2Z5GA 4TVSA 3F5SA 3QE0A 2YXEA 5EERA 1KZHA 1TKRA 2Q1TA 4G41A 3L8ZA 1CB0A 1Z7EA 4FCTA 3I34X 1BNCA 1N6RA 4OHYA 3U9LA 1YIOA 3ZVRA 1C9KA 1Z6PA 4DY6A 1QCCA 5JD5A 5ERGB 4TRMA 2DFNA 2FRXA 2WP8J 4ARIA 4NG4A 3UC9A 3CHYA 3TW8B 4LOJA 4E09A 1RXUA 1EFAA 1NUTA 2O48X 4TM8A 3D31A 3LCRA 3DG9A 2I5PO 5GM2A 1GGHA 2G7ZA 1R6XA 1SU6A 1XMPA 2Z98A 3TBFA 3D2LA 3NTUA 4G84A 2CCKA 1RYFA 3GEPA 4FFDA 4GRDA 1OUMA 4RHFA 2R65A 4FGKA 3HJHA 5CJJA 3ZBTA 1Y4UA 3COJA 3VBCA 3S8MA 1ENYA 2Q2NA 3U3KA 4FK8A 3SZGA 1O9HA 5HKBA 3DAGA 3CWQA 3RYCA 3HJGA 1YF3A 2J07A 1H9AA 3D4NA 4B3BA 3LZ6A 4OHCA 3PU6A 4LJSA 2C59A 2P5TB 1T5DX 1J2RA 1C3VA 1X94A 2GGSA 2W6ZA 2I3BA 1F4PA 1WV1A 3H5OA 4FMPA 4RKEA 3T3DA 4EKEA 4WOKA 1QVWA 2PKQP 4Y6OA 3PI6A 3I9MA 3C5HA 4CDMA 2ZDQA 2XYRA 1XJ5A 3FJOA 2UUAB 4FOTA 4G63A 2PZBA 2CXXA 3FW1A 4PX3A 5CNIA 3S2UA 3Q2IA 5AKZA 4KQ9A 4KXMA 4F04A 3CJRA 4AYTA 4G2NA 1FRFS 3HYRA 3B3JA 3IHLA 3N5CA 2QUZA 5KDLA 3AL2A 5FP0A 4BZWA 2HA4A 2OBXA 1MT3A 1QUFA 1EP1B 2C96A 3E4DA 3JALA 1RJ9A 2BOVA 1D6JA 5U4QA 1PGJA 3OIVA 2XUJA 3MC1A 4N1AA 4LF7B 4P3YA 1H9CA 1VTKA 4ALMA 1D7OA 5E8RA 2PS9A 3LL4A 3PDUA 5BV1A 1FBNA 1WPRA 3UMYA 4TTPA 1SY7A 5K8VA 2ILTA 4EOGA 2Y9PB 1KQPA 4AQDA 4IIYA 3NHSA 3ESRA 1N8KA 4UHDA 4N9WA 4BTEA 5J2TF 5JWRA 3EXHC 4AJ2A 1O6FA 1QKKA 3WLRA 3ESXA 1U3UA 2I3GA 3M4YA 2PLRA 2EJCA 5DYGA 5A5DA 3F74A 5ALQA 4JODA 3OA2A 5YASA 3G2HA 1E7WA 1L6RA 4ZYXA 1RVDA 2Z5FA 4CM9D 5A9SA 4RZUA 4X44A 1XRLA 3G5LA 5GM1A 1ZU4A 3KOYA 2JGDA 2OD7A 3LTEA 3N2LA 3HQ4O 4IHJB 4ZO4A 4BWFB 3NATA 5K45A 1T5OA 3G9QA 3BMCA 1NXWA 5CX1B 4IIUA 2OO7A 4KGXA 3RNOA 1ZSYA 1NJ8A 1OZ0A 1XBTA 3FPBA 3PUHA 4HMPA 4L3WA 1YZ3A 2I6FA 3EE6A 1GV1A 1N9GA 4I3HA 2I6QA 5IJ9B 2A88A 2OM2A 3E4CA 3R3SA 5HS6A 4MCIA 4NBKA 4YJHB 1DG9A 2PMDA 4IF6A 4BUCA 1II8B 1CD5A 2GCIA 2CL6X 5HTKA 5F78A 1CF4A 2VNSA 2EZ9A 2ZRQA 1MIOB 1CTQA 1V45E 4DLLA 5K3EA 1X38A 2FQYA 3HCDA 1TEVA 4RK4A 2P3OA 3EXFA 2Z4TA 5TGDA 3TXYA 2XCTB 4OMDA 3K0AB 4R8RA 4DLTA 2WZCA 4YDQA 4BQRA 1WBDA 1TQ4A 3IGFA 4EKIA 3UBMA 3UUWA 1G8JA 2PZLA 1ML3A 4UTZA 4WI1A 3CJQA 2P2SA 1S7CA 2O1XA 1OLSB 5CB8A 5JCJD 3NEAA 4M54A 1SVSA 1U11A 1JECA 1TYEB 1XDBA 2OV4A 3AFNA 1VI2A 2Z3WA 3CF4A 2VVTA 3QY0A 4TZTA 4B2LA 1ODJA 3HM2A 3VR2A 2CWWA 5EL0A 2X0RA 1NUQA 4F3NA 1IN7A 4PG8A 2X8BA 1DXOA 4KU4A 4ZFNA 4D26A 2FUG6 1KI1A 4ENSA 3A27A 4U7HA 3SVLA 1MN6A 4MYHA 2CJPA 3KHSA 4WKBA 4CKYA 3QEJA 3N28A 1B8NA 3I5MA 3Q0TA 1G42A 2V96A 4YGXB 1YR9A 2QJFA 2H17A 3L02A 4K6KA 1AB5A 3EVFA 4EYOA 3HB1A 2AWNA 2D1RA 2JIZA 1JXAA 3G2NA 3PR3A 4TMYA 3V32A 1C9EA 1XZHA 2AEFA 3KLBA 3BAZA 5AW5A 5TGZA 3G1UA 2H4WA 3AHJA 2WWTA 1MX1A 5JZOA 4EBFA 1N3YA 3W2EA 1AO3A 2CXOA 4JENA 3SF8B 1R1DA 1MFPA 3H7IA 4QUKA 4RTSA 1KETA 1VCOA 2VF8A 4HJRA 2C83A 4HAYA 4K28A 2XZDA 4U7DA 4BO4A 2AD1A 4IQ8A 3LX5A 1FB5A 1CQJA 2HHLA 4O0LA 3EFOB 3UMSA 1R0WA 2OGSA 3K5IA 4RZXA 4XFKA 3RW9A 2IY7A 1KFKB 3U4HA 3TTYA 4DG9A 1RNLA 1W75A 1FNNA 1TXGA 1NURA 2UVPB 3IBSA 4K26A 5E2BA 1R6VA 1P4AA 2VYVD 3IRVA 1TPZA 3OCVA 4MWGA 3HWX1 3X2EA 1QJCA 1KU6A 3VPCA 3QX9A 1Q0TA 5HIMA 4O1IA 4L2IA 4FFSA 4Q4CA 1TRKA 3SWWA 2ILVA 1WPXA 2PS3A 2RK3A 3IPAA 5BP7A 4G4SP 4P3XA 2E5WA 4TYQA 4BKUA 1N7JA 3ROPA 2C4TA 4TTVA 4EK9A 2R97A 5CDUA 4E4YA 1WHSA 2VYQA 5MF6A 3UPTA 3KS9A 5FOVA 5D1NA 4WCFB 2CD9A 4K0RA 1N8NA 2FP3A 4BFCA 5GZ3A 2LBPA 1I2BA 2V55B 1ZJJA 2R1VA 5AVYA 1OILA 4OH7A 3D6TB 1DX9A 2W37A 4RYDA 4YRGA 2C5AA 4KW7A 5AJUA 3QEAZ 4E6PA 4D9GA 4E3WA 1FUEA 3OMWA 4JYMA 3SLGA 1LDYA 1KMIY 1MT0A 1NXTA 2QN6A 1G3RA 2ZR7A 1UOPA 4Y3UA 2PGDA 3HI4A 4RIFA 2GEFA 2IUUA 4KFSA 3VJLA 4TTSA 1LV7A 4TOIA 3UPUA 3Q7SA 3UJBA 5I7WA 3R0ZA 1XZFA 4C07A 2IU4A 1L1RA 2OENG 1VYHA 2BFDB 2OXCA 1SHTX 1ONOA 2HQ1A 3IMKA 1C29B 3KXLA 4TS1A 3WMGA 3G1TA 2R7NA 1P81A 1IFXA 1WBJB 2Z08A 1RE0A 3OFSA 1VPVA 5IDVA 5JVDA 1PZEA 2PS0A 4A5OA 2CL5A 2VTDA 4CTNA 1KAEA 1UJ4A 3ESYA 4LY9A 1ZMBA 3M4XA 3CNEA 3OKPA 4BGUA 4MKHA 1I7LA 2A6PA 3OPVA 3RIXA 3WJ2A 5BR4A 5KOIA 5JI3E 2H3EA 3I01M 4K6OA 3ACDA 1BO6A 4II7A 1EVJA 1M2NA 3HKCA 3EOAI 4X8MA 3QVLA 2EJBA 4KI0A 2Y1OA 4QQNA 3MTIA 1WUYA 1WX1A 3GJXC 2QT1A 3GJ5A 4AO7A 4HRVA 4B84A 1X7HA 1JX6A 1PFVA 2CXSA 3QU2A 3TQRA 5JARA 2PL5A 1W48A 1XALA 1ORWA 2W6JA 3H9UA 4N18A 4UVEA 2H57A 1PVOA 2QQEA 3VR4H 2E4YA 2OAQ1 4AJ1A 4M6WB 1MJHA 2W4MA 3LQYA 1Z33A 2G40A 1ZR2A 4XQ9A 5EIFA 4PNEA 2BSQA 2H9IA 4EA8A 3NV9A 4PQEA 4XFDA 1F06A 1MDFA 4NXMB 4ID9A 3PRJA 4YIKA 2QEQA 4RTRA 4YJFA 1LNSA 4AL4A 5BNIA 1EXVA 5GJVC 1FFAA 4BNZA 2XWJI 4I55F 5DHAA 3OTOB 1NVKA 1GSOA 2NYAA 1Q11A 4O6VA 1NBWB 4YCDA 4RY8A 1BAPA 1ZLXA 4W5NA 2P1DA 4MYSA 2H7VA 3MN1A 2D4AA 5EYPB 1JR2A 3BTSA 1KEWA 1T0HB 4FNMA 4DIMA 2XKJE 1UBCA 1Z6XA 3KAJA 2O7QA 4OBXA 4RXTA 2YV2A 3V8BA 4URVR 4C5BA 1Y9DA 1RR6A 4BKRA 1OROA 