4HVGA

Jak3 kinase domain in complex with 2-cyclopropyl-5h-pyrrolo[2,3-b]pyrazine-7-carboxylic acid ((s)-2-hydroxy-1,2-dimethyl-propyl)-amide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
290
structure length
281
Chain Sequence
PTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title 3-Amido Pyrrolopyrazine JAK Kinase Inhibitors: Development of a JAK3 vs JAK1 Selective Inhibitor and Evaluation in Cellular and in Vivo Models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 281
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hvgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hvgA01
4AOIA 3VBYA 1YOLA 2O63A 4J99A 4FSWA 3CIKA 3C0HA 4JBPA 4U43A 4TYHB 4GFMA 4IB1A 3ODYX 4QT1A 4XLIA 5JH6A 4NTTA 3O51A 3VULA 4XV3A 4O7TA 3P1AA 5DYJA 5ANKA 5I9UA 4O0RA 5FBOA 4ALVA 1UWJA 4DEHA 5FBNC 5IQAA 3DAKA 4RX9A 4DYMA 4UX9A 2YAAA 4HGLA 3QQFA 3A99A 4NFNA 2YLFA 4O1OA 2JAMA 3W32A 3NYOA 5DT4A 4AZFA 3M42A 4XG9A 5KMMA 1JKSA 1P4OA 2XM8A 1M14A 3CJGA 2X8IA 3FPMA 2OW3A 4O0SA 3QHRA 4E5BA 2XJ1A 4IAIA 4F4PA 5IEXA 4BZDA 4FGRA 3NDMA 2P0CA 3NNVA 1WVWA 3Q4ZA 4FKPA 1JBPE 4IX6A 4J71A 3ZLWA 3PIYA 1GZ8A 2FSOX 2W1HA 3W18A 3A7FA 5IUHA 2QVSE 2ITOA 1IRKA 3EH9A 3PP0A 4GYIA 5CAQA 5M4UA 1FGKA 3TCPA 3W2QA 4D1SA 1DI9A 1ATPE 5BYYA 2Q83A 3NW5A 4IVDA 3C5UA 2C3IB 4FNWA 1M17A 4CNHA 2PMNX 2C5VA 2Y4IB 4FIHA 3Q2JA 4QMZA 4FEUA 3FHIA 3O8PA 4JAIA 5IUIA 2VX1A 3R8ZA 2C6OA 1OMWA 4K9YA 3NW7A 3BGPA 3EQIA 3DFCB 3DAJA 2J5FA 3R7GA 3R0TA 4MCVA 3RPYA 4NEUA 4BGQA 4DTAA 1H26A 4HPUE 3V6RA 5HORA 5M09A 1YOJA 4RIXA 4EUUA 4C57A 4DFLA 3GOKA 3D15A 3ZLYA 2C5YA 2I0EA 3BE9A 4WIHA 4YZDA 3QYZA 2J0KA 2OFUA 1LEWA 2C69A 2WMVA 5HE1A 2ZB1A 2YISA 3MY5A 1OITA 4AZSA 1WVXA 2WGJA 4N6YA 3T3VA 5IQBA 5L2TA 3Q4CA 1GY3A 3VQUA 4U97A 3W2SA 4UV0A 5ITAA 3SLSA 2VTTA 4YP8A 3AMAA 2XIZA 4HNIA 4MKCA 5DN3A 4ZXTA 4A07A 4OW8A 3LFFA 4BCKA 1AGWA 5CF8A 3F82A 3RCJA 3KA0A 3KCKA 3PPKA 4J7BA 2HELA 5A4EA 2BRMA 2F7EE 5HU9A 3DK3A 3F5PA 4I5HA 5GJDA 3ETAA 3DDPA 2J90A 3A60A 5CT7A 4IVBA 3RHXA 2WTJA 3CE3A 4XBRA 2CJMA 4EK4A 2RL5A 5E8VA 2VO6A 4FKIA 4OGRA 3KRRA 2R0IA 4KB8A 4RQVA 3ZO4A 4ANNA 1GOLA 4GCJA 4BTJA 1H1QA 2JFLA 2P3GX 3F69A 3Q60A 3QWJA 5C8KA 3RM6A 3UO5A 4AUAA 3AC3A 4FSQA 4GW8A 1PMEA 5AUYA 4C4IA 4BGGA 5CF4A 4UALA 5CAVA 1ZXEA 3EWHA 3LVPA 1H1PA 4DBNA 4PPBA 4RFZA 5BYZA 3MPAA 2IPXA 5JEBA 3QBNA 2WZJA 2X7OA 3FKNA 3VUGA 3BYVA 1U46A 3F7WA 4NJDA 4X3FB 4EK5A 2QD9A 5DBXA 2Z60A 3D83A 4RC3A 4NM3A 1F0QA 3QUPA 4MXAA 3DBFA 3FEGA 4O27B 2WU6A 4TYEA 3SRVA 4LV8A 4RPVA 5K5NA 3S3IA 5AV4A 4KBAA 1FMKA 3CY3A 5LMAA 5FXRA 5JT2A 4NIFA 2OXYA 4RT7A 4PL4A 2R5TA 4O7NA 4L45A 3LFCA 3ZYAA 2YCFA 5E8XA 4QP9A 4QMLA 4FTRA 5HVJA 1YDTE 3BYSA 3UIMA 3FMKA 4FKUA 2P55A 4FKQA 4TWNA 3IONA 5KMNA 3PVGA 4UWCA 2A2AA 4MBLA 1U5RA 4AZVA 2QR7A 2Z7SA 4MX9A 2BDFA 2BPMA 3OEFX 5EW9A 1MQBA 4FE2A 3GFWA 3QAME 5CF5A 3R9DA 1H00A 2ITUA 3RK9A 1YW2A 3FMMA 5DA3A 5EYCA 5HGIA 3VUHA 4CKJA 4XYFA 2YCQA 4O0YA 1OKZA 2YERA 3E8EA 4APPA 4H05A 1WFCA 4I5MA 2WOTA 3WILA 4GU9A 4RA5A 2YZLA 2XCHA 5CU4A 5HEZA 2XRWA 2FO0A 3FXXA 2XIXA 4GFOA 4IB5A 4KBCA 3P78A 4L9IA 2J51A 1OECA 4U40A 3R9HA 3TNQB 3ZZEA 2V7OA 1R0PA 3F2AA 4FVQA 4FEXA 5HTIA 1XBAA 3C0GA 3T3UA 3FYJX 2XKDA 4C2WA 4EHZA 2PK9A 4R7BA 1B38A 2PMLX 4O1PA 4MHAA 4YC3A 4O0TA 5F1ZA 4AXAA 3BZ3A 5BNJA 4OT5A 4WRSA 3AC2A 3ZDIA 4DE4A 2VO3A 4PTEA 3SVVA 5H3QA 4MWIA 5K0KA 5HI2A 4ZY4A 4DCEA 3I1AA 5M4IA 3IDCA 5GZ9A 4JAJA 2PVYA 3QXOA 3NYVA 3TNPC 5IA2A 1TVOA 3NWWA 4PL5A 3POOA 2VU3A 2J4ZA 5FDXA 5CSPA 4P5ZA 4QMMA 4U79A 5K0XA 5D41A 1OZ1A 3WF5A 2G01A 5L3AA 2A4LA 4TYGA 3SXSA 3QRKA 5B7VA 4F08A 3R30A 1Y91A 2DYLA 2JITA 3C51A 3FL4A 3PJ3A 3PYYA 3BHYA 1WBWA 2W9ZB 4MBIA 4QP6A 4O21A 4EHEA 4LUEA 5LXMA 3UZTA 4QQCA 3HZTA 3Q4TA 3GXLA 1Q8YA 4RIOA 4S31A 3GC9A 4WKQA 1G8AA 4E5AX 2PTKA 4AGCA 3E87A 3RI1A 2YWVA 3TI1A 1H1SA 1OL2A 3C1XA 