4HVCA

Crystal structure of human prolyl-trna synthetase in complex with halofuginone and atp analogue
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
497
structure length
482
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGILSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARMGAKSLCIPFKPLCELQPGAKCVCNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ATP-directed capture of bioactive herbal-based medicine on human tRNA synthetase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional glutamate/proline--tRNA ligase
total genus 162
structure length 482
sequence length 497
chains with identical sequence B
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4hvcA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4hvcA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4hvcA02
3HY0A 12ASA 4PHCA 2ALYA 3HRIA 4TVWA 4XEOA 3G1ZA 5C53B 1EQRA 1YFTA 2E64A 2DU7A 2ZZGA 3RACA 1HTTA 2EJ9A 5K1PA 3IKMB 2Q7EA 2ODRD 2DVEA 4YREA 4P71C 4H2YA 4H2UA 3QTCA 4UP7A 3PCOB 3V7CA 4X5OA 4YRQA 3A7UA 4XTVA 3TEGA 1QE0A 2QHSA 2ALYB 1YFRA 2G4CA 4H2VA 2CJBA 1B7YB 1H4QA 2DKGA 5ELNA 3TEHA 4UP8A 4WJ4A 4P3PA 3HXVA 1H4TA 2DQ3A 1J5WA 4XU0A 1BIBA 2C8MA 3V8LA 2Q5IA 1JJCA 3UH0A 4KQEA 2ZXFA 2QHUA 4PG3A 2ZIMA 3WQZA 4XTUA 4NCXA 1NNHA 4CS3A 4P74A 4WF2A 3RKYA 3REXA 3NENA 2RHQB 2XGTA 3RL6A 4YYEA 1NYRA 3HFVA 1E24A 4G85A 1NJ2A 4BWAA 1KMMA 1NJ8A 3ERRA 1C0AA 1EFWA 4Q15A 1ASYA 1ATIA 2Q5HA 4XTXA 2RHSA 2ARTA 4YRFA 4WI1A 1GGMA 4XTYA 1B70B 4RQEA 3MF1A 4XU1A 2ZT8A 4E51A 1N9WA 1X55A 3NELA 2E3CA 2FYKA 1YGBA 3HTZA 1EOVA 4KR2A 1ADJA 3MF2A 3L1AA 4K88A 1YB3A 1QF6A 2Q7GA 2DZ9A 2PMEA 3RKWA 4CH4A 3P8YA 2C7IA 5KNNA 2ZR3A 2ZNIA 1IL2A 1Z7NA 2RHQA 1B76A 3VQWA 4YROA 4YCWA 3CMQA 2RHSB 4P3NA 4ZTZB 3HXXA 4XEMA 3V8KA 4CH5A 4DQ2A 3EFSA 4H2WA 2E41A 3HY1A 1V95A 1E1OA 2ZINA 2ZT5A 3UGQA 4YRGA 4G84A 4AH6A 4CH3A 1WQ7A 4DPGA 4HWTA 3HXZA 4HWSA 2ZIOA 4K87A 1LYLA 1HC7A 2E65A 2J3LA 3LSQA 3QO7A 2EL9A 1B8AA 3V7SA 3NETA 2P0LA 4HWPA 3BJUA 5HGQA 5E3IA 4TVAA 3RUXA 4YRMA 4RMFA 3BFMA 2ZZFA 1NYQA 5ELOA 2ZT7A 2DDZA 1H4VB 4YRIA 1BBWA 2DXTA 4XU3A 4HA8A 4YRLA 2QHTA 3RKXA 1WU7A 1G5IA 2ZNJA 1ASZA 3UFGA 1NJ5A 3V8JA 4Q6GA 2QHVA 2ZGWA 4YCUA 3QO8A 4CH6A 2DU5A 1X54A 1E1TA 4RDXA 2DJZA 4UPAA 1G51A 4P75A 3FJPA 2EWNA 4TVYA 1EIYB 1G5HA 4H2SA 3LSSA 11ASA 2Q7HA 1RIQA 2EJGA 2DQ0A 1L0WA 1WQWA 3A32A 1WNLA 2E1HA 4YP0A 2CJAA 4H2XA 1USYC 2P5IA 3TUPA 2EJFA 2CGHA 1W66A 4TQDA 3A7RA 4TTVA 3M4PA 1EVKA 2PMFA 4O2DA 3P8VA 1BBUA 2AKWB 1HXDA 3E9IA 2ZR2A 2ZTGA 4K86A 5C51B 3HXUA 1VQZA 2CIMA 2LW7A 2ARUA 3QNEA 4ZTUB 4H02A 1H4SA 2ZCEA 4XU2A 3REUA 4XTZA 4YRKA 2ARSA 3IALA 4UP9A 3HFZB 1X56A 1B7YA 1Z7MA 4H2XB 4J15A 1E22A 1KMNA 5C52B 3NEMA 4H2TA 2EAYA 4YRPA 2DTHA 3PCOA 2I4MA 3RGLA 4KR3A 2XTIA 3MEYA 3E9HA 3R07A 2I4NA 2ZT6A 4YCVA 3VQXA 1EVLA 1WLEA 3RIRA 3KFUA 4YRSA 4P72A 1PYSB 2DTIA 3A31A 4P75C 4P3OA 4P73C 1USYA 3VQVA 2IY5A 4OP0A 3A7AA 4TWAA 2IY5B 3LC0A 3W3SA 5K1XA 3A5ZA 2DZCA 1X01A 4OLFA 3IKLA 1YFSA 4L87A 4P72C 1PYSA 3PZCA 2HNIA 4P73A 1X2GA 2I4OA 4YDQA 4LNSA 4P74C 3A74A 2J3MA 1BIAA 1NJ6A 2AKWA 1NJ1A 4HWRA 4YPFA 1SETA 2ZZEA 4TVAB 4EO4A 2DXUA 2E5AA 2I4LA 3L4GA 3IG2A 3EFRA 4HWOA 1B70A 4BW9A 4YRRA 2DEQA 3L4GB 3QO5A 4YRCA 3V7RA 2AMCA 3HFZA 4CS2A 3DSQA 2CJ9A 4CS4A 1WYDA 3TEHB 3L2ZA 3HRKA 1JJCB 3RF1A 3I7FA 4ZIBA 4WJ3M 3HXYA 3M4QA 1FYFA 4EX5A 3A5YA 1SRYA 2AMCB 4P71A 3P8TA 3VQYA 3UGTA 2ODRC 3OD1A 1X2HA 2E10A 3VBBA 1SERA 1KOGA 1ADYA 1EIYA 4HVCA 2DTOA 4YRNA 3ICAA 1WPYA 4TQFA 5F5WA 4YRTA 1SESA 4XTWA 4YRJA 3HXWA 4RQFA
chains in the Genus database with same CATH superfamily
3K15A 1YB2A 1NBMD 3ORFA 1A9QA 5B37A 2PUFA 2ABWA 3BMQB 2BSXA 4NK4A 4TYMA 1NBWB 4OK5A 2WQ7A 1L8XA 4RTKA 1WUHS 1JR6A 2BMVA 3E84A 3VR6H 3Q15C 1B8OA 1C9DB 4N7JA 3BS4A 1CYDA 3GU3A 5EJAA 5BSKA 5LQAA 3ETHA 4OQNA 1QDLB 5CB0A 1IBCA 3VHXB 4PLCA 1YS1X 1DFGA 3BULA 4W7SA 1BD3A 1US8B 4CIVA 1W4CA 4MTLA 5D01A 4E5UA 2HK6A 5L4NA 2HT1A 1CYEA 1XFDA 3UENA 2HWUA 3CWCA 1TK2A 4CFZA 2ZZGA 3CLSC 3SC3A 3RNLA 3DE5X 5BW6B 2Q7EA 1QYRA 1M54A 3PPVA 4ZXPA 4EEXA 1SVNA 1T3SA 3PX3A 1KFBB 5LWHA 1AX9A 3W5DA 3MHTA 4KPYA 3O90A 2FUG6 4YREA 1WSWA 1PQUA 2XE4A 4P71C 1C1YA 3WQQA 1ZICA 1P9NA 2FK7A 4TM8A 2EQ5A 5T4FA 3HV0A 1EFUA 1K8ZB 3P71T 1E6KA 5G2OA 1ZINA 3OHMA 4YYZA 1QFYA 4LBYA 1ZU4A 4AW9A 1NMZA 2C2XA 3Q1KA 2F1RA 5EWLA 1T24A 3GDOA 3A7DA 1Q22A 4LRXA 1CUEA 3D3WB 2GAJA 3QP9A 4ND1A 1YRHA 1CWUA 3GLKA 4MKXA 4OM8A 4ENWA 2WINI 3CSSA 4WA7A 2P91A 2ZPUA 1EIZA 4JJZA 1M2FA 4RCYA 3OEWA 3UWDA 2AFHA 3MUOA 4B4DA 3F6YA 4C88A 4EATA 4EG1A 2ALYB 2HRBA 1QX3A 2AFHB 4B84A 1YQEA 4F5WA 2A67A 2L18A 3SYNA 1U04A 3OQIB 2O8BA 3M9LA 1EBFA 1QTIA 1ZMXA 2O2DA 4Y7CA 3S2SA 4D81A 5CDFE 5JRDS 1NSFA 4HFMA 1EK5A 5AI0A 4WLNA 2CW5A 2CFRA 5CH8A 3AVXA 1Y80A 1GLVA 1KJWA 1XCJA 2MMCA 1MJ5A 2PZGA 1R10A 1ENOA 3DVRX 3KCQA 3L7OA 3R3WA 4GYKA 4LYGA 5C34B 3SC4A 3V7NA 4OI1A 1Q2UA 2PYDA 5CJJA 1P3DA 2XNKA 3RLIA 3GPLA 4UAUA 4IJVA 1QHYA 3LZ6A 3G9QA 4IH9A 2GPYA 4GSLA 1PFYA 4IAOA 4UQLA 5KOHA 2UXBB 4GG1A 2I3ZA 1YU6A 4NMHA 4JZYA 4PSVA 1E59A 3UH0A 1DRKA 2XB8A 4GWKA 1ESMA 1G6OA 2XF8A 4H6WA 2QHUA 4HLDA 4KVFA 4ZJYA 5IVPA 1JIJA 5KNBA 