4HVCA

Crystal structure of human prolyl-trna synthetase in complex with halofuginone and atp analogue
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
497
structure length
482
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGILSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARMGAKSLCIPFKPLCELQPGAKCVCNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ATP-directed capture of bioactive herbal-based medicine on human tRNA synthetase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional glutamate/proline--tRNA ligase
total genus 162
structure length 482
sequence length 497
chains with identical sequence B
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4hvcA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4hvcA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4hvcA02
4EO4A 1EIYA 2I4NA 4H2TA 3QO8A 1B70A 4YRNA 1QE0A 2EL9A 4H02A 3HRKA 4KQEA 4AH6A 4E51A 4YRKA 1WQWA 3MEYA 4LNSA 1H4SA 4BWAA 4J15A 4P71A 4ZTUB 5HGQA 3P8TA 3BJUA 1B70B 2DZCA 1N9WA 3R07A 3KFUA 1KMMA 1HTTA 1RIQA 2I4MA 3E9IA 2HNIA 1NYQA 12ASA 1NJ8A 1NYRA 4HWSA 3UH0A 4YRPA 2EAYA 3P8YA 1B76A 2I4OA 4CH3A 3CMQA 3V7RA 3HXYA 4YREA 2ARSA 3OD1A 1NJ5A 1ASYA 4CH6A 2DTIA 4HWPA 3TUPA 3MF1A 1FYFA 4YRIA 1EQRA 2CIMA 3A74A 2E3CA 3MF2A 4TVYA 5KNNA 3EFSA 3HFZB 1H4TA 1USYA 2RHQB 2AKWB 1USYC 1EVKA 2ZT7A 1JJCB 2EJGA 2EWNA 3E9HA 1X2GA 4P72C 4ZTZB 1L0WA 1ATIA 4HWOA 3HXZA 5K1PA 3RIRA 3P8VA 2EJ9A 1HXDA 5K1XA 4P74C 1IL2A 2ZZGA 4UP7A 1H4QA 4H2VA 4NCXA 2DU7A 4CS4A 2FYKA 1HC7A 3RACA 3W3SA 1SERA 4YROA 4HWRA 1YFRA 1SETA 2ZINA 2ZTGA 2IY5A 4X5OA 3VQWA 1BBUA 4RQFA 2DQ0A 1C0AA 2ODRD 3VQVA 4HWTA 4TQDA 3TEHA 1E1OA 4YRMA 1YB3A 2QHTA 1WU7A 1E1TA 2DKGA 2E41A 2G4CA 4WJ4A 4YPFA 2DXUA 3M4QA 3QO5A 2ALYA 4L87A 1WLEA 4YRJA 1WPYA 2E65A 1VQZA 2DXTA 4P72A 3PZCA 3TEHB 2IY5B 2C8MA 3HFZA 5C53B 2ZZEA 4XTYA 1H4VB 3DSQA 4CH5A 2ARUA 3HXXA 4XEMA 3IKLA 3V8JA 2DTHA 3HXWA 4RMFA 4UP9A 4H2SA 4XEOA 4RDXA 4XU3A 2DZ9A 2ALYB 1NJ1A 1W66A 2DTOA 2CJ9A 1X56A 2ZXFA 3HXVA 1X01A 3V7SA 4XTZA 3RGLA 4YRCA 3NEMA 2DU5A 2RHQA 1GGMA 1BIAA 4XTUA 2P5IA 1JJCA 3QTCA 2E5AA 2ZNJA 4WI1A 3EFRA 2Q7HA 2ZT5A 2ZT6A 4YRRA 4OP0A 4DPGA 1J5WA 4ZIBA 4TQFA 2C7IA 4Q15A 3A7AA 3HY1A 2AMCA 1BBWA 3HRIA 1KOGA 4BW9A 1YFTA 4G84A 1ADJA 4G85A 1WNLA 3IALA 4EX5A 2DJZA 2CJBA 3LSQA 4P3OA 1V95A 4OLFA 3A7RA 4H2YA 3RKYA 4P3PA 3M4PA 11ASA 3REUA 1B8AA 3REXA 4K87A 4P73C 3VQXA 1SESA 4YDQA 3A31A 3RL6A 3WQZA 3NENA 2QHSA 1G51A 3UGQA 3PCOA 4H2XA 2E10A 3HXUA 2QHVA 5ELNA 2ZIMA 1ADYA 1G5IA 4YCVA 4P71C 3RUXA 1B7YB 3V8KA 1QF6A 3PCOB 4H2XB 1X2HA 2Q5IA 2RHSA 1SRYA 2EJFA 4HA8A 2DQ3A 2ZR2A 4TTVA 2ZZFA 4TVWA 1PYSB 4KR3A 1B7YA 3TEGA 3RKXA 1EOVA 2RHSB 3ERRA 3A5YA 4YRLA 2DEQA 4TWAA 1WYDA 2E64A 4H2WA 3G1ZA 2CGHA 3A32A 3VQYA 3I7FA 3L1AA 3QO7A 1NJ2A 3QNEA 4UPAA 3V7CA 4WJ3M 3NELA 4XTXA 2AMCB 3HFVA 2ZCEA 4CS3A 3UGTA 3IG2A 2ODRC 3RF1A 4K88A 2ZT8A 2XTIA 1BIBA 1E22A 2DVEA 2P0LA 4YCUA 4UP8A 4Q6GA 4YP0A 1G5HA 4YRQA 5ELOA 5C52B 5E3IA 2XGTA 4CH4A 1WQ7A 1ASZA 1YGBA 4TVAA 1NNHA 2ZGWA 4WF2A 4XU2A 4KR2A 1EFWA 3LSSA 4PG3A 3VBBA 3A7UA 3L2ZA 2Q7EA 2J3LA 4O2DA 3FJPA 1KMNA 4YCWA 2Q7GA 4XTVA 1YFSA 3RKWA 3BFMA 4HVCA 1X55A 1PYSA 4YRFA 2DDZA 4P75C 3L4GA 1EIYB 3ICAA 4P75A 4PHCA 3V8LA 1Z7MA 4CS2A 4YRTA 4XU0A 4YYEA 3L4GB 2I4LA 2PMFA 4YRSA 2QHUA 2PMEA 2ARTA 4H2UA 1X54A 4RQEA 5F5WA 4P73A 2ZIOA 2CJAA 2LW7A 4P74A 2Q5HA 3A5ZA 4XU1A 2E1HA 1NJ6A 4K86A 4DQ2A 3UFGA 4XTWA 5C51B 3LC0A 3HY0A 1Z7NA 1EVLA 4YRGA 3IKMB 3NETA 2J3MA 2ZR3A 2ZNIA 1E24A 2AKWA 1LYLA 3HTZA 4P3NA 4TVAB
chains in the Genus database with same CATH superfamily
2BFFB 2EG9A 2YZKA 4HHEA 3IDAA 2O8VA 2MSDB 4DLLA 3IIIA 1WUTA 3IHWA 4PM4A 2W98A 3UAZA 1NAHA 1XAHA 2G5PA 2GHRA 4JQZA 1C1DB 5JXHA 1KF0A 1O97D 1IXYA 2XA1A 4DCGA 2ZUTA 2WK1A 3EBPA 3P2YA 3QJGA 1UBNA 2FP4B 2ISCA 3V33A 3ZS9A 1XZHA 3GDOA 3F1LA 1XELA 2FFRA 4IRMA 4KVAA 3QO8A 1BMFD 1YR7A 2AD5A 5ALDA 2YFKA 1MHPA 4IQ4A 1C7EA 5A9TA 2ZG6A 3ZHVA 6NULA 4L0CA 3F6BX 5AOVA 4YJ2F 5EQJB 3GLHB 4HQLA 3T3GA 2E3JA 2ZBGA 1K1EA 4Q3LA 1QJCA 1IMJA 2IYUA 5JSQA 1OH5A 4N5DA 3S5UA 4YXWA 4DV4B 1TZBA 2Q3CA 2ZYRA 3PXEA 4KK3A 4B7AA 1QVWA 4OHRA 4IGAA 3SQMA 1DKNA 4DLRA 3EZ9A 3ANTA 3ZIIA 3FI0A 4CYMA 1WXEA 5GADl 1BS9A 3EASA 4NATA 4JOCA 2AEMA 3OY2A 4IVQA 3JRWA 1FJXA 1NX9A 1L5QA 1TK3A 2WFZA 3BSYA 3LT4A 1P39A 4XSGA 3HSSA 4RM2A 3ZIUA 4ZU1X 3ZHRA 1K75A 3R07A 1QZZA 3JZFA 1CERA 3G8YA 3NQ41 4QJIA 3C39A 5JQGB 4ALNA 1USWA 1OIWA 5MFPA 2C5FA 3E9IA 3CU5A 2HFKA 3VHXA 3ZDAA 2CHVA 5FWYB 2WW8A 3OZTA 5C18A 1T1SA 2AG0A 3C3PA 2E49A 4YLEA 3OZVA 5LZ2A 2HU8A 4A16A 2QDXA 2IYZA 5AW0A 2FSUA 1Z25A 4L2IA 1KK0A 1TIKA 2VDWB 1YCGA 4Z1MA 3PV0A 4YJKA 3T7IA 4YREA 2JGFA 3W9UA 4B3DA 2ONYA 3E61A 1JIXA 1UIMA 5ICGA 1P3JA 2P2GA 3ADDA 2YN4A 2V5VA 3CEHA 3TOCA 5K2OA 1V8PA 4I50F 3A9WA 4I6GA 5IK2A 3ANYB 1KJQA 2Q99A 4UQOA 2VTKA 3E1SA 3AX6A 1DAKA 2OYSA 4LVUA 4ZQCB 1GLVA 1HXHA 1XZDA 2CVPA 2G77B 5H02A 2BBOA 1W0JD 3G2MA 5T4HA 3UXYA 3FI9A 4JOSA 4Y2JA 5GONA 2Q7DA 1GNLA 2LN3A 1M6HA 4OQNA 3NH6A 5KNNA 1T0PA 4DSOA 2X4LA 4R9RA 4XVUA 4JI5B 5ITZB 3GJ6A 3IDFA 2CE2X 3TX2A 1VZ3A 4YAGA 3FB1A 1YA8A 3INRA 3KQMA 4Q0MA 1RQXA 1LFAA 