4V0GB 4J1RA 2XBJA 4KAOA 4EQMA 3ZOSA 3JR1A 3NAYA 3HLLA 1JSUA 3ZUVA 3PRIA 1OKVA 3PE1A 4YZMA 4AE9A 3PPJA 4HNFA 4CZYB 5BVFA 2XKCA 5M56A 3BLRA 5EKOA 3SDJA 4IM3A 4EH8A 3MH0A 4I0RA 3OCTA 4N70A 2O2UA 4IB0A 3GBZA 2OKRA 4IE9A 4AW5A 4AP7A 1DM2A 2PVNA 4FZFB 3V5JA 4FYNA 2XVDA 5FM3A 3LFBA 1GIHA 5A14A 5JSMA 1J7UA 3ZEWA 3NUAA 1BI7A 5A3XA 3RWPA 2XZSA 1PYXA 4EH4A 3SG9A 3K2LA 4EORA 1NY3A 3QGWA 3KGAA 1OUYA 3WZKA 2YA9A 4U8ZA 5AWMA 3VHEA 4Y46A 4CXAA 4LV5A 4APCA 1UNHA 3HDNA 3OOMA 4IM2A 2WO6A 4UYAA 4YTCA 3NNWA 4ZJIA 3RCDA 4C2VA 3KK9A 4HOKA 1UA2A 3N4VA 4S30A 4W9XA 5LWNA 1OPJA 3BI6A 3JY0A 4HJOA 3QGYA 2PE0A 4E20A 1W82A 4JG7A 2OXXA 3KXMA 5CVGA 3DU8A 3BU6A 2PULA 2YM7A 3TEIA 2RFDA 3Q6UA 5HG9A 3VUTA 3ZTXA 2VN9A 4M0YA 4EOJA 3PSDA 5FP5A 5AV3A 3Q9YA 4EZ5A 2BHHA 3LMGA 4I1ZA 3ERKA 3G0EA 3KVXA 5EOLA 4ASXA 1LUFA 2GNLA 2CGXA 4RA4A 3CPCA 5F20A 3DXQA 4I6HA 4NWMA 4ZK5A 4AN3A 1WAKA 4LOOA 4ZJVA 2WOUA 3A2CA 2QLUA 1XH7A 1KSWA 3TNHA 1WBNA 2NO3A 4DGLC 2XYUA 4EOPA 2YFXA 5IDNA 5KCVA 3NUYA 4B0GA 2PVFA 3OEZA 2E9OA 4AW2A 4C4EA 1O9UA 3TJCA 3IKAA 2J0IA 2VD5A 4U0IA 3D5VA 3FYKX 1Q41A 3HP5A 3PVUA 4ZTLA 3KF4A 4WA9A 3UC4A 3VJOA 3ATSA 5KMIA 3LPBA 1P5EA 3HAVA 4OAVB 2WIHA 3TKIA 2GNJA 3O7LB 4FOBA 4QQTA 3DXPA 4HGSA 3OTVA 2XNOA 1QPEA 2O8YA 1B6CB 1R39A 4OTQA 3MFTA 2C1AA 5DLSA 4RJ3A 4XCUA 4FZAB 4QTAA 5TKDA 3ORKA 4JX7A 5LCKA 1TQPA 2JGZA 3QTWA 4H36A 4ANBA 4H1MA 4IWQA 3D9VA 1UU8A 2QKRA 3ATTA 3F5UA 3EN7A 5IZFA 3NR9A 1RQQA 3DLSA 2J5EA 3DK7A 3A7GA 5HBJA 2JDSA 1LEZA 2IVUA 3GI3A 4U80A 1FBNA 4BCIA 4LOPA 4QP2A 3R83A 4BDBA 2QO2A 2ERZE 5B0XA 2PUPA 4ZP5A 3A7IA 4F65A 4ZEGA 3TV6A 4PDSA 4WO5A 4E4MA 4C4GA 3R7VA 4BDEA 4OTRA 4LRMA 3VW8A 3JPVA 4L6QA 2BUJA 4RVLA 3QRIA 4ZSEA 4OBPA 4DITA 3CTQA 3TIZA 2F4JA 5IKWA 2W4OA 4EK8A 5AAGA 2OJ9A 1UU9A 2WHBA 3CS9A 4NH1A 3AD6A 4BB4A 3VBVA 3L8PA 3ORIA 5CVHA 4FV1A 4D2VA 3FLYA 2VWIA 3HA6A 3P23A 4NM7A 5ETFA 3VS0A 1KOBA 4YU2A 4GG7A 5GJFA 4U44A 3H9RA 5CS6A 2AUHA 4FSYA 4CYIA 1BL7A 3G2FA 3D0EA 1W98A 2VWBA 3V5LA 3BGQA 3WIGA 2VV9A 2CKPA 1OIUA 4W4XA 5IDPA 4IFGA 5FRIA 3KK8A 4LUDA 3ENHA 4MAOA 1PYEA 1XH8A 3L8VA 3POZA 3OVVA 3H4JA 4WSQA 1YWVA 2REIA 4IQ6A 4LMUA 3UG2A 4J52A 2BALA 1XJDA 3ZU7A 3EKNA 5J8IA 4EOLA 3U9NA 4FA2A 3ALNA 2I0VA 1QMZA 2GPHA 3QWKA 4LI5A 3R7YA 4AACA 3KXXA 4DBXA 1PXKA 1FQ1B 2C1BA 2QG5A 2GS6A 5IMXA 1KE7A 3T8OA 4FNYA 5BX0A 5C8NA 2UW6A 4RVTA 2C5NA 3I0OA 4IX3A 2ZMCA 5AP7A 3R7UA 1K3AA 2IJMA 4KRDA 5CQWA 3RTPA 4NL0A 2A0CX 2XYNA 1OIQA 3L9NA 3FXZA 4YHTA 2GU8A 2JIUA 2YITA 5J7BA 3DT1A 4L43A 5BUEA 4RJ8A 5J9ZA 2RG5A 3D4QA 2BAJA 1BUHA 1XH6A 2R7BA 3VNTA 4M15A 1YI3A 3OS3A 1IEPA 3UTOA 2PSQA 4MYGA 1J7IA 2EXCX 2Y4IC 4M14A 5HQ0A 3AG9A 5D10A 4BDIA 3CGOA 5H9BA 3ZRMA 4F7LA 4A4XA 4JX3A 2CN5A 4CZUA 3QTRA 3UOLA 2CMWA 3UIUA 5L2IA 1PHKA 3GCUA 3PXFA 4RWIA 4GS6A 3L9LA 3LMHA 4O38A 3W1FA 4FKJA 1URWA 4PP7A 5HKMA 3LXKA 3DY7A 1Q8TA 1T46A 4NT4A 4FKVA 4G6OA 4I5CA 3H10A 3BEAA 3A62A 5AX9A 4C3PA 2X7FA 4CSVA 4DGNA 4OAUC 2JD5A 1STCE 3PA3A 4XEYA 4EH6A 3G6HA 2VTRA 1ZMUA 3IS5A 4LOQA 4O0VA 4L7SA 4Z9LA 4YHJA 3NVMB 2I7QA 4FV0A 4O7LA 1RE8A 1ZYLA 5JFSA 4C3FA 2PVKA 2HENA 4BIDA 3QTZA 3PJCA 3AC5A 1M2RA 3Q5IA 4XG3A 1M2PA 2W4KA 3RPRA 3WF9A 2BRNA 4DFZE 3FQHA 3EN6A 3TNIA 3TZ7A 1H28A 1UNLA 3AC8A 3CCNA 4RQKA 2JLDA 4DG0E 2XK4A 3MESA 2OZOA 2YCRA 4LGDA 3LFSA 2XA4A 4GK2A 4XG6A 4EJNA 5EW8A 5LVNA 1Q61A 2QHNA 3OTUA 1PRYA 1U54B 2BMCA 4R5YA 5AR2A 4MNEA 2PHKA 5I9VA 3LQ3A 4FZ7A 4CMOA 3VBWA 3V8TA 4XRJA 4I6BA 3C4XA 2C6IA 4XG2A 3V8WA 4J95A 4EOQA 3MY0A 3PXRA 4L7FA 5J1VA 3T9TA 3NIZA 3L8XA 4ZTNA 2QNJA 3MI9A 2WMRA 2R0UA 3QALE 3TNWA 4XMOA 2B7AA 4Y5HA 4E4XA 2A19B 5M51A 2OH4A 4D1ZA 4ENYA 4QMWA 3C5IA 1JAMA 3LZBA 4AU8A 4FT5A 4BFMA 2JIVA 4CMTA 3MA3A 3COIA 5DT0A 3UOKA 5HHWA 3QQKA 5EHOA 5AX3A 4F0FA 2E9NA 4CFWA 4E7WA 3F3WA 4D4RA 3SHEA 3ZXTA 2BRHA 3FL5A 3HMPA 3HP2A 5CTPA 4E93A 5LMBA 1CKJA 4EH5A 3FZPA 