4OKSA 1AV6A 4G26A 4GP9A 3GEDA 1ECFA 5EJIA 5EA2A 2CLHB 2DFKB 1MRNA 4R3UC 4ESVA 3H6KA 1XJCA 2VQSA 4IV5A 5JJKA 3JZMA 2FA9A 3P9QA 3QNUA 3QX9A 3U0VA 4J1NA 3AW9A 3S44A 2ZSFA 4JNCA 4EPYA 5D3QA 1KIMA 4QJ3A 4AZ3A 5AVTA 3RBVA 1Q1NA 1DINA 3A9WA 5HDQA 2QSJA 4EJ2A 4H60A 4CL0A 2IUTA 3ZQ4A 4EGCB 1A4IA 4YYEA 4HT3B 1NDQA 1ICIA 5TPZA 4YS6A 1Y3AA 1R00A 1QPBA 1O4WA 3KZKA 4HNUA 4NH4A 5DMHA 1EP1B 1ZAYA 1D7OA 4UUAA 4EUFA 1E3TA 1PUJA 1Q2XA 4JI0B 4BMXA 3ERRA 1Q7RA 4BV8A 1Q0ZA 3ROKA 4KO4S 1IPHA 3LBIA 1KRHA 3S2UA 7MHTA 1QBGA 3OF5A 5IKMA 3VDQA 2O7QA 2A7XA 1E2FA 3NOQA 4CV2A 2CKDA 1NAIA 3HUEA 1QFMA 1F20A 4WXMA 2GSWA 3LA6A 4GC9A 1SKUA 2C92A 4CT5A 5AM3A 5CYGA 4WX2B 1AK2A 3NAZA 4RLFA 2X41A 3NALA 1SUWA 1Z35A 1YI8A 1AN9A 2FI1A 3K53A 2BCJQ 4JN6B 2O2CA 1W7AA 1C7JA 4JEMA 4KLAA 1NW3A 1RRFA 3KUXA 1GL9B 1N78A 2B34A 1C7ZA 1Q0UA 1UEJA 2HO4A 1PJCA 2PJZA 4BE7B 1DI0A 5MDHA 3KKOA 3KLBA 2BI4A 4HGYA 4N5IX 2VSNA 4DLBA 5A5FA 2W5UA 4QXQA 3ANSA 3GFOA 2CNOA 1QVVA 3IAFA 5P8WA 2FPLA 4D3YA 4G56A 5CCEA 4BVKA 2NO7A 1CJCA 2HXSA 4L75A 2IE0A 3RV4A 1ZNXA 3GHHA 2ZWOA 4FXOA 1YR8A 3HE3A 3BL8A 4F11A 4V24A 3GJ6A 1DCKA 2Q7GA 1UT5A 1E8DA 1SU7A 1YE5A 3PQEA 3VPXA 4NEHB 3WLJA 4ZI2A 2P0YA 2LGJA 1U4NA 2HCBA 2VJQA 3BDAA 3IHLA 3K4PA 5B6PA 1SQ5A 1U2DA 3A27A 1I6KA 2BKLA 2F9LA 1BS2A 4BB9A 1K5HA 3AW8A 3L77A 1KZ1A 4R8SA 5E9QA 5F2KA 3ZCRA 4EY5A 3DKKA 2G07A 1MZPA 2C4TA 1JVSA 5HCNA 3KP1A 4H1WA 3BB4A 3GP3A 4RTNA 2ORIA 5CLJA 2V74B 1R6AA 3PVSA 1UJBA 1OFUA 3LIPA 4YP7A 3O4RA 2RHSB 4P3NA 3BRCA 3MWDA 4PM4A 3FZEA 4KWCA 1X92A 2Q5EA 2EP7A 5KC8A 3Q41A 3LC1O 1AE1A 1ODTC 5K9ZA 2UUCB 4MVJF 1OH6A 1QIFA 5HVNA 4FXPA 3T5BA 5K4AA 3DEKA 3ZU6A 4G23A 2EAUA 1JEQB 1VXRA 2EFDB 2D62A 1Q91A 3LPMA 3ASZA 4BX0A 1UQUA 2IUEA 4A2PA 4RS4A 3KZMA 5BW8A 1PWEA 1IWPB 3D7LA 4ESHA 1T1EA 2CB0A 4Z3OA 4MUKA 3GGSA 1JDZA 2V3CC 4D82A 3REGA 4RZIA 3AVUA 3GGDA 1W88B 3RKSA 4I1IA 4BBPA 5CM9C 3PHBE 3OG9A 2XGSA 6ADHA 1F2UA 3I8XA 4JHLA 2VJAA 3O4IA 1I80A 1XMSA 2AFVA 4Q3KA 1LSJA 1MEOA 2REQB 1JT2A 3ANLA 3GFPA 3LPAA 4WZAE 4M0KA 1TW3A 2E82A 2C9YA 2DE0X 2FWRA 2JLUA 3M8KA 5EWJB 2XCSB 4XPIA 1W87A 3CINA 5FUVA 3UY4A 4EARA 4R69A 1L4EA 1WKCA 4TWIA 4Z99A 2IUSA 4GGPA 4J0CA 3U0BA 2BZ1A 2DT5A 2Z5LA 2HBQA 2O0MA 3JALA 3JQ8A 1JDBC 3S7TA 2CJWA 4BMNA 4TV8A 2GRUA 3KZCA 4M0UA 3TGWA 1N32B 1TB4A 2EGGA 1L4UA 2IOFA 1TDJA 2V3WA 1MENA 3CH4B 3CX4A 3I01A 1M8GA 1MX5A 3H0KA 4K6GA 3P0IA 1BBWA 3RU7A 1HE1C 3WLAA 3HEMA 4PU0A 1HZJA 2PJRA 5ENVA 4OAPA 3R0QA 1DADA 2H8GA 5DBEX 5T4EA 5AICA 4D9GA 3PV0A 4MS1A 2CWWA 2GD0A 5HDBB 2YFYA 4RIEA 1BDMA 3C16C 1V48A 3DE3X 3CX3A 4PN3A 3CUVA 2GD2A 4AG3A 1W52X 2EWVA 3FNBA 2EP8A 5HM8A 1TVMA 4RDIA 4FEGA 3R76A 4F8JA 4YMWA 5FV4A 3L4JA 2FETA 4HZUA 3QO8A 4KI7A 4KRXA 2D1FA 5AK5A 1UBCA 1NVKA 3K96A 3LQRA 4NQZA 3SHQA 4LHEA 5G1NA 4AKTA 5FLKA 3OJFA 4LSGA 3EBOA 3KALA 1BJKA 3ZHRA 1NQ5A 3K4QA 1SHTX 2GAFA 4C4ZA 1RLOA 2NU7A 5ECDA 5JDIA 5ESDA 2E4XA 3WGOA 1IN5A 1MIOB 3WKCA 4TV8B 1Y7IA 2XMGA 3FPGA 1EUZA 3O73A 2Z8YA 3EX7C 3OE7D 1JHYA 1WQ4A 3ZBTA 4RTJA 4BO4A 1IXSB 2IZ0A 3LTNC 2B8JA 2SECE 1C5KA 4CKCA 4BO7A 1WUJS 1UKZA 3S3TA 3SHWA 1SQFA 1Z8DA 4DG8A 2AXEA 4DREA 3CKLA 3AKCA 1BSVA 3O47A 4KWHA 5KQPA 3F9RA 2DFNA 2OILA 1JGTA 2C5FA 2RHJA 3T0IA 2ZYWX 5JCJA 2WWYA 3D5EA 2BGUA 4EUHA 5AXDA 3ODGA 2A9JA 1UANA 1NN3A 2QT9A 2ZYSA 4PQFA 3E7DA 1KZHA 3RVOA 5K45A 1YGPA 4RTSA 1PR9A 4JUIA 3T5GA 2AN3A 4YCSA 3VI4B 2WD7A 2D2XA 4POOA 4LQCA 3ZGLA 4V0RA 4N5NA 3L5KA 3LWBA 4HGPA 4GEKA 4CDMA 3WRWA 3G68A 3GA5A 3E35A 3K70D 1K6MA 1Y42X 2A0WA 2F1JA 4HEJA 2Q5FA 5AHWA 2WNSA 3MIIA 4Q3CA 1C7EA 2H2IA 4V0ME 4BBJA 1NW6A 5C51B 3D0QA 1JF8A 1N57A 4UREA 4EYGA 3FHOA 4LCBA 5ALDA 3ASUA 3FIUA 4FDMA 1X7DA 1YC2A 1FSZA 2CHQA 3AK4A 4FFWA 5D85A 5AKJA 2QJTA 2ADFA 2GN2A 4DV5B 1XWIA 2ARUA 3EVFA 3UT5B 5JO0A 3JAMA 1S3GA 1Y8ZA 4YRDA 3H1GA 2EH1A 1SHJA 1XZCA 3RHTA 1Z8HA 4KH1A 4EGAA 1AKVA 3BAZA 3PCRB 4IMRA 3UYKA 3E9QA 2RGAA 1HORA 3ENNA 5ALUA 3TYXA 1RWWA 4MWZA 3ZQUA 4BRUA 1MBZA 1EJ2A 2HF8A 1I2AA 3K5PA 4KYUA 1KEVA 3G59A 4MRMA 1WEHA 3KAKA 2GZRA 2H1HA 2DEUA 1BXZA 4CKWB 1QPZA 1SXJD 3GNTA 1LA2A 1UDVA 2C5SA 3LT5A 1ADGA 3NEMA 1RRGA 4UM5A 1U3UA 1FFEA 1ZPDA 2XDAA 1RRMA 2CUZA 1YZ3A 4RHXA 3RGLA 1C2YA 2J32A 4FHDA 4IXNA 2B5VA 2QN2A 1YR1A 4DMLA 2VSFA 5CVEA 3O8OB 5EOVA 4A6EA 2WM9B 1HGXA 1E9CA 2ZI6A 1ZOOA 2G8LA 2YKGA 4LVKA 3GJ3A 2VR1A 4CIDA 3LLVA 4NV0A 1G0NA 2IC5A 2R0QC 4HLQB 1OXVA 2VZ9A 3A3NA 1X39A 2Q3VA 1BCSA 3MOIA 4ZQBA 2R6ZA 4F92B 3WDKA 4L28A 1S9HA 3K9GA 1RZUA 4HWGA 5JPIA 3U3MA 1QGOA 1YRAA 5KKAA 2PR2A 1HDGO 1Q57A 1AJEA 4P2BA 2Z4SA 4DCMA 3NKFA 2VBCA 2IY5B 5D87A 3TD9A 1LNSA 5G3YA 1NG1A 3OT5A 4OLFA 2CZCA 2OHXA 1YFSA 2PYZA 3GARA 1MPXA 3IDAA 1VJTA 1PYOA 1TT5B 1PK7A 1XA3A 1K2WA 3OBBA 3E7XA 4H1TA 4P73A 2HQ1A 3FOBA 5BWNA 1GGVA 4QX6A 1U6KA 1QC5B 3DWFA 4JU9A 4NABA 1EK6A 2XEDA 3UKDA 1CW2B 2HWWA 4RENA 1QOZA 4HTFB 5GM2A 1PDVA 4AMBA 4AY3A 3HQ4O 4LHYA 2B21A 1BIAA 4DLWA 4CIWA 6NULA 3CA8A 5CXXA 4P81A 3NYRA 1QIIA 3DVAA 3U1VA 4PRKA 2DFVA 1YCGA 2FUG1 3N6VA 3T6KA 1IEVA 2VPZA 3OP1A 2C9DA 4X1KA 3RIMA 3SX2A 3VRHA 4DIFA 3E61A 3K31A 1SCIA 16PKA 3MLEA 2GBCA 4HWOA 5CJPA 3HUFA 5A62A 2XZOA 2Z43A 1KXJA 1OAKA 1B2LA 1E94E 2EKQA 2ZJFA 