3V8NA 3QEMB 4LOKA 4KXYA 4QVIA 4C1NA 2G9RA 1UC8A 2Z2KA 2UZAA 3FPKA 2QJOA 5JU6A 1J70A 5T64A 3FNIA 4Q7MB 1DDGA 1YMUA 3FKSA 3NIFB 3OPMA 1JHUA 5EIFA 3FCAA 1N0WA 4R2JA 3RSOA 4YUWA 2Q3BA 5L45A 3WDKA 4ZTZB 3LPCA 3HI4A 2NUPA 3AKYA 3PICA 4FFOA 2Q0HA 1XZAA 3RIRA 1L5MA 4ZVVA 3L1VA 4LXIA 3KL2A 1G64A 2P40A 1O6ZA 1F8FA 4UP7A 3JYPA 4F84A 1Y63A 1OREA 4LJKA 4BNNA 3I62A 2A5GA 2FPPA 4TUYB 4CT5A 1G8SA 1GZHB 1ST3A 2X19A 3IUPA 1SBQA 2GD0A 3PQ6A 4MJ3A 4PYRA 2JC3A 2GTPA 1Z4QA 4W9NA 1TMGE 4G56A 1YFRA 4MAMA 5ICEA 2FDCA 5GJBA 1SETA 2Q2WA 4LF6B 1WHTA 3D8TA 4FE7A 3PLNA 1WUHS 3CE9A 2GAAA 3A9VA 3SF8B 2DQ0A 4FSDA 3WZ2A 3HQ4O 4A1FA 4HUTA 2WIKA 3UWPA 3L0YA 1G9TA 1VCOA 4PX9A 4HRAA 3H87A 2RHRA 3KOZA 5BV1A 2R6GA 1AKUA 5KSYA 3ED5A 3TEHA 2IDMA 3QVGB 2JHAA 5G4KA 4E5VA 1W36D 3L4BC 3HMKA 4CMIA 2WIBA 3EPJA 3PWSA 2NZJA 1N1MA 3BGIA 5H81A 2X41A 2Y93A 4LNUB 1RLIA 4Q4DA 1H05A 3H83A 1U7UA 2GA8A 3HR8A 2G28A 4XM2A 5LQJA 1B23P 3L6CA 2XNCA 5A9RA 5KYXB 4QQRA 1RWVA 5BWCA 1JGTA 2AC7A 2CDBA 5E7IA 2J3KA 1MKYA 2XUPA 1X86B 5FPYA 5BT9A 4YQYA 3L0IB 3MSCA 4YRJA 1QH0A 3BIOA 3H2HA 4R1QA 1OVMA 4HVLA 1KTVA 1G9XA 1NVTA 2GEFA 4J0DA 5BV0A 5L3QA 5LP1A 5GOTA 3V00A 5F4BA 3ANNA 2HMWA 5DHRA 2Y6VA 3W04A 4F3CA 5CD9A 2BH2A 2DH5A 5BN1A 4GKBA 1JV2B 1I2DA 2JGKA 1E1NA 5L6MB 1DIOB 2WHPB 3PNQA 3RAGA 5C46F 1AD2A 4ACAA 4MUEA 3JZDA 5ALRA 3DUFA 3ITEA 2DFDA 5CFMA 2IHTA 4BQFA 3R5HA 1V1JA 3C2QA 1PWXA 3B9PA 1A7UA 3PNLA 3Q7RA 4M8NE 4EYEA 4Y1RB 4A6PA 2FZGA 3BIJA 4EJSB 4HRXA 1YNSA 4HD8A 1J2TA 3GVHA 4LJ8A 3MQZA 4YRDA 2BMDA 4CKWB 5DNYB 1WHTB 4NZMA 5HF5A 3EUWA 2HYDA 3N9IA 3VSDA 4DIOA 4Z0TA 3GLHA 3V6MA 1G1MA 3DE1X 2PS0A 5LBUA 3OEEA 1A5AB 4XEOA 1K6XA 5DJ5A 4MV0A 3U5TA 4Y18A 3QHQA 4R9SA 1EXWA 3NUQA 2I29A 3CM0A 1DQSA 1QOQB 3RM3A 2W90A 4QOHA 3SQOA 5A5DA 4LF8B 1GUBA 4DNPA 2IBSA 2W0SA 3GFTA 1MEEA 5G02A 4KFCA 1YBFA 3GHYA 2HSEA 4NBNA 4OAOA 1MA3A 4EAAA 2DCMA 1D7AA 2GCEA 3CPEA 5LA6B 3EZNA 5F1KA 3OD5A 3FPAA 3H5WA 4JT4A 3SE7A 3T7CA 1HDOA 2AV6A 4C14A 1MC8A 1N5LA 1V0JA 4B4KA 5FJIA 1HFJA 4AI6A 2CVQA 3FMOB 1ECCA 2AXQA 2WWIA 4FKMA 4J6FA 4J03A 3RC7A 3AY6A 4RA6A 2GBCA 3ZV3A 1I32A 2CJPA 3QBDA 5EE5B 2QBYA 2JBWA 1V8ZA 5DBEX 4YP5A 4EI7A 3O2QB 2JFWA 2Q3MA 3ODPA 3KWMA 1UWCA 1Q12A 4JJ7A 3LD9A 2YXLA 1ATZA 1YVRA 2R68A 2RAUA 1U31A 3BDVA 1G8AA 1ARZA 4AUMA 3FCOA 4JEIA 2VJOA 1WZNA 4KH0A 1VE3A 1TLLA 3PFKA 3VPSA 1PQPA 4HAXA 2X6TA 2QX6A 3PVCA 4ZIBA 3DE5X 5T4EA 4DCMA 5JH7F 3A06A 3A7AA 3ANXA 2YVUA 4NJMA 4CPDA 5C1PA 1NMZA 3G8BA 3QMWA 4EKNB 1U1GA 3O1JC 1UBTS 4QUAA 5DM70 1MG0A 3UANA 1MZPA 2FEAA 2QI9C 4W8HA 2I7DA 4KBGA 1WVMA 1E60A 1H0HA 1VMAA 3R7LA 1MAVA 3NALA 4LXUA 4QARA 3R8XA 1ZX1A 3K0AB 3TUJC 5F7XA 2GHQA 3EAQA 2DHQA 1RSZA 1Y9XA 1MT3A 1VTKA 3GLSA 2WQ7A 3U4IA 1SVWA 4R81A 4RZ3A 3K96A 5TF4A 2BT4A 3T9EA 3R20A 4LZJA 3UUWA 3L4KA 2ZIEA 5JLAA 4TTPA 4IPTA 1QCDA 2B25A 3FOEC 1BN6A 5KINB 4V0SA 5I9LA 5IAGA 4KQ6A 1GSOA 1PR0A 3F78A 4ZDJA 3K09C 5JRDS 5HP4A 4A2WA 3B2EA 2WWVD 1JPUA 3GYGA 4MMZB 5KYWB 4GR5A 1O1YA 5I7RA 1EIWA 2FPKA 2WQZA 4ML3A 5EINA 2VEDA 3NNNA 2WAYA 2LD4A 4HDSB 4G1CA 2YY5A 4P3YA 1RE0A 4A3SA 4DQXA 4KC0A 5BNTA 2F00A 1J0XO 1L8OA 2B3TA 2OM6A 1ZW6A 1FNNA 4FR2A 4N3AA 4QQNA 2V7BA 4URFA 3VC7A 3KTOA 3EMDA 3BUSA 5A4AA 3BEDA 5HWSA 4H77A 2GZRA 3G59A 5DXAA 5JXWA 2NQTA 3EG9A 2F4NA 3ZU2A 3KQOA 2WD8A 4G4GA 1CUJA 3MSXA 1B73A 3CH7A 4WE3A 1RKUA 3R8FA 2YOGA 3KQLA 4UM9B 1O94C 2WINI 1ADFA 2OHGA 3OE7D 4C3VA 4Q34A 5B3AA 2Y2VA 5B4UA 5AICA 1B8VA 5H3CA 2OG2A 1ABFA 1S6YA 4JGGA 3BN3A 2JLVA 5KPJA 1J7JA 1LUAA 2VPXA 1TVKB 2ZDGA 1FTYA 1QQTA 2B5VA 3EIWA 1CKEA 1JDZA 4PW0A 2XGMA 3ZZ1A 4QOGA 3IMFA 1V7ZA 2PNFA 4AJ4A 3PQDA 4KLAA 5JXJA 4K1XA 1YMVA 2OZVA 1QR6A 4RETA 3EWSA 4C04A 1SU8A 2QUZA 1QRRA 3GDFA 4KNYA 5AI8A 1STOA 5G40A 1H1LB 2AFIE 2QZ4A 2YW2A 3KSRA 4W99A 3S28A 3TLYA 5DSXA 1E66A 2FQYA 3AOEA 4ZT4A 5AJWA 3T38A 1DZIA 1UZAA 3TOXA 1OTHA 1NI3A 1GG5A 1VL5A 4OU4A 4DC1A 1OAKA 2FX3A 2XNHA 1NJ2A 4GMKA 4GR4A 1ZJJA 4RY9A 5CHYA 3QF4B 4AECA 4MVJI 1EP3B 1Z8DA 3A2MA 3U13A 1GG8A 3M8KA 4LJ9A 4LVNA 4AX8A 1Y3AA 3O4JA 3JASB 2COKA 4NXNB 5FTJA 4TMYA 1OT3A 5BVGB 1DCKA 4OHBA 4D6PA 3KYJB 2HA7A 2XUDA 4AN1A 3OVMA 1SCKA 5KNCA 4EPYA 2PPLA 1HMPA 3DAOA 1CU1A 2IYWA 1ZL2A 3L7LA 3N2IA 2QU7A 4MYDA 2QLMA 5DT9A 4YAEA 2JK0A 3VZQA 5LQMA 5FPTA 2JCVA 4INJA 1JILA 2HA4A 4NMHA 3NZEA 3VKWA 3EIQA 1V9CA 1DCJA 2EP8A 1KARA 4M1QA 3Q8LA 1U9JA 4LFCB 3M2TA 4G4SO 1YDGA 4YP0A 1BMFA 2Z95A 3BWCA 4BN5A 1RI4A 4IJVA 5FBLB 4PNEA 5JECA 2BGGA 3BFJA 4GAEA 4HPXB 5CFQA 2O3RA 1XPRA 1EZZA 2CXXA 2P77A 3CKKA 3OZGA 4C5AA 2EVWX 4Y0NA 1P4SA 2HL6A 4B33A 4BVGA 2Z58A 4CKEB 5DW0A 4ZVQA 4DQUA 1YGBA 1OU0A 4V0MA 2ODPA 4GDMA 1GP2A 2ZGWA 1TQHA 2F3TA 5J5CA 2XMDA 1VKJA 2ZE5A 4F2WA 4LJYA 1E9CA 3R44A 1NMYA 3REGA 3RF7A 4LVCA 4D8YA 4E6EA 3GFFA 3UBTA 1CV2A 2IXEA 2W2NA 4H0CA 2BEKA 2QXTA 3WG9A 3ZV6A 1Y3CE 4UQPA 2HMYB 1GFZA 4DNOA 4L8YA 1XXHE 4JQCA 1FNSA 2BKLA 1T2CA 3K0HA 1SUIA 4W1PA 4LHVA 4X3OA 4JS0A 2AZXA 1FLVA 1U28C 1ULAA 3TN7A 3RJZA 1QE5A 3PR1A 2Z1DA 1WSDA 2HBZA 3PXAA 3O3CA 1XMIA 4GMGA 5C31A 5K20A 4DV3B 2HGSA 3GH3A 1RTKA 3WDMA 4C76A 4ZCSA 4J0KA 4WOKA 3QFRA 1NPYA 5NULA 2G0NA 4Q16A 2A9JA 1U8EA 1IVYA 1NG1A 2BTQB 3RS5A 3F73A 