4HYQA 1R64A 1HFJA 2H4JA 3KHUA 5B6IA 1AKQA 1L8OA 1OAKA 5DTIA 1E1LA 1V1MB 4D6PA 1QIMA 4O3MA 1YDEA 3HKBB 2HMSA 1DRVA 3L0ZA 4WDQA 1Q15A 9ATCA 1IZ7A 3R8XA 1AXRA 2I2CA 5DRYA 4BLTA 2UXBB 1JDJA 1FSPA 2DLCX 3A1SA 3IP3A 1N8SA 1J8YF 3PICA 4GM4A 4LDJA 5DIZA 3X1KA 4E5VA 4E7OA 3CTPA 3E03A 1PZXA 1ABFA 3TTXA 2QX7A 1O97D 3Q3CA 2FXIA 2R85A 3A05A 1A9OA 1TD9A 1CYDA 1CZNA 1Q17A 2VBCA 4KYTA 4ZXPA 9GPBA 4OP1A 2VEOA 1SCUA 3HGTA 5IP5A 5WRFA 4C01A 1K5PA 4B4OA 2Q1YA 3JQAA 4WZBB 4Q19A 4A03A 5L3SB 3PUYA 1GGNA 2XYHA 3HB5X 2MWMA 4LDRA 5C4MA 4UM9D 4KLNA 1JLKA 3ROTA 1T29A 4CEHA 4GLJA 2C4UA 1EFHA 1NMYA 4K9SA 3RTEA 4YV2A 5I7OA 2PZMA 1UDWA 2HF2A 1J8DA 5L9AA 1WMEA 4G5FA 4WKGA 5CJPA 3A10A 2Q07A 1JDBC 3L8FA 3OIFA 3PC8A 2ZT5A 4JI0B 1J2EA 3G5UA 3Q3IA 4FGUA 1ODCA 4GQBA 3LC7O 4OFWA 3RH0A 2Y6UA 4C04A 4R9SA 4Y30A 1XEXA 3PFWO 4EHAA 3KPYA 4RENA 2A5JA 3NT5A 1TM4E 2WHYA 3AQIA 4WA7A 5ENVA 1Q7TA 5AI8A 2ID7A 4Y8VA 2ID4A 5H80A 3H17A 1EK6A 2YICA 3ZWQA 2BY4A 4B0PA 2ODNA 3RSCA 2D59A 1QPZA 3PWKA 1KFBB 1N1GA 1YVRA 1EXNA 3R5TA 4L5IA 3UKJA 4PSVA 2V9CA 2PGXA 3U49A 4ND1A 1Z45A 1VG0B 3BB3A 2OBLA 1XTTA 1XELA 2EKBA 3ET5A 1JSCA 1SCDA 5TARA 1B74A 2B21A 2R8XA 4RA9B 5FUBA 1KH1A 2WR8A 4DPKA 4GSLA 4MS4A 2HNAA 2WU3A 1SBCA 3LC1O 4QELA 4EGFA 4QOEA 2BFBB 4R8LA 5DM1A 5EWJA 3G8AA 3ZTWA 5MN6A 3O0DA 2NO4A 1E79A 5I6DA 5IZCA 3E9ZA 4K0KB 4RK5A 2ZKIA 4UHEA 3K53A 3E22B 2H5EA 2OHFA 1IYZA 2VEDA 2XJ9A 4Q7LA 4YBZA 4DEVA 3FJYA 2ZSIA 2BGWA 4QBFA 5C51B 1G38A 1QZ3A 2OWDA 2DPLA 4OLJA 4PGMA 5DW0A 4EY4A 1RHMA 1ESZA 4Y2PA 1XMXA 1BS1A 4UFNA 1UPFA 1Y48E 2V4MA 3WL3A 4YRAA 3MYRA 1S0UA 2YQ4A 2ESRA 1C4KA 3K8OE 1ZM3A 1C41A 4R16A 3F4KA 1WDMA 2QRGA 2IYOA 2YZ2A 3RYTC 1JDSA 3AO0B 4EB0A 4EELA 5JNSA 5K8JB 4X8LA 5DMHA 4LGCA 1R88A 3BIOA 2FN8A 4E33A 2ZRFA 3OKFA 1QH8A 5A7GA 2X1LA 3KG2A 1M0WA 4MZXA 3IKJA 3O47A 5LXTF 3WP0A 5A3VA 3G2OA 4DMFA 1JYEA 2H9YA 3R9KA 3S27A 3GQBB 4TKZA 4EY6A 3KEMA 1C1DA 3FVTA 2H31A 3T3PB 1EBFA 3U4QB 4S04A 1CIPA 2JFPA 3GLFE 3RK0A 3H9QA 3WNCA 1QH9A 3LE8A 2OD9A 2FMFA 1J9ZA 1GSAA 1PJSA 3N76A 1QFJA 2GMWA 4JKOA 4Z49A 3RRJA 4YMUA 4EB3A 3VTKA 2GWHA 3HGQA 3T9CA 4D4HA 1DO0A 1DUIA 4JYPA 4E5NA 2M6SA 4H77A 3FPFA 1DUVG 3N2GB 3UEOA 1EUQA 4NDAA 3MS4A 1ZU5A 3G82C 3UAOA 2WSBA 2HJSA 3DCJA 2QD2A 2JHCA 3UAVA 1PEYA 3MFYA 1R6TA 1YGYA 4BTLA 1SU7A 2VPZA 3EGXB 4TV9F 1GA4A 3AM5A 3BMCB 5GZ6A 3UXHA 4IYJA 4I55A 4QDJA 2X8JB 4GECA 2JAOA 2PGJA 2W4QA 1OLUA 3CNOA 5IULC 2FE4A 5AW2A 1O9BA 1CUSA 1BYIA 1DOAA 1P2TA 3D9QX 1PNQA 3GPIA 2VHEA 3PNMA 4KNVA 5K0LA 5LJIA 3UMMA 4R6XA 1T9BA 4EVIA 2H1VA 2G9VA 4EY8A 1DAEA 5B30A 2R6DA 4TMKA 2VATA 5KTSA 4ZHSA 4PGHA 4HQ0A 2EYQA 1BMQA 4F4UA 3WWOA 2GM9A 2BSAA 4C0SA 1DTWB 5HX7A 1GDDA 4M8LA 3UWDA 1NMZA 3ZQ4A 5LKAA 1WDLA 2D8AA 2IPLA 4GZ5A 3ZWKA 2VJYA 16PKA 3OZAA 1N2OA 1R8JA 2JKYA 5IASA 1AB6A 1R00A 1A5ZA 3EZ6A 2BYTA 2QTLA 2FN9A 4INPA 3UJCA 3VJRA 4FYIA 4LEIA 5IC5A 1ZRSA 3ELUA 4I5EA 1U0TA 1G5RA 5F52A 3RKUA 4FX5A 4HNTA 4NCNA 3ENZA 5CT8A 1JHPA 1YUMA 3DMDA 3C98A 1HR0B 5H9WA 1RRKA 2IZ5A 5FPPA 4O63O 4UVGA 3MPOA 4FFBB 5JXJA 1GTRA 2POCA 1JH9A 5LBUA 1I94B 2RGWA 2XVAA 3ICWA 3D1JA 4MEAA 4UMDA 4Q5IA 5AM5A 4X71A 2QORA 1ZOPA 3K0CC 1MVNA 1OD6A 2C1EA 5DNVA 1R9NA 4CIYA 4C88A 1DKPA 3WLNA 1T8WA 3BA6A 5IXSA 1PT7A 3G5MA 4QDKA 4CMEC 2QXUA 3CA8A 1JA1A 1D2RA 1XXHE 2Z2ZA 4MWBA 3I2HA 3OEYA 2ASVA 2WUVA 3BRWA 4EFDA 1RACA 3A4YA 3FUUA 4RPKA 2ZT7A 2BMFA 1B1AA 4OGKA 3QPAA 2GR9A 1T2CA 3KETA 4GEKA 4C9BA 2X8WA 4Q1DA 3CVOA 4YRRA 5FWDA 4YJHA 3QHAA 1T1EA 3SIPA 3EFHA 2FP4B 4AO6A 3ZI7A 2KLHA 4HPJB 3SNHA 1UK7A 2OAGA 4UTRA 3E6AA 3RS4A 1OIWA 4EY3A 2QRLA 7MDHA 4LQLA 3LQ1A 4KC0A 1HDXA 3JQGB 3ER8A 3UAWA 4N6NA 2CNKA 5HQTA 3C3XA 5LBTA 2Q0XA 4PBRA 1ABBA 2H2GA 3IVXA 1SKMA 1OH7A 2E6KA 2XGMA 1WW2A 3UCEA 3DTVD 1RC8A 2R751 1OA1A 2HF9A 2YFYA 1CDEA 1QJ4A 4BQEA 4OXXA 4IRUB 3VSDA 3K09C 4IOKA 1FZQA 3HV0A 4AG5A 4FJ2A 3UB2A 3B20A 4CM8A 3HDVA 1ISPA 2KPOA 2WTUA 4JI7B 5PGMA 3H05A 1M6EX 4Z4EA 1IH8A 4GBED 4DR1B 4P7JA 1H6CA 2X0IA 2AMFA 3C6KA 4IBOA 4OI4A 4PYLA 1LB1B 4LF8B 1C9MA 2WIFA 3WWYA 4LZPA 2I7CA 3C6XA 4EPWA 1A7KA 4HB0A 4HH0A 1U63A 3ZLBA 2LCFA 1P3JA 2WP0A 2P9JA 4Q3AA 4UAVA 3P4UA 2FLKA 1BGVA 1F6DA 1EK0A 3DLBA 4YQFA 2Q5CA 1E9FA 1L5MA 2HV9A 2B37A 4LJ5A 4UUNA 1RWVA 2JB9A 4K2HA 5BWNA 3LFTA 1VSBA 2AZTA 3FWNA 2PUTA 3UVEA 3O83A 5E1BA 5T7BA 4XVHA 5EJ9A 5KSPA 1OY1A 3I1JA 5DFAA 1C1HA 1USKA 3VR6A 3H3JA 1ULAA 2XYPA 5KYVA 1TB4A 5C2JB 1FFWA 4P82A 3HFSA 3KKPA 2JI6A 3A11A 3H1EA 1AK9A 3LY9A 2Y77A 1QO9A 2CLHB 2WTNA 3N7AA 3OWXA 4EY7A 3WGIA 3T5PA 1NP3A 3NRBA 4BEVA 2P6NA 4FHCA 5H7XA 4DWOA 3JYLA 2ZSAA 5LMCA 1E9RA 1ZKDA 4B3DA 3AOEC 2YVQA 1N2BA 1Z28A 3VX3A 1J0XO 2JLQA 3AL3A 3ZWCA 3I73A 3OCWA 1UEXC 1V9LA 3R2JA 