3DSCA 1F4PA 2LDXA 3AXTA 2EX1A 3M3HA 2WICA 3V6LA 2ACKA 1YZVA 2GRAA 2SICE 3HA2A 4ODIA 4JI4B 3L4GB 2GEDA 3LBHA 4WLEA 2O8VA 4KYVA 3V1LA 2DU8A 4O5OA 3FKQA 4C0QC 1K8QA 2Y1WA 4TKMA 1FYWA 3AC0A 4WOPA 1R6VA 1EGQA 1THTA 2X40A 5JAUA 5ITZA 4EECA 3T9FA 4MVXA 3CRMA 3IUPA 4OK3A 4S0XA 1DCTA 4A8TA 4P53A 3UAZA 2H5JA 3OU7A 1X13A 3N3AC 3VU8A 4H7HA 1NJFA 5LMZA 1ESEA 3IFSA 3R0VA 2C78A 1BMDA 4Z7QB 1RYDA 4II7A 4CR8A 1U8ZA 1JQKA 5CB4F 3KQUA 3ABOB 2WKSA 4KDEA 1N9GB 1XCPA 3H9BA 2GH1A 4FGWA 1FYFA 5CBPB 5I9TA 2P62A 4TVOA 1RIFA 2YHAA 1SRYA 3IO3A 1NULA 2A9PA 1R0SA 3L79A 4L74A 2B83A 3RFUA 2SNIE 2HPHA 1JG1A 2DULA 4QHYA 1UZLA 2EKLA 3NYQA 1WZ2A 2CL0X 1J00A 1CF2O 5J23A 3COPA 3CU5A 3E5NA 2AC2A 1LPBB 3JY6A 5LXTB 1OUMA 1U7UA 4OJMX 1S5PA 1LEHA 4PGMA 1OU4A 1TUGA 2PY6A 4A0QA 4NESA 1DWOA 4M4SA 3T35A 4D45A 3NOVA 5JEDA 2AOTA 5FEUA 3NHWA 3VZPA 2XODA 5BYBA 1W36B 3NUGA 1THZA 1KH3A 3TL2A 1K68A 1V96A 2F1OA 1N1EA 2JIPA 2X9QA 2FEMA 1DEHA 3K20A 3QFTA 1AS2A 3D7RA 4RDHA 1UT6A 4C89A 1S8FA 121PA 1XQ1A 4NZ9A 2X2FA 3F1LA 2Y1OA 2C59A 3PIDA 1XZFA 2DU5A 1VSQA 1H0SA 1BGXT 3I72A 4R2MA 5TF0A 2NMVA 3MWFA 2DUNA 12ASA 4TKVB 4ARAA 3VBCA 1RYMA 4K28A 2EZTA 3MJEA 2QUBA 4U0JA 5H16A 2C2WA 3FRJA 1WMAA 2PZ8A 3KU1A 1U28A 3UTDA 4ZI7B 4B73A 1XR3A 4BJ5A 4BAUA 1SC3A 4RNDB 4XEUA 2X42A 3NV7A 4W9RA 1O94A 2YYSA 3KR0A 3KKQA 1IJBA 4WKPA 1TKCA 3RBZA 3SC2A 5KVSA 4X62B 3TIIA 1J4AA 4IHAA 4RF5A 1AHNA 1IBRA 1L5SA 2IFTA 3DTVB 4QHTA 2QGZA 2VJKA 4FSDA 1ZIDA 1NURA 1CQJA 2C7OA 2BGLA 2OYRA 1PJAA 2OOSA 1ISIA 1DKMA 1NC3A 1O94C 1P2UA 4IQGA 3LRPA 2ZAOA 4QUGA 4QZVA 1SQ6A 2HGZA 3K6SA 4MA0A 1EDOA 3TGPA 2MTBA 2VPIA 2DPXA 1ZIXA 4WZBA 4B7AA 1A50B 3A1EA 3QV1A 1I4EB 1WIWA 4IGFA 3ZVLA 3B85A 1GG9A 2VK1A 2PUHA 3DMTA 2W6NA 2J41A 5JSKA 4AWXA 4ZCLA 2JZOA 3NYWA 4UP7A 4I8DA 3LG2A 4CLRA 2V1UA 1C3OA 4DZRA 4IJWA 4OQPA 2NQTA 1UIMA 5JH7F 1NE7A 2JATA 1V5GA 1WSBA 2XNSA 2Q45A 5EJ2A 4D26A 2Y1LA 4RVNA 5DNWA 2X76A 3SX4A 5KTNA 4CLOA 4LMRA 1G7SA 3W5BA 1SA0B 5JAMA 1V39A 2PIAA 4D9HA 1A4XA 1A5BB 1OQAA 2CJBA 1R6UA 2KQUA 3ACDA 4CUKA 1T1SA 4IJ5A 4JAVC 1VLLA 1JDUA 3GEEA 3RS3A 1MB9A 2PQMA 2R48A 3VPFA 4C22A 1CP3A 2DQ4A 2I4TA 1BU5A 2MINA 3B3AA 1ID8A 1DJLA 1KBZA 5IC4A 4GPIB 3K8QA 2C1ZA 3L0YA 4EL0A 3HB4X 3R3SA 3PGMA 2E6KA 1QPGA 1JBQA 2CMKA 3GR6A 3JCZA 3C6YA 2VUTA 2OZPA 3LK6A 3OCVA 1GAWA 2QAJA 2G06A 3WK9A 3AB8A 3L01A 2PLAA 1GGNA 4GIBA 4H7KA 3DKVA 4KYIB 4EY3A 2RGXA 1NJGA 3ND6A 4AX4A 4RVGA 4MICA 4N40A 3F46A 3MGKA 1JH8A 3ONVA 5FNVB 4A10A 2BT4A 4R7GA 2F3TA 2GEJA 2XOKA 2W90A 1QYCA 4NATA 5LOVA 2JKYA 1N1GA 2RJNA 2RE8A 1XROA 4E33A 5C35A 1QZUA 4V0LA 3QVKA 2JLCA 1NX6A 2IT1A 2V5VA 5GZ3A 3F0TA 1UL1X 2IKSA 4MYCA 3BF7A 1F3LA 4FEYA 2AI3A 4NARA 2W6ID 5T3YA 4C5CA 5JR3A 4JP3A 1KSHA 1JXAA 2H5IA 2HMWA 2R9VA 3IODA 4QTUB 10MHA 3K70B 3QJGA 5C0OE 3TQTA 2XGTA 2XAUA 3B2EA 4INOA 3G2OA 3RL6A 3HJCA 2EF0A 3DDWA 4JWKA 1OBOA 1GWNA 3MRSA 3ZJ5A 4U2GA 2WPNA 1ZM7A 4DSOA 1P4GA 4IDAA 1IZ8A 3LNCA 1JL3A 3QMWA 4PX3A 5IN4A 3O1LA 1E3JA 3OIYA 4BBAA 5KNDA 4DBVO 4F7DA 4Q3LA 4Y6GB 3VR6A 4OHKA 1GRQA 2I6QA 2X58A 2Y68A 5JJLA 1MG5A 2G1UA 2YNMA 4C0KA 3T52A 2LCQA 3VZQA 2HKIA 1RYFA 3HKDB 5EXTA 1ODJA 1R37A 1SPXA 1JR4A 1ZC3A 2BGIA 2O2EA 2OO3A 4O2AB 4UZFA 1N6IA 4HNRA 1RRPA 4LI0A 1AD2A 2V55B 5BSGA 4BCCA 5BSUA 3C4QA 821PA 4CQMD 4PX2A 3B1JA 2H9UA 2FWBA 3LXXA 1HA3A 4GM4A 4N1AA 1T15A 1KK1A 4EP1A 1VL0A 1FUKA 4F9GA 4YAIA 2O5CA 3WGGA 1B8VA 2POQX 4JJGA 521PA 5JFGA 4S12A 1YVUA 4KITB 2FYKA 4KQKA 2NSYA 2B92A 4O2AF 1TVCA 3RI3A 2Q9AA 2NP7A 1N2JA 3AVYA 1AQLA 1NHGA 1GPBA 1ZMTA 1CE8A 3G49A 1QOPB 4UNPA 2XNDD 4YY3B 3OPYB 4MVJD 4JDUA 4QAJA 4XGNA 4RQTA 1A2KC 5DGHA 5CFOA 1P91A 1YQTA 2I2DA 4MRAA 3KWJA 5KAPA 2RK3A 3A0UA 5FPSA 1Z0IA 4M38A 4F91B 1T5TA 3F7NA 1HDRA 3G13A 3QWBA 4NHEA 1C3EA 4HGZA 5M5BA 3GRFA 1DG9A 3FCUB 3WXMA 1BDIA 4LJ8A 2BM9A 3AL2A 4AYXA 3GVPA 4UFPA 4ZIRA 3TKYA 3V2UA 1FP4A 5C8YB 1LZKA 1D6MA 5AI5A 4FEAA 4BPRA 2A6PA 5DE3A 4Q47A 1K7EB 4WZAA 1R0BA 3ZG6A 5BMVA 5K09A 1IUNA 1KDPA 2Z3WA 3FZGA 2WTAA 3UCFA 2DR3A 1BFUA 4L0CA 2R4QA 4JVMA 3KKNA 3EFSA 1IRIA 1X38A 2QP3A 2PH5A 3N2ZB 4HDRB 3V4ZA 5C4IA 4LJLA 3CKMA 8GPBA 2XRZA 1ZIOA 4Y6QA 3TUIC 5FNVF 1FYEA 3FM9A 3K0AA 3TJRA 2RMKA 3ELUA 4RD4A 1LDNA 1KERA 3M6WA 1GQOA 2Z6VA 3QPDA 2QWXA 4X85A 4KXXA 5BR1A 3R5TA 1BOFA 1WQ7A 3O8BA 1BVRA 1FIUA 4D0LB 4F5YA 1E6CA 1X86B 5EIWA 1Y63A 4I81A 1GN8A 4OH1A 3UVEA 1J42A 2E65A 1RJWA 3LBAA 4J0FA 3KYDB 3NT2A 2QMUA 1ZA2A 2VF4X 4OQLA 2PQ6A 1DUSA 3O8QA 1YS9A 1DAPA 3DF9A 5JUWA 1SVLA 1RJEA 2DPMA 4IIVA 5DM70 1UBNA 1L1QA 5HE9A 1WXFA 3LOPA 3L49A 4CLRB 4WSOA 4X7RA 1BGWA 1M8KA 1VPLA 3JYQA 1GNRA 3PITA 4JR1A 1E3WB 4XDZA 4MUIA 4IINA 4FKZA 1DXHA 2AOVA 1WDTA 3HGMA 3JZIA 4PLPA 5JTTA 3AM1A 2QUJA 4MSUA 1WP4A 1P7ZA 1P1HA 2PS1A 2BBOA 3NANA 3TOCA 2ZZFA 4Z53A 1H0XA 2IKQA 3H2SA 1KO5A 1V1JA 4Q7KA 4D9KA 2QU7A 1OFHA 4QGSA 4C29A 1FCJA 1M7BA 4D4HA 2DDZA 3IEUA 5A05A 2IX9A 2ZBPA 3NPMA 3IA7A 1D8TA 2FG6C 2PWZA 1ST2A 1OSNA 2WB4A 1IHOA 3W7VA 2QHTA 3IMKA 3HDJA 2ZYHA 2GM9A 4OQQA 3DE2X 4P38A 4BFYA 4BLPA 5C32A 2W9XA 1NP6A 1BMFA 3QKSB 4RIIA 4AL4A 3VYTB 2BGKA 4IYJA 3NHJA 1E92A 2BDEA 1Z8FA 3PNKA 2QYOA 3FFBA 5BW5A 3EVNA 2ZRFA 5KVVA 2QAIA 4JB0A 4W7HA 4ZZ1A 