3E53A 1FDOA 2XUHA 1K9SA 4XR9A 5EP4A 1UBEA 4PCVA 3WHIA 3GZ4A 2J9GA 2ICAA 3B7PA 3TAHA 5KWSA 5BN3A 4KVGA 4LWQA 4PTLA 5T8KC 3T35A 2NTYC 1PR9A 1GNQA 1CNFA 1N9KA 4KK4A 2EFYA 1JIUA 3FSJX 4XPZA 2AFHB 2Y3IA 4YJ3F 2PMFA 3S1AB 4GPTA 4P4SB 1GQ2A 4FJ0A 1GM5A 3EXHC 4LZOA 1E2BA 4DKXA 4O4IA 2XUZA 4IH4A 5I6DA 3PJDA 3RLIA 3FN4A 4A6XA 2YHUA 3CEPB 3IIMA 1NVBA 4UHCA 4CMGA 2C4NA 4TXNA 3UKDA 3EPLA 1XL1A 4DC0A 4D4KA 3UGJA 4ABTA 4TRRA 1EKXA 4L16A 2IRWA 1F20A 2JB9A 4H1TA 3GOQA 1NJ6A 3HJAA 4MUAA 4U2DA 4DQDA 1OWMA 3ELWA 3PTZA 4DQ2A 1SB8A 2Q5EA 4I4IA 3UJ3X 1FZQA 4TPKA 1HI9A 1O6GA 2OZEA 3NAZA 2QX7A 3D3WA 4COKA 3ZJUA 4JFRA 1N6KA 1EFVB 2V6FA 3EUAA 3HV2A 4PGAA 421PA 4KYUA 3LHSA 2N1MA 5A7GA 3EUEA 1QG6A 4B8YA 3OZWA 4R69A 2JATA 2QE7A 2A92A 1RWXA 3UAYA 4EO7A 1TQDA 4ARIA 4J3NA 4G67A 3TKYA 2V0GA 3IEPA 3UXMA 1JDUA 3ET4A 4TVAB 3MOIA 4E5UA 1XEZA 3OX1A 4OP2A 4BQRA 4WZ6A 3UATA 1IJFA 4WZAB 2B7LA 1S5PA 3SOZA 1I7QB 2V7WA 2YVQA 1SZPA 3MQFA 5K3FB 3WGLA 1RIIA 1KRHA 4IDOA 4UNPA 4JJFA 4YIKA 5LQNA 3N0WA 5KBYA 3BHMA 3U4CA 1YL6A 3OCYA 4LIPD 2BFDB 2Q3DA 2I22A 2QW1A 3FGPA 4YCDA 1XD9A 2BLLA 4V0NA 3DL2A 1PQUA 2DULA 2GN4A 2QL9A 5B2FA 2C1ZA 3OUTA 1GGEA 4M89A 4E51A 3KAPA 4ZP1A 5ALGA 2LE0A 5LP6C 2G7MC 3ORSA 3TBKA 4YCCA 3QXSA 2R5WA 2HNKA 2WZQA 4A92A 1OA0A 1KYZA 4L9WA 4UDYX 3X0DA 3H6GA 3EARA 5BR7A 1ZD8A 1ZUNA 2I1VB 2QD3A 3HP4A 3NVAA 5D2CA 5GVSA 1MO5A 3K0FB 5IYZF 4CCAA 4LSGA 3VNQA 1VQ1A 2MYPA 5CVUA 2VA9A 3DLHA 3KHTA 1YGPA 4LF5B 1J0AA 3WO1A 3MJRA 1H5UA 1UJBA 2AJDA 2Z9CA 3ENWA 2HF9A 1JKFA 2ZJ5A 3JSAA 4A26A 2HN9A 5HZHA 4ZTUB 2GBIA 5ETJA 2QROA 3I9V1 3H1PA 1RQ2A 1YCHA 4C3UA 2XWBF 3NTUA 4IEFB 4CMIB 4A15A 4BJHB 5CBKA 2RHLA 3CRMA 5E1MA 1KZYC 5HDQA 3B1WA 1A04A 1FMJA 5AT1A 4ZVUA 4CLOA 3C6XA 3FWPA 2V4MA 2FW0A 12ASA 2FZCA 3O2SB 4BU0A 2VP9A 2Y77A 3AEYA 3HDQA 4YC7A 3S68A 4RTJA 6LDHA 4YRPA 5M34A 1KHHA 4IZOA 3TL6A 2AE2A 3FNQA 1C9MA 3RTCA 4BMSA 3UMCA 5IJZA 1KNXA 4MI6A 1GAQA 2EKZA 2EP5A 4MLCA 1K2WA 3FPGA 4OXKA 4Y6GB 2HA5A 2BSQA 3OD1A 1Z8FA 4ZKEA 1GQRA 4KG7A 3NX4A 4LKOA 1DAFA 4QXQA 4NY1A 3KPUA 4FCVA 2ZTMA 2B4YA 2Y4NA 2PG3A 2V0CA 5FFMA 5BWNA 4LYEA 3L8MA 4D9KA 5I4BA 1C0IA 4YTEA 5DWQA 5EJFA 3BK7A 4ZYUA 1H2EA 1Z0FA 4PRZA 3ULKA 4E3WA 2WAMA 1DBWA 1Q95A 4QBHA 1GCGA 1KO5A 2AI3A 3OE1A 1U0OC 4V0OA 3V8BA 4J43A 4YV7A 3W8DA 3RGGA 2O57A 3PPXA 4H7IA 1XNRB 3ZIGA 3ZHTA 1I5EA 2PKCA 1Z4IA 3D6FA 5EXTA 4ZC8A 1P5JA 4CRWB 5AOBA 1U1FA 1EVKA 2FWIA 3FUXA 3HFGA 4K8OA 4M8SA 3IO5A 3WYFA 4LTDA 1HE4A 2HA3A 3A3PA 5CGZA 3GRFA 1KFKB 2XT6A 4FB5A 3MTIA 2XUJA 3IE1A 1NN1A 5AVVA 3ICWA 3AT1A 4S35A 3CYFA 3O7MA 3LIPA 1SQFA 3AQ4A 1W9MA 3WJAA 1RCUA 1Q0QA 2AYYA 2F67A 2O1XA 2X1HA 3B9RA 1HXDA 4LNUA 4MWSA 2OMEA 1IL2A 4IAOA 3AVTA 1JWBB 3ICEA 3ZDYB 3TNDA 5EZYA 1QZUA 4GMXA 3L4BA 2A33A 2GASA 3PRKE 2W6PA 1PFUA 1JLSA 1X38A 2X0RA 3B20A 3DG9A 4JI1B 3VZPA 1E0KA 1SOUA 1O6CA 4GW3A 4F5EA 4NQZA 4OXQA 1A8QA 3AU9A 2WJ3A 1U7DA 3BORA 1OTYA 2BY4A 3DEHA 2ZINA 3QMPA 4ZT2A 3SXUB 4BAZA 4X5OA 1G5FA 1YHYA 2R5NA 1T10A 2WPNA 4WJZA 3SGLA 2Q9CA 1C0AA 1MJFA 3TQFA 2RKBA 3R3WA 1NULA 2Q3JA 3MJVA 1C50A 1FK8A 4DCPA 1MDFA 1J2EA 2HDHA 3RVLA 1WCIB 4TQDA 4IKEA 4L07A 3CZMA 4LZLA 4RF2A 4EMSA 1X2BA 3MT7A 3O95A 4KQ9A 2X2PA 3UH1A 4CM7A 3DDCA 1GU7A 4EM6A 3ESDA 3TLZA 2E87A 1EJBA 3OU6A 2UYQA 4EAQA 4U7WA 2CSXA 3DJFA 4BECA 4IDEA 2OBLA 4HXGA 1XRMA 4GI5A 4WFKA 3QSYA 1NHGA 3SE0A 3F71A 1WZEA 5J2TF 1JFSA 2QVGA 3BXFA 1UMKA 1LQ2A 3A9UA 4S1NA 4FWBA 4XX0A 5DI3A 5FR2A 4BNIA 3AF6A 2YZ2A 3S2ZA 4IYRA 1TRHA 1UUFA 4E31A 3AEKA 3CHYA 4L87A 2HI0A 4JLSA 4KWHA 4JAVC 5D6OA 1G8GA 2W93A 1IVSA 1T9KA 2I6TA 4LDZA 3QRWA 2C8LA 2WUFA 2Y1BA 3ISTA 4JP2A 1F0YA 5EKUA 3TXYA 2TMDA 1N9GB 2RONA 4HRVA 1REQA 4M1KA 3VR6A 1TW2A 2XIQA 4F93B 3FPHA 1AIPA 1ND5A 1O7JA 3FTQA 5E6SB 3ANSA 2O19A 2IS2A 1SKBA 5C53B 3JRNA 3WNVA 4P8RA 2E1PA 2Q6IA 3LKDA 3A27A 2Z09A 1EUCB 2FFAA 1V35A 5ALJA 3RSSA 4ZOLF 3E18A 4H31A 4KKVA 1T9DA 1YZUA 1X1EA 2OT3B 2JIMA 4JKYA 2XXJA 2YY7A 4XTRA 4MS3A 3PNVA 2PX4A 2EK0A 3LECA 5J47A 3X2SA 5SZJA 1SEPA 1CQJB 5IEBA 1ADBA 1J06A 2FN8A 4KHPB 4ZCMA 1VG9B 3R77A 1RAFA 2VAMA 2I2XB 3QEAZ 3IABB 1S8NA 3CLRC 4DUGD 5EKTA 1XTUA 4JMPA 3H5NA 3NHUA 3IDSA 3CRW1 4MVJM 3U26A 1B14A 3VKHA 2EQ5A 3M0EA 5J1SB 1CF9A 4R4JA 3VTKA 2DHRA 1QHYA 3TNJA 3PPYA 2XUOA 3QEOA 1HE1C 4MYSA 3PC6A 2XYRA 2X8JB 1W19A 4I1VA 4LE0A 1R0ZA 4D9GA 2JLYA 3F8SA 4LHEA 4LCJA 1J25A 4DADA 1U63A 4FDAA 1LLCA 1JAZA 1PYDA 2RCNA 3GFOA 5ALZA 5FV4A 2JFQA 3R6LA 3F6SA 2IFTA 3LIIA 1DBIA 1P7ZA 3IBGA 2GHTA 2PUEA 1BEZA 4A8JC 4I3FA 1BW9A 1H1LA 2Q9AA 3DXZA 1V16B 3Q7IA 3EJ6A 3SDZA 5L53A 3Q3IA 1UBMS 1KC1A 4EY3A 4YV2A 4GNRA 1MJGA 5JWOA 1BDBA 3WAKA 5KNCH 3WZLA 5HJEA 1D2EA 4PCLA 4B82A 4EY5A 1NSFA 4FFBA 4UFOA 5ALSA 3VU1A 1CVLA 2OUKA 4PTZA 2GXAA 3T0GA 1MD9A 1PR1A 3MWKA 3I34X 1DAPA 4KCGA 3OFKA 3LHIA 1B16A 3PYLA 4OV6B 4QDXA 1I0IA 3PDWA 2AN5A 4MKGA 3ML1A 3LQRA 3RHFA 3GYBA 3MT0A 1USGA 3CLSC 2W6MA 4FFNA 1J07A 2A58A 3FYHA 5AKIA 3D6UA 3P20A 4FQ7A 3VDRA 3K53A 4G84A 2H4JA 1JDJA 1QIGA 4BKRA 5LOVF 3NGMA 2KLBA 1K2VN 2EJVA 2QE6A 1ZM2A 1Z37A 4GP9A 4IRUB 2UZ1B 4UUBA 5ENZA 3KLPX 3BTVA 5C0OE 5EIEA 4HL6A 5AHOA 4C4XA 5HOQA 3I6IA 2CJBA 1B0AA 2OV3A 4TLLB 4UTPA 5I48A 4KGZA 