3DBEA 5GZ8A 2PZPA 3R73A 4TYHA 4E6DA 3E7VA 1JOWB 1QPCA 1YOMA 4G6NA 4JNWA 4PUZA 1PY5A 4UY9A 3CTHA 3II5A 4I5PA 4WG4A 4MQ1A 3EQPA 4AAAA 5J9YA 1H8FA 2W1DA 4HYIA 4NU1A 2PZ5A 5L6WL 4O2ZA 4CRSA 1YVJA 4AE6A 5I9XA 4IVCA 4IB3A 4UYNA 4EC8A 2J6MA 2OG8A 3TZMA 3QRJA 3Q6WA 3CPBA 2GNGA 4FX3A 2J0JA 4WOVA 3U9CA 2QR8A 4BDJA 4BZNA 5AEPA 4ZTSA 2VWWA 3BELA 1XKKA 2ITVA 5DPVA 2BFXA 3JUHA 2X1NA 3UO6A 3LFEA 4TL0A 3ZONA 4NKSA 2OH0E 3DOGA 3UGCA 3GP0A 4HYSA 2VUWA 3OCBA 4EBWA 4OTIA 3E88A 5AUTA 2Y6OA 1WBOA 3BGZA 5HVKA 2W17A 2UZTA 3EFWA 2UVXA 4L00A 4JIAA 3KL8A 4H3BA 1PKGA 3FJQE 4XS2A 3P86A 4CKRA 3ZFXA 4MWHA 3A7JA 3LFNA 3IK3A 2BAKA 5DI1A 2PUNA 5LWMA 4QMPA 3NRMA 4RFYA 4RLLA 1YHWA 1UU7A 2JBOA 4U7ZA 4XX9A 3REPA 3PVBA 2BZHB 2GCDA 4IAYA 4LG4A 1ND4A 3PSBA 4WBBB 5DRDA 4R7HA 1SNUA 4TXCA 3W10A 2J50A 3ZH8A 4FTQA 3FI8A 2WELA 5E8YA 4ZMFA 3ZFYA 3PSCA 2HZ4A 3BBTB 3BYOA 3MH3A 3OG7A 4GUEA 4F63A 4GKIA 4NCTC 4QNYA 3E8CA 2OI4X 4CCUA 3HVCA 4KKHA 3DAEA 5M4CA 1H1WA 1YXTA 2EUFB 2Y8OA 4D0WA 5AM6A 3W8QA 5IQFA 1MUOA 4IAKA 3LAUA 3PXQA 2CGUA 4LM5A 3PY0A 2ITNA 5HX8A 4ZY6A 4P2KA 4QQ5A 5IH6A 4FMQA 2YM5A 1H27A 5AUWA 1PMUA 3V01A 1DI8A 2WTKB 3KN6A 3VRYA 4EZ7A 1BLXA 4PPCA 3FY2A 4IZYA 4KKGA 4HCVA 2YACA 3K5VA 3UE4A 2IZSA 4OTPA 5HO7A 2V62A 3NW6A 4XOZA 3R7OA 2HOGA 2PE2A 1NXKA 1Q62A 3D94A 3RNYA 3DB8A 4KIKB 3DKCA 3LJ0A 3EOCA 4RIWB 4YLJA 3HKOA 3VUDA 3UQFA 4JL9A 1V1KA 3MVHA 4O96A 4RX8A 4PQNA 5CSXA 5J95A 3ZSGA 4D9TA 1MQ4A 2VRXA 3SW7A 3QA8A 3MTFA 2IW9A 5I9ZA 3SD0A 1JKKA 3AT2A 4ONAA 4UMRA 3B2WA 3TV4A 1NVRA 4FTTA 4BKJA 5BVDA 5G1XA 3O0GA 3QTIA 4A9UA 1SNXA 4PMPA 5JMSA 2H9VA 3I81A 3VUMA 1O6KA 3I0QA 3PXZA 2YEXA 4XHKB 4I4EA 4IZ7A 2XH5A 5ETCA 3UG1A 2QOOA 4YJSA 1OL5A 4M66A 4X3FA 4ZIMA 4IC7A 2ZV7A 5CU0A 1XBBA 3CXWA 4BC6A 4E6QA 1FINA 4WUAA 4PMTA 3OFMA 3D2IA 5CEMA 3KMUA 5EHLA 4L52A 3LLAA 3S4QA 3ZO3A 2X8DA 3AT3A 4AX8A 3EFJA 4Z7HA 2ZAZA 4E73A 5IPJA 3P5KA 4C35A 5HCYA 4Y95A 5AP5A 2B4SB 5LOHA 3ID6C 4KIOA 4BZOA 4I3ZA 5ANEA 2C68A 5IQGA 1OIYA 4K11A 2YJSA 4L3LA 3IECA 5CAOA 3EZVA 4ITJA 4J97A 3IDPA 5D12A 2BHEA 3FKOA 3ZLSA 3DB6A 5JFVA 4UBAA 4YC8A 3ZRLA 2R3NA 1H07A 4GVAA 4FSUA 3DGKA 4MVFA 3Q2MA 4YJVA 1LPUA 5A4TA 2ZVAA 1G5SA 2DWBA 1PXIA 4FSNA 2QU6A 1ZMVA 3FHRA 4YLKA 5DE2A 3LOKA 3MYGA 3GFEA 3R01A 4CV8A 4R3CA 1PKDA 3K3IA 1UNGA 3BV2A 4ZOGA 4G1WA 5HNBA 1OPKA 5CLPA 3S1HA 1E1VA 3P7AA 3O7LD 4FV3A 4QP7A 4YJOA 3QZHA 3MSSA 4C61A 1MRUA 3DV3A 1F5QA 5FXQA 5ICPA 3CP9A 5AR5A 3JY9A 3EKKA 4WD5A 1OGUA 4G3FA 4L01A 1NVQA 2XRUA 4XH6A 2Z02A 3OF0A 3QTQA 3ORMA 2VTNA 4YR8A 5K4IA 3PDTA 4D9UA 2CPKE 5EI6A 3AXWA 4X2NA 4BVUA 2XK7A 3TXOA 3VS2A 2GHLA 3WZEA 4W8EA 2C0OA 3F6XA 2OWBA 4OTWA 4AA5A 4AZEA 5JRQA 3R1SA 3GB2A 1JWHA 5A4LA 3OCSA 3C9WA 4ZS4A 4U3ZA 3QD4A 2Z7LA 2ONLA 3FMNA 4FL3A 4NCTA 2ITXA 3RAHA 3QU0A 2VTHA 3EQHA 4HYHA 4TWCA 4BDKA 4RX5A 2AYPA 4IEBA 4G3EA 5EW3A 4B99A 3QQUA 3OOGA 3PA4A 4Y73A 4EKLA 3LW0A 1M7QA 3ZC6A 3COKA 2YHVA 3PA5A 2WEVA 4D58A 4YSJA 1OI9A 5CU6A 5KUPA 4AW1A 4P7EA 5EDQA 2R7IA 3NPCA 3V5WA 2SRCA 2ZV9A 4V05A 4B9DA 4JLCA 4D2WA 3ITZA 4QMXA 2OK1A 2GS2A 3FZTA 5C27A 4YHFA 4HVHA 3ZS5A 4W4VA 2O5KA 1K9AA 1H08A 5KBQA 4IWOA 4BHZA 4M67A 3TUDA 1OL7A 5DEYA 5L8JA 2CGVA 1FPUA 3EB0A 5FG8A 2ZOQA 3LCTA 4H58A 2QOFA 3SG8A 3COMA 5IA4A 3FQEA 3ORNA 3ZC5A 4FT0A 5JZJA 3P08A 2F57A 5A4QA 4V0GA 1SYKA 4DH1A 5HZNA 3F2RA 3OXIA 3NUSA 2CCIA 3SQQA 3ULIA 3GU7A 4K6ZA 2CKOA 4GJ3A 4I93A 4X6RA 4YJPA 3VVHA 4IXPA 5EYKA 4B8LA 1J7LA 3VWAA 2WTVA 3BE2A 2IWIA 2WQEA 3MS9A 3U55A 5CSVA 3U8WA 3HV6A 4P5QA 4XRLA 1XBCA 4UN0C 3VO3A 2XK3A 3G9NA 3MFSA 4RJ6A 4BDHA 2PZYA 3FMLA 3K54A 5GIOE 1KWPA 3MB7A 4L44A 4GVJA 1NT2A 3FZRA 3RWQA 3C4FA 4J98A 4CQEA 1TQMA 4GL9A 4MTAA 4C4JA 2W1CA 3IGGA 2VWYA 3ZSHA 1PW2A 5GINE 3ACKA 4AG8A 3PWYA 4PP9A 1G8SA 5DG5A 4B4LA 3RZBA 5HCXA 2XS0A 5AUUA 4FK6A 2UZDA 1H4LA 3W2RA 3DNEA 4X2FA 4FK3A 3DNDA 4ZJJA 5JRSA 4O0WA 