3ZOZA 3UA3A 4C3OB 1OFUX 5KJCA 4DR3B 3K16A 4BRZA 4MDFA 3SICE 1QJ4A 1K0FA 2CF6A 1N2HA 2ATXA 3HJNA 4PZUA 5IBPA 1SUCA 4DA0A 5J2UA 3ZCSA 4C7BA 5MGBA 1DPFA 3AUFA 3ONWA 4Z4QA 2XSZD 1TYZA 2ZCVA 4CF3A 5BV2P 2WWHA 2XBMA 3NQ41 3ICWA 4HP8A 1ACMA 4P7JA 1XTKA 1XJ5A 1ZVMA 2PN1A 4GKKB 4JELA 2PUTA 2QMHA 5B3JA 2MCFA 2ZZKA 3EFEA 3GVXA 3V4PB 5KQRA 2PBFA 4HSGA 1BEZA 1L1RA 2Z0MA 4Q19A 5F1PA 3HGQA 4UNNA 4DL9A 1O96A 1XZMA 2GBLA 1N2CE 2P9TA 2Q6TA 3JQ9A 3AEQA 4M8KA 4LY9A 4S35A 4U2FA 5EIFA 2FSVC 5L8VA 2C9CA 1T9CA 3OOYA 3WK4A 3D1VA 5JECA 2WG1A 2QN8A 4S1TA 4A3SA 3OZ7A 1PJ2A 4IEIA 2RHMA 4S0ZA 4WZ6A 4RGBA 4IIHA 4MW7A 3GVCA 4DVGA 5ECWA 3DMFA 2CE7A 1P1FA 1G3RA 3EQ2A 3FSEA 3HI4A 1FJ2A 1MEEA 4MW5A 4BKOA 2E1HA 1I6MA 5K0NA 3MWYW 1KFJB 1EWKA 4RIFA 2FPWA 4DM3A 1USYC 3ZDRA 2EJFA 2D5LA 2JIDA 4GVLA 4H9GA 3TNJA 4P33A 2WFLB 1SHZA 3IOYA 2OAEA 1HL7A 1KH2A 3LPDA 3PG5A 1A98A 1GSOA 1MHPA 3K94A 3OEEA 4PICA 4PSDA 5DHSA 3VZSA 5A4DA 3CZMA 1QVZA 1I0IA 1HWYA 4HQ6A 1DDIA 1N2OA 2R8ZA 3A14A 1EDDA 3D3JA 3P9YA 2AKWB 5CB4B 3EFHA 4DIDA 1MJNA 1XYVA 3FRIA 2F1IA 5AM0A 5KWIA 1FLVA 4I6GA 2BI8A 3SBEA 2BVNA 3B3JA 3JARB 4K26A 3DCNA 3DS8A 3JWIA 4IQFA 3ZD7A 4Y2PA 1F2TB 2MSEB 3HWRA 1OLSA 2R96A 3BXPA 3F6RA 3DBRA 3PFNA 4GL4A 5AQEA 3GT0A 2O2ZA 4XTZA 3E23A 2GM4A 4TVSA 2R6GA 2GVZC 3WIBA 5ICCA 4UP9A 5FXMA 3SNHA 4X1KB 1X56A 1P5RA 3A4LA 1YCFA 2FPKA 2I7DA 3RJZA 1AA6A 4OAOA 3EASA 3DZJA 2GAAA 2NPOA 4JQZA 5YASA 2I3DA 1DT3A 4GLFA 4I4TA 1B7YA 2EW8A 1W30A 1IN7A 2I2CA 5AOCA 2X4IA 4LJ4A 2JLSA 3L93A 3RHZA 1W4AA 1VPWA 1P2GA 1Z2AA 2HLNA 4BLUA 1TJYA 4ZDWA 3IEXA 5JY1A 1R0YA 1TU4A 1PUXA 3DE0X 4M88A 4MJLA 4RH0A 4XR4A 4JEHA 1LQTA 4QEZA 3RS8A 3SZMA 1TT5A 4Y9RA 4S2EA 1VL2A 1U7OA 4X1YA 4GFDA 2YHSA 3OZFA 4DLKA 1D2GA 5GAJA 2WZBA 5E1DA 2PX6A 4M1YA 3SFVA 4L72A 1VI6A 2AC7A 3ESZA 3IVRA 3STVA 1P19A 2AFRA 1M6WA 2INGX 3EAFA 4Y6SA 3TRHA 5H9WA 4WAUA 5JNLA 1L7EA 2PFKA 1MT0A 4GPAA 5JAQA 3TB6A 4CCAA 1DO2A 1L3IA 5FOWA 4V1CI 5J2TA 4W9MC 1GPDG 4BX3A 2B37A 1P62B 2K5UA 2WU8A 3MWKA 3H2ZA 3L46A 1T5HX 5CK5A 3DCIA 4F96A 9LDTA 5IYZF 3G0IA 2FWIA 3U4IA 2FSFA 4R1LA 3EF3A 1QAMA 4WE3A 2IEIA 4G81A 4AROA 2R7LA 5FTMA 3SX0A 2GVNA 4WK0B 4C01A 3KB1A 4HLUC 1VRWA 2BGTA 4KDFA 4TWAA 2QE6A 1JR3E 4E6PA 4R2JA 2J4CA 4YUXA 4FJ1A 4L87A 3NHFA 2Q49A 3I04A 4CM3A 1Z8NA 2O0LA 3BE4A 3BK2A 3CBQA 3SE7A 3G2PA 1BDHA 1RAGA 2ZAYA 4ZWNA 5EP2A 4TXHA 2YVKA 4NBUA 1YBVA 5DLDA 3PFBA 1X7WB 1ZZGA 2AQKA 5L51A 5LCXA 3QENA 1U2TA 1I5EA 4ARBA 2F3QA 3A0RB 1QP0A 1EGAA 2YFHA 1NBHA 3AZPA 1U3VA 1WJGA 4U9IS 1YS2X 4MUMA 2PK3A 3HDYA 3FVRA 6GPBA 3M4XA 3L0DA 1C1DB 5FWNA 3H9UA 3SLGA 4PBTA 4MWCA 1E1RD 2KW5A 3P2JA 3NNSA 4OYYA 1YNOA 3ZS8A 5I9BA 3QYPA 3V7FA 1ORWA 1SVUA 4PPYA 3I9OA 3HR4A 4LC1A 2WMNB 2JFGA 4K0RA 3NAGA 5CNMA 3N8IA 4E6EA 5LLSA 4AB1A 3VPGA 4TMKA 4ID9A 1CDDA 1ODFA 1XRQA 1Y5LA 3QPVA 4W1PA 5F7ZA 3W04A 3ZWAA 4BMDA 3M1YA 4YX9A 1Y8QB 5JZOA 3CT6A 3WYGA 3VDRA 3NUQA 1SMKA 1Z3CA 5F9HA 1R15A 1CRWG 3LCUA 4I1VA 5JOQA 3OZIA 4J1QA 5B36A 2O7NA 1VCHA 3DBOB 3ZWBA 3NC1C 1VLVA 2EG5A 3L3BA 1VHWA 1M1XB 2BR4A 3DNMA 4TMWA 1M1ZA 3H1BA 4NV1A 1KJNA 3SS7X 2I71A 2X0JA 3GLGB 2VJYA 1FBTA 3NTOA 3OZBA 1JYEA 2FK8A 2WHPB 2JJ8A 1XU4A 3VM6A 3HXMA 1O0CA 1C3VA 1X1CA 2ERYA 4GOMD 1KI8A 1V37A 4LWPA 1AM4D 1T6ZA 3K4HA 2JGEA 4GYYA 4KQFA 4TLEA 4ROTA 2BTEA 1D2EA 4S1PA 1Z2PX 1JHDA 2W6JA 4W5HA 1U1DA 2JCXA 4NWIA 5FP0A 3IQHX 4Q12A 1SY7A 2O3JA 4P84A 2XDYA 1WU8A 5IFLA 3VX4A 2BM8A 1Z5PA 4P31A 1NUPA 4DSZA 2GD1O 1ZU5A 3UJHA 5IYZB 4S05A 2XUIA 5AVWA 4CM4B 2F3PA 2MT9A 4YCJA 2LKCA 3LXUX 3BE5A 3BJMA 3B1XA 1U7HA 3KT0A 3NASA 4OP2A 4PZZA 4REMA 5FULA 1YRYE 1GSIA 3S4YA 5LZ9A 2EC5A 4OGFA 4WESB 3V8EA 5IJ9A 1NXQA 3KJEA 2OCAA 1CVLA 1ZD8A 1CETA 3TLGB 3ECAA 4AX8A 5JS8A 1C1XA 2EGHA 4R1QA 5TEWA 1I94B 2VAPA 5KPJA 3KR1A 4FLMA 3EGWA 2XDQB 2ZR8A 1EGMB 5TRTA 1F06A 4CXMA 1HSZA 1D2CA 2ZU6A 1NUSA 1OV4A 3PICA 2A5JA 4L8WB 1CR2A 1CUBA 3UC9A 1FSPA 5CT8A 3CEAA 1T0PA 2GTIA 3IAHA 4KTTE 4G0QA 2A5LA 2IXFA 2RAFA 3ELYA 4TTIA 5DCWA 3VKUA 2R6HA 3VOTA 1AHIA 3H1TA 1UWKA 4Y7DA 4UM7A 2RONA 1HX7A 3R5XA 3PDIB 4JI6B 4ZHQA 4MYHA 4CMBA 2DRIA 2ID4A 3CE6A 3MJTA 1OGJA 1WP9A 3A1VA 3BKXA 4RZHA 4U5XA 4XFKA 1RXWA 4X6UA 3Q2KA 5JAHA 4DV7B 4J90A 5AJXA 3KAQA 4Z7NB 1BCRB 2AV6A 1QO0D 1P4HA 4MGEA 1JV2B 4A2CA 3W0LB 4S2UA 4U39A 4Z8YA 5CIQA 5I51A 1ATZA 3CEHA 2LRHA 1XYGA 1CY4A 1PLJA 1UAAA 1LXCA 3EXIA 3L40A 3VKVA 4TXJA 1K9VF 1TKRA 3OFVA 4RY0A 3RT1A 4ZYTA 4E1VA 1TIKA 4OL9A 3Q7IA 3KTAB 1Q3TA 4XGQA 3DLCA 2ZAIA 3PC2A 2P3OA 2VZLA 2H2DA 5B1YA 3ROFA 2VYVA 4XTVA 1LK5A 1ST3A 3ROZA 1LD3A 4Q3NA 4HAWA 2ODTX 1OXXK 1ZL0A 2BZ0A 2NUAA 2P0AA 3C6MA 3GL9A 4OUDB 3LI2A 4H4CA 4UOEA 2JFFA 2WE7A 3JXEA 1KYXA 3MINB 4R7TA 2GYWA 1Y48E 2WSMA 2XBUA 5KOJA 4JROA 4EBFA 4JGGA 5KSOA 1SD1A 2HLPA 4GNKA 1DZ3A 4R2KA 4Q39A 1RABA 4LF5B 4XASA 1V7PC 4IMJB 3BXEA 3UMYA 2JH9A 1H4TA 3QEJA 4XWKA 3B7GA 1J5WA 1MAWA 1DIBA 4XU0A 2GQ0A 2RKWA 3IUMA 1QIGA 1DQPA 4WDRA 2ZWVA 2R79A 3RG8A 3N8GA 3L2OB 5DTMA 2QEQA 3TLEA 2BC9A 1ZVJA 2V8OA 1V5FA 2C0PA 3FF1A 3FY4A 5AHRA 3S0JA 1MOQA 2FPIB 4G5GA 4H3SA 2W42A 4CL2A 3B5IA 5J5CA 3RRXA 4BN5A 2M9MA 4WLOA 4RVOA 1XTVA 1OX4A 4J1TA 1BFKA 2J4DA 2QK4A 4V0MA 3DHNA 4NDNE 1QLWA 