1T9AA 4LHEA 4EMUA 1D2EA 4E21A 3LPLA 3KYIB 4YRLA 3PITA 4AS1A 4AJIA 4B33A 1VHQA 4MUYA 1QZXA 2Q99A 4R1LA 4OQEA 1UKYA 2BD0A 2EHJA 4KZPA 2GVZC 2VZ9A 1JPUA 4JXJA 3VVLA 2P6UA 2IUEA 2V7VA 2WWFA 2YWRA 3BYZA 3WNBA 2VP2A 1GLGA 4Q0MA 3RIMA 2DZDA 1XMVA 1YA4A 5J63A 4HR7A 4DPLA 1BA2A 5F5LA 3HH8A 4V1CA 4EENA 3IEPA 2D7JA 2PVPA 3E9YA 4P6VF 3RHTA 4JLOA 1QKIA 2ZE6A 5EE0A 2NT3A 4NK5A 5D5HA 1G7RA 3LUPA 4H35A 4LIPD 1E2JA 3HUFA 4MDYA 3ISJA 3WNQA 1SM4A 1GQQA 1F60A 1TMYA 2JHPA 1XZJA 2GXQA 4JUDX 2VDJA 4M60A 2ZWMA 1GAWA 3P2MA 4O4IA 4Y2TA 5IVKA 1D1PA 5CB4F 1UZUA 1HY3A 3AR9A 5AK6A 3U31A 4IIGA 1A72A 1JQ3A 1MTOA 1YJQA 3R7AA 4KO8A 3CZMA 1ZS9A 2HPAA 3GT4A 3MELA 5CDSA 3Q0IA 1GQRA 3U56A 1L4UA 4KE9A 5E6RA 1A88A 5M5BA 5BXYA 2WSSA 3AXSA 3Q5DA 2ATXA 1O4VA 2IZ0A 1C4WA 2GHRA 2DRIA 1KJWA 2AEEA 1I4OA 2YVLA 2ZVPX 3COZA 3GG2A 3OETA 1QDUA 3EAFA 3TB4A 2HTFA 1PYDA 5JNLA 3A3KA 2JD1A 3OPXA 1CJUC 5ICMA 2A9RA 3D5EA 2ZROA 2J5KA 3IOEA 5B4TA 2V03A 3I2JA 1NUHA 1IM5A 3O03A 3STVA 2QBYA 1Y3FE 3NBKA 3MTDA 1NDHA 4LHVA 3K30A 1T35A 5SZKB 2QR3A 1D8AA 3FYDA 1WL8A 4V0MA 4CMGA 2RGGA 3P9ZA 4UZFA 1O5IA 2ZR8A 3HVKA 1O9GA 3RWMB 3VH3A 5TMPA 4MGHA 2IKSA 3H5NA 2H1CA 4ENUA 5GWXA 1RZRD 3CG0A 5LC1A 3M4NA 4H9GA 3AP1A 4N0MA 2PFSA 4BO8A 4YJFB 3CLSD 5L3QB 4MQMA 3DHVA 4NFYA 4F5YA 4HFJA 5FA5A 3GJ0A 1VA4A 2B2CA 1I6WA 2FSVA 2JIDA 1Z5OA 1P72A 1V47A 3WFIA 4FFOA 4NU5A 4Z7NB 4NOJA 4LXTA 5A02A 2AW5A 4UHBA 1ZCFA 2L69A 1BD3A 1WUTA 1KVTA 3Q3HA 1PFWA 4FEYA 4KQWA 4RF2A 5F51A 1V41E 1CKEA 2X0KA 3TJRA 4AJPA 4DB2A 2PUHA 2O5VA 2DULA 2XDAA 4JJ7A 2HJVA 2QL6A 2VLBA 4WW0A 3RBAA 3M1AA 4DKJA 3BGIA 3JQ7B 1DC5A 3PQDA 1CRZA 4AX8A 3FWZA 4IH1A 3ZX4A 4OMCA 4ZMRA 4CV0A 3A2MA 2XITA 1KORA 3V4VB 1KK1A 1UXKA 2F1RA 3FZNA 4MRNA 3CX4A 5FPYA 1GGVA 2C9CA 2D62A 2KX7A 3DE1X 2X22A 2IHUA 1ECFA 4Y6RA 3H75A 1QAOA 3D6VA 2MIIA 4RPCA 2KYRA 5CU7A 1AUQA 3NAMA 2ES4A 1RHKA 1ENZA 4CL0A 1XF1A 5FLKA 3IR5A 2NVBA 3FSRA 4XWYA 1SCQA 2PX3A 3O8OB 1OI3A 4BGEA 1Y5MA 3VZSA 3AEQA 1S4QA 1JXQA 1UC9A 2G7MC 2XB9A 4NMXB 4FE4A 3BZUA 2PXHA 2ZRDA 4HAZA 3V8RA 1E1CA 2FETA 3LBIA 2I3DA 3FYSA 3M5PA 1POXA 4RFSB 4BJ1A 4EABA 4C20A 2D1QA 5IKPA 1EXWA 1FOEB 4B7XA 1Q84A 5D84A 4G0QA 4EUEA 1AMUA 5JS2A 1U2GC 1NW9B 3CSDA 4CT0A 3BXGA 2IGTA 2ORIA 2BRUC 3DKPA 3H1AA 4KJZA 1U7UA 3AMVA 4MLDA 1M5UA 3TRIA 5KBYA 1DCMA 4AKHA 8OHMA 4B87A 4BGIA 2PLNA 1T3LA 2R00A 2ZE5A 5DW3A 4X3CA 3ST7A 1O95D 2JJQA 1GRRA 1ZJ6A 1UQUA 2ZTVA 3FLEA 4U2KA 1TA9A 2F1OA 5EKXA 5LVAA 3IIEA 4G0XA 3CCCA 2OZPA 4Q9JA 3V6LA 4QREA 3GUCA 1YZLA 3INYA 4I50A 1EMDA 1RKUA 3P0EA 2P5YA 3TZLA 1MA3A 5JH7A 3HXOA 1LTHR 3CKMA 3I0MA 4LXXA 1AQNA 1QPGA 2C8LA 3KXPA 4RC9A 5KVCA 2ONKA 4PHFA 2GLXA 4DPMA 3AJAA 1TDJA 2UUOA 2IVZA 3HWRA 3PQ5A 2EJUA 2IXEA 3Q7EA 1UJ6A 1SUSA 2P27A 3G49A 4EQ6A 5HIAA 3U19A 3MUFA 3QXSA 1Z29A 4M8NE 4WY8A 3S68A 2BTQB 4O1MA 1WXIA 1KH3A 1WQ1R 2WB4A 1L8QA 4UD6A 4M21A 5AVRA 3A04A 1LFDB 4GZ6A 3QI2A 4JI2B 1RM0A 4MR8A 4FNAA 1TF7A 4DBLE 2RHJA 3E3AA 4I4CA 4GPD1 5HK9A 1P2UA 2ZS8A 2OFWA 3U16A 4F3KA 1L1FA 1JQDA 3FRIA 1CCWA 3QUCA 3MS2A 3CIFA 3WLHA 3WLEA 1PX0A 1PF7E 5BWCA 5EIXA 3HVUA 2IH4A 1XCOA 5D00A 1UBSB 3OQMA 2ZJ1A 3VSCA 2E37A 3BOSA 2OO3A 4P5EA 5D6OA 4K6CA 2KLBA 3HPRA 1AH2A 4BRSA 2GCPA 4LDAA 4AY5A 3OOJA 1G21A 1WXFA 2VTVA 2Y2UA 1SK9A 4GOMD 4ZRNA 3EXHA 3GQBA 4EJFA 2D8MA 1PV4A 3QYJA 1Q16A 3V2IA 4WZZA 1M1NA 4DLZA 4XA8A 1DBVO 1PJ3A 3TLGA 3U7GA 1GO2A 4OQZA 5FR2A 4B4VA 4ZOLB 2NG1A 1KMNA 4FPXA 1UBLS 2GKOA 4AF8A 1MO3A 1W5SA 2XWQA 4ZREA 4YMTA 4I9GA 4UEOA 4PFKA 2OWEA 1MW8X 2F8TA 2YN2A 1I0ZA 2EIXA 5BT8A 1Q0ZA 1BMDA 3QLJA 3B8HA 2AMYA 1J49A 4OHPA 2JH9A 3BJRA 1VL1A 2PIAA 2QLBA 4KQHA 2RGBA 1EZ1A 3RM3A 1BC5A 2AN1A 4AY4A 5IF3A 1YDHA 2RDMA 3G0DA 4MS1B 1CNFA 1W96A 3KJIA 3U61B 2IWHA 5CHYA 1AXEA 3KZXA 2I2XB 1NGSA 3CE9A 1BYUA 3ZGXA 3QM1A 3GZ4A 4DIUA 1NMXA 3PXEA 2B69A 3FB4A 1CEQA 3UAXA 1Z5PA 2AYYA 4NCKA 2IXDA 4GX2A 3MCAA 3WLPA 3I30X 4DA6A 4LGMA 1N7HA 1OLUB 4FDTA 4JB0A 5K8TA 3LDGA 2IELA 5LZ8A 4FLEA 3T3OA 4UM7A 1DXHA 1O96A 4UAUA 1LS1A 1QIJA 3B6JA 3JYHA 4P4GA 5AM1A 2BM9A 1XP5A 3QQ5A 4R8VA 5EFOA 4OQQA 2JLCA 4RUKA 2EKLA 2GJ4A 3COPA 3TINA 5HIKA 4FFVA 4FZVA 1FRNA 3DE7X 3DR3A 3G68A 4NOKA 1OAOC 4TXJA 2Q9CA 4QPZA 4DMKA 1G5QA 3WGYA 1IZ9A 1GYPA 1XTKA 1UEIA 1V9CA 3G2JA 3DLTA 1IHPA 3LW7A 4I1OA 2G4CA 2E82A 2RI1A 3RAFC 2NAFA 3V7YA 3WB2A 5J47A 4Q9HA 2EEZA 5CPFA 3UJ3X 3ZYCA 5LWHA 3V34A 5KNBA 2R11A 1KHHA 1CVRA 4D3YA 1L2TA 2VSNA 4AI6A 2QUHA 4JBGA 1CW2B 3L6OO 2Z83A 2BMWA 2QX4A 3HG7A 4FC7A 4M9ZA 1ZZEA 3DMHA 5C81A 3CUSA 4G56A 4PAOA 2OHJA 3KDAA 4JU9A 2POQX 4L5JA 5H68A 1I7DA 3FMFA 2HD4A 3P7MA 4AZ0B 2VP0A 1Z6YA 3GROA 4XPZA 2FN3A 5BWBA 3VYWA 2UYQA 4EARA 4PLPA 1UP6A 5EKDA 3H18A 3MGKA 3MM4A 1A4RA 