4EITA 1Q19A 2RCYA 2H1LA 2OZLA 4KX3A 4MDEA 1O08A 2G1PA 2Q49A 4R3NA 3ZCUA 5JYCA 4TKLA 2F1OA 3H5TA 2ORED 3AHDA 3BXHA 2H0AA 4HGNA 3TSOA 1RJFA 3OAAD 3V97A 2ZZMA 4O33A 1ZIPA 2VWPA 2C9CA 4C6RA 2WDPA 1FVHA 3A31A 1HO3A 2CXNA 2HEIA 2PSJA 3P0HA 3NMUF 4G86A 4AZSA 1FFSA 1FUYB 1L8QA 4O63O 4F6RB 3HKCA 1CR6A 3PNPA 1VA4A 2VTEA 3G0GA 5EIBD 4S2UA 1KBZA 4BFCA 3DDOA 1YIDA 2YV5A 5ALUA 4AY6A 4AZ0A 1ACJA 1UBUS 4E1VA 3CQ9A 4JYAB 1ECFA 4JZKA 4UE2A 5E3HA 3KS9A 4P71C 2AJLI 1NFHA 3TLGB 5C81A 3KXLA 4KVZA 2BJVA 2TYSB 4FIDA 4NBWA 3BH0A 3TLCA 4X97A 5LJIA 1RWOA 1I6WA 2FMHA 2XTMA 3FNFA 1IHYA 2GPAA 1I1QB 1NPDA 1LA2A 2MMCA 1RE1A 4FKBA 2I3ZA 4G5OA 2VXBA 2QRLA 5ED0A 4FMBB 5JAIA 3ETLA 3EZ6A 1IHUA 1U8ZA 1ID1A 2EX0A 1LBEA 1YONA 2ZLBA 3ZW7A 4ZMRA 3O4GA 4GPIB 3VM6A 1RP1A 3TEGA 4OP1A 1C8LA 2PXCA 4Q9IA 3WWEA 2RJNA 4CEHB 1RXCA 1HF3A 4EJSA 3WMEA 4M55A 1CY7A 4CCYB 4EKGA 1X7ZA 3EQ2A 5I3ZA 1XC7A 2B98A 3NHJA 4AKSA 1G8KA 1U5CA 1R3DA 1NM5A 3KZXA 1A27A 2QTGA 3RUEA 2WDZA 4E1AA 3E7WA 2Y0EA 4RTKA 4GECA 3M9WA 4HB3A 2MSCB 3AEZA 3KOOA 1XTBA 1YAHA 4IWXA 3DVAA 4QODA 1HWYA 4LY3A 1WL8A 2DE0X 1AUOA 1UWKA 1W4RA 4XB2A 2WAOA 5JS6A 1OWPA 3FYDA 1AQLA 2SICE 3MUNA 1U90A 2XB6A 3QNEA 1U0GA 3RHSA 2AHRA 3AUKA 1NUHA 5KCZA 4MCHA 2CWWA 4Q9LA 2DFKB 1TLTA 3F6EX 4U6QA 2I1QA 4EUHA 5JIBA 2XKJE 2XX3A 4OM7A 1Y4DE 2AMCB 4I1UA 2VPPA 1SCUB 4KVFA 2DF8A 4K6CA 3USZA 5EZYF 2C42A 5JG7A 1GADO 4GZ3A 3TLGA 1FDTA 1RM3A 1FTQA 1C2TA 2NZ8A 3R5KA 2ZT8A 2I3AA 4C3ZA 1H3FA 4C4OA 1RPNA 1PN3A 4QL3A 2WUVA 3EVEA 3N39C 5DMXA 1E92A 2VJPA 1ZOPA 4RYDA 4X1OA 1XYVA 1TAGA 3NWEA 5FQNA 1YWGO 4UDNA 3V9AA 2GNPA 1TQ2A 2DFPA 1S2DA 3A1CA 3DQZA 2BFBA 3H13A 1PW7A 4NEGA 3COWA 4RKQA 1K6JA 5FTMA 1U2GC 1ISHA 1ISMA 2NU6B 3GA0A 4TWJA 1ST2A 1KERA 1PJ3A 3GL9A 3M6VA 3AKDA 1MF7A 1J8VA 2FFBA 3CB2A 2OOSA 5EMKA 3EIHA 3GFGA 5FOUA 5TGZA 2IZ0A 2R2GA 3RUIA 3H4MA 3MM4A 4LQLA 3THYA 2Y1DA 4CM4B 3RFFA 5BR4A 5JD3A 2NPFA 1RCTE 2C2GA 1CJCA 3DZCA 3K16A 2W48A 4BFVA 4CR8A 1E7SA 3RTEA 1PJ8A 2FZ4A 3FR8A 2EBHX 2V7QA 4YCWA 3GJ3A 3AIKA 1UODA 3D0KA 2FR8A 4PZPA 3AFMA 1G7TA 4HEJA 4QFDA 4X1KB 3V1KA 4ERNA 4L75A 4I9FA 4L1KA 5GVRA 3O47A 5TT0A 4X63A 3UNXA 3PT5A 5AW9A 1V48A 3H7AA 3L02A 2A30A 4LYHA 5I5GA 3SI7A 2WD7B 5EMLA 3P26A 2O2YA 1NASA 1G60A 2HK6A 3OLYA 1AKVA 3RS4A 3QKUA 1KMHB 4UCQA 4JJGA 2EW1A 2J7KA 2P78A 1RAHA 3ROEA 3EZ7A 5K0FA 1E9FA 1E7WA 3PUVA 4WLVA 5EEGA 1EXVA 1RS0A 5DTEA 1B0ZA 1EFKA 3R7BA 3L0SA 3ZWCA 1BDHA 3GGJA 3NAGA 3K9HA 4AY2A 1K4MA 4O4HB 1RJEA 1Q57A 4HH4A 5B3JA 4ZALA 4EYGA 1U3UA 3LOPA 3AVYA 1IU9A 2A78A 1XFAA 4NE2A 3ONEA 4RMNA 2C84A 3W5JA 1FNMA 3PC7A 4ZAVA 2QLBA 5DXFA 1A69A 1IBCA 1U0NA 2PBLA 4Z9EA 4TKZA 4MPDA 3VTFA 4TT8A 5IHPA 4PLFA 1FE8A 3WMGA 5TNXA 3MB8A 2ARTA 4H2UA 1K5HA 1NVWQ 2WWHA 3GY0A 4QXAA 5AOCA 5FPSA 3COJA 13PKA 4FW9A 3HTXA 3BEOA 3PQCA 1AK9A 2H06A 2ZRGA 5HF6A 1DOAA 2FPGB 1WXFA 2QNIA 2HAEA 3THXB 5ICCA 1YBMA 4NE9A 4FI3F 1T26A 4PPYA 1AMNA 2FX5A 3KB8A 3OTOB 4LX0A 4GSLA 4LA4A 4QGGA 5DRYA 2UAGA 4MUYA 3UJBA 1AQJA 4WUTA 5C51B 3T5PA 1TTPB 1P5HA 1EJ0A 1Z08A 5CDHA 3HKCB 2EFJA 3ZHCA 1OLUB 4BKUA 1D1PA 2IL1A 4JFAA 1W59A 2QVBA 5BSWA 1U3WA 3AP3A 1E24A 4ZT3A 3VHQA 4DNFA 4Q01A 2XY4A 4QEDA 2WIGA 3WRYC 1L0BA 5J63A 3IQEA 4FU0A 1E1QD 4KR7A 2WABA 1DX9A 4I5FA 2B2XA 4CF5A 2ZWVA 4WTOA 1SBTA 3NWJA 1H3EA 4GF5A 4D0NA 4NENB 4AS2A 1D1QA 4G0ZA 2DUWA 2ZRFA 3LBHA 1TJ4A 1GL9B 2E9SA 2Q3LA 4OQFA 3A1NA 4OXIA 4TVBA 3WLIA 3WXMA 1W4LA 3C6QA 1XHLA 2YQ5A 4PR0A 5AJXA 4PQEA 1GUFA 4AG6A 1ULUA 1NG9A 2AQHA 3OFNA 5JAZA 1MRSA 3FOAA 1T0JB 1NKVA 5B64A 1HDEA 2FF7A 1Q0TA 3KSDO 1AZWA 3EGEA 1C41A 1ZD5A 1R1DA 4XD2A 4LY0A 4EECA 5F1YA 1QM5A 1IWPB 1UJMA 4YT5A 5UKDA 1KR5A 2PWPA 1E9AA 2ZIAA 1Q44A 5FA8A 1QK4A 1RDFA 1WF3A 3L4JA 2EU8A 3AERA 3L1JA 4C6TB 1BG6A 3I64A 1FYVA 2BEWA 2R7MA 3QUAA 5E9QA 1CQPA 5BUQA 4NJEB 2RK3A 2QM7A 3DL4A 1XCMA 3LY8A 4I1IA 4ZARA 1X1CA 1YZHA 3B6MA 3EXG2 4PVDA 3QOYA 4DJEC 5CVTA 2H1IA 3ZWBA 1MA0A 2R47A 3EVFA 2NMVA 3NEYA 4FNMA 5F1PA 3L9XA 1J2JA 2XAAA 3UJ8A 4D82A 4R1PA 2Z8ZA 1PV2A 5DE3A 3T7TA 2A0FA 3G5AA 3ZXYA 3DCIA 2VAXA 1HE8B 3AHEA 4N7RA 3CX3A 3K4PA 4BKOA 2AR0A 3UJAA 1ZGJA 3Q41A 4C0WA 1RVV1 3WOHA 4RJTA 1RFLA 2EFCB 4ISCA 5TF0A 3WLLA 2WR8A 1JALA 1NV8A 3OI7A 1ZGAA 4LZPA 2ZJ8A 4WN3A 5SYAA 1X92A 3WNZA 1Y42X 2GZDA 1WV1A 1WULS 1EK5A 2JFHA 3AUAA 4HDRB 4RFSB 2I5PO 2R1TB 3GJSA 4J1QA 2FW8A 3DPIA 4OK5A 4M49A 2YWRA 3SXJA 3TIIA 1P7YA 2DTIA 3JQFC 4PRLA 1IAVA 5JNSA 3P9CA 4NHOA 3TUPA 2P3LA 1WNFA 2CEAA 2WSYB 3KOYA 1XRRA 4YRIA 1DQPA 1P5ZB 1FRFS 2AMFA 3MQ4A 4F4JA 1WKCA 5G3YA 3VNSA 4MOWA 1YI1A 4D57A 1FRQA 5FBZA 1EJ6A 4GUAA 4B83A 5T57A 3HFZB 2ZUSA 1O03A 1T4CB 1XMXA 3O21A 4DUZB 3H9CA 1FFEA 3HB4X 1IOLA 3TAUA 3B8HA 5ICMA 3QITA 4AAYA 1VPLA 1ZPDA 4NBLA 4CDMA 5AKYA 4BO7A 3EDOA 3L4EA 3QSGA 4YQEA 5JRZA 1GYRA 3K5IA 1ZESA 1ZD3A 2QQFA 1N1EA 3PE4A 3U7FB 1IC6A 4KE9A 1L1FA 4BNDA 4RPHA 3COVA 3DKPA 4RNDB 5ALOA 3DS8A 3L5OA 3Q6NA 2HRZA 2BEVA 3AR6A 4IZ6A 2HMSA 5JDCC 2OPBA 1P1KA 1EVZA 1MPTA 1TEVA 5FHRA 1PSZA 4FGZA 3HXKA 3UJCA 1WLYA 3IMEA 4UTVA 5K8UA 2FN7A 1VA5A 4H59A 5JUWA 2Y0BA 2ZSDA 3RF6A 5EE9A 2X0KA 1FDRA 4B4DA 3MMPA 4NCXA 3WWOA 2Z98A 2HCTA 2ZJ6A 3KOWA 4PYOA 1KEKA 2PGIA 5FBQB 2Q4EA 