3VS4A 3NLBA 4BL1A 4YBJA 2IZUA 4O2PA 4PWNA 3KXHA 3C4EA 4BTFA 3LMIA 2IVVA 2WTCA 2GDOA 3C4ZA 4GT5A 4F0GA 3F88A 4Q9ZA 2XEYA 4AOTA 2VGPA 5LMKC 2XB7A 2B9HA 2F9GA 2OF4A 2VTMA 3NUNA 2PMIA 5FTQA 2QOLA 4FG7A 3R8MA 3V8SA 4KWPA 2W5BA 5DWRA 2NP8A 3R9RA 3MPTA 5E8UA 4CVAA 3E92A 1YXXA 4FL1A 4NK9A 1Z9XA 1L8TA 4PMMA 5HO8A 4ACGA 2ZM3A 3NAXA 4ZZMA 4RWJA 1ZZLA 4PNIA 2QURA 4U3YA 4EH9A 3ORZA 4R1VA 5H8GA 3QC9A 2QOKA 4QOXA 4DEGA 3CR0A 3VS1A 4UEUA 2IO6A 3UOHA 3VS7A 5BVOA 4NZWB 5CEPA 4JBOA 4YJTA 3MGYA 5CNOA 5IH4A 3U6HA 1OPLA 2QOHA 2WIPA 4MBJA 1WZYA 3CKWA 3HGKA 2QLQA 3MH1A 3OROA 3OUKA 3IQ7A 5CXZA 2F2CB 3CQWA 4QO9A 3R1NA 4L46A 3OY3A 4ANLA 5KHWA 4USFA 3HV5A 3ORLA 4D2SA 2H34A 3RKBA 3SOCA 2ACXA 4XUFA 5DR2A 3NS9A 4FKWA 1XHAA 4E4NA 5IEYA 1S9IA 5LJJA 4ZTMA 5AV0A 1WCCA 2X9EA 1XWSA 4F6WA 4A4LA 2RKUA 3WF6A 2FH9A 2XEZA 2XNGA 3VBXA 3RVGA 3O17A 4ZZNA 1QCFA 1CDKA 2WMTA 3QUEA 1Q4LA 4AT5A 3V51A 2PL0A 2BIYA 2Q0NA 3WYXA 3DFAA 2HYYA 3UIBA 3EQFA 4FODA 4R7IA 5EI2A 1JLUE 1KUTA 4BHNA 3OWKA 2X7GA 3E8DA 5B2LA 3DJ5A 4B6LA 1M2QA 5IU2A 4TWPA 5AIRA 4D5HA 1PMVA 4DEEA 2R3PA 4RVMA 3UP2A 4KA3A 5HLNA 4GSBA 4CMUA 2XBAA 4ERWA 2FSLX 4GK3A 2UW4A 4AS0A 5CI6A 2F49A 3KN5A 1H01A 3MV5A 5BUJA 3WF7A 2W05A 4QTDA 3KREA 4BCHA 4Z55A 4R78A 4OBOA 3VS5A 4TYIA 4ASZA 4BN1A 4DN5A 2CLQA 2AC3A 3F3TA 4XG8A 2HY0A 3ZMMA 1A48A 2VTOA 3JVRA 4MF0A 2BZIB 4R5SA 3OW4A 4RBLA 5AV1A 3WI6A 3ZEPA 3NUXA 4PNKA 2GHGA 3I4BA 4Y85A 1Q3WA 3D5WA 3R1QA 1REJA 3WZUA 5C4LA 3VQHA 5EDPA 3UO4A 3BHHA 2C6MA 5DR6A 5I0BA 3G15A 1GJOA 3F5GA 5DVRA 4DT8A 2YCSA 3N4TA 4RGJA 2IZRA 5KZIA 3FMJA 4L3JA 3R9NA 5AR7A 3AD5A 4ERKA 5IQIA 3WYYA 2WEIA 3KF7A 5IA5A 5IISA 3BHTA 3D5UA 4EZ3A 4FIEA 2HZNA 2OFVA 3ELJA 3GC0A 3NUPA 2ZM4A 3DZOA 4D1XA 2DUVA 2X2KA 3OUNB 5J7HA 3RK5A 3O8TA 4Z7GA 4JOAA 4FVPA 3U51A 4O0XA 4CLIA 1JQHA 4IW0A 4RVKA 4CFNA 5LMKA 3Q3BA 2YIXA 2X6DA 3IGOA 4FTJA 3QX4A 3WIKA 3MWUA 4EOOA 2G2HA 2PY3A 3V04A 2VNWA 2Y9QA 3LQ5A 3VAPA 4JDJA 4GEOA 3R9OA 4BI2A 3LXPA 4R77A 4OR5A 3FMHA 2YM3A 3V5PA 3SV0A 3QZIA 5T3QA 2QU5A 4KS8A 5EM8A 4FGBA 3QKKA 4AN2A 3TTJA 2EWAA 4X2JA 4FSRA 5CQUA 5D7AA 2HK5A 1OUKA 3KEXA 3UC3A 2WPAA 4YJQA 2B1PA 4BRXA 3FWQA 3MW1A 5HLWA 2GFCA 5AJQA 4BYIA 3K5UA 5FQDC 4RWLA 2X6EA 4Y72A 4QTEA 2BZJA 3MN3A 4Y83A 2IW8A 5CNNA 4BTKA 4C62A 2RSVA 3LCDA 4OLIA 4DH3A 1XH5A 4JXFA 1VYZA 2WMXA 5AAFA 3GQIA 2QKWB 2OO8X 5DEWA 5EYMA 2J0MB 4MEDA 5HLPA 3VHKA 5L8KA 5HICA 3R2YA 3LFQA 3OWJA 4DTKA 4HYUA 3PLAE 4BI0A 2VGOA 4WRGA 4F70A 3UVRA 3HNGA 2R3JA 3O50A 2EXEA 4FKOA 5TF9A 2BDJA 1CKPA 2X4ZA 3L8SA 3IW6A 2PUUA 4A9TA 1OB3A 1XO2B 3R8LA 5IQCA 2DS1A 2JC6A 4G6LA 3QRUA 4XV1A 3PJ8A 5EYDA 4JI9A 1VJYA 4CG8A 1Q5KA 2UW3A 4FTCA 4ACCA 4NW6A 2UV2A 3S0OA 3FY0A 2W1IA 2WTKC 3IW5A 5TO8A 5HU3A 3CGFA 5HG7A 5BVKA 4D4YA 3LXLA 3D7ZA 2H8HA 3CY2A 4GKHA 1OKYA 3PJ1A 4F7NA 3MVLA 3QCXA 4FV6A 1JKTA 5M44A 2XMYA 1U54A 3ZFMA 5FTGA 2VO7A 3WARA 3LE6A 4QMSA 5ANGA 3QFVA 3R21A 4RJ4A 3GUBA 4CTCA 4DAWA 4ANSA 4IMYA 4I4FA 4Q5HA 4FV2A 3ZSIA 4WG3A 2HAKA 4IIRA 1OKWA 4B8MA 5J5TA 2HXQA 4O7YA 1FVRA 2CKEA 3BKBA 5IA0A 4BI1A 4D2TA 4MK0A 4LRJA 5F9EA 3PJ2A 3S00A 1ZOGA 3G6GA 4UB7A 3UBDA 1YWNA 2G9XA 5HG8A 3FAAA 4CKIA 3LQ8A 1UKIA 4IDTA 4DH5A 4IADA 3UZRA 4FTOA 5JQ8A 3TZ9A 4CFFA 3DS6A 3QQJA 3ANQA 3ZXZA 5AUZA 3FLSA 4D28A 3F3UA 3GQLA 4CFMA 4YTHA 4D55A 1Y57A 4I41A 2P4IA 4ZTHA 4DH7A 2VWVA 1ZLTA 3SC1A 5LVMA 3Q9ZA 4IH8A 2B0QA 1U5QA 4EC9A 2OXDA 5AP4A 4D2RA 4RFMA 3G9LX 3ZM9A 3DKOA 4RG0A 4NFMA 4N4SA 3DZQA 4X0MA 2YDKA 1SVHA 5IG1A 4YPDA 5C9CA 2OICA 4YJUA 1Q99A 2JFMA 3HMMA 2VWZA 2ZV2A 1GZKA 2OU7A 3Q96A 2UZUE 2XKEA 3QYWA 4C4FA 1TQIA 3FXWA 3ZO1A 4EL9A 1DAYA 3WZJA 4EONA 4UMTA 2WFYA 3SKCA 4M69B 5KMLA 4XV2A 4GV1A 5HBHA 3B2TA 2GNFA 4WG5A 2R3MA 5AADA 5K4JA 4L68A 3OCGA 2VTQA 3QD3A 3LJ2A 4LFIA 4PY1A 4I6FA 2ITWA 3V5QA 4FTKA 4G31A 2XIKA 3VF8A 4DFBA 4M7IA 2ETMA 4NW5A 2VTIA 3I79A 4MXZA 5EM6A 3UZPA 