3ZZ0A 3A25A 4H1HA 5TGTA 3STWA 3AF4A 3LC2O 4JI8B 1P6QA 2H2AA 1SVIA 2HQSA 2ZT6A 2NTNA 3AF2A 5HF5A 5B7NA 2HA2A 2JHAA 4B3TB 2F90A 1VGQA 4B3FX 2VH1A 3KZCA 3VDQA 3OF5A 4OGFA 4IINA 3FG9A 4AXXA 6REQB 1NY6A 4KOAA 1RJWA 2I2AA 4MYRA 2HCRA 3UKOA 4N6GA 4ZAFA 1N1MA 3C6YA 5DHPA 3AILA 2I4MA 1Y8ZA 2DWQA 3C3KA 5BY2A 3PNKA 4ND5A 3WFJA 3JZFA 2G6BA 5EP4A 4ZQCB 2QG9A 4MV9A 3L5OA 1KP9A 1DAIA 3BRSA 5J4HA 5K99A 3GAAA 1TA4A 2I71A 2VUIB 7REQB 3FPSA 1EAYA 3BXXA 1XCPA 2ZITA 2ZUFA 1BX1A 3FWHA 3BMXA 3CLRC 2PRIA 1BHQ1 1SPBS 1SZDA 2VAXA 2C03A 2JIRA 3HB7A 3IS3A 2IHBA 3MGGA 4QUEA 2PNJA 4Y0AA 4NOMA 1O8CA 2HSGA 2GXUA 4YJ3A 3JRNA 2HBZA 1PJCA 4AFNA 4OHBA 1DINA 1JTVA 3IPCA 3OAAD 4EHBA 1U1GA 3DV0A 1B3RA 2FPWA 3EGDB 3WOHA 3A9UA 2OUIA 3C3MA 3O9VA 1YQ9A 5K3OA 4YTEA 4KWTA 5LU8A 1FTQA 3WDSA 3A2KA 1OJLA 2GF0A 1FE8A 3NGLA 5CPBA 5J4LA 1BCSB 5HBRA 4EHNA 3HJFA 3MTQA 5DGHA 4KDEA 1RHUA 721PA 4FSXA 4ZAYA 4DSAA 2DFDA 3MWGA 2YBDA 1U2DC 2FFHA 2H0QA 2YFKA 1BRTA 4P86A 3ANNA 1NW5A 2X5XA 3D0QA 1E2GA 3VR6H 4R84A 4NLLA 3MD0A 1EVEA 1VGRA 3TWOA 1R5OA 4EVQA 1T8TA 5FTNA 1K06A 1CR4A 1FY2A 4LZNA 3QXGA 2Y1DA 4N82A 4MUAA 4PLHA 1ODTC 3R41A 5K3FB 3ZDZB 1WDKA 2IOHA 2WQ7A 1VL6A 3UWOA 1Z0SA 1EJ2A 1EWRA 5KNDD 1JYSA 4E30A 3D59A 3C70A 1B1CA 1DDOA 3B3FA 2ZIFA 1UAGA 1BKYA 3DOIA 3E8SA 4N3AA 4YYEA 5BV0A 2J67A 3ZHOA 3N59A 2VHWA 5AKKA 5JSZB 2WWWA 3L9WA 5G0SA 4QGFA 4ARUA 3TGPA 4OD0A 1C7QA 3FHTA 4K6GA 1WNTA 1MQ8B 4LZLA 1G8AA 4JVLA 4PSUA 2XZOA 1IQ0A 1W0CA 3MFQA 1JB9A 3L79A 3NZEA 3ZIDA 1K92A 3V7WA 1K3FA 4RVSA 2PIDA 3SICE 1N4AA 1LW7A 2IEAA 4ILKA 2QAGB 5FUWA 4E0BA 4R9NA 2R60A 1FFEA 2J7PA 3INNA 3X1ZA 2WINI 1AA6A 5MFZA 1WUJS 3D1VA 1SUDA 2REQB 4H2DA 2XUFA 3EVEA 5TS2A 3OOEA 4F3RA 4D82A 4RLSA 1SCBA 1TUEA 4NS1A 3F6BX 4ZI5A 3ROXA 1XN4A 4KXUA 1RWOA 1DQRA 2I9PA 3AETB 1KYIA 1SUAA 4BXOB 1MO4A 4KQFA 2ZR9A 4O4HB 1I5EA 4P83A 2VQSA 2BUAA 3GRAA 3R5XA 3QG1A 5ALOA 2FHPA 1AS0A 2FWMX 3M4ZA 3DT6A 3Q6MA 1YFZA 1SC6A 4CCYB 3OLVA 3B2NA 4LZAA 1PV2A 1G9TA 3KTAB 4MCHA 2N1MA 2V7QD 4K9OA 2WYVA 4WECA 5AMXA 1NDQA 2FFBA 3OE5A 1GXSA 3L4BC 3D6JA 1N2JA 2A92A 1BMTA 3DE2X 3H16A 3IXLA 4AX4A 3AG6A 4E5YA 4HZUB 1YQXA 2Q45A 1GRNA 2QRZA 2VS1A 2ZZKA 1DI0A 4PTLA 5FL7D 2B5WA 4RHYA 3WWEA 3FHLA 2B6NA 3FOEC 3T52A 1NBHA 1Y82A 2NUPB 4MPTA 3DNPA 3WXMA 5KTNA 3ZHZA 3LD9A 2EQ5A 1B8VA 4J49A 1GRVA 3NGXA 2QLTA 4MJLA 3D0KA 1ZK2A 1FYDA 3NC0C 1AKTA 3E0QA 5BNWA 3FOBA 4R31A 4UPEA 4UBKA 2QJOA 5I47A 4C0WA 5EGNA 4C4OA 5DWQA 4V24A 1G16A 2O2YA 4EX6A 4FOLA 2P35A 3B13B 4BX2A 4WEOA 1D2CA 3GT3A 3AB8A 2C3YA 4YCCA 5BSVA 4MCJA 2BFFA 1ZNYA 3MXOA 3R7WA 4HNGA 4PSDA 1WPQA 4JDPA 4HDMB 3ZE6A 1M72A 2V7EA 5IZCC 1QHNA 2BHTA 3BBLA 4WA8A 3ZIUA 4QFBA 3HTXA 4ER0A 2DWCA 2O2EA 3ZDBA 5F1KA 5F3RA 1CR6A 1KK3A 1GM5A 4LJYA 1US8B 3WBFA 3ASYA 5FOTA 1GGKA 1HURA 1QS0B 4LXIA 3FB1A 2P9YA 3MWLA 3VM6A 4D8TA 1YQEA 2HIMA 2VPTA 4Z2AA 2OZLB 1POWA 3OUZA 4ZHQF 2FG5A 3ZDFA 2KS6A 1DWUA 3QBEA 1M2HA 1WPGA 2JCSA 3UM9A 2JJMA 4YT2A 4WXEA 4BFWA 4Z5XA 2R87A 3HL4A 5DE3A 1FNDA 1AS2A 2ASEA 4J6EA 1V8FA 5F1YA 5IM4F 4LX0A 3VO9A 1QV6A 2XT6A 4J16A 2I78A 3SPXA 2WI8A 3ZY2A 1GT91 5KYXB 4QPPA 3GT0A 3A1UA 5ED0A 1JT9A 3L0DA 1D6NA 2O8CB 1MOQA 3ILXA 1Z4LA 1NXOA 2QUBA 1R8YA 1P7ZA 2AR9A 3ZVNA 3GP3A 4Q4JB 3LDAA 3DEKA 1XROA 1X1DA 1T4CA 1JLHA 4X63A 4QM6A 1RZVA 1NJ2A 3ASUA 2O3RA 3TZHA 3HZOA 5CLIA 3TLEA 2WF7A 1Z4PX 3PIIA 1LA2A 4AF7A 1HORA 1OGIA 1OBFO 2GM3A 1GKLA 3GEEA 3DE3X 4LOKA 4WMLA 5SY4A 3T95A 5C35A 3WZMA 1SVUA 3PJFA 4G8CA 3KT6A 5BOVA 4AWXA 1PQYA 2JFXA 4FFWA 2BKEA 3DV9A 3KWMA 2VJLA 1XA0A 2CV1A 5FPHA 3ABIA 1TYZA 4YUWA 2QVGA 1H2BA 4M99A 2ZJBA 3CRRA 2FZEA 2XRFA 3SXUA 3RT1A 1L5WA 4GFDA 3U0VA 1VCNA 4D43A 1Z16A 2CWDA 2CBXA 2YFQA 3LLCA 4O33A 1TCAA 4RVHA 1Y3HA 1NPTO 2PGNA 2XQIA 4WT7A 5ECWA 1ZNWA 3VUEA 5KUTA 1OYVA 4N0DA 4US2R 5IRCD 1GAJA 4JVMA 4ZTBA 4HNVA 4C1BA 3DZHA 3GNTA 4P36A 4TRNA 3IBYA 4B34A 3EFBA 5ILQA 1PJRA 2G9UA 2QTRA 1XQXA 3G8BA 3N2KB 4ZYLA 4X62B 4PR3A 1HGXA 5I5GA 3ETDA 1T24A 1X3LA 4L0CA 4EX7A 1BXZA 2X5NA 2YIDA 3CISA 3SJ7A 2VI5A 5LUAA 5J3JA 1PEKE 2VKQA 5B2ZA 1GGEA 4C6HA 1VIAA 1YCFA 4ZU6X 5AXCA 4BNDB 3DXXA 4DARA 4RF4A 2B35A 3NV7A 3RROA 4B44A 4D41A 1CU1A 1P3DA 1A97A 5GONA 5H5JA 2PE5A 2GI4A 3K8YA 3SYKA 3FJ1A 1XVIA 4ZT2A 1NNI1 2CB9A 4WJZA 3DKVA 2O0LA 5CCEA 1O96B 3HDGA 2OP0A 1UWVA 2Q28A 4MMZB 4PRKA 4QGAA 2GEVA 3EEIA 4M76B 1CY1A 3PX2A 1YS2X 4HZGA 1EP2B 3SK0A 5B4VA 3H6KA 4CR8A 4HHEA 4CRWB 5C5IA 1BG6A 2GHQA 4N9QA 1Z06A 4MTLA 3L05A 4B71A 3PA6A 3M6IA 1C7FA 3L1UA 5CT4A 5DXAA 5I4CA 4DDTA 4ZRDA 2NO1A 1IQRA 3T5DA 3ABQB 1O2DA 2O4CA 5L95A 2J9FB 4YJ2A 1GG5A 3T41A 4YJKA 2BGJA 4XOUA 1M1NB 5AR1A 1ADFA 1TUBB 4RE6A 2ATIA 4ZDIA 4Z4HA 1P2DA 2A5LA 4HF7A 1DGQA 1EK2A 4I7EA 