2H16A 2OBFA 3R0XA 3PEWA 2VH1A 1GG8A 4KQHA 2O8FA 3QXSA 2O3QA 5MHTA 4WA8A 5I3CA 4XQCA 2AMLA 4LKOA 2NU8B 2WY2D 3GP8A 3N39C 2IEBA 2GZMA 4ER3A 2QX9A 2YFQA 5JALA 3B9BA 5KU1A 2QE7D 4MINA 3IAXA 3NVKI 3GWGA 3UG7A 1OXSC 3UPTA 1IPEA 1GADO 1X87A 3C5CA 1I1NA 2WYOA 4M54A 2ZSKA 1FUEA 1GY8A 1UBTS 3ETLA 4UHDA 4JC5A 1A1VA 4ZIRB 1JHAA 3TFOA 1BDJA 1DUVG 3L7MA 1XZDA 4AZ0B 2OD9A 1OYVA 3HFVA 2QZJA 2ODEA 4RK1A 1PJSA 3CNHA 3Q3GE 1TCAA 2PDAA 4C7KA 4CKBA 1UJ4A 1KZYC 1Z6YA 4L5JA 5ED0A 1DCFA 3GUYA 2YRXA 3OFJA 1C0AA 4O59O 1PBTA 2XQGA 4R0VA 4CM8B 1U5BB 3G02A 3CLRC 3PA8A 3WRXC 1A96A 1NUTA 4GX2A 1Y4SA 1ZZEA 3PUKA 1G19A 3E05A 2A1UB 4BNVA 5AW2A 3GLIA 1XXHE 4TKUA 5A0VA 1P61B 4A1OA 1QGED 1OTXA 2RHTA 1G60A 2IOFK 2VH2A 3FPHA 1XQYA 2PSEA 3ZIHA 5CA0F 4YT4A 4G01B 5DASA 5EPOA 5LN1A 3REOA 1BYUA 4C2AA 2IY7A 3BD9A 2HAEA 5AOBA 3SFTA 5ALTA 3KCNA 1LS1A 2GFIA 1IULA 3EGDA 2XAAA 1FMLA 4W99A 1TNDA 4WCFB 3RODA 2QIPA 3HWSA 1PHPA 1J0CA 2DBRA 4DY4A 4EAQA 5L6MB 2CVOA 4OPMA 2DERA 1CIVA 3C3KA 1S2GA 4TKLA 2YWGA 1JIIA 1UINA 3R09A 3C5WP 4A0HA 1UZMA 2C8JA 4JWTA 2A8YA 3KQTA 4NE7A 4OHUA 1MJFA 5D51S 4FOTA 1TMKA 2FZGA 5EKXA 3LDGA 4DADA 4G0WA 1L1FA 4CCSA 4TTJA 4JMLA 1WUTA 2C7IA 1A71A 3R7WA 3UWSA 4RPJA 3KV1A 2P8JA 1OFTA 2QBYA 4ZT6A 3U1TA 1YRQA 3B7WA 4C08A 4TTPA 5C2JB 1Z29A 4BWFB 3CRQA 1HQKA 2ZS7A 3E5HA 3PIRA 4XEMA 1DJOA 1VE9A 2CFIA 3MTJA 4PWYA 4LGCA 4RFSA 3ML1A 5TMDA 2VT2A 3TKAA 4N3CA 3T7DA 4H2WA 2J9RA 2X14A 1W0CA 1DX4A 1DOAA 1XTPA 4NCIA 4R05A 3Q5GA 2RH5A 3DBIA 3F8SA 3RVDA 1Z6GA 2J6IA 2PAAA 3SJUA 1FDUA 4YRGA 3PQDA 3X1WA 4B2PA 1GVNB 1EQAA 4RU1A 3A7EA 4R9VA 4Y30A 4A8JC 5IJ0A 1RWKA 1QONA 4FN4A 5LQKA 1EUYA 3F3YA 1J09A 3L0CA 4HWTA 3S27A 3SQXA 2ISCA 3VPHA 1EP3B 1DC6A 1OHHD 3HEBA 3QYFA 5F78A 3CX6A 2QKYA 4WKGA 4YASA 3DFUA 2BJHA 3AHIA 1VBFA 1HQDA 2GAOA 2EL9A 3BMNA 1LRKA 3A2KA 3R5KA 1WZCA 2QVXX 3G88A 3JAWB 4FYKA 5FADA 3RO7A 4CMHA 5JJBA 4HWPA 1P9LA 5H02A 4LJ5A 2NP6A 1HYEA 3DVLA 3EIHA 4AN4A 2X13A 1BX1A 4HR7A 3HFGA 3RT7A 1E2EA 3HKCA 1ZXBA 5HFJA 3WP0A 1ZGCA 4E5KA 4J7CA 4M1MA 4ETIA 4DDHA 2FTKE 3FZQA 3ZY6A 4RMFA 2BUAA 2DH6A 3ZLUA 3WMXA 4JJIA 1YVEI 5ITWA 5EE0A 3TG8A 1USKA 3NR2A 4MVCA 5F52A 1V4NA 4P5EA 1LFDB 3OCXA 2PX8A 4U8HA 3TQQA 5K99A 1PJQA 1KY4A 2HIGA 3LY8A 3TX6A 4XU3A 5SV2A 1VE5A 2BL4A 4GBGA 3VZRA 4ARIA 2J6BA 4L76A 2C58A 4F2WA 2HJSA 2WLSA 4HWKA 4PLVA 4C07A 5K0FA 5EUMA 3C8DA 2JGMA 4AC9A 2XUQA 3KT8A 1PR1A 1WQ3A 4QOSA 1UBLS 3IDFA 3OIDA 3E3OA 3I45A 4FB4A 2A59A 3RE1A 3AIMA 3DP7A 4F2HA 5JV5A 1NJ5A 1PV2A 1RTKA 2VP5A 1VA4A 3GY0A 2C3MA 4QPPA 5E3JA 3WA6A 4F4JA 5L3ZA 1KQPA 5EJ8A 3JQCA 1XEZA 3OPVA 4Y9SA 5DTEA 3DTVA 2IV7A 2EEPA 3KJZA 2QOEA 2PO5A 3KEFA 1P5ZB 1X54A 4KXVA 4RHCA 4NFLA 2H1CA 3A3PA 3NHMA 3WGKA 3BAFA 3H4TA 3OOJA 4GT1A 4P4LA 3T3DA 1S89A 4X54A 1E3DA 3DMTC 4I5IA 4LNAA 5BUSA 2JK1A 4HRAA 3K1AA 1J2EA 2UVPA 4E07A 2WYVA 4RADA 3UJNA 5FEMA 1U5BA 5LBUA 3LSSA 2QXTA 3L9XA 2H65A 3EFOA 2Q7HA 2RGWA 5K3SA 3ET4A 5IT0A 1E2IA 4HBZA 4AJLA 4I5FA 1ABBA 4IIYA 1A95A 1AGXA 1G21B 1VHLA 2O7RA 3HXKA 4HB4A 5E4YA 1MO2A 3VPAA 1PVVA 2B9VA 2LN3A 3BPSA 2FN9A 5C1DA 5KX5F 3MZ0A 3A32A 2X1LA 4MS3A 2JI7A 1HLGA 2IGBA 3PGA1 1EK0A 3KPYA 5PGMA 1X7YB 1RBMA 4JY7A 2R6CA 3UJ9A 3I30X 4G25A 2B8WA 5IUKC 4Q7LA 3RK0A 5D3KA 4UULA 1Q1AA 1RFLA 2RHRA 3HCOA 3P45A 3EQ9A 4R6WA 3T94A 4XKJA 3R3UA 5DHFA 4F4FA 2YZ7A 3KVYA 3L8DA 1M1YE 1AKQA 4WERA 1FS4A 2JCSA 4GYJA 1YOVB 2ZIWB 3RYHA 3NV9A 4DQ0A 4Q01A 3H3XA 3G2HA 5DMXA 1SKYE 3DJFA 1HXDA 5D5QA 5BSEA 1P31A 2RARA 3QKIA 4REQA 3E9IA 2WF7A 4FE3A 4WPGA 3U81A 1TO2E 1ADBA 3VR4H 3RRFA 1N1DA 3JD2A 5ES4B 4K46A 1NW8A 2HMVA 4N9QA 2VF7A 1POWA 1KRWA 2WSYB 1LN4A 1VIDA 2B4QA 3ILSA 2WWIA 2I0FA 3ESQA 4WCVA 3V4SA 5HOEA 1ZJ5A 3QH4A 3FUWA 1HM5A 2FY8A 3T7JA 1ZM4A 4B2LA 3PWTA 5L9AA 1XNRB 3REUA 2GFHA 5IAJA 2WMYA 5FOTA 3KBBA 1N75A 4YPOA 5E9JA 4JENA 2H2HA 2PV7A 3PTZA 2X6RA 4KPUA 2OAGA 3DG9A 1N3YA 3KEMA 3WRYA 2AJ8A 4U0KA 5EJEA 2P9JA 2RGGA 3JYOA 2VHQA 3L4EA 5DN6D 1BE1A 5IPFA 3ZVMA 2C9BA 1LSSA 2YINC 3WB2A 3EA5A 3ER9A 2P78A 3DXXA 3UK1A 1B8PA 4QJIA 3ES9A 4E2FA 2M2IA 5KNBD 1E22A 1KMNA 1HFEL 4MRSA 4ZPJA 4PN7A 1WWKA 3FYTA 5DRTA 3HZOA 4Z4HA 4X90A 5AIBA 1JDVA 1X7XA 4YCNA 2GEBA 1ZQ9A 2BGMA 3IAAA 2GXSA 1A97A 4GECA 4MLCA 2OR3A 3AETA 4TN1A 4TVBA 4WFKA 5EIAA 5F64A 4E46A 7ADHA 1QG6A 3PQ3A 4Z0TA 4ZC1A 3FTEA 2X7HA 4IIUA 1FS5A 1S7CA 3DV0A 4LCEA 1ML3A 3PYLA 4BMPB 2LNDA 4EDFA 4J4TA 4QOEA 3FCXA 3MPOA 2OGSA 2ZT6A 4MO2A 1GUYA 3VOAA 1VG8A 1EVLA 4CI9A 1WLEA 1RI1A 2OO5C 4DA9A 1KS2A 2YMMA 3AP1A 3ICCA 2GSDA 1HPLA 4X7PA 3C3PA 3R7SA 1YRBA 4LSZA 5TPWA 2WD8A 3KB6A 3EPHA 1XNHA 4FYHA 3ANMA 4LDRA 1OE0A 4I5GA 2GYVA 1NVVR 5EZYA 2JHGA 4OB8A 4QYIA 4BASA 1YMQA 2GLTA 3EDMA 2PXXA 3NIFB 3ZJYA 3BDIA 3UWPA 3VKGA 1YWGO 4IM7A 5DNEA 2CUTA 4RVFA 3E2IA 3N2KB 4WNAB 4V0QA 4D46A 1F8XA 1N0IA 5BOSB 3A10A 4KREA 1OASA 4Z3DA 2PV0A 2AZ4A 3URKA 3BWMA 2V45A 1Z0DA 2MSCB 1ZA1A 4CTMA 4QOJA 1ZOSA 3ISTA 5E0OA 5KPDA 1Z62A 5U1PA 4IIJA 4HAZA 4EHIA 2G9RA 1TCBA 1YFZA 2G63A 4TV9F 1H8EA 1NJ6A 2WEKA 3F97A 3KXIA 5THKA 2FN4A 4ZYLA 3MCWA 4NCNA 3PUYA 4DSAA 3QKUA 4Q9AA 3ED5A 3PE3A 2HFKA 1DC4A 5A71A 3RREA 5C31A 3DTNA 2FPPB 1EJBA 5ETJA 4MDHA 4X24A 1Y8QA 4AZ0A 4F2PA 