5GIPE 4USDA 2GTMA 5JKGA 4KUJA 3UODA 4BIBA 2PVJA 3F9NA 1PMNA 2WMAA 4H39A 3FZOA 4FTMA 1MRVA 4CFXA 4FKSA 4H3QA 5A6NA 3KXZA 4BDFA 2JIIA 3QQLA 4O82A 2YIRA 4FUXA 4I6QA 4M97A 3MFRA 5K5XA 4XJ0A 3HV3A 3M2WA 4DC2A 1UU3A 3HV7A 3F7ZA 3OXTA 3PFQA 2OBJA 5CSHA 5EQEA 4C4HA 1RDQE 3UNKA 5LVLA 2B9FA 4O81A 3E7OA 4MXCA 3TKUA 3FC1X 4C02A 3NEWA 4HVSA 5EQYA 5DFPA 1J1CA 4BBMA 5ACBC 2W7XA 4RSSA 3MPMA 3TUBA 4DINA 3EFLA 2YAKA 4XG7A 1Y6BA 5DMZA 3PXYA 4JDHA 5HE3A 5E4HA 3EL7A 3IDBA 4WNMA 5CANA 3IO7A 4QYEA 3KVWA 3TL8A 4M12A 4MXXA 3R7IA 2XIYA 3R71A 5HO6A 3UVQA 4QMNA 3DA6A 2Z2WA 3AMBA 3T9IA 3UDBA 5CEOA 4KKEA 2A1AB 2F2UA 4KIKA 3EYGA 3HUBA 4FOCA 4RIWA 1PXMA 5HE0A 2VTPA 5T6KA 5L6OA 5E1EA 4B7TA 4O7RA 2BRGA 3KULB 4RC4A 4IZ5A 1CM8A 3NIEA 5EFQA 2QG7A 5TT7A 1Y8YA 5ANDA 5AUVA 4ALWA 4ZSAA 4G3GA 4C0TA 2JKOA 3G51A 2QO9A 3Q4UA 2FSTX 5DNRA 3RPOA 3TN8A 3VRZA 4EWHA 1PXLA 2OLCA 2JEDA 4YGAA 4GMYA 2XP2A 4FV9A 4KSQA 2WMUA 4U9AA 5A4CA 5HD4A 1P14A 1XR1A 3JYAA 4I94A 4YZNA 4HCUA 1ZYJA 2LGCA 3A7HA 4O0UA 3UYSA 2WXVA 3E64A 3RALA 4UMUA 3C50A 4IX4A 5D9HA 1U4DA 3KKVA 2CSNA 2Z7QA 4K1BA 3VUIA 3VIDA 5KX8A 3C4WA 5L2WA 2OZAB 4O6EA 2PUIA 1VYWA 2C3LA 2C6DA 1O6YA 1UV5A 3KRXA 2BVAA 3TWJA 4FI1A 1IG1A 3PTGA 2BRBA 2PU8A 3KFAA 1V0BA 2Y4PA 4F64A 1REKA 3CD8A 4K0YA 2IN6A 1XH4A 4FTUA 2OIDA 4JR7A 4YURA 5HCZA 2CNUA 3MFUA 3GC7A 3RPVA 2C3JA 2BKZA 2Y6MA 1OM1A 4KABA 4CFUA 4ZTQA 3UOJA 2WQNA 4U5JA 2BTSA 3FUPA 3Q5ZA 2I0YA 3PUPA 1JPAA 3ROCA 4BKYA 5E8SA 4DCAA 1WBPA 3BBWA 1FVTA 5LVOA 3GVUA 4ACDA 2KTYA 4FT9A 4EBVA 3H3CA 5B2MA 1V0PA 3PE2A 4CRLA 4Q5EA 4U45A 3RP9A 2VX3A 4NYEA 2UVYA 2VNYA 3JXWA 4J8NA 3ULZA 4H1JA 1VR2A 1YXUA 5F4NA 1H24A 5KMOA 4BGHA 2OJIA 5CY3A 5DRBA 4A9RA 4GT4A 2I40A 5DH3A 3ODZX 4DFYA 1Q3DA 2H6DA 5I3OA 3TUCA 1M52A 4CG9A 3E93A 4YSMA 5DR9A 3SX9A 4XLVA 4FYOA 3EMGA 3QKMA 5FP6A 3EN4A 1AD5A 3TZ8A 4BDAA 3HAMA 3D5XA 1H25A 3PXKA 1WMKA 3R2BA 4K33A 1OIRA 3TJDA 5KHXA 5BYLA 2C3KA 3GCQA 4BF2A 2R9SA 4P4CA 2X8EA 2EB3A 4WSYA 3BHVA 4TRLA 3CLYA 4MF1A 4F7JA 4ORKA 5H8EA 4DGGA 2BTRA 3HRBA 4EJ7A 3R28A 2NNWB 3P0MA 3WZDA 3R6XA 5AR8A 4ANQA 4Q9SA 3RK7A 4BCGA 4UXQA 3OW3A 5A46A 5BVNA 2YM8A 1OBGA 4G34A 2VTSA 4DFXE 5AA8A 2QQ7A 4II5A 5I9WA 3HYHA 5ANJA 4QP8A 4HVDA 4G9RA 2OJFE 3N51A 2GSFA 5CWZA 2BILB 5GJGA 3BYUA 2X4FA 4QP1A 3HMIA 3GCSA 1KV1A 3HV4A 4G2FA 4D0XA 2QONA 1QPJA 3DBDA 4QPSA 3SXRA 4BCJA 3FV8A 3ZBFA 3KRJA 1E9HA 1UWHA 4EHGA 2XJ0A 3HA8A 4ANOA 4OT6A 2C30A 3HX4A 3D7TB 4TTHB 1MRYA 4TNBA 2W1GA 2OF2A 5CXHA 3VN9A 3H30A 4JRVA 4AWIA 4FZ6A 3MH2A 4HPTE 3KU2A 4IM0A 3QCQA 2G2IA 5IUGA 3MVJA 3GU8A 2BZKB 2XK8A 3QQHA 1VEBA 3O8UA 4LRKA 4X6QC 4BBFA 4HVIA 3NVKI 5CU2A 4L42A 5C1QB 3CD3A 2X0GA 3UQGA 4LQMA 3KB7A 4GRBA 2CNQA 3P7CA 2UW5A 3NYNA 4E1ZA 5KMKA 4Y8DA 5EM5A 4KD1A 5EG3A 1IASA 4ZSLA 2H96A 4C37A 3B8RA 4FG9A 4NJ3A 1KOAA 4FVRA 5AP1A 3DQWA 1U59A 4QTBA 4E6AA 4CT1A 3CEKA 4AQCA 3THBA 4YUQA 5AFVA 4L53A 3D2KA 2W0JA 1ZARA 3FI2A 4M3QA 4MNFA 1L3RE 4JG8A 3CBLA 3FSKA 2A27A 3AD4A 3AQVA 4R3RA 4C58A 4YPSA 4BY9E 4F99A 2W1ZA 3SOAA 3VBTA 2FA2A 3DBQA 4E8AA 2ZM1A 3BRBA 3IW8A 2WMQA 4IAZA 1R1WA 4J96A 2PWLA 4JG6A 1GNGA 4WUNA 5A6OA 5LCJA 3UPZA 1BMKA 3TKHA 4NKAA 2QCSA 2B9IA 3H0ZA 5I3RA 4O7VA 5KMJA 5GHVA 1CMKE 3BCEA 2FSMX 3TACA 3I60A 5CEKA 4FIJA 5F94A 1BYGA 3DKGA 2HCKA 3QXPA 2PZIA 3ZM4A 3TM0A 2XKFA 5AP6A 1SM2A 4MD7E 1AQ1A 4I0SA 4GU6A 3U54A 4EH2A 2UZOA 3PLSA 3Q32A 5CYIA 4F6SA 5E8WA 1JKLA 4FEWA 4X3JA 3BX5A 5JGAA 3FMEA 3FI4A 4IVAA 1G3NA 4USEA 2ZJWA 3WE4A 5JN2A 2IW6A 3QA0A 1IAJA 3W55A 1K2PA 2O64A 4EWQA 3FKLA 4YJNA 4ZTRA 4AGUA 1R0EA 1IA8A 4IANA 4KINA 5JGBA 3ZRKA 4RC2A 3WE8A 4YJRA 4AW0A 4DF3A 1OBDA 3EFKA 3U6JA 2HWPA 2Q0BA 2RIOA 2WB8A 3A61A 5L2QA 5IA3A 4IAAA 4KBKA 1YKRA 3E63A 2OSCA 1YRPA 1TKIA 1O6LA 2LAVA 3V3VA 2QI8A 5KBRA 3HECA 3G5DA 4UWBA 4AFJA 4LYNA 5FUTA 3L1SA 3RMFA 1SVEA 3KXNA 2O65A 1URCA 4CQGA 5JK3A 4JJRA 5BVWA 