5TX7A 1KEKA 4EI8A 4EM6A 3K4QA 1P17A 2ZI5A 3DWEX 3JU3A 1OCEA 3JAMA 4OIFA 2QNBA 1FP7A 3SQDA 5LLDA 4RE5A 1GPMA 2WV7A 3MRTA 2LPMA 2ZI3A 3A1NA 1Z74A 1TKAA 1G98A 1JLMA 1A8UA 4CF4A 2CXHA 1AUOA 1FDVA 2QR5A 2A0XA 2XE6A 2WAOA 1CETA 1GPLA 3CC8A 2JNWA 3SBEA 4EHIA 1PT5A 4ZVOA 5BWOA 2CSXA 2ZU0C 1CX9B 4GG1A 1QO7A 1HLDA 2XE8A 3EZ9A 3PP8A 3V4RA 1QC5A 3BTVA 2J8ZA 3B38A 1T2FA 2AH5A 3HO6A 4BBZA 5AQ1A 1QF6A 1XMIA 1WLYA 5IBPA 3KOOA 2WIAA 3WYAA 2FKAA 4Q66C 2V5UA 2FEPA 2GZDA 2X0FA 3RFTA 4DIFA 3K0EA 3JWEA 3OFNA 1UOEA 3PKIA 4GKBA 3QPDA 3Q2OA 4Y2UA 1WCV1 3RHZA 4KIUA 2PFGA 2WAAA 3DPIA 4B48A 5JS8A 5JZSA 3DAFA 5BSMA 1SIWA 5LWQA 2CV2A 2X14A 3LV8A 1TGVA 3G8DA 3AB3A 4MUKA 2P9CA 2JVIA 4GLBA 2I4RA 3GJQA 3WYCA 3KDSE 4GAEA 3QVWA 3T1VA 2WJPA 1P0IA 5K3DA 3B9RA 2PL3A 1IUKA 5AI9A 3KUCA 1GR1A 1TU0A 1EFUA 2OG2A 4LYGA 3HBJA 2CXUA 2VDWA 1X2EA 2IL1A 2P11A 1JQAA 1YUBA 2E1RA 4FVTA 4ZAGA 5IKOA 4RDXA 5GIOE 2ETVA 3M3PA 3O1IC 3L06A 4Q1CA 4YRZA 1W93A 2ZWAA 1RHJA 1U0LA 3RVOA 5H59A 1GVHA 1RCTE 3EVCA 1RAGA 2DECA 5FADA 2Y68A 1W35A 2EYUA 4UDOA 4V0KA 5J23A 4YN3A 4KR2A 1Z0ZA 1ZJYA 2KMLA 2Y1CA 2OAEA 2AF4C 3FOAA 3NRCA 3OIUA 2NIPA 5DX0A 3W78A 4G0OA 2J32A 4DJ5X 1FP6A 1HNWB 3IQHX 2BDTA 3P9NA 4ND6A 2GM5A 2NOAA 4KNWA 1PNTA 3R9XA 2G08A 2X6RA 5DLDA 4DJEC 3OPYI 3PGKA 4G1EB 4F6LA 2Y6VA 5LBIA 3FTQA 2P75A 3H87A 2YWXA 4M9SA 2E87A 1RXVA 1JJ7A 4EI9A 1NI5A 1RE1A 3TQFA 4RIGA 4L4XA 1DEXA 4HH3C 4TWIA 2QV0A 1SUFA 3N7TA 4LE0A 5IUNC 3V33A 2XMCA 4JOSA 1CUDA 1YULA 3B9BA 4KIGA 4R1TA 2VXBA 4ZOLF 1FSGA 3QNUA 3P2IA 2HM7A 1Q50A 4PCUA 2G9ZA 4FBGA 2HMYB 2GCOA 2IU6A 3TQIA 3U44B 4ZICA 4KSCA 3U7EB 4DCUA 1B6RA 3PC2A 4B3HA 3P0HA 1ZMOA 1GUAA 3QTTA 4FLFA 1JJAA 2GZ3A 3DPSA 3WB0A 2D2EA 5CG2A 4KHPB 3LRTA 3F4LA 4FHZA 2FDRA 1JEDA 2BEWB 3KWJA 4G0NA 4HNQA 4I6EA 4C7MA 4MVJG 3HO1A 2YHIB 2HU8A 3N74A 1IZ8A 4IEEA 5F1OA 4Z9YA 4JLUA 1LVUA 3I4CA 4TS9A 1E20A 2FPOA 1SBZA 3L7BA 2YZ7A 4AYWA 3STXA 1A50B 4B2YA 1OT5A 3L0OA 5JQWA 1WB5A 2E5FA 3EDRA 5G3ZA 2FA9A 1W73A 3DE6X 3DP9A 3IBFA 5J9FA 3OJXA 5K2MA 1XAIA 1Z83A 1DZIA 2QRNA 2X4LA 4KN9S 5C3UA 3P5BA 4ER3A 1J1IA 2MINB 3FM9A 3TLXA 1VJDA 2JHGA 4G07A 1FRQA 3D7NA 1QYWA 2J08A 5LCXA 2W2NA 3BRWD 4PM4A 3WIDA 4ZO8A 1Y81A 2K2WA 4CM4A 3IP1A 2XVXA 3L8CA 1CQIA 1Z7GA 3NHJA 4RPHA 1XK7A 4RGBA 3JR7A 4QUBA 1CFJA 3U7FB 1NQ5A 2QAGA 4AO8A 4I6JA 4BVFA 1SBTA 5B7PA 3RARA 5TS3A 2CN1A 1G19A 3NW9A 4HEQA 3QF4A 1PK7A 2C98A 3C5VA 2Z8YA 3K9HA 1LPPA 4HB4A 1YJXA 4Q4AB 4TMXA 4W5WA 3IEKA 4ZI7B 3F2VA 3JX9A 4HL6A 4CDNA 5LM3A 2XSZA 4PONA 2A1UA 3DVLA 1F1JA 1RAHA 1TCBA 1TK3A 4K9LA 4OJKA 5CDGA 2LV8A 3GGDA 1FUYB 1SCJA 2FFJA 3L49A 3CVWA 3SAJA 4MIEA 2AI3A 5U9CA 4EEXA 1L4MA 3HWSA 1ZAKA 4QU5A 5JYBA 3DFZA 1TL7C 2RBEA 3K2BA 1YVUA 3RV3A 4C0BA 1GZVA 1U7DA 4MKFA 3ZXIA 2CFRA 3C43A 2CMFA 5EHGA 1FPMA 3FZQA 3MILA 4CEJB 5D6NA 3X1XA 4XH9B 1GQOA 5HUQA 3FKQA 3MUEA 3FNIA 3MWKA 4UUQA 2GEKA 4XW2A 1HE3A 3JPYA 1UDAA 4MPRA 2ROQA 1BU8A 3VYTB 3VR3A 1COWD 4QKQA 3CVVA 3ZDAA 2HDWA 3OQBA 3T1YB 3HFRA 5I01A 4LPKA 3IFSA 3PR2B 1OFUA 3QVUA 4KPFC 1BS9A 3GBVA 4LJLA 4ZC8A 3GNLA 1E79D 1W5BA 4M1YA 1XLWA 4XUDA 5IEBA 3RSFA 4E14A 2QBYB 2ZFUA 3DQPA 3ETGA 1KYTA 4ZCSA 4IAOA 3FSJX 3LZDA 4C3ZA 2AXQA 1IXRC 4BRWA 4EW3A 1TAQA 3AONB 3ADCA 3IUPA 3P2YA 3ETJA 3QEMB 4E5SA 2CCGA 1EBUA 2BEVB 2EVWX 2C77A 4QYMA 1SQFA 4OBEA 5EIAA 1YIDA 3GVXA 4D4GA 3HXKA 1U0FA 4WZAE 2XODA 4DJJA 3K0HA 1TTTA 2IPNA 2I8CA 3OOHA 2AOVA 5HGJA 4RLHA 4L08A 5EWLA 4AJEA 4BVEA 3I9KA 5AW9A 1M2KA 4ZYYA 2QL7A 2PR2A 1I3LA 4HI0E 3MT8A 5CW2A 2BWJA 4JYCA 3MQFA 1WVMA 2QZSA 4QO8A 1EGQA 1OX4B 1E61A 2WC1A 3NTOA 1A5SB 2ZI9A 2O59A 3PD0A 4NBLA 2QSYA 4X61A 4BMPB 3VDRA 1A5AB 5K8LA 5JTUA 4YV0A 4C0JA 1DWOA 4TXMA 5DBEX 5EIWA 3F78A 3AOEA 1JWBB 1KJNA 5M2QA 5HF6A 1SVLA 2OUKA 1I2AA 2O2JA 3AR3A 4AURA 3BMOA 3JZAA 3LUBA 3RHSA 2X86A 1ULUA 2VJAA 3I05A 2AFHA 4GBJA 5ARDA 2WUFA 2QAGC 5FPQA 4ZCPA 2XNHA 1UL1X 4FIZA 5K0GA 2VWPA 2NO5A 2WNSA 3L92A 3N3BC 5H8WA 1YA8A 1VB5A 4PX9A 4UVDA 2QMEA 4RS4A 1JPJA 4KI7A 2KQUA 5TE9A 5BUQA 1V1JA 4QSHA 4D56A 1I80A 1PFQA 3OZTA 3O95A 4LRSB 4Y1RB 5C5DA 3TG8A 3DNFA 1JKMA 4EHJA 5CLFA 3HL0A 3KSRA 4PYOA 3PDWA 1H0SA 1U2SA 1DE0A 1QFYA 2AHRA 2F48A 3EWIA 4PLWA 4MTCA 5I8PA 5JW6A 3O4IA 2O5EA 2WWRA 1EFVB 3C4QA 4RL4A 1XJWA 4GR4A 3R8CA 5DIFA 3PX3A 3TLKA 3CH7A 3K73O 4B4KA 1CF2O 4B7ZA 2ODEA 1UC8A 4IDOA 4CIWA 3ZGZA 4MROA 4RSHA 1J06A 3PPYA 4PZUA 1JS1X 1RRVA 3QUQA 5DLPA 1SURA 2H2HA 2IHKA 1M1ZA 2WKSA 3FTCA 3ZV6A 4DADA 5JH7F 2PMBA 3UT6A 1MAAA 3V4OA 5KSYA 4GDMA 8ABPA 3CKKA 3ZQ6A 2XB4A 4V0QA 2M6RA 5CH5A 2YYAA 2EHDA 1JKXA 1R9JA 2R2AA 3RVRA 2Q6LA 1S2DA 1ZRNA 3GI1A 3H42B 3KPJA 3PQ2A 4I8DA 1HYQA 3GFOA 4G24A 4RGQA 4DM3A 4ZZ3A 2FUEA 4ZN6A 3S6JA 2PA3A 3WMXA 