1T2DA 1KYWA 4B43A 3RYCA 4TMTA 1II0A 1JHPA 2Z6AA 2DFVA 1GAJA 2WNSA 3BXZA 2SKCA 4A2PA 2ZIVB 3OOHA 4QZVA 1ETHA 2GZ1A 3TIGA 2NV6A 1W2WB 2ZTGA 5HA5A 4LPSA 1RHQA 2EHDA 2Z3WA 3QOWA 2X2EA 3NBXX 4JL5A 1V1MB 4KQWA 4F8JA 2IE8A 3C41J 1E2FA 2DECA 3LCCA 1HDIA 4FMDB 4JC5A 3D8SA 3OA0A 4JHLA 3NJRA 3VHXB 5E8RA 1MX9A 3A1UA 1YQWA 4TQUS 5CA0A 2OENG 4M53A 4PINA 5AKZA 5GQSA 2ZI7A 1I2BA 1X70A 2AD1A 2JLXA 3UB3A 2J3HA 3MINA 4RZXA 2VSYA 2CJYA 3BGVA 1YIAA 4DNQA 1FOEB 1DE0A 3GH1A 3GFPA 1G2IA 1G8MA 1QVVA 1SB9A 2Q8PA 3JS5A 3QLUA 3G3EA 5E8JA 1B6GA 4E4RA 2ZE7A 3DA8A 4PLZA 5DLEA 4I81A 4CQMD 2ZYHA 1ZGCA 3ZG6A 3R3HA 1ZJ5A 5AI6A 3ZQ6A 3D4BA 2GT1A 3FFBA 1P8JA 3QYPA 4MRVA 2X7XA 4BYMA 2Q4DA 4WK4B 4ZYZA 2KJQA 1GCAA 1LJLA 1Z63A 2ZSIA 3F46A 2ZU0C 3IAS1 5KX5F 5AOAA 2SBTA 2OO7A 2QMOA 2XMPA 4FFPA 1EBUA 3PYMA 5ALKA 3O4VA 3T1OA 2HBRA 2OECA 3K9QO 4E46A 2XSZA 2CCJA 3FCXA 4C4ZA 2DPGA 1I13A 4OA5A 3WMFA 2ZJOA 3HFSA 1Z0IA 2HA6A 2IYTA 3H4VA 3TE7A 1H6DA 2V7QD 4P7JA 5HG0A 4A91A 4ZOLA 1RABA 1S1CA 1N1GA 2CVHA 1KAMA 2D3TA 3EN0A 4CLOB 4DV2B 4JI4B 5ANRB 4AKHA 1YIOA 3BFVA 1F60A 1UXHA 3G82C 5I3CA 1ZUWA 2AG8A 3CVOA 5EEHA 4GSKA 1G55A 1I1NA 2EEPA 4XXHA 4ICIA 1T6BY 5SICE 4BBZA 4GMHA 2HCRA 4WDQA 4V1CA 2RKWA 2X9NA 1XGKA 5HKAA 3VR4D 1BCRB 3TR5A 4WCDA 1CHDA 2VJCA 1RT9A 3ABZA 5A2QA 8GPBA 3E8MA 3P2JA 2H63A 4EHKA 2ALYB 1GEEA 1GCUA 1MCZA 2Z57A 3HKEB 4BLTA 1QOZA 4NCAA 1SR8A 3S70A 4L02A 3DMHA 4WBXC 1C0KA 1MV8A 3BMQA 1T2NA 1XK7A 4D26A 4FYMA 3SZMA 3EJWA 3D8UA 1G8FA 1I4TD 1NC3A 1PL0A 3ZI0A 3V7SA 5FA5A 1OWNA 2Y0DA 3SDSA 2IT1A 4DT1B 1NQ5A 4MMXB 4IF4A 3UWSA 1YB5A 2VKTA 1YJQA 1XP5A 1SM4A 2YRXA 3P4XA 3WK6A 2A9VA 2QYSA 4KLNA 4ZRDA 5EYPB 1AMOA 2L8YA 3BRWD 3M6XA 1FDSA 2MSLA 3GAAA 3NWOA 3CJRA 1L4FA 2JFVA 3SX2A 3VNBA 1Z7BA 2H0QA 2VJAA 2W6OA 3HKDA 3EFRA 3D3NA 1VE1A 2SHKA 3HU1A 2DKFA 4G36A 4JUFA 5TV2A 1DINA 2AFIA 2L2QA 3TE6A 1J0BA 3NTOA 1FNCA 2X1MA 3ER8A 1T2EA 2HSWA 2A8EA 3I0ZA 4H7EA 4ZVMA 4DPGA 3B9QA 2B2CA 3U4DA 3ZR4B 4P7GA 1CIPA 1JDPA 2C7IA 4PYMA 1NZDA 2HWWA 3QNWA 4IIXA 3M34A 1CQIA 1D0IA 1D4OA 1TQ8A 4PNHA 4RGBA 3VSCA 4B0PA 3GLIA 2AN3A 2EJTA 3VKVA 1QU2A 2FUCA 1WQ3A 5TLSA 3R5XA 2OV1A 2PXXA 2I03A 5A2GA 4LFBB 2E4ZA 4GWKA 4UXJA 2VJQA 3SSNA 1E7MA 3KVYA 3GJQA 5AIBA 3HN7A 3ENKA 4I4NA 2BR4A 2C95A 5ENVA 1QGZA 3E9NA 3RVDA 1XN4A 2X4GA 4M98A 4YMHA 1D1TA 1NYTA 1R4MB 3PSAA 1G3IA 2DWCA 2XBMA 1NV9A 3VQXA 1SESA 3JARA 1O9GA 1C81A 3LKZA 1TU3A 4RQAA 2GM9A 1BU5A 4PLVA 2JLQA 1W49A 1FP1D 1DIRA 4Z2YA 3HKBA 2IVFA 3IMKA 1JX6A 2QUIA 3UGQA 2P4SA 5E7QA 5DTJA 1NBMA 1ODLA 2ZWMA 5IRCD 1W73A 2C2XA 4KRYA 4HBGA 3OE4A 4DVGA 4V2IA 2VDOB 4B87A 4EB8A 3RYCB 1DPGA 4P6VF 1M5TA 3L7YA 4FYIA 2ZYWX 4YUYA 1DKOA 4JLOA 5TDHA 4DLZA 5LM3A 2AEJA 2QENA 2KS6A 5DWDA 1QLJA 1QTQA 3ONFA 4EOGA 3QVTA 4KL8S 2BI7A 3R6GA 1JB9A 2JI6A 4L9SA 1K8QA 1QANA 3QU9A 4ZVRA 3R7FA 1O0CA 3CX4A 1PFYA 4XWGA 3CW2A 2X9GA 3D5EA 3I4LA 4CVNA 4Z3OA 3BA6A 4KR3A 4D42A 1XJ0A 4Z4GA 4LMBA 4HTFB 3A2LA 3S6JA 1TMOA 2I7TA 5AJYA 2A5LA 4QQ8A 4WN9B 5C34B 2P3QA 4WOCA 4CKBA 1HZZC 1WIWA 2RHSB 3M6FA 1T1RA 3FPCA 3QLUC 3QP9A 4KYTA 4D5EA 1IN8A 1CDEA 1PGJA 4AQDA 4PAMA 1NKSA 4V0RA 4F21A 3RADC 1HKHA 4IX9A 5KOIA 4MA5A 3MUFA 3PS9A 4MVXA 1GGVA 1NQTA 4OXNA 1BWPA 1QPGA 2QRVA 4R0VA 1JDVA 3MQ2A 3TMKA 4L72A 5LBTA 1W4BA 2CGHA 1M2VA 1T0BA 3FRJA 3O4RA 3C7AA 2W6ID 4NLLA 2A0YA 1WTAA 3U3OA 4GOLD 3O92A 4Q93A 5JANA 4BMPB 3C1UA 1YBAA 1NQVA 2XNDD 5ULLA 1QHXA 4W7SA 5BN4B 1NQOA 4JJZA 5MGNA 3WRWA 1Z0KA 2C2KA 2EERA 5EE3A 1W93A 4XVQA 5HCNA 1ZN7A 3RRFA 4TKUB 2C4TA 5TB5A 1FRNA 2FPMA 3IDOA 3LDUA 4XQGA 1UAGA 4TS9A 1LFDB 1PI3A 4LKRA 4J9VA 4NH0A 4RWEA 2UUPA 3CE6A 1JJVA 2WSLA 1QUEA 8LDHA 3BIWA 3SNKA 3SFZA 3NS7A 2ET6A 3FY4A 3WKAA 5ADHA 3RLFA 2CWDA 1GR0A 5DHTA 2R8PA 4FE3A 1A2KC 2HO4A 2AOUA 1XZBA 2E1RA 1KA9H 1QE3A 1DJPA 1U2ZA 5LYJB 3VHLB 3H11B 4RVFA 5FIUA 4G1FA 3AF0A 3SYNA 1H2BA 4CV0A 4KGVA 1P81A 3T9AA 3VPAA 1SCUA 2NZYA 4HJXA 3OQ1A 2ADMA 2FPUA 3ABSB 2I54A 4OQMA 2RGRA 1E2NA 4PQRA 4WASA 1I0ZA 2C1EA 3MTAA 2YZGA 2ZQ5A 5HF9A 4IIFA 4TMVA 2B92A 1E8MA 4NL4H 2FB9A 3L7KA 1KZHA 4CEIB 4DDUA 4MB0A 1NRXA 1T8WA 1YB7A 4HZGA 1QPBA 1LNZA 5CA0F 2CUTA 2OGZA 1ZFNA 1L7MA 2UYHA 5EFZA 1YDEA 3DVLA 1V9LA 1KJYA 4E5NA 1V6SA 2VT7A 3WYAA 4I9HA 4GH5A 3SIWA 5K0SA 1XRQA 4WBNB 3TG2A 4DFDA 3U44B 5AW7A 4B3TB 1DXYA 5TQ2B 1YOBA 2HC9A 4N54A 4P4UA 4EF4A 4ZZ0A 3HRHA 3LT2A 4HGQA 2LUOA 1DOZA 4JX8A 4TTSA 4OI0A 1CY0A 2ID4A 3UENA 4ESHA 1NX6A 4MMYB 1MJHA 1NXXA 1ULBA 1WSWA 1F0KA 2QGZA 5FWXB 5BMOA 4QKQA 2O3TA 4BFSA 4RK1A 4DMMA 3ZUGA 3LLSA 5KIAA 1MIHA 2Q7GA 1M7HA 3EOZA 4Z9BA 4C2AA 1W46A 2OCKA 5WRFA 4RTOA 2I9PA 3C4QA 4GICA 3QPDA 4L8WB 4L9AA 3WL7A 2Q8NA 1BVHA 4ZI3A 3VPHA 5TQ0B 1K7FB 1XZGA 2JDID 3C0KA 2XEXA 3AFNA 4YRFA 1SC6A 1I0LA 3N59A 3GDHA 2Y0PA 4YJDA 1KRXA 1IDN1 3UMSA 1A8SA 2J7PD 2O48X 1SBCA 4MGIR 4HH3C 2I76A 4F9FA 1P1FA 3DKRA 4N6OA 4IQFA 4US2R 1PT5A 2A9KA 3OT4A 3EQ8A 1WXIA 3ILYA 1YUBA 4RFVA 3W5UA 2VATA 2PKQP 4JA2A 4IJWA 2QR2A 4M0MA 5BSTA 5LDDC 4ZVLA 3U4MA 2QZZA 3CFYA 3OCZA 3WBJA 4FQ8A 2H1HA 2NV0A 3BH6A 4OI2A 1JYFA 2QHUA 2SKDA 3EA4A 2HUNA 4H7DA 4NYMR 4RY8A 1DIAA 1ZITA 2QUJA 4HNTA 1CY1A 2YC4C 4UBMA 3KQNA 3TLJA 4BHTA 3I2IA 2XB4A 3ZNNA 