4MARA 5JSQA 1JVBA 2ZIUB 1R88A 3OZGA 4R1UA 4MWBA 2GERA 3K9QO 4JEUA 3ZC3A 3ZUGA 3CZAA 4WJZA 1PZMA 2JFBA 1VG0B 1G4HA 2P41A 5FAKA 3ECCA 5DM4A 3QW2A 2Y1GA 3N5KA 2FCAA 4COKA 1NVAA 1BH6A 4GS5A 4HNAB 2QVCA 1T4MA 1JDBB 3FOCA 4UNSA 4DCSA 5LZ4A 4NTZA 4JA2A 2NXNA 4RD1A 1QRSA 2O8FB 4DJDC 1J9ZA 1BXGA 1N7IA 2OSBA 3GRPA 3MIZA 3GLHB 4HNGA 4O2RA 2WMDA 2XUJA 4I3FA 4R41A 4W6QA 2QLNA 2A9FA 2Q7OE 2B5WA 3IC5A 3T0GA 1QG4A 3LFTA 1XZEA 2CBGA 3VR4D 4E5DA 4FBMA 2WHPA 4CZ2A 3E82A 3TWOA 2DTXA 4KRGA 3FPJA 4EG4A 5JJ5A 3G89A 1OPRA 1SURA 3R5HA 4EG7A 1EVEA 3EDQA 3K0BA 4EG3A 1ZK0A 2YJTD 1ZD1A 5K0JA 1Q74A 1JU9A 4XWOA 3QLUA 3MT9A 1G20A 1K92A 3RC1A 1G16A 3ESAA 4F85A 1DJPA 3IAM1 4ZICA 3IEKA 1EB9A 1T34A 3OWHA 3M9XA 4IV0A 4EIWA 4RTQA 1H8HA 4O5AA 1EXDA 3N0TA 1UKCA 2FG7C 3FI9A 2JGLA 3KL2A 2QAGA 4DMRA 1XDGA 5DPMA 3Q7SA 1XNQB 2DSTA 3C3DA 4AQ7A 2D4HA 4P22A 4YDHB 2H11A 2ZJ4A 5JE8A 2VK8A 5JVDA 3AR6A 1YFKA 4DR1B 5EMMA 4YJ3B 3V3KA 2BHRA 1N0UA 2WUEA 4MYDA 1HE4A 5FR1A 4NYIR 3PTLA 1J9GA 1I3MA 4Q9DA 3ZJUA 3RLFA 2Q2WA 2I6XA 1ZUIA 1RP7A 4TYYA 3CF4A 2ASVA 3COWA 1S8OA 4K3VA 5IMBA 3UG6A 1E8NA 4DZZA 1QFJA 1YHYA 1Z2OX 4U5QA 4N5DA 4HYQA 4D99A 3P9NA 3HA3A 4U9UA 3W6PA 2AN1A 3OAAA 4YRJA 2QJFA 1CUAA 4N3BA 3BGDA 1N2SA 2QENA 1JLHA 1U0EA 3C5EA 2OL4A 2G5PA 1NNLA 2J3QA 4B43A 4CKXA 2H0QA 5CR9A 5L7YA 4IDCA 4CT4B 4OX9B 2RHLA 3QX7A 1D6JA 1V9CA 5LNK1 1CR1A 1EHCA 4XARA 2WWTA 3CUYA 3GJXC 2OHVA 3VUFA 2IYWA 1Y81A 3NC4A 4M89A 3HZZA 4KN8A 2Y1BA 1HYHA 1P8JA 2OECA 1ENPA 1OU0A 2PH3A 4R40A 1SHUX 2R68A 1V8ZA 3UEOA 3V48A 4JBHA 5HMMA 3X1KA 3GDFA 4CFYA 2EJ9A 1Q7TA 2PT6A 3HCEA 4RE5A 3PHJA 4X8HA 1JLMA 4ISBA 5L53A 2MJLA 1IK4A 1YIDA 3CEJA 3PK0A 4IFIA 1YT5A 2FQYA 1EWVA 3UMRA 1E5TA 1KKLA 1RLUA 2IVFA 1D2NA 1W93A 3GDGA 3CW2A 4X91A 3WWYA 4H2YA 3FBTA 1X9IA 2NXJA 3LO8A 2VDVE 5DYNA 3R23A 2VF5X 3D6AA 2QXUA 2PUVA 1BQ4A 2BFOA 4AG6A 8LDHA 5IDXA 1SEPA 1W1WA 1A9XB 3CRZA 3HNOA 3MXOA 4BNGA 3EGXB 3DVQX 4N6OA 4RSHA 2PT9A 4N41A 3ZYCA 4WH0A 1P81A 3GYGA 2VNIA 3I0NA 2B3DA 4ZODA 3ZY2A 3ZHSA 1FF9A 2O8CA 2V6JA 2XCIA 2Z4RA 1M6VA 3OPMA 1CDZA 1K86A 5CURA 1WMSA 1ID1A 2J48A 5DYWA 2YHIB 1H4QA 4YJGB 5EWJA 4E22A 2VHCA 4FFNA 4IDHA 4WJ4A 2FV8A 3K8OE 2ZTUA 4TSRA 3TTUA 2QE7A 3KTOA 4CM5A 4F56A 5FI1B 4QPCA 3UHAA 2XR1A 3EXHC 1Y6QA 2GZ1A 3KKKA 3U9LA 1XAIA 3A70A 4CKEB 7REQB 5LSAA 1MVNA 4B33A 5MN5A 3SDBA 2Q6VA 4LTNA 1B3RA 5BQ5A 1KORA 3FVTA 2XMBA 3M6AA 4TV8F 3P2OA 4YP5A 2B0CA 2LVBA 3KTFA 4JL8A 2H4JA 1JG7A 3WYEA 2VDWA 4YJ2A 2C61A 2JPDA 3VU9B 1S2OA 4TWRA 3WWCA 1W5TA 4B3GA 3G7SA 5AKZA 3IT1A 1G8KA 4XTUA 3G0DA 4IEFB 4ZFNA 2IRWA 4DXDA 4RK7A 3QXGA 1P9OA 3E4CA 1Z26A 1I6WA 1JJAA 3P27A 4FYYA 4OI2A 2G5TA 2HCFA 3PHHA 3GLUA 4LZPA 1CJMA 1KJ8A 1KFCB 3BUSA 1A2BA 3F8TA 2XRYA 3U6KA 1MC1A 1UMBA 2QRVA 1FMJA 3EXHB 5EERA 4P08A 4B3BA 5DXFA 3G9UA 4KFRA 4DWWA 2JI6A 5BVHB 1PSZA 2QPAA 4I6EA 2GBGA 3P0FA 4OHXA 3TZQA 1J8VA 5T7BA 4JP8A 3ULKA 1VOTA 2VA8A 2UYOA 3NEAA 4IR7A 3WWZA 4FR5A 3SSMA 1ZEMA 1NYRA 3TSUA 3IQZA 4REQB 3T7SA 3PFWO 1HSOA 4BWAA 1KJJA 4QM7A 3L7DA 2FEPA 3DWIA 4JT2A 1LV7A 2Z5GA 2M6LA 4DMKA 2C7QA 3EVBA 3E7FA 1YU9A 3PSAA 4WK2B 2K4MA 3OO1A 1B42A 4N7BA 4R2XA 4ASUA 1ULUA 3CMMA 5FUQA 1ASYA 4ZU1X 1WG8A 1V6SA 4LS3A 3I2KA 3QGMA 3ANXA 2WZCA 2ZRMA 5AT1A 5AW8A 2ONYA 4L78A 3TSYA 2YYAA 3UJAA 2H2GA 6YASA 3W2EA 2F55A 3OLQA 2ZWAA 4G86A 2AQ8A 4PC2A 4K9MA 3QVWA 5T8KA 1JH9A 1KE2A 3NM4A 4P3XA 1AB6A 2EFHB 2PXCA 1B93A 2FW9A 2WSLA 1EBUA 3LCJA 3QBEA 1N9WA 1O97D 3LHDA 3QY0A 4IIDA 3STTA 1T8TA 1YR9A 3I4FA 1IAVA 3NJ4A 3EVCA 5C8ZA 1A7JA 1UXHA 2I9PA 2ZJOA 1BX0A 1JDSA 1Z34A 3EZXA 4LOLA 4CCYB 4L08A 3E7WA 4M22A 1OV6A 4KR2A 1ADJA 1MKYA 3LCRA 4D79A 4HEA6 4Z3KA 2B7BA 4RSMA 3RC9A 4LFAB 1YA8A 5LDGA 1IOVA 1QJCA 4YUAA 3T1QA 3W3AD 2BFMA 4LPKA 3IUEA 4W5QA 5AKXA 1LGYA 1WXDA 1XRJA 3QTLA 4ARZB 1E0AA 3GUHA 3IP6A 3QG1A 1KNXA 1HFWA 2VVTA 5CXSA 2ORWA 1YOVA 2BRUA 2BFWA 1VG9B 2WBLC 3IAEA 3FZNA 4HADA 3C0KA 4RQUA 1DJNA 3X1YA 3PXUA 1GFWA 1W48A 1CXZA 1YQXA 2X7XA 3BB3A 2D06A 1YV9A 4PSUA 1D6NA 1CR0A 1XDWA 1CT9A 3CMQA 5F2NA 2L42A 4WGFA 2GO1A 1ECLA 5FBRB 4UU0A 4W5JA 1NFJA 4BY9E 4I36A 5CLGA 4C04A 2X5JO 3A1SA 2I67A 4I66A 2ORVA 3TI7A 4C76A 3QKBA 4L0MA 3D8SA 2ALJA 3FNGA 4QGHA 4V2UA 1V95A 1U0OC 1EFPB 1EU1A 1SIUA 1Y8AA 1TVKA 4TMYA 4F4UA 4Z9FA 4Z5XA 5JASA 4LZAA 4MO9A 2M98A 4BV2A 4RZQA 2NUPA 3ZI0A 1NI4B 1SQGA 1W94A 1NW4A 4MV5A 1V11B 3S6JA 1YZHA 2JGIA 4YWJA 3VJMA 3RAFC 4DV4B 4O2BF 1XTUA 4X45A 2V7QA 1E1CA 2QSYA 1GKKA 2IHJA 5A4KA 3HXZA 2BUCA 4YGYA 5JS2A 3VVMA 5TNXA 3ZQ6A 2X9NA 4K87A 2OVFA 2RI0A 1A8HA 1FP7A 2I7XA 1L9XA 3M34A 1X6VA 2O4CA 3TQOA 1SN7A 1XEXB 1VSUA 2Q7XA 1NVMB 3A6EA 3AERA 3V7SA 3W5JA 3U44B 1JEOA 3EMKA 1TCVA 1JHOA 3FYUA 4L9SA 1W2GA 3EZ7A 1JQAA 4CODB 1PE0A 1TU3A 5EZ5A 4FWBA 3SKYA 5LOVF 2EBWA 4ENPA 3GK3A 3V1TC 1IBMB 4QHSA 4QL3A 2G0TA 4YJ3A 4POAA 1OFVA 2OYSA 5K3DA 2VQDA 3D6VA 4Z9AA 1C3XA 1DRVA 1S9DA 4OOEA 1T1IA 4HRXA 3UK0A 4IG9A 3WIUA 2OFXA 4C43A 1KMHA 3NLLA 4MR7A 2D8MA 1WS6A 2YWBA 3SZUA 4YR9A 2B4YA 2Z09A 1Q1ZA 4KRYA 3ZIUA 1QRRA 5JW6A 5LFAA 1EJ6A 3OY2A 1LPMA 4Y2VA 2V0GA 4M9UA 2GWRA 5FPQA 1F5NA 3WDSA 2QDKA 4TYWA 1XLTA 2ZBFA 5E1BA 1KQGA 2RJOA 4DM7A 1A9TA 3JQRA 4PG6A 5CVCA 4OX9Y 