4AIRA 3UJNA 2Z43A 4DRXB 2XZPA 4XM0A 3M1LA 3JAKA 4YDRA 3VKVA 4E5DA 3VKGA 1KGSA 1YGPA 2O8DA 1YE5A 1BCRA 2BJVA 4R9UC 4CM3A 3O4VA 4Z1MD 3OU2A 4LV5B 1G8PA 1Q57A 1RCFA 3R23A 1TTHA 1WAMA 1QNFA 4LDQA 4M38A 3PC4A 4BRUA 1U1CA 4BWGA 1GAXA 2J09A 3LXRA 1EQ2A 1UM9A 1ND6A 2RH9B 4FR2A 1Q74A 4LNAA 1C30A 2VDMB 2JRLA 4HWTA 4MV5A 3FF1A 1NRWA 1R0ZA 4IZOA 5LB4A 3VHXB 6NULA 1UMDB 3SD7A 1WQ4A 2P91A 4M98A 5EXDA 4ODIA 5LKRA 3ZIAD 1ODFA 2H65A 1KZ4A 3NBUA 4HJXA 2C2WA 2Z3ZA 3H65A 5ALUA 3ADOA 5I9BA 3OG9A 1SA0B 1PL6A 3DL4A 3FDXA 4EHHA 3H83A 4PIMA 5KNCD 1W4BA 5DM4A 3U6BA 1TIBA 3NTXA 1T6ZA 3RB8A 5JD3A 1TAHA 5CB4B 5KYWA 1A8PA 1MABA 5SYNA 3VO2A 4O02B 1RQRA 1OTHA 2HF7A 2XMBA 3E1KA 5DWVA 6YASA 3UHOA 4QM7A 1N33B 1URPA 1IHUA 2GS9A 4M37A 4PG5A 4WKPA 4H6VA 5AVVA 5D86A 1YWGO 3K92A 1IEQA 1V6CA 2GSWA 5L6MB 2R00C 3GB9A 2UVDA 3D64A 1U3TA 3ES9A 2W2PA 3TGWA 5B3KA 5AOBA 2MYNA 2FSVC 1TUBA 1Z36A 2DKOA 2GZAA 2I67A 1YZKA 3D6MA 4IFIA 2PXCA 1JDBB 4AIIA 2HLHA 4O08A 3IUBA 5K6AA 3L46A 5EPEA 1AQLA 3UUEA 4WKOA 5CURA 5DBFA 1RU3A 5EOVA 2GF2A 2Y1WA 1G6OA 3D2BA 3ZWDA 3A9SA 1CP2A 2ANBA 5I7UA 5FUVA 4GU5A 3SDSA 4AU1A 3QYAA 4MV6A 2CHEA 3P8ZA 4PYJA 3MLBA 4NH4A 4A8PA 3FMGA 5KAMA 2LXNA 5FPSA 5FLXA 2QRMA 5DHQA 3TL6A 1CHNA 2YOFA 4JLMA 2JGDB 3HUUA 1FNBA 3P5SA 1IPHA 3KQOA 3D4BA 3CY6A 4K7JA 3P9QA 3QKSB 3ANSA 3IEUA 1MXHA 4JHLA 1Z08A 2GN6A 1GCGA 3DB1A 2ZQ5A 3JXEA 3V8MA 3CMCO 3W90A 5FOQA 4AQ7A 2E2WA 4ZOCA 1PFGA 2JZNA 3RVQA 4DWWA 2JGNA 2RGDA 4TL8A 1Y6JA 2CFIA 4BUZA 5KTRA 2IP1A 2WSSD 1NYTA 3HYTA 3I6QA 4BX3A 4GXNA 1E2HA 3ENWA 2C2GA 2WHEA 2OVFA 4NZMA 1M54A 3QLVC 5LD2C 3C8DA 3W5UA 5LP6B 2XNSA 1H2RS 4QJ5A 3A6KA 3TZEA 2I7DA 3W4IA 4KRGA 4CKZA 4HYTA 3IAEA 1CRWG 2WT4A 1CF9A 4FW9A 4ND4A 1LZKA 5B3JA 2GFHA 3LFHA 1SELA 2UZ1A 2AJDA 4XASA 3UMVA 4AAYA 4XM1A 1GU0A 1HO3A 3RVSA 3WADA 2IBSA 1HFEL 2WTXA 1W4LA 4RHXA 1M0TA 1R27A 3KNZA 2H1WA 3II6X 4XKJA 4GI2A 1YQWA 5ICCA 1F6BA 3PUVA 3L18A 3V4PB 2V8OA 1L6IA 4U7TB 1PR9A 3ITEA 2GK6A 1TZCA 3A4IA 2HJGA 1KBOA 2HCTA 3UPDA 3BORA 3HB9A 3AI1A 5B4UA 1L0BA 1W36D 1IK6A 4ZD6A 3BAFA 4L76A 1QOZA 2DKFA 1ZVQA 1A8IA 1E8MA 5ED4A 2WSYB 3H5WA 3A1FA 3HY4A 4BMZA 3RK4A 2YOGA 4JR2A 2E21A 4ZQHA 1N2EA 3SF0A 1MXFA 2IYNA 2GKSA 2I22A 3C7DB 3VRHA 1TJNA 2A2ZA 3FGOA 2H4YA 5CDHA 1MORA 1L5YA 3D8UA 4OQDA 2OHVA 2QN1A 1IY2A 5KNDH 2FSFA 3EMDA 2GN0A 4QHYA 3MOIA 1X7WA 1I6KA 5B58T 3IKVA 1W59A 3ZV5A 3PKZA 1RMTA 1K8RA 4KRFA 3LUAA 3FYUC 1Z2OX 1JHXA 5FUXA 2OEPA 1I7PA 1ZM7A 2R6ZA 3OI7A 3LS2A 2Q4EA 3TAXA 1H5UA 4AUMA 2XMSA 4TYWA 3O9MA 5IK2A 3D6AA 4Y2JA 5IDQA 1NOJA 3C7AA 4AROA 3BXZA 4EHFA 2O06A 3DA8A 2HWUA 2Q3MA 2BEUA 4MX8A 5AVOA 1N9GB 2FEOA 3I9V6 3RNLA 5IJ9A 1M33A 5HYVA 4TRJA 2WQZA 4N5HX 5DGIA 2VDNB 1WUIS 4RMNA 1K7FB 1LUAA 4YAJA 3ZGNA 3FFAA 1LPSA 2HADA 3KC2A 4HWSA 3X1YA 2OV3A 3Q9LA 3KOWA 3SZLA 2QU8A 5K3BA 2X0EA 4KREA 3VYVA 4MI3A 3WJAA 2Z6UA 5HMMA 3LUJA 2VDUE 3LP8A 5HW0A 4HEHA 3TH5A 2VJPA 2EBWA 2WYIA 2J3DA 2IX3A 2H52A 1W36B 2VPXA 4UXHA 3ZWNA 2XRZA 1AE1A 4O2BA 1OIVA 1LCIA 2H1OA 1J4AA 1QIGA 5AM4A 4PXAA 1IC6A 4FILA 1KFCB 1NVBA 1DSSG 1L5HA 5C8YB 2ZB2A 2VOJA 4LJ4A 1X14A 4EF4A 1VJGA 2AJ8A 1QFMA 2ZS7A 3ZJTA 1XWIA 3OJOA 4XARA 2AR7A 3L1KA 3LOUA 4N5DA 1ZH6A 2VNIA 4RNDB 1S8AA 1ORIA 2WJHA 4IIEA 4PWYA 5IANA 3NNNA 1P7PA 1ZM2A 5KPDA 2O7VA 1H4TA 3W2TA 1AZTA 1A1VA 1UP7A 1AKYA 3EQ7A 4UBNA 4LYYA 5L6LB 4IHKA 1JQKA 3R7NA 3E8MA 3RVLA 2X41A 2GWRA 3F9IA 2FQXA 3NFRA 1ISRA 3UK2A 4J6FA 4FMCB 1ZR4A 1T0PA 2WWHA 2Z2JA 3H11A 2IXFA 5IUKC 1DDIA 1DNPA 2JI4A 3SX0A 1QK5A 3FMVA 3DEAA 4I1PA 3SLRA 2IHTA 3QEMA 4QUIA 1AGPA 3PFCA 4IMPA 4GX5A 3VR0A 4MB2A 1GGJA 5CLJA 4PIVA 1ML4A 4CMIB 2WLSA 5GIPE 1HDZA 3CTMA 4G1CA 3I04M 4M83A 4J1NA 3ROQA 4DSZA 3A1CA 3H6GA 5DT9A 3TSAA 4O2AB 1KTIA 2G07A 2XYGA 3GELA 2VSQA 1FX1A 2QXTA 3KB6A 1XXHA 1Z2AA 2P9GA 1O6GA 13PKA 1PJBA 4MVJM 1XP8A 2J6HA 3GJZA 4U7GA 2CVQA 5HQJA 2DHQA 1MW9X 3DMRA 4FT2A 3E5HA 3T38A 1Y7PA 4AJOA 1NHWA 1SB8A 2DUWA 2FOLA 3R5JA 3MCVA 1YR2A 2QM3A 4JBLA 4UVIA 1W0KD 4WCFA 1T8YA 4GEGA 1WOMA 1XMSA 1XRNA 2A1IA 4LJ6A 1KA9H 4KN6A 3ZU2A 4BO1A 5B6JA 5B7GA 1ACJA 3M81A 3WG9A 2QG4A 4JLVA 2R1VB 5DU2A 5K4AA 2ZANA 5AI0A 4DMLA 2PUEA 1SHKA 3NYIA 4FGZA 3RUEA 5EMLA 4CM1A 1QHHA 3CB4A 2LIPA 4NZOA 4X6YA 5EE1A 2NXNA 3ZVKA 2R7KA 2J0UA 1V11B 3BWVA 5G02A 2DUJA 3WRYC 1QIKA 2RC6A 2OYRA 2CGEA 3ZHTA 4DT1A 4F6RA 4YV1A 2CLKB 3IEVA 1TFUA 2OQIA 4DCOA 2G3YA 4JFRA 2F1KA 3BSSA 2Q6IA 2PEYA 4MK4A 3B6EA 3NTVA 3HCWA 4G4GA 1Q1EA 2IS1A 1YKGA 1R8XA 2HWXA 1TRHA 4GKJB 3BIWA 2V7TA 2QRQA 5ECYA 5I9TA 3WKAA 3ZZUA 3SR0A 1T6BY 4X84A 2A9OA 4KVFA 4YP1A 3DUFA 4DFDA 1F48A 3R8FA 3K1JA 2LNDA 2VUUA 4ALIA 4RSRA 3RAGA 4AT1A 1FMJA 5A5EA 2NPIA 3LWZA 5EWMA 3NTLA 2EWWA 5KX5B 3QXHA 1Q95A 