2C6TA 4A7CA 3IW7A 2E9PA 4FBXA 4FICA 4IWDA 4Y5QA 4JQ8A 2O3PA 2UVZA 4WT6A 4QMOA 2R3HA 5M07A 4QYFA 3GOPA 2IZTA 5ETIA 4DEDA 2IG7A 4FSMA 4ARKA 4HZRA 5CU3A 2R3FA 3BV3A 1Z57A 2W96B 1OL1A 3PZEA 4IJ9A 5ACKA 4HGEA 4M84A 4EOSA 5EM7A 2F7ZE 3NZ0A 1GZNA 3F2NA 4OBQA 4PV0A 4F7SA 2JKKA 3M1SA 4A06A 4CLJA 2YLEA 1BX6A 2BR1A 3HEGA 3VC4A 4C3RA 1W83A 3BWJA 4CCBA 3KY2A 5LQFA 2QODA 2X9FA 3QC4A 4EEVA 5CF6A 4FV8A 5M06A 5J5SA 2W5HA 5FLFA 1YDRE 4BWKA 1KE8A 4LL5A 4PMSA 4DEAA 4TKSA 3JS2A 5ANIA 2YIWA 3VS6A 3DBCA 3DXNA 3FZ1A 2OJGA 3R00A 3C4CA 4GYGA 4UXLA 1B39A 4XP0A 5D1JA 5CEQA 2VTLA 4AFEA 2R64A 3TIYA 3LIJA 3F3ZA 4WNPA 4WNOA 3O96A 5HOAA 3R1YA 4J8MA 4CEGA 2FGIA 4RMZA 4GK4A 3ET7A 3MJ2A 2UUEA 3OWPA 3OWLA 4R3PA 3EJ1A 3BIZA 4G5JA 2PVRA 2P2HA 3OBJA 4ASEA 2V0DA 4XG4A 2BFYA 3CQEA 4U41A 3MB6A 4L67A 1YXVA 2QOIA 4FNXA 4F9YA 2X2MA 3LCKA 3NNUA 3MVMA 4OTFA 3DTWA 3NX8A 3ZBXA 4FSTA 4A9SA 5BMMA 5J1WA 5AA9A 4YLLA 1QL6A 4OTGA 4PPAA 1WBVA 3N4UA 4MXOA 2XNBA 2C4GA 3GC8A 3KXGA 4C36A 1GIJA 2B54A 3ORTA 4LGHA 4ZLOA 2QO7A 2EXMA 2R3IA 4YTFA 2XJ2A 4ACHA 4EOMA 3WF8A 5L6PA 2OIQA 3TDWA 1I44A 4HVGA 2XNPA 4LMNA 3VS3A 3BLQA 3ROYA 2YJRA 3W2PA 5DIAA 2VX0A 1ZY4A 4YBKA 2BKKA 2YM6A 4S33A 2YIYA 3UMXA 2FUMA 4F9WA 2IVSA 2JDVA 2WMBA 3QF9A 4C59A 2W06A 3H0YA 4X21A 3FC2A 4FSZA 5A9UA 1X8BA 3LCOA 1FOTA 3TG1A 5BQ0A 2C5XA 4BWXA 2PZRA 2V22A 3FBVA 2UW7A 3ZDUA 3C0IA 5K3YA 3VUKA 5AMNA 5C4KA 1ZYCA 4QP3A 3P9JA 5CSWA 4DEIA 1ZWSA 1HCKA 2BCJA 3P7BA 4QMUA 1WBTA 3EQRA 4QYGA 3QLGA 5KZ0A 2JAVA 3F61A 2W4JA 3IG7A 4DGOA 5KO1A 1W0XC 3DKFA 4BDGA 5IF1A 4RIXB 4CYJA 4GT3A 2JDTA 3QCYA 2JKQA 1JVPP 3EYHA 4O6LA 4RLKA 5C03A 5FTOA 3SAYA 3NUUA 5HX6A 4FTNA 3VBQA 4O7WA 5IA1A 4XNEA 1CTPE 5JFWA 3A8WA 4I0TA 3UMWA 4TYJA 5B2KA 2NRUA 3L9PA 2EVAA 3FLZA 4QRCA 4EH3A 3GNIB 4JQEA 4GUBA 4K8AA 3E3BX 3D14A 3LCSA 2FVDA 4IDVA 4X2KA 2HZ0A 4AT3A 3W2CA 2KULA 4G3CA 1NW1A 4TW9A 5AIKA 4X7QA 3KRLA 5CI7A 5BVEA 3PG1A 2RFSA 4M0ZA 3CJFA 4L3PA 4AT4A 3EQCA 4RJ7A 5D7VA 4HGTA 1Y8GA 2BDWA 4RIYA 5I4NA 4QPMA 2ZMDA 2EB2A 2I0HA 4F9AA 5TE0A 4JQ7A 3LLTA 4BCFA 4S32A 2ZDUA 3OXZA 1DAWA 1KE5A 2UZBA 3ORXA 2YDIA 2C5OA 4BCOA 2HY81 4IHPA 5TOZA 4O7SA 2PPQA 2PYWA 2RF9A 3GCPA 2OGVA 4FEQA 3UIXA 4AGDA 4DEBA 4NM5A 4DT9A 5CVFA 3ZUTA 3R8UA 1Q8ZA 1Z5MA 4QMYA 5M55A 4WNKA 1XQZA 3LXNA 4CT2A 2CLXA 3RNIA 4ZAUA 2R2PA 1BL6A 4TNDA 3AMYA 4P90A 5E91A 3CQUA 3SW4A 4BWPA 5HTCA 3EQBA 5EQPA 2ETKA 3EQDA 4I23A 2PVHA 4R8QA 3LFDA 3GT8A 2J2IB 1ZYSA 4G5PA 2NPQA 4DG3E 5HESA 5HG5A 3RPSA 2ITPA 4QYYA 2CHLA 3LHJA 1H0WA 4DTBA 4JDKA 2E9UA 3PWDA 3MJ1A 5D11A 5K9IA 3TTIA 4ASDA 2P2IA 5IQHA 5FEEA 3HRCA 4L8MA 3SRVB 2BROA 3QKLA 1VZOA 4FG8A 4BKZA 3K3JA 4U81A 3AGLA 3QLFA 4NIFB 2GNIA 2QHMA 2WTDA 4M69A 4CFVA 4I22A 4ZLYA 5A54A 3N9XA 4JIKA 3RJCA 3U4WA 4AA4A 4CTBA 3CSVA 4DFNA 2CKQA 4O7ZA 3DLZA 4NSTA 3QHWA 1H1RA 4TPTA 2VTAA 4YNOA 3ZCLA 4F1OA 4PTGA 4F1MA 1JSVA 1ZRZA 3MA6A 3QTXA 4M68A 2W1FA 3M11A 2C6LA 1A06A 5E90A 3AC4A 2F7XE 5KKRC 4IX5A 4F1TA 5IMEA 3TDVA 4QMVA 2JDRA 4OUCA 1BI8A 3L9MA 4E5WA 5HNIX 3RBWA 4D4VA 3BU3A 4JBVA 3TV7A 2UZLA 2UZWE 3KRWA 2X81A 4MD8E 4CV9A 3QD0A 3S2PA 2XF0A 2ITTA 2QOQA 2R3RA 4GH2A 2ITQA 2J9MA 1CSNA 2PVLA 3KC3A 2G15A 5BUIA 3V5TA 5T68A 4DLIA 2VAGA 1NVSA 4GIIA 4JR3A 4W4YA 5DT3A 4D2PA 3NNXA 3SGCA 2VWXA 4TWOA 3RAKA 3EIDA 1RJBA 4IZAA 3U87A 3VW6A 3KQ7A 5C01A 5TR6A 4ZY5A 3P79A 5M4FA 4BDDA 1Q24A 3HUCA 4G3DA 2R4BA 2E2BA 2O0UA 4YZBA 4KRCA 4A4OA 4I21A 5AP3A 4YZ9A 4Z16A 4Q2AA 3R7EA 1SMHA 2GQSA 5E92A 1FVVA 2EU9A 4QPAA 4IACA 1RW8A 2C0IA 2UZVA 3A8XA 3KULA 3OHTA 3ZLXA 3A4OX 3PRFA 3PY3A 3ORPA 3QZGA 5LARA 1YHSA 5FWKK 4ZZOA 5EK7A 3PIXA 3GCVA 4FKTA 3KMWA 5J87A 3OP5A 4I92A 4RZVA 3HMOA 4RIYB 4ALUA 3V6SA 3SXFA 5LVPA 4CD0A 5I9YA 3Q52A 3MTLA 4FTIA 2WD1A 3QD2B 4KIPA 3W33A 5M08A 4BDCA 4QTCA 2XNMA 3E3PA 4U6RA 2R3KA 3FLNC 4CZTA 2GNHA 4HCTA 4EI4A 5BMSA 4PDYA 3IOPA 3W16A 4KNBA 2AC5A 