1IWOA 2DBQA 4NHOA 1X42A 4M1EA 4XWAA 1SIWA 2FPMA 4WINA 2GD6A 4B2IA 5DSXA 4IY1A 4RFSB 5AVOA 1QQAA 3N0VA 1QH8B 1G9TA 4U4AA 4KDRA 1EFRA 5SZIA 2BE9A 5E6UA 4NKRA 2PBRA 4OMDA 3SBOA 2PSFA 3E9EA 5JO9A 3U4HA 2ZIXB 2IA5A 3EWAA 3G8DA 3KAJA 4Q4HB 4A8JA 1BOOA 2HBZA 2EDAA 4BVFA 1K3UB 2YCLA 3Q11A 4B17A 1Z06A 3JPWA 4ND3A 4CM7A 2PGIA 2TMGA 1ZN8A 2PWYA 1CX9B 3RWBA 3I2HA 2EWNA 3UXYA 4EQZA 1QF9A 2DECA 1SULA 3OQMA 2VUUA 1XF9A 4CV0A 1PLKA 2HIHA 1LWNA 2QMYA 4X7BA 3U3DA 4JBXA 2AJTA 3IVMA 2CJYA 4Y2JA 5CVTA 3W2GA 2YN4A 1J0XO 2X77A 5M2QA 1CNMA 2QV7A 2G9VA 2FZ5A 2FX2A 5IG2A 2EATA 2GJKA 5D8DA 1XF1A 2FPGA 3IUQA 5K3EA 2IU0A 1FSGA 1FOEB 2BFFA 3GCZA 1RM4A 2XE7A 3ZZ1A 2PL5A 1WR8A 1XLUA 4NULA 5I4KA 3M2PA 4JB2A 4RHYA 2VP3A 4ZQGA 5CITA 2OWDA 1YVDA 1X7XB 2PMBA 5KX5A 4XXHA 4XYGA 4B7UA 2AUNA 4YAFA 2OWEA 1UZUA 2J0EA 2WPDA 3KYIB 3CVYA 3SM3A 4KB5A 4NPHA 1FRNA 3IUSA 4IXMA 2OCIA 2GN4A 1U0GA 2V6FA 1CZHA 3E70C 1MA0A 2YYZA 5LBTA 4YAKA 2QRJA 4TQDA 2I2AA 4K05A 4YCDA 3WYAA 4TTVA 3CPEA 3HBAA 4U7TB 4AJ9A 4FZ5A 3Q10A 1NY6A 2O3TA 1EFVB 3P2EA 1DC5A 3WB0A 5CFPA 1RHJA 3ZLVA 4NBRA 5CAEA 2Y67A 4LJ6A 4IF4A 4RL4A 3LE8A 4UE3S 1NPTO 4RVSA 3WV5A 4CLDA 2ETXA 3R6LA 3I6QA 2LW7A 1YQ9A 2WU0A 4M49A 2BKYX 4MRPA 1ONNA 1YDWA 3MJFA 2CYBA 2D2FA 2R6AA 3RC2A 3TH5A 3AONB 1FNSA 3SVLA 4QATA 4B8YA 4RS3A 2BKXA 1JRLA 1WW2A 3AHFA 3K09C 2X86A 3HNPA 3NAMA 1AC5A 2LIVA 2Q6LA 3CE9A 2F1HA 4HMQA 4JKIA 5E6RA 1YIOA 5E6RB 1QGUB 4D2IA 1G38A 1GG5A 1SG6A 5BNTA 1QIHA 4I2NA 1XTZA 4RA6B 1CTQA 4BL5A 1CVRA 3BQMB 5DHRA 3W8NA 1FDSA 3AO0B 4J0JA 3S7ZA 1M1YA 4XW2A 3ZHCA 1KARA 3AU8A 1PEKE 1SKAA 4PZLA 1N4DA 3IKVA 5JWOA 3DDSA 3O3NB 1XTSA 2GZ2A 2RAVA 3PHCA 4MZXA 1IDN1 1JE0A 2NV2B 3CT4A 4LYHA 5C5EA 4IXDA 4YRPA 3FMFA 3DMGA 2H1IA 3AYXB 4Q4LA 4YXFA 2F17A 4QULA 3V32A 3L8YA 3VHLB 1ZNZA 1CBUA 2VRBA 3FHTA 3ZV5A 3KZOA 5I8PA 1NBEA 221PA 4XCVA 4O8CA 3VSAA 1O03A 3FN4A 2JH3A 3MJDA 1CIJA 1YR6A 2XWPA 3ZY5A 1QZ3A 4CG1A 3IQGX 1V0JA 4DCUA 1PNVA 4I1SA 5E7IA 4YI5A 4ENUA 3TMYA 2PZMA 1M1YB 2VP0A 2UVDA 1BRTA 4A4DA 2JJ1A 1IM2A 1UK7A 2MHCA 1ISFA 4GPBA 4O2BB 5D3MB 5DHTA 4D6XA 4DNXA 3ICPA 5KNDH 1PL7A 3WRXA 4DJJA 1QGUA 3K1JA 2GCNA 2GYYA 4NJOA 3PUWA 5KYKA 3LGSA 5JTUA 1P1JA 3SC2B 1P5JA 4KCGA 4DRZA 1AQYA 1AH2A 1J49A 1LVGA 4NZMA 2XSZA 3CLTD 2RKBA 4CUJA 4DSNA 3L7KA 2AYZA 4MS4B 3JVVA 3CNQS 2H4ZA 1V1RB 2K7ZA 2HDHA 3KQPA 3TZBA 4UBKA 1O0SA 1UM9B 2FE1A 4Q48A 4CETA 2OHIA 2OCPA 4CDNA 1KIAA 1OI2A 4RMGA 4GXQA 1KOJA 1N8NA 3K0FB 1EUDA 2NV0A 3DAHA 2ZRHA 3RVQA 4AY5A 4QELA 3KL4A 3NDRA 1FZTA 1JSXA 1R18A 2BFBA 3CPJB 4HDNB 1SHLA 2O2SA 4WUTA 3PX2A 1HT1E 2YWFA 3L0OA 1G8SA 1VBNA 2D2VA 3EMVA 4FQ5A 1NWCA 4FSXA 3P7MA 3OAAD 4INJA 3BGVA 2F3SA 2D7CA 4OREX 3F47A 2A0UA 1OBHA 3P4XA 4B82A 2I4LA 4YV1A 2ZSIA 3L4GA 3I1YA 3BK7A 4NOLA 2GF2A 4CMGA 5JJIA 5IJWA 2VNKA 1PEDA 3EH2A 1NATA 5AI8A 4XB2A 3ZIAA 3GMTA 1R0LA 1QH8A 2HJWA 2WIKA 3ZWPA 4CL3A 5TMBA 4QU0A 4NCBA 1KXZA 2IHYA 2Z04A 1KL7A 1NJSA 1M2JA 5CW1A 4DVJA 3MCUA 3LSTA 3S28A 3NVDA 2R7AA 1DXQA 2QG9A 1EVJA 3K9LA 1YACA 4QGAA 4WECA 5JMTA 1PD1A 1UWLA 3BJRA 3KSZO 2GPTA 2HSDA 5BQPA 1JNXX 3U3JA 3C48A 2A33A 2WJYA 4HX2A 4KOEC 5DW0A 3VNRA 1Z74A 4F8YA 4MEJA 5DT9A 4L8GA 2KWIA 4Q4JA 5FWYB 4EMSA 1XMQB 3T7IA 1QC5A 4WJ3M 2WYWA 2G76A 5K03A 3LNTA 5IDYA 2VXYA 4DS3A 2ZDHA 5BRJA 5CDYA 3F4LA 3NAQA 2J30A 3QU2A 4KV7A 1BCRA 3AEUB 4YJKA 2D74A 1U3WA 1Z0UA 2AW5A 5SYAA 4DZTA 2O8CB 1F1JA 1HNXB 1CDOA 3H17A 3RJMA 3JQDA 1DAFA 1DKQA 2X15A 3GRZA 3LC2O 3AKYA 3MF4A 4GC5A 4L85A 3G5MA 1A27A 5ARCA 1I30A 4H31A 4ITRC 2EVWX 3AERB 2PBLA 4PGAA 2WJVA 1YQDA 4H6PA 3OURA 2FZWA 2CHVA 3C7KA 4ZVQA 5KHLB 3T1HB 5DVZA 3ZH2A 5FOQA 1VBKA 3NT4A 4BKMA 1POXA 3VISA 5FUMA 4TN5A 1TTQB 4I55B 3MTEA 1LV8A 3IR6A 1UBSB 4XLTA 3GLGA 2JI9A 2Z6AA 4I9HA 5A04A 3DD5A 5GGXA 3TTVA 3H9GA 3RJ9A 2A8EA 1F2VA 1ZITA 3GOQA 4DAOA 5LYYA 1WPYA 1YVPA 3NTXA 3CLUD 1YJXA 2IYFA 3EC2A 1EGVB 1AZWA 3KOWA 4FDLA 4LXGA 4AJIA 4ZI7F 1SESA 2B20A 3T3GA 3IXQA 4DLVA 5EIHA 2E0IA 5CRIA 3W5HA 3R9WA 3HY0A 1VSTA 2JFXA 4B7XA 1FRQA 1JPNA 3AF1A 5JARA 4LFBB 3MJRA 4TVWA 1PWZA 1I4WA 2VBGA 3P9KA 1EVQA 4EI2A 2J59A 2XTMA 5BN1A 2PR7A 5E8RA 1B6TA 1LLFA 3QK7A 4YCAA 4FFDA 4M46A 4EEKA 1RXCA 1DIRA 1SBZA 1E7WA 2AEJA 3A2MA 3HSSA 4KMRA 5DNUA 5JEEA 1QCYA 1C1DA 2I54A 4Y1FA 4ALIA 1X1AA 3FYUB 3RACA 4EI7A 1AMOA 5DNVA 3UT5A 4ZAFA 2YUTA 5TDHA 3M5CA 2R66A 1SC4A 1NBAA 1K2VN 3C7DB 5LXTF 8ATCA 4YRBA 2JFVA 4IKOA 3CZRA 2AOUB 1IU9A 4G9EA 4M6WB 3BIWA 1KI6B 4TS4A 4CM8A 5FL7D 1JLLB 4WASA 4PYOA 4X94A 2VZ0A 1JDQA 1V11A 1B15A 1XZNA 2Q2QA 3MCVA 3NP7A 4G8JA 4ND5A 1GUFA 2VHJA 4W9NC 3STWA 1Y82A 3EBPA 1J8MF 2R8RA 2XLCA 3DTTA 3LF1A 3NXSA 5G40A 3I23A 3RJTA 1GLGA 4GBED 2WFZA 3VR6D 2EXXA 1W6UA 1RRVA 3O91A 3E3MA 4JR0A 4OSOA 1E7YA 1TC2A 3EQ7A 1UP6A 2QM3A 3IIKA 4LDZA 1U1IA 1ZLXA 5EUBA 1WXIA 3OMLA 3P32A 1K75A 4BO1A 1Z18A 2E4WA 4D9MA 5ARDA 4EF5A 5I7RA 4YDSA 1Z4NA 2G7ZA 5TE9A 2BGGA 4DWOA 2NYRA 2RK4A 1NV8A 2G4CA 1Y3HA 3OA0A 5J2TF 4QG3A 6Q21A 2ZTHA 1XTTA 1NPDA 2DJIA 3EFBA 4AYWA 4F9EA 2H29A 2XA1A 4FONA 3Q98A 3RHSA 1K7XB 2A30A 3MQ2A 4LVLA 4ZP1A 3ZK9A 2FZ4A 3DD1A 7ABPA 3L7CA 4XWYA 1MFZA 2DPHA 1M34A 5LQMA 5D7BA 4KXWA 3GLHA 1Z4QA 3JWPA 3NEYA 1U2EA 4CT0A 1N33B 