1Q77A 4JI6B 3OQ1A 4UTXA 4W5HA 1GZ6A 1KAQA 2HQBA 5ITZA 5C1DA 5AK0A 1C7RA 2GBLA 4G1BA 4CEIA 1N32B 3O6VA 2OMKA 1DAOA 1K3TA 3MMNA 4I08A 4Q00A 3RIGA 3W7AA 1HE1C 4S24A 1F1BA 2A3NA 4D0RA 3UAYA 5K05A 1KI8A 4URWR 2J3JA 2FOXA 1VG9B 2QE6A 3S4YA 3NDRA 3P94A 4F8EA 1T9CA 1AZWA 2CW5A 2IEDA 4PYIA 4RVGA 4C4SA 5BW8A 1FYVA 3N2ZB 2R47A 4HVTA 4DC9A 5T64A 1U9CA 2JFNA 2WTBA 4L4ZA 4MGZR 4L9SA 4ZOBA 3ZZNA 5KYXA 1XI2A 2QYHA 3ZLJA 2GXSA 3UN1A 3JD0A 3KQKA 1IPFA 4I5IA 4O4LA 4MVJA 2COEA 3ZZTA 4ZZ0A 2FEAA 3HLKA 4KMOA 5CCDA 1NR7A 4BFTA 1A9XA 3U4IA 2ODAA 2Q2OA 3PGJA 2YOHA 4N0PA 2OK8A 4YRQA 4BMYA 3LBYA 1DIHA 3R3WA 5B1HA 3T9DA 1SJ9A 1TVKB 1J70A 1PTJA 1KZ7B 4PC1A 3GLGA 3ZQKA 4IDPA 5A3QA 1RZ3A 3GCWA 1TTPB 1TVMA 3C3JA 1WHTA 4FE7A 4KMMA 2Z09A 5FCDA 1OI7A 3AJDA 1XD9A 4QTYA 2I4OA 2BI4A 2HL6A 4JI1B 1JW9B 2V59A 3KQQA 2SNIE 1J24A 4QX6A 1MUUA 3I2GA 5CLGA 4DA7A 4XD7A 4BLUA 3CF4G 4PGFA 1WS6A 2ZE7A 3GPBA 1LWOA 3KV1A 3CN7A 2OVBA 3A1EA 3KYCA 3PSHA 3EXEB 5E8JA 3IEMA 1T4DA 5JO9A 3OMXA 4EG6A 3DHYA 2X6TA 2I3AA 2OCIA 4DQ0A 2AKAB 3ZWAA 4LBYA 1KAMA 4EB6A 3NDBB 1W7AA 1E3LA 1CULC 4LW8A 2JRCA 3BXEA 4LYDA 3OEHD 2R79A 4Q37A 5M34A 3AHEA 3QUSA 4JC4A 4OP3A 2AZXA 1JEEA 3K5PA 2PRYA 3L5KA 4V0NA 1ZH2A 3VJMA 2FPIA 4BX8A 3UK0A 1TTQB 4L85A 3IRUA 3IDZA 4LVUA 3U7JA 3KKLA 4DTCA 2Z6QA 3FTEA 1J56A 1LI5A 4LSGA 2M9MA 5E4JA 4CM6A 2L19A 3Q7IA 3EGXA 3PRKE 3VR5D 2JLUA 2CLSA 2O52A 4DLKA 2QPTA 3JQ8B 4G81A 2NUTA 1U65A 2Q0HA 4JA2A 1NAHA 1MG0A 2HF8A 4Q21A 4Q4LA 3C1TA 1DTSA 4TROA 1S2OA 1U2EA 3D8HA 1T3GA 4FIDA 4AJHA 3THWB 2ZP1A 3SJBA 3S1SA 4NENA 3SYTA 2QA5A 1LY1A 1V8ZA 2CNBA 2AWOA 5CA0B 3Q12A 1FJGB 3A1TA 3D8BA 2M1XA 2F1IA 4AY6A 5EXEA 2D0PB 2G5GX 3M6VA 4FMDF 3BH6A 3PKJA 1ZOOA 2YS6A 1E3MA 1MF7A 1A4XA 4NYIQ 3AP2A 3KPUA 4X7BA 1SWWA 2WPNA 3B8EA 3E3LA 2O8VA 3OE7D 4KXXA 3TD6A 3WLOA 1WXQA 2RIPA 1EGAA 1RIIA 3EC7A 4Z9BA 4K8RB 1P0FA 4JBWA 4X95A 1E0SA 3OEEA 4MS3B 5HF9A 2UZ1B 2XOXA 2J6BA 1M7HA 3NBQA 4F1WA 3LBAA 5P8WA 1KARA 2AE1A 1ZAYA 3EQZA 3PHHA 4U3JA 3W6PA 2GOYA 1KS9A 1EFKA 2PDAA 3U7IA 3MERA 1VCHA 3QVKA 3GF4A 3QXJA 4RD2A 5BWLA 3I5AA 4URYR 2ERCA 4FOOA 3T3NA 2AD5A 2BR4A 2HA6A 3UHAA 1V4BA 3AESA 2Y1KA 5K0BA 4LSWA 4J94A 5JC1A 3QZUA 4UFOA 4GL4A 1I51A 1LBIA 3PHCA 1ESEA 2ON6A 5EZ6B 2HQRA 4ER6A 4PLFA 3GK3A 3ORRA 2WKPA 2RE8A 1UBFA 4WASA 1ILWA 1DAHA 3C2QA 2P8SA 5C8DA 5EJ5A 2CNWA 3QP9A 4BFVA 1XMQB 2HFJA 1HV8A 5BN4A 1ZX1A 2HLDD 5GGXA 4TL9A 4ASUA 4BB9A 3KIPA 2Q5JA 2WKQA 3I01A 3OH8A 4GLLA 3JATA 2BBWA 2ZYVX 1ZCJA 1SMKA 2FR8C 2XEXA 5CLLA 5KKAA 2UYHA 4AQYB 2B0JA 4H7DA 1ZBDA 2C57A 3TXAA 3CPJB 5CM8B 4ETNA 1PG5A 1TZKA 5I7SA 1YE8A 1XQWA 1A1SA 1UJ2A 2ZIUB 2QQ5A 3VR5A 3NWOA 6ABPA 2JH3A 2VDWB 4BU1A 5FUQA 2NQTA 4L9RA 2FR1A 2VIIA 1W88B 3AT1A 4HATA 4YMIA 3AHHA 1DJNA 3UJHA 4WZ6A 5G40A 1TLFA 3NO4A 5LQKA 1WWKA 1M34A 2BFOA 3FI0A 3NFYA 1UT6A 3UAGA 2VFAA 4OHKA 3G13A 4UC0A 1UBMS 4MNTA 3UFXA 5D5PA 5IG2A 1VBNA 2Q4OA 3C5EA 2IK8A 3CRQA 3DDWA 5E2IA 1E1RA 3LY8A 4JBXA 5TF0A 1CUVA 4PNZA 3W8RA 2HPZA 3PVCA 3UWKA 3LLVA 4BNFA 3QV1A 4HAWA 2COKA 4QNNA 3TR0A 1BOOA 1L3CA 1CRPA 1B93A 3RVKA 5KJ1A 4MI6A 4AF6A 1XWFA 1Z4IA 3T7JA 4FYJA 4RVFA 4BZXA 1JLSA 3L0IB 2OXRA 3AERA 3T12A 2OKGA 4TVBA 1N0IA 3QWFA 1DJPA 2VP3A 2BFWA 4Y6LA 2P2ZA 4TMFA 3GUZA 4TVKA 4OGWA 3G9TA 4DVGA 1CPYA 4IS3A 3DXFA 1J00A 1R5JA 5E7JA 5EKTA 3U4CA 4HO1X 1TT5B 3RYFA 4EYQA 5JLJA 5CT5A 3SYNA 2QT0A 4IVPA 4TV8A 5F2OA 1ZA1A 4PZDA 2GEBA 3RKRA 1FFSA 2B5VA 3WFZA 2ZWOA 4R1OA 3U4AA 3WRYA 4PGAA 2J9XB 3RRFA 1MRNA 1M10A 5JSFA 2BKLA 3D02A 2ZIWB 2RHBA 4BDSA 3UXMA 1UJMA 2CK3A 2OO5A 4U5XA 3K6SA 3SYRA 1YDGA 3CS3A 2NXEA 5B1DA 2OPHA 1W36C 4AUEA 1P73A 2P4SA 4BMOB 2B82A 2OG1A 2WTAA 1K0FA 3URKA 4IFEA 2QTAA 4HDCA 1K6XA 2Z56A 5TY0A 1S7GA 2CFOA 1J97A 3RBZA 2GK4A 3O94A 4PFSA 2CY0A 2FB9A 4H4CA 3WYDA 3C6QA 2RCNA 1LBHA 4G09A 4JVOA 5KVAA 1Z0AA 1HRDA 1QFXA 1XZGA 4FKMA 1XRPA 3LAWA 3GLIA 3GMDA 2FRDA 1GZ7A 4YECA 3WAKA 4EATA 3C14C 3LVRE 3E2PA 4HNRA 4D9EA 4QPCA 4J9UE 5LLTA 3DDOA 5KYUB 2YR0A 3E5MA 2WHRA 3KJHA 3R0QA 2BM1A 1U8TA 2WMDA 3C8HA 2Q3JA 1WMDA 1YB6A 4PSAA 2LGJA 3P0RA 1PK9A 2XZTA 1R4ZA 3GEIA 2X2PA 4HQLA 1QLJA 4MRAA 2W4IA 3U39A 4AS2A 1KXJA 3IB3A 3B85A 3R09A 5ALDA 2D0IA 5ER6A 5LIPA 1DVRA 2FAXA 3X3HA 1X1QA 1YZQA 4OGGA 4KKVA 5AM0A 2GPYA 4RTQA 1P7YA 2XTZA 3I3OA 3K3PA 3GP8A 1ZD1A 3BL5A 2CHUA 4PS1A 2XQFA 3OPYB 1I9GA 2FRVA 5FHRA 4DMUB 2A14A 4MKGA 1KS2A 2XAUA 2YIJA 1EWYA 4DV7B 4ZT6A 1TKCA 2IOQA 2BP7A 5JJIA 1GZSA 1R5BA 1WXGA 2AN9A 3KBBA 3MZ0A 5BSRA 4MUBA 2JCYA 4P35A 1KL7A 5L45A 1KWGA 5G53C 4RESA 4UNPA 5GOZA 3T7SA 3D6NB 5E9QA 2B30A 4BB5A 3HN6A 4OI2A 3RUFA 3DT8A 3EEFA 4L8WB 2I8AA 4H15A 3NDJA 3BWDD 4OH1A 3UG6A 3U09A 1QCZA 1U0RA 1Q12A 2J30A 3TW8A 1EAMA 4NV3A 