1FGIA 4W4WA 2OZAA 2WNTA 3RINA 2XK9A 1IR3A 2HW7A 3QL8A 4FT3A 3I5NA 2DQ7X 1QPDA 4HZSA 1EH4A 4YO4A 2JDOA 5J79A 5IQDA 3F5XA 1UVRA 3QRTA 4G16A 4S2ZA 4OTDA 4FKGA 3FE3A 3W2OA 4EKKA 3LM5A 2WMWA 3GU6A 4XV9A 2R3OA 4O83A 2J0LA 2WQBA 3BQRA 3R63A 3QX2A 3NGAA 1FMOE 4ZLZA 3I7BA 5HIBA 4N6ZA 2V55A 4FT7A 4TN6A 5E8TA 5CAPA 4UMQA 2GS7A 3PVWA 2X2LA 3NCGA 4XP3A 3SA0A 3RHKA 3EZRA 2XUUA 3ZHPC 4E6CA 5FGKA 3BQCA 1F3MC 5AV2A 4ZMEA 3ZUUA 2YN8A 4C34A 3G33A 4I20A 2UZNA 5GNKA 3GENA 3ZZWA 5CALA 3I6UA 1YXSA 4ITHA 4AA0A 5E9EA 1J1BA 1JNKA 4FNZA 5L4QA 2C6EA 2YDJA 4ZSGA 2WMSA 4NM0A 1Y6AA 4DA5A 1P4FA 4TT7A 5DHJA 3PG3A 3UNJA 3DQXA 4JDIA 3FZSA 4ZSJA 3DPKA 3UPXA 3FDNA 1T45A 4F09A 4H3PA 2GQGA 5IQEA 1M7NA 5FEDA 4YTIA 2HZIA 2G1TA 1E1XA 3COHA 3G0FA 3G90X 4U42A 5ETAA 3QTSA 2W99B 4GFGA 4NTSA 4UMPA 2HXLA 2OJJA 2QC6A 2CCHA 4M8TA 2W5AA 4FKLA 4EH7A 4CGAA 2ESMA 2ZYBA 3O71A 4ACMA 4BIEA 2B52A 2RFNA 2C0TA 2VWUA 1PXOA 3GU4A 2ZDTA 2YIQA 4UZDA 5FD2A 1CKIA 2OIBA 1XH9A 2CN8A 2VZ6A 4YO6A 2WKMA 3PIZA 2QOBA 3DCVA 4MD9E 4RJ5A 5CASA 3RGFA 2G2FA 2W9FB 3WBLA 2PE1A 5J9LA 3EL8A 4ENXA 1KV2A 4EOIA 4MH7A 2WAJA 4IFCA 2I6LA 3WOWA 4E26A 5JGDA 3UQCA 1LP4A 4FIGA 5E7RA 3HDMA 3AOXA 4M13A 3CTJA 3R22A 2BIKB 5E1SA 3IPHA 3FMDA 1IA9A 2UW0A 1J3HA 1ZOEA 4D4SA 5HIDA 3IW4A 4RZWA 5CT0A 2FB8A 2R3LA 4OTHA 2IVTA 3BPRA 4TY1A 5BPYA 2ETRA 3ENMA 3H9FA 3BU5A 4G17A 1S9JA 4EQCA 4C38A 4A9YA 2E9VA 4J53A 4PF4A 4QNAA 2GTNA 2R3QA 3QTUA 3MIAA 5JZNA 5M57A 5M53A 4FV5A 1YWRA 2PVMA 3Q9XA 4O86A 2YWPA 4TZRA 4EK3A 4EHVA 3AGMA 4WBOA 3F3VA 2B9JA 4FTAA 5CZIA 4YC6A 1PXPA 2ERKA 3B8QA 3D7TA 4PL3A 5AR4A 4QMTA 4E3CA 4EYMA 4FV7A 4PDOA 3ZO2A 2J7TA 5FEQA 1ZMWA 1YHVA 3OBGA 2JKMA 5ANOA 5EHYA 3TT0A 1W7HA 5L8LA 1LR4A 4PDPA 4S34A 2I1MA 5C8MA 4EUTA 4FR4A 3ALOA 4AZTA 4ITIA 3UNZA 5HNGA 4EK6A 3EN5A 2CNVA 4IJPA 4N0SA 4UWYA 3UVPA 3PY1A 5AUXA 2CDZA 3AC1A 2W1EA 2GMXA 3NYXA 4F0IA 5HTBA 4FIFA 1GAGA 1KE9A 1UKHA 2JBPA 1OVEA 5JFXA 4FV4A 3BEGA 4DG2E 1YQJA 3VJNA 4AZWA 4LL0A 4N57A 3R04A 3PZHA 5FM2A 4AGWA 3ACJA 4PX6A 2Y0AA 5EDRA 2ITYA 2WQOA 4LGGA 5CZHA 2FYSA 1H0VA 3FLQA 2GFSA 5G6VA 3S95A 3FLWA 4X3FC 1PXNA 3MIYA 1SVGA 1YI4A 3GGFA 4JRNA 2B55A 4RRVA 2XK6A 2V7AA 3PP1A 3GEQA 3F66A 3RAWA 3LM0A 4EQUA 2WTIA 3DJ6A 4GJ2A 5JQ5A 3UYTA 4K2RA 4KIQA 5EOBA 4AN9A 2HIWA 3EQGA 3I7CA 4JBQA 5AP0A 1MP8A 4Z3VA 5FDPA 2V5QA 4PTCA 4AF3A 1YI6A 3IOKA 4KS7A 2YZAA 2RG6A 5CENA 5CAUA 5IH5A 1PF8A 4BYJA 3LFAA 3MBLA 1HOWA 3PPZA 4O22A 4F9BA 4K77A 4GIHA 4C8BA 2WTWA 3QUDA 2C6KA 3OT8A 4FUYA 4FL2A 4IC8A 2WQMA 3I6WA 3OY1A 4XBUA 2VTJA 3EHAA 3H9OA 2QOCA 1PXJA 1Q97A 5KKRB 4QP4A 2C47A 2CGWA 5F95A 3FSFA 4ZS0A 3U6IA 5HBEA 3EN9A 4GG5A 2P33A 1A9UA 3E8NA 5CX9A 3E62A 3R02A 3W8LA 1APME 5GZAA 3BWFA 4DHFA 4FC0A 3RM7A 1ERKA 1Q8WA 5HE2A 2XM9A 5I5ZA 4XOYA 3Q53A 3R8VA 4R6VA 4DH8A 3O23A 3DDQA 2UW8A 3AT4A 5AAEA 4BR3A 3FPQA 1IAHA 1JSTA 3UJGA 1R78A 4FZDB 2UW9A 1P2AA 3MDYA 3QCSA 3DTCA 1SZMA 3CKXA 3HMNA 5H8BA 4DFUA 5EKNA 1GIIA 4K18A 4QQJA 5HD7A 4BCMA 4EOKA 4WHZA 3QZFA 4O84A 3UP7A 3DJ7A 1KE6A 3U4UA 1W84A 4HW7A 2GHMA 4IBMA 4BCPA 2Y7JA 1ZOHA 2YM4A 5KNJA 2ITZA 5DGZA 3OC1A 5AR3A 4W8DA 1BKXA 2VO0A 3RAIA 4MQ2A 4UZHA 1PJKA 3NSZA 4FIIA 4BICA 4PRJA 4FF8A 3BHUA 4JVGA 2ONLC 4C33A 4YMJA 1HCLA 3HRFA 5E8ZA 3R8PA 3OZ6A 5HVYA 3KMMA 2HW6A 5H2UA 3NMUF 3I5ZA 3DK6A 4XP2A 4KSPA 4DLJA 4E4LA 3BYMA 3ANRA 2R3GA 2PMOX 3OT3A 4FKRA 4G9CA 4IWPA 4ID7A 2UZEA 3VF9A 3OMVA 5L2SA 1NA7A 1J91A 5AP2A 4QMQA 5EH0A 4FEVA 4C7TA 3C7QA 5AM7A 4QYHA 4JT3A 4W9WA 3MY1A 2XCKA 2ZV8A 4YZCA 4EYJA 3LKMA 5EI8A 3Q9WA 1W8CA 3RZFA 4F9CA 4O91A 3GU5A 3KCFA 2RGPA 3FQSA 2WU7A 4MNEB 2GQRA 3BLHA 2Z7RA 4NUSA 1V0OA 5KE0A 4V04A 5C26A 4MXYA 2BAQA 1ZZ2A 5HIEA 3HL7A 2Z8CA 3JVSA 1R3CA 2ZB0A 4JS8A 4V01A 5DOSA 1GZOA 2X39A 3NCZA 3C13A 1WBSA 4ANMA 4BCQA 4F6UA 5IEVA 5FXSA 3OD6X 3LJ1A 4RX7A 2B53A 3O2MA 4X2GA 3CC6A 4RWKA 3FI3A 1WVYA 4BCNA 4AOJA 5CEIA 2XNEA 1Q8UA 4IAFA 2YABA 1OL6A 1ZAOA 3E5AA 1ZYDA 2NRYA 1I09A 2XIRA 4FTLA 4YNEA 4D5KA 1DS5A 4BTMA 3A4PA 1YDSE 3P4KA 2RFEA 3QQGA 4I24A 2XNNA 3Q04A 4R1YA 4DGMA 2HWOA 1ZY5A 4BBEA 4QD6A