3G0BA 3WK8A 1HLFA 3PWSA 1Q0SA 1U9JA 1TM7E 5KOIA 3DGFC 3KJQA 3NEJA 2B61A 3IR5A 1KDOA 5KYVA 2WSIA 3CF0A 2WVAA 3IMFA 4XPIB 2CK3D 4YC7A 2Q5IA 4UZSA 2WMOB 1DHTA 1C30A 3D4LA 1XB2A 2C29D 3AJRA 3BJIC 4RPIA 5JYCA 3O93A 5A4IS 4K6CA 1OX6A 2ZXFA 1GQYA 4NK5A 2MSDB 1XRRA 3FVWA 2CHUA 3ROXA 3KVNA 1U8XX 4QXOA 1FDRA 1XHFA 3OIUA 1RXIA 2XB9A 5E6SA 1UAGA 5BN4B 4CS3A 3I4CA 3I8SA 1DTEA 1YB1A 3K35A 1JR2A 1NNSA 4UAVA 3LH5A 2AKEA 3GJ7A 5FTNA 3AP3A 3RKYA 1YQWA 2I1WA 2ZJ0A 2Z95A 3GJ4A 3KFXA 3UT0A 4CNQA 5A1TA 2WUWE 3DNPA 5FFNA 1IEQA 3GRKA 2IF0A 1VDMA 2HCTA 4TZKA 1YRLA 5H1YA 4D4MA 5J2TB 4XD7A 3WNDA 1HR0B 2ODAA 3KQWA 1LTKA 1E5XA 4TOIA 4ZV9A 4EMBA 2D0PB 1KBOA 4FCTA 1WNFA 4NNOA 5EGSA 3T4XA 1RYHA 4C1BA 3KTAA 4MVJH 4QQRA 3DBVO 3ODPA 2GPBA 4B5LA 3BKWA 2J3DA 3OD5A 2Z9CA 2H4HA 3PUVA 3DDZX 4Q15A 1XKLA 4DILA 2OZLB 1E2PA 2GK6A 2RB5A 3O4FA 1ATIA 2BSQA 1VYUA 2JLVA 4I50A 4IXTA 4TSFD 1PR6A 4R1NA 4BAZA 4QYMA 1V7CA 3QKRB 3ENWA 2PCLA 1HFJA 2BE7A 4FGUA 3U4CA 3U7EB 5B4VA 3CB4A 1ZRMA 4BCDA 2Q7DA 1EFRD 2ACVA 3VH2A 3PF8A 2HUPA 2IBSA 4DMHA 1OAOC 1WLYA 3B5EA 3GH1A 4Z4GA 4UBLA 1TUBB 4AY4A 3NELA 4NONA 1AKTA 2UYGA 3CEMA 3I2IA 3QVSA 1C7FA 2Q2VA 2V7BA 4AUNA 1PT8A 3NRBA 3INRA 2FDCA 1GZ6A 5DCLA 5D00A 1KEUA 2GPNA 4MCHA 3MCZA 2XD9A 4E31A 3EUAA 2J0SA 3IAM6 3L1AA 3PWZA 1Q7CA 1TECE 1Y1PA 3UA4A 1YB7A 3T54A 3ZWKA 1C7RA 2YZ2A 1TM1E 2AG0A 3AJ9A 4OXRA 3VAAA 5K3OA 1ZSNA 2GZAA 5KMGA 2IV2X 4MQ4A 1U2GC 2PMEA 3LCMA 1ELOA 1NZDA 1Q44A 2X0DA 4B85A 3MTIA 4NBTA 4AD8A 4AQYB 3K32A 5IJ9B 1UP4A 2ZR3A 1V47A 4XYEA 4LTDA 3V97A 1IL2A 2J85A 2H48A 3RSOA 4TV9B 2HF2A 3QU7A 4NU5A 5JNUA 3UMSA 5ESXA 3MWDB 4BATA 5HQ3B 5F2OA 4FLEA 4DRXA 1TYBE 3R7AA 3STHA 1QYDA 4DRYA 2FUNB 1LBTA 2OESA 2VNSA 2VHWA 3F5SA 4H1UA 5EZSA 2GK7A 1E1QA 3VH3A 1WX1A 4DQ2A 2FF7A 4BVJA 2WYUA 1NI3A 1EMDA 3PNYA 1NBMA 1Y7HA 4RETA 3ROTA 2F1KA 1SK8A 1T4GA 1B41A 3NUZA 3Q8XB 4MWOA 1DBIA 8ADHA 3UXMA 3PXCX 4H15A 1ONBA 2VUIB 3WG9A 1VKZA 3JRWA 2JK0A 4PG7A 5FPYA 4UD2A 4ZRDA 5T57A 3OFKA 1I10A 1C8LA 5KSYA 1KGDA 1SBYA 3IP5A 1HETA 2Q1YA 4M98A 4MITA 1ZY2A 1E7RA 2FJPA 3SXPA 4ABYA 4FCVA 4BNUA 1N92A 2HHAA 3O7MA 4L5BA 2FDRA 4R84A 2DXIA 4MP8A 5AW0A 5JQGF 3C74A 1E3WA 3W2TA 2OFWA 2WJHA 1HLDA 4RY8A 2AEMA 4M60A 2C5BA 4IFTA 4LYYA 2XUPA 2VHVA 4KPUB 2HR1A 3VNUA 5F7JA 3RTGA 4XVRA 2R2AA 4MW1A 2FU5C 3BEOA 4XYMA 5AW9A 3VPSA 1RADA 1GP2A 1A5TA 1ORTA 2I7TA 4QRHA 3DLIA 4MUJA 2AVNA 3BWDD 4B47A 1CULC 1OI4A 2FAXA 4QREA 3V1KA 1S3SA 4EZBA 4YMUA 2FMXA 1EVYA 3K0FA 1W8DA 4UXIA 621PA 2RGBA 3BFMA 5HP4A 1WXQA 3IT2A 1UC8A 2H2FA 3PUZA 4MQBA 4TL7A 4DN6A 4ZCQA 2DX7A 3PLAE 2G6TA 4QFBA 4B8ZA 4BFCA 3WGYA 1DCJA 2H1LA 2OFOA 1CEYA 1WVIA 3BXXA 4JSTA 2GZSA 3NWOA 4G5YA 4D0NA 2JGJA 1O8BA 2WDZA 3PQ5A 3SVZA 1JXQA 4PY2A 2QN1A 4BHTA 1SBTA 3M5PA 1B16A 2B78A 1X80A 3PUXA 4MR9A 4XTCS 3AIOA 1T6XA 1D04A 5HZKA 1UXJA 1OH8A 2VQFB 4JCOA 3U9SA 1NOKA 2REXB 4LVIA 5IUNC 2XB6A 4TLMB 2IP1A 1G3IA 5A7HA 5LIRA 1PGOA 1TW2A 4WOKA 1Z7WA 1K5GA 2WT8A 1YZYA 2YY6A 3VH1A 4L5CA 2HDOA 1VKJA 4NH0A 2FFRA 3ZWDA 4DR6B 4D8XA 4ZOBA 1FU8A 1FDVA 4PIPA 4WK6A 1GN9A 2CSUA 3OESA 1VP9A 4NDZA 3RIXA 3B20A 4ZHQF 4EGJA 1G20B 4BX8A 4CE6A 1MRSA 2AD1A 2JD2A 2ODQA 1N3LA 3EWIA 4QWMA 1MW8X 3FD8A 5DHQA 3UAXA 2V6IA 5A7FA 1V7ZA 2PHZA 3K0CA 1JPJA 1T8PA 2WZQA 4IJQA 1AXGA 3Q9LA 4RJ2A 2CHFA 2HV9A 4IS2A 3WLRA 3CNEA 3FSGD 1PV1A 3LVJC 1T3TA 2QTVB 3MWJA 1YTUA 4FGJA 4MS1B 5KOHB 4DV0B 2HF7A 3OZTA 1PQPA 1BWRA 3USES 2R62A 3DUWA 1ADFA 1J90A 2IOYA 2VRNA 3WTCA 5JZBA 1CSEE 4ZO4A 3WLLA 1U7PA 3EYWA 2Q0QA 4K6HA 2XVMA 1T9KA 5EUQB 2I76A 5EIEA 3C5VA 4FILA 1C3LA 3HVIA 5I9SA 2X5NA 3G7NA 4DNQA 1JHXA 1U7TA 3O95A 2Q29A 2K6GA 4FYMA 1IN6A 1FFHA 2VPTA 4FU0A 4MJ3A 4FD3A 4OO3A 1GYRA 4K6OA 1TQDA 1QHHB 4M3NA 4CG0A 3DYVA 3FKSA 3WGZA 2JGRA 2BDTA 1F48A 2FHPA 3A4NA 4IRMA 3ETDA 2XITA 1W35A 1NX9A 4DQKA 5GOTA 2VJOA 4NOJA 2FWJA 2Z5FA 1N25A 2O14A 3K9HA 3OX3A 2IYXA 1TCUA 1U02A 2YCBA 2UAGA 2BM1A 3KJNA 4W6ZA 3V7YA 5EIXA 5B4TA 1T0IA 3HHEA 2WP0A 3ZWVA 5AESA 1ORRA 1W44A 4L5YA 4OLBA 4KE9A 3JU3A 3CJTA 3C8HA 4O0MA 5CDTA 6PFKA 5AYVA 4HUJA 2WM3A 1QP4A 1WUKS 1ZRSA 3I12A 3GLQA 1VJDA 3C85A 3V4RA 5IBCA 1F4VA 4Y1RA 3BWCA 4QTYA 1G3MA 1OJLA 2ODPA 2EK0A 2ZCEA 1WW3A 4FE7A 3W78A 4AJ2A 4GPTA 4PYRA 4FFSA 3EVZA 3H2YA 4E7PA 4TZ6A 1GAQA 4NS4A 1US8A 3AP2A 1XV5A 3BIJA 1T91A 4H7FA 4HGRA 4Z7JA 3H99A 1E58A 5HFNA 4WCFC 2PLFA 4B3TB 1O58A 4R1OA 5F1KA 2IPAB 2YWDA 4LVOA 3EY9A 1IOZA 3K0EA 3OCJA 4MA4A 1EFCA 4JI7B 1FQJA 4QXPA 3K5IA 1YJCA 1GYQA 2JIMA 4PYKA 4EFKA 1WBDA 2PMCA 4FMDB 1C81A 5JNWA 1J2JA 2VQ3A 1EX9A 2XTIA 1V71A 3L02A 4UCXA 4AF7A 4CG3A 5C8VA 2QYSA 3BB1A 3KVRA 3DWGA 2C2GA 2JD1A 4I9FA 4AWBA 4WKCA 4BB0A 1K7CA 5REQB 4OBXA 2I4NA 1GFIA 2IU4A 1HE2A 3WMGA 1B6GA 3FNQA 3WJ1A 4DIKA 4GMFA 2J3HA 2AOXA 2O9JA 5IC6A 1ZGZA 2Z1MA 3FB1A 4NRDA 1A2QA 1UKYA 4J2HA 2NAFA 2ZI7A 1A7UA 4G07A 4OXKA 4Z0PA 3LTEA 2A0YA 3Q72A 3ZGYA 4HDSB 4P75C 1ZHHA 4N01A 2DWUA 3PCXA 1UXGA 3W5SA 3JYPA 3LY7A 4QE3A 4I4NA 4I4LA 1E2LA 3FSRA 5GMOA 4BU1A 1WBBA 4RABA 4LJRA 2ZLBA 1U4SA 3U3XA 2MR5A 4J6EA 2ENUA 5DBHX 1TQ6A 2GJ4A 3F5FA 3L0PA 4NJEA 4C3UA 4EW3A 4JASB 3A5ZA 4GD3Q 3VDNB 3O74A 2OK8A 3CWQA 1WF3A 3W8FA 3TPZA 4WN9A 4E32A 4JU8A