5JEEA 1SCKA 3DGEC 3JWJA 3HJNA 1U6KA 3I1IA 5GGYA 3NH6A 4W99A 3DMNA 3CR3C 1S3SA 3R7LA 1TQ8A 4J4HA 3S55A 5B6PA 2OR3A 1JEYA 2ZVJA 2JA1A 4UAGA 5AWFC 2ZTUA 1U8XX 5IMSA 2RHRA 4JC5A 2X7HA 1HI9A 3EH2A 5K01A 2Q9AA 4D4MA 3AX6A 1N2GA 1VKRA 1M2OB 1N2CB 1NVUQ 4P5PA 4RTLA 3J80A 4NDNE 1YO6A 3CZRA 3G0GA 4XPIA 5LP6C 2K7FA 1V5FA 1ZICA 3L4KA 2VUSA 3WC4A 1E9AA 3IURA 3TIFA 1GPAA 2A0UA 3AW8A 4W4TA 3PVSA 4UU7A 1NRIA 2PT6A 1JVSA 4B3CA 3RU7A 2A1TR 5DDIP 2EW1A 2IZZA 2K4MA 4NBWA 4DJTA 1CUYA 4Q16A 3WSWA 4KXFB 2E4AA 1O6ZA 1Y9ZA 1Z35A 3CCBA 5LN1A 2P0AA 2JGFA 4TKLA 4E08A 1TADA 1H6AA 2VZ0A 3BXOA 4JOBA 4A8JA 4AZ3A 1UK6A 4A92A 2WFLB 4OB7A 2G25A 4CDGA 1XU7A 1FJXA 3TIXB 3EEQA 1GHTA 1N75A 3AI3A 4EG7A 3BM5A 1FNCA 4MKZA 4CG1A 2I2BA 5DK4A 3DZCA 4AJKA 1A4IA 2Z2XA 3GJSA 3INTA 2Q4DA 2J31A 4LECA 2GPJA 3C4VA 4ROTA 2VT2A 1CUIA 1L7AA 1XB2A 3ENKA 1DARA 4A2PA 2FR8A 1B0AA 2PLWA 1PJAA 3B60A 2PKXA 1NBEA 3F7TA 4L22A 5CCBA 1XR3A 2YV4A 3UC5A 2JAHA 4B5KA 5EJEA 4JC0A 4MSUA 1FP2A 1RYDA 1KK0A 2RONA 3KR9A 4RWZA 1XLTC 4D0GA 1CC1S 1OXSC 1ZM4A 2MT9A 2ZBUA 4WXYB 5FL3A 1M75A 1NZFA 3I09A 3L43A 4E13A 3K16A 4Z53A 2F62A 4X1KB 3HRKA 1PJ8A 4IHAA 3BFVA 2GN9A 4LFBB 1NASA 4F9FA 3NBXX 4WNAB 1ZA2A 3TOXA 4E5KA 5AHWA 1YRYE 3TNLA 1C9DB 1N5MA 2C92A 1E3WA 1IQUA 1UPXA 3HR8A 4I0WB 2WD9A 3TE6A 4B1FA 3T54A 4A26A 1HK7A 5TB5A 4PHGA 1H1LA 2OCAA 3OTGA 3Q72A 1IEXA 1YIAA 3G0CA 4LWQA 4QT4A 5J4VA 4GMKA 1XYVA 4MUIA 3KB8A 1FIUA 2X8LA 4W5QA 3G02A 2NVOA 3MSXA 1PR3A 1Y1SA 1JR3E 2ZTSA 1H8HD 2EBFX 2IDMA 1X7ZA 2JAUA 4JVSB 4I3FA 5IDWA 1BTOA 4R1PA 3T7IA 2WY2D 2V6BA 3H4IA 4RLFA 1K5DA 1P44A 1P5JA 1TLTA 4JJFA 2UU9B 1RRPA 1PGQA 1NN1A 3I64A 4TN1A 4ZAZA 1F0PA 3LI2A 3U40A 5IYZB 1SULA 4Z0PA 3KJFA 4OU5A 3BWMA 2BELA 5BNFA 3RASA 3EEBA 4AKSA 1NL3A 1LPBB 3LVFO 4WCFC 1EPUA 4E22A 2GZSA 1DP4A 3O4JA 3OOYA 4ZKEA 3ICCA 1EFDN 5HCNA 2FW8A 4PFQA 1Z3IX 3DM9B 4KQ6A 3DBHB 4H3VA 5DTEA 3KJQA 5EJAA 3U9TA 4E94A 5AOAA 4WXRA 1KDVA 2C7OA 3AUJB 2GA9A 4MW9A 1MCZA 3D4PA 3MXTA 3OC6A 5IARA 3RG8A 4YMHA 4YAUA 2QN8A 1OXVA 1WCYA 2YV3A 3RT9A 4C4XA 3EYAA 4OQYA 4FI3F 4YLYA 1DAMA 4YDSA 3C45A 5CA1A 2LKDA 3UJAA 2G70A 4RTNA 1C3LA 1JLLA 3E3OA 4IDNA 2J1LA 5JZVA 3JARA 4M86A 1PI3A 1YR8A 2HAEA 2HTEA 3IB6A 3OD1A 4JJ6A 4P3OA 4K87A 1ZMTA 4Z86A 2NU8B 3VDNB 1NULA 2GFIA 3T5BA 1SBHA 3QBDA 2BRUA 3KTDA 2R66A 4OLFA 3DZ8A 4HDOB 1SVMA 2J5RA 2PNFA 1JWAB 4P92A 1ILEA 2GYVA 3RUDA 3OLWA 1DWQA 1IN4A 1G4UR 1JVBA 2IPAB 1OFTA 2LDXA 2REXB 4BO9A 1LXCA 3GN1A 1EK1A 4P34A 4OU4A 2XNDA 3VPGA 3PFHA 1I2ZA 4C76A 4C2UA 1WU7A 3CBGA 5JI2E 1GWNA 3C16C 1W46A 4UUOA 4E6EA 4O5OA 2RFLA 1E8NA 2D5LA 5EIOA 3UCXA 3EUWA 3N2IA 3WO0A 3KUKA 4B85A 1RMYA 4A0QA 4Z4FA 3O4GA 1HEIA 1Q21A 5E6UA 3FPKA 1S1MA 4FYMA 2BZSA 2HLNA 1O4WA 1ZH8A 3AR8A 4IMRA 1W34A 1XHEA 1AA9A 3QMVA 4BBJA 3CH6A 4F85A 1J2UA 5F3DA 4O29A 3SQOA 3TRFA 4MWTA 4JLDA 1XQ6A 2MSWA 5KU7A 1W4ZA 1SHUX 3SJCA 2GJKA 3DWIA 1H3FA 1I30A 4EJMA 2O23A 4Q3NA 5CA0A 1ATZA 4GF5A 3T8YA 2P77A 4CI0B 1YC5A 1JSZA 1F7UA 2UYGA 2OCYC 3KR0A 3NH9A 4D9MA 2BFNA 1X19A 3ZJVA 5JJKA 1UOQA 3AHDA 4URFA 1YMUA 2A94A 3LKZA 4RSMA 1VJCA 4LE2A 5B3LA 4QVGA 1U99A 3BTUA 3MLAA 4JI3B 1CJVC 1UZAA 4WKCA 4RAQA 4BBAA 3OM1A 5JFGA 1ORHA 2BTQA 2PS1A 4O4HF 3W8NA 1R0RE 2HBQA 4RVDA 4L50A 5B2FA 3VSEA 2QMZA 5LA6A 3UT5A 1W4RA 1F38A 4MYDA 4L6AA 3PX7A 2O0JA 2ZRHA 4MA0A 3RGWS 2QSJA 4MINA 1F7VA 2JCXA 5I9NA 1EB9A 3OFKA 2K5UA 4G9EA 3U1BA 3T9BA 4HZIA 3V2UA 4GICA 3U80A 1J0DA 1O5TA 5JBQA 5CYPA 1VB3A 2XCQA 3UATA 2QE7D 4AUNA 2P62A 2TRSB 2FTKE 4E51A 1M9NA 4L7QA 5AK4A 4BEJA 5BUSA 1ECGA 5LB2A 2OPBA 2IV2X 2NMVA 3E9MA 1PP4A 2XPCA 3HUDA 1H69A 3I72A 3CUKA 3E82A 4G4SO 3TSZA 1P1RA 4BLRA 1SKAA 4PNHA 4LN1A 4MPPA 4HX9A 4G0ZA 3VI3B 3WO1A 3SM3A 1U3CA 2YNMD 2EZ4A 4DIKA 5K8IA 3A6GA 2JD2A 5JZMA 1A8SA 5D7NA 3HSSA 1BFDA 1W4AA 4PWZA 4KRXA 3IQWA 4JAVC 3FVVA 4QPJC 3T3IA 1ETHA 3ON5A 3AYXB 4DLNA 4Y6PA 5FJIA 1OH6A 4QOSA 4O2LA 1FYFA 4KN5A 5AOCA 4CN8A 4MQEB 4WVLA 5JU6A 2UUBB 1J0CA 1QU2A 1OYWA 1BEZA 4OQPA 4BUJA 5ALLA 1MEJA 4IJVA 4KG7A 5BV7A 3R20A 1CUHA 4Z9XA 4JNKA 2NU6B 2NV2B 2R86A 3UW1A 4DR3B 2WM2A 3UWPA 1JFVA 3DTTA 4MMYB 4M49A 3R77A 4MO9A 4BEWA 5MDHA 2UV8A 1DHTA 3LQ4A 1J5XA 1YI1A 2BI8A 3CEJA 2I62A 1XU4A 1I01A 4B6QA 1GL9B 1OZAA 2DH5A 4AMVA 3ELDA 4BU0A 3QLVA 2GNOA 2AG0A 1Y80A 1T4BA 3OCCA 1YAHA 1NQTA 4QSMA 1PEDA 3FGNA 3E2IA 1P8AA 4G0UA 4CKXA 1L4BA 3LWNA 2WD7A 2YXBA 3O7MA 4BYMA 5JASA 1RLJA 2JGMA 3DV0B 3OLQA 1EJ0A 2HIGA 3PT9A 4FZJA 4MYCA 4U63A 4MI9A 2CJWB 1SD1A 4HWKA 1RTKA 1SZJG 1VL0A 4CCAA 4M0MA 5BV2P 5COQA 4CLRA 3O4RA 1VI5A 2FK8A 1PL8A 2Q7DA 4L8VA 5I4KA 1Z0KA 2BUBA 4MWOA 4CV1A 1L4HA 4BLQA 1H0KA 2Z1MA 4ZAXA 1R9GA 2H5JA 3HN2A 3M9XA 4CMBA 3QE4A 5ADVA 2VZEA 3DVQX 2G9NA