1XEXB 1UK8A 1KAQA 3FM9A 5F5WA 1WUIS 1IDOA 2W2LA 3T3OA 4L3WA 3BA1A 5CITA 1SKMA 2LW7A 2JCBA 1E2IA 3KZMA 4GQIA 1TAHA 2BTQA 4GXNA 4MGHA 1L5KA 4YMVA 2DWPA 1NNI1 1JEQB 2QN1A 3ELYA 3U9LA 3VH4A 3M5CA 4Q3OA 2JKYA 4YUZA 3TSQA 1II8A 4G0MA 3SM3A 2GN9A 2OD9A 2LZ0A 1EXDA 1GZSA 3EWAA 1XD2A 2CW5A 1X1QA 3KK0A 4C3OB 2PL5A 4DA0A 5JASA 1Z7NA 2HHLA 3A14A 4JCCA 4EJMA 3C3KA 1E0SA 1J8QA 4PSDA 2OORA 2EQBA 1BXRA 3RABA 1IXSB 2FMXA 4ID9A 2VRBA 4A27A 5I4CA 1TC1A 4UNQA 3KTAA 5I51A 1PBNA 4WZZA 1QMGA 2CYAA 3DV0A 2DQKA 2QVYX 3DLCA 1RZUA 5AW8A 4PHFA 2ETVA 3OC6A 3II6X 3GXBA 1P33A 5BP7A 2YHBA 3WKDA 5JDIA 1VBMA 3UMYA 4WVLA 4UARA 4B7ZA 4GBJA 4I5EA 3HZRA 2A88A 1RPTA 2IU6A 3C3CA 3CUTA 1TM3E 5FBKA 5LC1A 1LSUA 3UW3A 1T5DX 5IDWA 5EE0A 5HILA 2F48A 3C1OA 4F12A 5TMBA 5EGSA 3I01A 1E1YA 2ZQZA 4QECA 3MWLA 1RHJA 3S2GA 4CW7A 4HN4B 2GEDA 2EL9A 1L8LA 1RXIA 3RS8A 1Z29A 1BXZA 4AH6A 1I1HA 1CR1A 1ZVMA 1HSZA 4Q4LA 4RH0A 5KWEA 1EUYA 2IDZA 4GLLA 5FUXA 1KJ9A 2PQ6A 2YBEA 3VOTA 1IG0A 3L7JA 4IH9A 2G04A 3FYUC 3IT1A 4NYJR 3Q15C 1UCFA 2D0PB 1WW8A 4F7DA 5KYXA 1SVKA 4JQSA 1M0EA 3SQNA 4KUHA 1IPHA 3R6DA 2QD2A 1IN4A 5GP1A 1L9XA 1Q3HA 2AUMA 2GCIA 1U2DA 2ZRMA 3AESA 4PZLA 1TW3A 4B45A 4Y6OA 1TTTA 3U62A 1V4BA 1XQ6A 4BTEA 1L7NA 4JP1A 1W30A 4LRYA 4RF5A 2A7QA 3HNOA 1HKUA 4WXPA 2QSJA 4L27A 1S4QA 5HSGA 4POOA 1Z3IX 3EX7C 2DQYA 3ELBA 2DERA 1MORA 4BUJA 1CJTC 1JEYB 4C0BA 2AFHA 1KI3A 3MGBA 3P0RA 2JAWA 3WL5A 4GYWA 4BP3A 3BK2A 1L4EA 3WA7A 5E4FA 1X1BA 2PD4A 3LTEA 3IPXA 2J1LA 2YRFA 4G63A 4MUKA 1FFCA 3A6ZA 2ZIUB 4RVHA 3AV0B 3K1TA 1NYRA 4RH1A 4HWSA 5A4IS 2RHHA 5HQ3A 3LP5A 3EZGA 3E3AA 3GLVA 3PB3A 4IYJA 3DSRA 4U7JA 2GM3A 1SJ9A 2A9PA 3PNBA 1T36B 4URWR 1NUAA 4ZAZA 3JQ9C 2HK8A 4MRMA 3LPMA 1YC5A 3O82A 3NCHA 5JHHB 4IJQA 2ZULA 5FNVB 3ORFA 4REQA 3CWZA 3JQCA 3IEKA 5T5QA 1NNUA 1NR1A 1JA0A 2QT1A 1UK9A 5B36A 3NYQA 3ZX5A 1DC8A 5KZMB 2VDNB 1UZMA 1OWLA 2F3UA 4I14A 3X2FA 5CJ2A 1IK4A 2RAPA 3V2UA 2FEOA 4RF3A 3P9NA 4OI1A 4RESA 5JMWA 1U9ZA 3QI2A 4Q48A 4HPJB 4LXGA 4LBVA 5ARDA 4BDSA 5LQKA 1S3FA 3MPUA 1M1YE 4EHJA 4Z9XA 5DYYA 3MLEA 2RFLA 2H5EA 4ZGBA 1Y3HA 3K1JA 4UTNA 5JNWA 4L22A 1GGFA 5KTRA 4FS3A 4P2BA 1T13A 1RZRD 5TPZD 2IPXA 2FG7C 1SXQA 4Y8VA 2W2MA 1QBKC 3GT0A 1VYTA 3THSA 3QE2A 2B30A 1NNSA 3UV6A 1R6TA 2GFIA 4OYLA 3R9KA 3EFBA 4QOJA 5JT1A 1W1IA 3JTEA 2D5BA 2K7FA 4I08A 1JE3A 3U1TA 2EX4A 4KV7A 1BA2A 4EHFA 1FSPA 2I2WA 1DKRA 4TSFD 4BO9A 2DMRA 4YQZA 1E89A 3JD1A 2C88A 2WJWA 5FD8A 3PENA 4RQUA 3ZYZA 1AQIA 1CUVA 1YO6A 1KAOA 4BJ5A 1MO6A 1D6SA 3VUEA 3MHTA 3BRWA 1WCYA 3NHWA 1NVGA 3LK6A 4A0GA 3TO5A 3VC1A 4AWBA 5K6AC 3FLMA 1ZHFA 4QVGA 3ORHA 1M10A 1T8TA 2IU3A 2QRMA 4GFDA 4FOPA 4DAEA 4DQLA 1PK9A 4OATA 4GEGA 1XZPA 2H18A 5BSRA 1SERA 1NR5A 1FZTA 2JFNA 1ZCAA 3DMYA 2I1LA 2X23A 1SIWA 3WA6A 1N8TA 3D64A 3U37A 2YDYA 1DQZA 2FSSA 1XCOA 1TIGA 1ZI9A 3IOEA 1K9VF 1W8IA 2CLEB 1NXTA 1Z5OA 2WJJA 3TSWA 1NAIA 3UJHA 4AT1A 2FMTA 1N3YA 3BTOA 5TQJA 3W7AA 4U1RA 3IA2A 5FTWA 1MFZA 5CCBA 5ALLA 1XROA 4AJ1A 3EXFA 3GPDG 1JE1A 4I5GA 4MITA 5EOVA 1GKIA 1FS5A 4GXQA 5JO9A 1OY1A 3VQVA 4LVOA 5H8WA 4OHUA 1S89A 4B35A 4MAFA 1FW8A 3TR6A 4L0DA 2C7OA 1AA9A 5I7AA 3JQAA 2XA2A 4CIVA 2A7XA 1QYRA 2Q27A 3LP6A 4O8ZA 3MCWA 1JG4A 4GOND 1EUCA 1QGED 3B52X 1L5LA 4YCBA 3RT1A 4R6XA 1II8B 5K0NA 4NARA 4I0WB 4DLXA 3FLBA 2W58A 4C30A 2IQIA 2ECOA 1N6HA 4GQBA 3BB3A 4ZHSA 2PJDA 3BKXA 3WGQA 5L3QB 2ALYA 1OKKD 1JZTA 3DW1X 3JU3A 1FNDA 4G2TA 3M6LA 4IH1A 1E8NA 4PG7A 5DW3A 3HXPA 1C7ZA 1W5FA 2I71A 1EFCA 4MUIA 4R31A 4O2BB 2K2WA 4EG8A 3OOJA 1T34A 3NO4A 2VHTA 3G8CA 4WLUA 4ZO8A 1QV9A 3O26A 4DIFA 1Y3BE 1YTLA 1QH1A 2YV4A 4JV5B 1E2GA 1YQEA 3RO7A 1H9CA 4B7UA 2PA3A 3HJGA 2R4QA 1M2OA 3FWZA 1B3RA 1C3VA 3WYEA 1QYWA 1E9DA 1KVSA 4KOEC 1RM4A 3EPHA 5K0GA 4D9FA 1G7CA 1OHHA 3LYHA 3JQBC 1MVNA 1S7GA 2C5SA 3IQXA 5F3DA 3C74A 4G9EA 5GONB 1T5SA 3GBSA 4INZA 2YWJA 1G0OA 1XX6A 4N03A 4YMIA 2RAFA 2X0FA 1BHO1 3ZWDA 4C7KA 2DTHA 4LCEA 2I2CA 3I5MA 2UZ3A 2C54A 2CSUA 1D4ZA 2QNBA 3LRTA 2IDJA 4BB0A 5IT5A 1N6NA 1PAVA 3HCCA 3U48A 4I1SA 2N47A 1DC7A 3LDHA 4I8DA 4NF2A 3ZVLA 4F8YA 1DUSA 2OG1A 3PQ5A 3DVQX 4H7JA 2DR2A 2PMCA 4LC0A 4MZDA 4L4YA 2FTKE 5BW5A 2W6QA 2QYTA 3H86A 4YFVA 4NKRA 4C22A 4IOMA 3PJEA 1WVIA 2ZTHA 4RJ2A 2BEJA 3VISA 1XN1A 2HT6A 1Y1TA 3TUIC 2C5EA 2IHJA 1FTNA 1OXBB 2B7BA 3WI7A 3HL0A 3IAFA 1Z9BA 2ATCA 1JPJA 5HIMA 5HR5A 1IBLB 2BSAA 3OQ6A 1UJNA 4HWKA 3OZCA 3RVRA 4GLFA 4GHWA 5AQ1A 1YC2A 4Y2QA 1T9CA 2PTHA 3F8WA 2IP4A 2OCGA 2QAIA 1M1UA 2C20A 3OPYI 2GVNA 2NO9A 4R01A 3DCNA 4H1WA 1UT8A 4HOYA 3TBHA 3WE7A 3O38A 1CUSA 1WCXA 3HLKA 1NKTA 4S12A 2A0XA 1I3OA 3UV7A 2UZ1A 3EPRA 2HTFA 3N6VA 4M1MA 4ZWNA 2MYTA 3WJ1A 4R0MA 1YVPA 1OV4A 3R3VA 3GG2A 2ZXEA 1L6RA 3OUZA 4H6XA 4R1SA 3T7RA 3ZCQA 4WI1A 1MW8X 4QNRA 3GUCA 1GRCA 1THGA 1A9YA 3FNBA 1I7LA 2PKEA 2LWIA 1XLUA 1OZHA 1MT0A 3B6KA 3QUBA 1WHSA 3WLSA 3SNHA 4TQGA 5AW1A 2VDMB 1XKQA 4PLWA 1KFCB 3ASZA 3VNVA 4AO8A 2HMUA 3CEJA 3G2OA 1DX4A 5J4KA 2OV4A 3E0XA 4NZPA 3ZW8A 3HY1A 5L3VA 1E1RD 4DPLA 4EY8A 1IZ8A 1XRLA 1QHHA 3OTGA 1JIKA 4W5TA 5KTPA 1FYXA 5EQTA 1NZFA 1B41A 5C4IA 5AW4A 2GBLA 2VJDA 1HG0A 3AR9A 2ZSFA 3ELUA 3C6BA 3CPJB 3RG8A 2GYWA 1KOJA 1KZ6A 2O20A 3O4HA 4RHFA 2CXSA 2CNWD 4N7BA 1XO1A 3GX1A 5MN4A 2DJZA 3BB4A 1Y9DA 1J8FA 2IW1A 2FVYA 4JYPA 4HS4A 4OMUA 2CV0A 1CJMA 3DZBA 1B8AA 2GEVA 4K9KA 2ZBPA 4Q1BA 5HBRA 3WP0A 3LSYA 4Y6QA 3BCRA 2OO5A 3ESYA 4P73C 4IXNA 3ZS8A 3MEQA 5FOVA 2X22A 3X1DA 4UXHA 3NT5A 5CBPA 3LYLA 2HRQA 4WKPA 1OC2A 3Q8MA 1P1HA 1E6CA 5TQVA 3P9YA 4YECA 4ZAXA 2OCYC 4QYMA 5BSMA 3TRJA 4HZUB 3K8QA 1JJIA 3TGWA 4A4DA 1M7BA 5BOSA 4Y0AA 3FZQA 4OJQA 1DKPA 4DIKA 4UULA 4S3MA 3AYZB 3ESZA 3VVBA 1CRWG 5BVHB 2G8LA 3GZNA 2ADFA 4ZZ2A 3RKRA 1X8LA 1B0PA 4JUAA 1QRTA 1R9GA 3UMBA 3HCRA 3LF1A 1J9ZA 1NFQA 3FJ1A 3KT8A 4W1QA 4Y2HA 5LZ4A 1BWRA 2DBZA 1UMCB 4OBXA 3SN6A 1X2HA 3W34A 1R0XA 4Y6SA 5C1BA 2XKKA 1S3GA 2ZOSA 4OHOA 2CBGA 3QKTA 2UDPA 1PJQA 1D04A 4RA9B 4TTVA 2HH9A 1IHOA 4AY5A 3UWMA 1J1IA 4FBQA 2GDZA 1KY5A 4ZXPA 3AZOA 4DR5B 4X1KA 4BPBA 1BW9B 1H42A 2IDKA 2QJRA 4MAAA 4NZTM 4O3FA 3PIRA 5K1ZA 4UEQA 4CQMA 3RKXA 1YDWA 1M1NB 2G9VA 3SBDA 4K1LA 3D4PA 1WV0A 1FB5A 4OK3A 3C6ZA 1OIXA 4LTNA 4C2BA 1BIFA 2CHEA 4MYRA 4MCJA 1NLFA 3GCZA 4MO9A 4RPLA 2RHWA 4H2WA 4JR0A 4XH9B 1ODSA 4F1KA 2HHJA 5CM2Z 1I33A 1XRSB 1KZGB 3SKYA 2QTAA 3DO5A 3PUWA 3TH5A 3ROKA 2P9TA 3I3SR 3O74A 4D97A 3C85A 2CLFB 5KS2A 3U3JA 2FN3A 5CBPB 5CH5A 5C7OO 1X1DA 1C9NA 1MJNA 2YH2A 4BX2A 3TFOA 2ZTLA 1ZNWA 3NT4A 4HH1A 4LF4B 1VSTA 4LWOA 3H9BA 3QLTA 4OP3A 5IF9A 4Q6WA 4ND7A 1SA0B 3V7CA 2M98A 2ONJA 1IRIA 4IJ5A 3P0EA 4LXXA 4R1NA 1ZGHA 2LIVA 4FI3C 3W7VA 4X66B 2GAIA 4F85A 1ZH6A 2P79A 2P4UA 4JDUA 4V24A 4S1VA 1TFRA 3PFBA 4UEKA 1QH8A 2RG1A 4YH1A 1KKMA 5A05A 4JMLA 3BWVA 4B3GA 2AL7A 3HDYA 4AULA 4YMTA 4IDNA 4B4UA 1COWD 3BE5A 3Q5EA 2EZTA 4TKUA 1KKLA 1NOKA 1XWFA 5LQUA 2WB2A 4OOFA 3IO3A 2D2XA 4FGJA 3TCXB 2ZRDA 3TW8A 4E5PA 5A06A 1JEAA 2J07A 2VBFA 4J4HA 2YYSA 4Q9NA 1SRRA 3RD5A 1K06A 2CRQA 2PKQO 3DEZA 4KACA 1Q20A 3LLVA 1W4CA 4Q6GA 1U11A 1A7KA 5AM4A 3CNOA 3I9JA 1BKYA 3QBVA 1V25A 1VCNA 2DKNA 2PLFA 2C61A 1GVNB 3BMCA 5SZIA 4U6SA 2GJ9A 1A72A 3UT5B 3AW8A 1J21A 3VH3A 3ZIAA 3K70D 1OAAA 1GPWB 4B8WA 1USUA 4CH4A 1GGJA 4YJGA 3VTZA 1ASZA 1G6HA 4ZK2A 3D7NA 3ZTWA 4WF2A 4BMVA 1FX0B 1GNPA 2BC9A 3MTQA 1D2RA 4UBLA 1Z2AA 1A1VA 3DZKA 3M33A 4GC9A 5JMPA 4PG3A 3G9TA 3HWX1 4PZCA 4RY2A 1VM0A 1ZXLA 2V59A 5FUBA 3VJKA 1UXIA 3A7UA 2KBFA 3EFEA 4K6OA 2Y66A 3BWEA 5FNZA 3WKBA 3GLGB 2EP7A 2ZUUA 3HA7A 4X93A 1FJ2A 2O8EA 4CN9A 1LN4A 5LL6P 5K8LA 2RI0A 5DCUA 4N8DA 2X0DA 1L9KA 2JKVA 2W0MA 1X19A 2WA1A 3G2JA 4HYYA 5ECYA 2OQIA 4RV9A 2FMIA 3LC7O 5EE1A 1GA1A 1XTSA 4P83A 5JCJA 4D4HA 1KXZA 3GK3A 2JKZA 5AVJA 2IH2A 3VSBA 3MERA 2HXGA 3PE3A 1B7GO 3GFQA 2G36A 4UBNA 5D3MB 1TVKA 4BTLA 3R40A 4EUEA 3LGSA 2O8DA 2GCOA 4FZ3A 1GDTA 4O4IB 3ZYCA 1CCWA 3E82A 1Q11A 1R4NB 2EDCA 3LQFA 3QY9A 4GXTA 5EKSA 2J0UB 5IJWA 1MGOA 2RBGA 1R2QA 4JI8B 4YRTA 3OFVA 5JAOA 4CQLA 3SLKA 1I3MA 4AWAA 3UA3A 7GPBA 4LK2A 1Y6RA 1KYVA 1MVOA 3QFFA 4MVJG 3H4IA 4RPCA 1KI2A 3DT8A 4ZOAA 2Q28A 3UCEA 4BJ3A 4IUYA 2D3WA 4MR9A 4QNNA 3TVDA 5HJ2A 1QIJA 5A3VA 2Y1LA 5DEOA 4X7MA 4M9UA 5A6VA 3ISJA 4LNAA 3U4GA 1GPNA 3I2GA 3PR3A 2KB0A 1MOZA 3PTLA 2PIDA 3QLVA 3PPIA 7MHTA 4EQZA 1BX1A 2AR9A 2AWOA 4M36A 2OESA 1Z6AA 2X9VA 3U1BA 1F6BA 3HDTA 3ZBUA 4FJ1A 5KB3A 1CJSA 3D7SA 1PX2A 2XVMA 3IR5A 1KS2A 1NVKA 5DWVA 5ERGB 3EZXA 3CLTC 5HRUA 4P9NA 4ZD6A 1MEOA 4YRGA 2W8BA 4J1TA 3ZKWB 4F0JA 5KYTA 1YE3A 4PHGA 1Y8QA 1EDOA 2AOXA 2AXNA 3M89A 4PSVA 4TUYF 5CLHA 4YP7A 3RFUA 4DR4B 1JWLA 2IEGA 1CZLA 2R7NA 5A7HA 5B1EA 1E6EA 1XG5A 4LOLA 4EJ0A 5DB4A 3IJPA 4EPRA 4C0LA 2BOVA 3N05A 1MFPA 3NDJA 1SUDA 1N2CA 2WKQA 4N76A 2H29A 4OHKA 3B2NA 3ZI4A 2HWUA 4IXWA 4BNTA 4X1IA 3H8SA 3CH6A 2J8ZA 3KTAB 3TTUA 1CZKA 3TUZC 3OT5A 1TTQB 3U9SA 2Y6UA 2IWRA 4EI8A 4BVEA 5JO0A 1CLEA 1YL7A 3FOZA 2VYND 2XCTB 1DRJA 1NE7A 4FDMA 2HQOA 2G06A 1UF9A 4FLEA 3RTAA 4YRKA 4GOKA 1BD4A 1H2ZA 2EW8A 3KFXA 5JZMA 1T6NA 1YSCA 1YE5A 3EVGA 3FKQA 2WYIA 4ARUA 3LBYA 4JUIA 5DM60 2ERYA 1E5QA 3BSFA 2AOVA 2OXRA 3KC2A 2ZS7A 3G6WA 4G0PA 4WFIA 5BW8A 3R0ZA 3T5AA 1QNLA 3BULA 4BO5A 1KU0A 4EGFA 1NM5C 4IG4A 5HGQA 4NV0A 2QPAA 3KB2A 4MQ6A 4ZQHA 4KDFA 1X9GA 4JBWA 1C4KA 1RJDA 2DZCA 1TEXA 4HDKA 1QO0A 3PUJA 1L5RA 2OGSA 3LCJA 3UPUA 3HH8A 4R9NA 3NIDB 2XXAB 1DV2A 1DSSG 4NMWA 3BILA 5CJPA 3W4IA 4MA0A 2A86A 4YMWA 3W5CA 1I6MA 2FXIA 4O4HF 3EZLA 4AURA 4CIYA 1G8PA 1Y9JA 4ITRC 2FDRA 3PFCA 3SZLA 2JH3A 4C4RA 1V6AA 2AK2A 2YW9A 3CGWA 4CH3A 1C30B 1Y89A 2OKGA 3C15C 3O90A 4LE1A 4NMXB 3VYWA 4EKDA 3HJRA 2ANBA 2JCGA 5GM1A 5J2TA 2QLLA 4L6CA 5L9AA 3LLUA 5TQ0A 3S8YA 4IBOA 1Y5LA 3R23A 5KQSA 3HCNA 4I5DA 2E18A 3K6RA 1AF4A 1MH1A 2OVFA 5AJHA 4K26A 3GJ8A 4CIXA 4UOEA 1I2CA 1XLTA 3NKVA 4GOMD 4UMEA 1DJNA 3GR6A 5FNVA 2PIAA 3U3MA 1Y1RA 2J32A 1SG6A 4NBTA 1UXJA 1O94D 1FXSA 1YDHA 5D6NA 4MDFA 1B3BA 2M6LA 4XLZA 2Y9PB 4LZNA 3T1VA 1IPEA 4ZYWA 4Q4CA 4J07A 4JIMA 3FTEA 3NM4A 3ADCA 4NENA 1GXSB 1R3UA 4GI2A 4JOBA 4OXXA 5FKJA 1MV5A 1TYAE 3BE6A 2EL7A 3CTPA 4M88A 3TGPA 2XWSA 4TRMA 2TS1A 2KW5A 4MVCA 2ZT7A 3B70A 4R8MA 3WNQA 2YNMA 2QVXX 3OIDA 3JD4A 4QO7A 1Z75A 3OQBA 3DBRA 3EF1A 1BJRE 1L2TA 1TIPA 1ZH8A 1TYEB 3B3FA 3OECA 3RIGA 4ZJZA 3TL3A 5C35A 4YT8A 3M2PA 2A4KA 1OB2A 2AXEA 3M1AA 1P4AA 3ILSA 3OJCA 1TYCA 1CF2O 1EG7A 1XTVA 1YQGA 2OQ2A 3IE2A 3KXKA 2YN0A 5K1XA 2QDKA 5FL7D 3WGZA 4UUOA 5I9NA 1E99A 2JS7A 4FXPA 1F2DA 2FYKA 3ASUA 2JH9A 2LXNA 3RACA 3LJKA 2ASEA 2OILA 4MIYA 3DEJA 3L06A 4DM7A 3TAXA 2Q5QA 3L8EA 4HDQB 2H2HA 2LCFA 3I8SA 3LPNA 3MJCA 4RADA 3ZBQA 1Q1BA 4XUGB 3RH0A 4WRRA 2ZDHA 3MD9A 1JDQA 5HUHA 1EVEA 2DBQA 2FX2A 2BGTA 3QG1A 4KMOA 2WWRA 1KJJA 1W87A 3AB7A 3HVHA 2ODRD 3E2IA 2CN1A 2HOQA 1H2HA 1QB8A 3QFHA 4TTAA 4LSMA 1OXXK 1Q15A 4UMVA 1H23A 3KTFA 1OV6A 1V5WA 5DN9A 2ODTX 1EWQA 1T2AA 2B36A 5IMSA 2IYSA 5BXQC 1KSGA 3HVUA 3ITKA 1VJTA 4TM8A 4XR4A 1BA3A 3BGDA 1Z28A 3BAFA 4K9NA 4ZO7A 4AJKA 3A26A 1OLXB 3NV9A 1SUCA 4IINA 2GERA 1N9GA 2C3PA 4B2PA 3LOQA 3C5CA 1Q7TA 4G1UC 2GZ2A 4QPCA 4UJ3A 5SY9A 3UAGA 3U4QA 4HADA 2RHOA 1H2WA 4BXOA 5DNWA 3TMAA 1UC9A 1K7XB 1YJCA 5FOSA 4D8WA 4DG8A 2D7CA 1R8QA 4W5JA 4ESEA 3GGSA 3PXDA 2WSSD 3CNLA 4WZBB 3UCXA 2YWFA 3DFKA 4FLMA 3PZCA 1H6CA 1TLFA 1XKTA 4IOJA 4U0JA 3NBFA 4D1YA 1T3TA 1TT7A 2ONZA 3F1KA 3T3EA 1TMYA 2CF6A 2CLHB 1JQKA 3F5SA 2XUFA 5FYDA 4N4AA 2VRCA 1EUDB 2VDLB 1M0WA 4YCAA 5KJCA 3NONA 3OKPA 5KNBD 2VHXA 5JXGA 1PVVA 1Z68A 4OHZA 1JEOA 1N8KA 4FN4A 2QP9X 1E58A 4DRYA 1RKBA 1JT9A 4HQOA 5MDHA 4NFHA 3W3AA 1TNDA 2QOEA 1MIOA 4RMFA 3WC4A 2R7AA 2WIFA 1N7IA 2QX4A 1DKMA 4TQAA 1SKQA 1KQ3A 4R6WA 5A0FA 3EQZA 3K7EA 2YL2A 4D9BA 5KQPA 3GFBA 4UAGA 3EXAA 4QEKA 4HDAA 2NT3A 3JQ9A 3PNKA 1NTRA 2FWRA 1X3LA 3DOCA 3EA0A 3LUBA 3ZDCA 1AK1A 2WLTA 3CVUA 1VG0B 3CUUA 2JGMA 2YJNA 3CVJA 1QO7A 3OPYA 3ZU3A 4FD2A 2JGAA 1PFGA 3GEPA 4U2BA 4YY3B 4HDMA 3HXVA 2QRNA 2QMEA 3OF2A 3GWZA 2YWDA 1F7UA 3H1AA 3RGLA 3G2NA 3TRHA 1VJ0A 2JJMA 4H4EA 3WQRA 4WKGA 3KYCA 4PONA 3DZHA 3D54D 1KP9A 3C70A 1N77A 3RAEC 3LHDA 5U4QA 8ADHA 4Z4CA 4PLTA 2YJ4A 2UU9B 2Z5GA 1E3IA 4YDHB 1U2PA 4ME6A 4RELA 3SX0A 3ZK9A 1U8YA 2NG1A 1Y7HA 3WQBA 2V96A 5ARBA 5FQOA 3D8BA 7ADHA 2J30A 1WO8A 3IPRA 4CKCA 1W1UA 1L7QA 2H1SA 2WBLC 4AU1A 5IVDA 3ES9A 2PLWA 5LIRA 1Z4NA 3CEAA 3KVRA 3MOGA 5D7BA 2ZEJA 3MJDA 4CM1A 3I5YA 1I5RA 3KYDB 1BJKA 3LGXA 1FFDA 1R7RA 2AEFA 4FMDF 1OASA 4WERA 4WY8A 5E2IA 5U1PA 1L1RA 3RRNA 1PJRA 2VZ0A 4MW2A 4N49A 5I8WA 3I9V6 3IQHX 4MKZA 2W7TA 2NAFA 4KI0A 4GKKB 1GD1O 4RABA 5ALFA 4ARZA 1PUIA 2ZRQA 3GZTB 1A4IA 3C3YA 1WW2A 4TVKA 2FF5A 3HRIA 5JRJA 3V8QA 4EARA 4CMKA 2DFNA 1YFKA 3ME5A 5JMOA 5D3QA 2R8XA 3NRCA 3OE7A 4N1AA 5B53A 1UADA 2XITA 3K6JA 4FFVA 1UC5B 3VR3D 1LW7A 3TBFA 1ADJA 4EB6A 2G76A 1SNYA 1P45A 3H1TA 3HJUA 2XB8A 4X8HA 1YS4A 3LLMA 4N3NA 5CXXA 3V1TC 1WMFA 1XTQA 4ID3A 4LGYA 1II7A 1O5OA 1W85B 1VPTA 2ETXA 4FBMA 4HR7A 3ZIDA 4EWLA 5IHXA 3GFSA 5JPCA 3SDBA 5E1OA 1QRUA 4FFSA 1DL5A 11ASA 3T4XA 3DT6A 4HDMB 1V16A 2FKAA 4URVR 1JHDA 2W6JD 2P9GA 2WWFA 3Q12A 3VMMA 3ITDA 1BGWA 1NLUA 2P9CA 3K09A 2QM0A 4A0SA 3DBRB 3RSFA 5DNUA 1IMOA 4LAFA 4D7AA 4G8CA 4JLVA 2Z3ZA 5F51A 1E2JA 2HCJB 2N42A 3EC1A 3PBKA 3NYIA 4NH4A 1KE2A 3KO8A 4F1WA 4TV9F 3QF4A 2XUAA 3OZIA 4QVKA 4DUPA 2P8SA 1M1YB 2H1WA 3FE2A 2X4IA 1YNOA 4ERXA 5B58C 3HKEA 3HUUA 4DIEA 3KUUA 1MABB 1P0MA 3T61A 2V4ZA 4S2EA 9GPBA 1KZ4A 5IARA 2FPPB 4PC3A 3PHHA 1U2QA 4KODA 2X0NA 2NZXA 3G1TA 1Y5MA 1QGYA 1HZJA 1B43A 4LY6A 5K4GA 1ZVKA 4OLJA 4FSHA 4GM0A 4LJLA 1SH7A 2EC5A 2Q5IA 5K3FA 4ARZB 5DHQA 4YBRA 1RXVA 2IUEA 3D4NA 3NOXA 4TXJA 3QTLA 3U4AA 1F4VA 2GSDA 5DV9A 1D1SA 2X7HA 4QD3A 3O6VA 5JJ5A 1YH3A 2ADOA 1IONA 2XCUA 5AFSA 4R1LA 3K9FC 3NBQA 5A0VA 3MYRA 4E03A 3D8NA 1PV1A 3LQ4A 4D45A 2BCEA 3TYXA 1D2CA 1RZ3A 2AIRA 4HZIA 2Y0CA 4U63A 3VZCA 1NU6A 3X1YA 4CG0A 1OKKA 4P7KA 1OOEA 1LZLA 3SYKA 1E77A 3KR2A 1G18A 1E61A 1UEIA 1UKAA 3HEMA 1E79D 1NLZA 4HYQA 3UK0A 1BH6A 2YTZA 2H7YA 2R7KA 3IIKA 3BQ9A 3GMTA 2O7QA 3AR7A 2O2EA 2R6R1 1WPGA 4N3CA 2ZI9A 4OFBA 4XFDA 5DNDA 2P11A 2HB6A 2R6AA 1YZGA 3E9ZA 3Q8XB 3GT4A 4LK3A 3ZZNA 5LPNA 1ORTA 1PNVA 1FSSA 3EHEA 3IOYA 1PWEA 2PH7A 3I7FA 3M5WA 3OZRA 2C03A 2QM8A 3KJFA 4PQFA 2Z56A 1G2OA 3HO6A 1TJYA 1AG9A 1OF1A 2ZBDA 1JJAA 1GU1A 4DJJA 4DS3A 1LKZA 4Z8XA 4NCJA 2LDBA 2YINC 3QXGA 5CCDA 5I45A 2O5CA 4B31A 1E2EA 2GWRA 3AL3A 3MF4A 4OKNA 4QBIA 1H2FA 2V45A 1PKEA 2OKCA 3DOFA 3E3OA 1L8XA 3WLTA 1S9HA 3OU7A 3VH1A 1GFSA 1EUDA 2CLOB 1J20A 4WNAB 4MR7B 2HJRA 1Q0SA 3FVTA 4HATA 4BN0A 2TMGA 1CEQA 1O95A 3OX2A 3AXSA 5AKKA 2VSNA 1ZRSA 3SZUA 2NU6A 5JAPA 3C7KA 5IN5A 3GQBA 5LP6B 3JVIA 4YCUA 1Z74A 4CDNA 2XGGA 4XA8A 5FL7A 3CH4B 4PRYA 2XMQA 4PYLA 5C8ZA 1C14A 1SUEA 5HDBB 2ECFA 5JLJA 4LZAA 2GO7A 4JR1A 3TD9A 1KJWA 1Z4JA 2F1JA 1R5OA 3DOEA 1ISFA 3O8QA 3PK0A 4OD0A 2IC5A 2Q1WA 3SQXA 1K3UB 1GLGA 5DO9A 2YJ6A 1KO7A 4O4LB 2JJ2D 3OF5A 3DPSA 4JR2A 1SULA 1DKUA 3URMA 2EARA 3LU1A 1XDDA 3A6FA 3I8XA 1TPYA 5SV2A 1PFVA 3COYA 4Q9HA 4L28A 3LSSA 2QJFA 2ZR0A 3EVBA 1N92A 3PUZA 1PTJC 3K0CA 1G8HA 3VR5A 4CXMA 4EUSA 1PZEA 5CYOA 4ZCRA 4WCVA 2CCKA 2J0QA 3FJPA 1N2CE 4U7HA 4WLNA 2ODNA 2V1UA 3AR5A 2EJUA 2P1DA 1N4DA 3OZ7A 5KYUA 4Q1EA 4CTMA 5L4SA 4Q9DA 4WN9A 1GZ3A 1D6NA 3RKWA 3KXPA 1Y7IA 1GEGA 3DB1A 2NZ2A 2QK4A 3B12A 2Z0MA 3CLKA 2XRFA 3DJYA 3GAMA 3OTIA 2JHCA 4P5EA 4ND3A 5DHFA 1ULSA 4OHFA 4OX9B 3H75A 4HC4A 4U2CA 3UICA 2C98A 4YT2A 1JH8A 2DDZA 1Y1LA 3BQNB 2YFQA 3QI7A 5CIYA 2G6BA 1AS3A 3FGOA 3ZJYA 3CUEF 2H1FA 2ZSKA 5IKXA 2XZLA 2BFEA 4OKIA 3F3YA 3I9FA 3KYIB 4DSUA 5JHGB 3K71B 2AKYA 1DARA 4MUMA 3ZQJA 1QPZA 1KI4A 2BMFA 2IZ5A 2X14A 1ZI6A 2VF2A 3QUSA 5BUCA 1WBBA 4J1NA 2PUCA 1P1IA