chains in the Genus database with same CATH superfamily
4AOIA 3VBYA 1YOLA 2O63A 4J99A 4FSWA 3CIKA 3C0HA 1VLRA 4JBPA 4U43A 4TYHB 4GFMA 4IB1A 3ODYX 4QT1A 4O4FA 4XLIA 5JH6A 4NTTA 3O51A 3VULA 4XV3A 4O7TA 3P1AA 5DYJA 5ANKA 5I9UA 4O0RA 5FBOA 4ALVA 1UWJA 4DEHA 5FBNC 5IQAA 4BJJB 3DAKA 4RX9A 4DYMA 4UX9A 2YAAA 4HGLA 3QQFA 3A99A 4NFNA 2YLFA 4O1OA 2JAMA 3W32A 3NYOA 5DT4A 4AZFA 3M42A 4XG9A 5KMMA 1JKSA 1P4OA 2XM8A 1M14A 3CJGA 2X8IA 3FPMA 2OW3A 4O0SA 3QHRA 4E5BA 2XJ1A 4IAIA 4F4PA 5IEXA 2XALA 4BZDA 4FGRA 3NDMA 2P0CA 3NNVA 1WVWA 3Q4ZA 4FKPA 1JBPE 4IX6A 4J71A 3ZLWA 3PIYA 1GZ8A 2FSOX 2W1HA 3W18A 3A7FA 5IUHA 2QVSE 2ITOA 1IRKA 3EH9A 3PP0A 4GYIA 5CAQA 5M4UA 1FGKA 3TCPA 3W2QA 4D1SA 1DI9A 1ATPE 5BYYA 2Q83A 3NW5A 4IVDA 3C5UA 2C3IB 4FNWA 1M17A 4CNHA 2PMNX 2C5VA 2Y4IB 4FIHA 3Q2JA 4QMZA 4FEUA 3FHIA 3O8PA 4JAIA 5IUIA 2VX1A 3R8ZA 2C6OA 1OMWA 4K9YA 3NW7A 3BGPA 3EQIA 3DFCB 3DAJA 2J5FA 3R7GA 3R0TA 4MCVA 3RPYA 4NEUA 4BGQA 4DTAA 1H26A 4HPUE 3V6RA 5HORA 5M09A 1YOJA 4RIXA 4EUUA 4C57A 4DFLA 3GOKA 3D15A 3ZLYA 2C5YA 2I0EA 3AKLA 3BE9A 4WIHA 4YZDA 2AEGA 3QYZA 2J0KA 2OFUA 1LEWA 2C69A 2WMVA 5HE1A 2ZB1A 2YISA 3MY5A 1OITA 4AZSA 1WVXA 2WGJA 4N6YA 3T3VA 5IQBA 5L2TA 3Q4CA 1GY3A 3VQUA 4U97A 3W2SA 4UV0A 5ITAA 3SLSA 2VTTA 4YP8A 3AMAA 2XIZA 4HNIA 4MKCA 5DN3A 4ZXTA 4A07A 4OW8A 3LFFA 4BCKA 1AGWA 5CF8A 3F82A 3RCJA 3KA0A 3KCKA 3PPKA 2XAMA 4J7BA 2HELA 5A4EA 2BRMA 2F7EE 5HU9A 3DK3A 3F5PA 4I5HA 5GJDA 3ETAA 3DDPA 2J90A 3A60A 5CT7A 4IVBA 3RHXA 2WTJA 3CE3A 4XBRA 2CJMA 4EK4A 2RL5A 5E8VA 2VO6A 4FKIA 4OGRA 3KRRA 2R0IA 4KB8A 4RQVA 3ZO4A 4ANNA 1GOLA 4GCJA 4BTJA 1H1QA 1TFFA 2JFLA 2P3GX 3F69A 3Q60A 3QWJA 5C8KA 3RM6A 3UO5A 4AUAA 3AC3A 4FSQA 4GW8A 1PMEA 5AUYA 4C4IA 4BGGA 5CF4A 4UALA 5CAVA 1ZXEA 3EWHA 3LVPA 1H1PA 4DBNA 4PPBA 4RFZA 5BYZA 3MPAA 2IPXA 5JEBA 3QBNA 2WZJA 2X7OA 3FKNA 3VUGA 3BYVA 1U46A 3F7WA 4NJDA 4X3FB 4EK5A 2QD9A 5DBXA 4DDIA 2Z60A 3D83A 4RC3A 4NM3A 1F0QA 3QUPA 4MXAA 3DBFA 3FEGA 4O27B 2WU6A 4TYEA 3SRVA 4LV8A 4RPVA 5K5NA 3S3IA 5AV4A 4KBAA 1FMKA 3CY3A 5LMAA 5FXRA 5JT2A 4NIFA 2OXYA 4RT7A 4PL4A 2R5TA 4O7NA 4L45A 3LFCA 3ZYAA 2YCFA 5E8XA 4QP9A 4QMLA 4FTRA 5HVJA 1YDTE 3BYSA 3UIMA 3FMKA 4FKUA 2P55A 4FKQA 4TWNA 3IONA 5KMNA 3PVGA 4UWCA 2XAOA 2A2AA 4MBLA 1U5RA 4AZVA 2QR7A 2Z7SA 4MX9A 2BDFA 2BPMA 3OEFX 5EW9A 1MQBA 4FE2A 3GFWA 3QAME 5CF5A 4DDGA 3R9DA 4DHJA 1H00A 2ITUA 3RK9A 1YW2A 3FMMA 5DA3A 5EYCA 5HGIA 3VUHA 4CKJA 4XYFA 2YCQA 4O0YA 1OKZA 2YERA 3E8EA 4APPA 4H05A 1WFCA 4I5MA 2WOTA 3WILA 4GU9A 4RA5A 2YZLA 2XCHA 3VONA 5CU4A 5HEZA 2XRWA 2FO0A 3FXXA 2XIXA 4GFOA 4IB5A 4KBCA 3P78A 4L9IA 2J51A 1OECA 4U40A 3R9HA 3TNQB 3ZZEA 2V7OA 1R0PA 3F2AA 4FVQA 4FEXA 5HTIA 1XBAA 3C0GA 3T3UA 3FYJX 2XKDA 4C2WA 4EHZA 2PK9A 1XMLA 4R7BA 1B38A 2PMLX 4O1PA 4MHAA 4YC3A 4O0TA 5F1ZA 4AXAA 3BZ3A 5BNJA 4OT5A 4WRSA 3AC2A 3ZDIA 4DE4A 2VO3A 4PTEA 3SVVA 5H3QA 4MWIA 5K0KA 5HI2A 4ZY4A 4DCEA 3I1AA 5M4IA 3IDCA 5GZ9A 4JAJA 2PVYA 3QXOA 3NYVA 3TNPC 5IA2A 1TVOA 3NWWA 4PL5A 3POOA 2VU3A 2J4ZA 5FDXA 5CSPA 4P5ZA 4QMMA 4U79A 5K0XA 5D41A 1OZ1A 3WF5A 2G01A 5L3AA 2A4LA 4TYGA 3SXSA 3QRKA 5B7VA 2NYAA 4F08A 3R30A 1Y91A 2DYLA 2JITA 3C51A 3FL4A 3PJ3A 3PYYA 3BHYA 1WBWA 2W9ZB 4MBIA 4QP6A 4O21A 4EHEA 4LUEA 5LXMA 3UZTA 4QQCA 3HZTA 3Q4TA 3GXLA 1Q8YA 4RIOA 4S31A 3GC9A 4WKQA 1G8AA 4E5AX 2PTKA 4AGCA 3E87A 3RI1A 2YWVA 3TI1A 1H1SA 1OL2A 3C1XA 4V0GB 4J1RA 2XBJA 4KAOA 4EQMA 3ZOSA 3JR1A 3NAYA 3HLLA 1JSUA 3ZUVA 3PRIA 1OKVA 3PE1A 4YZMA 4AE9A 3PPJA 4HNFA 4CZYB 5BVFA 2XKCA 5M56A 3BLRA 5EKOA 3SDJA 4IM3A 4EH8A 3MH0A 4I0RA 3OCTA 4N70A 2O2UA 4IB0A 3GBZA 2OKRA 4IE9A 4AW5A 4AP7A 1DM2A 2PVNA 4FZFB 3V5JA 4FYNA 2XVDA 5FM3A 3LFBA 1GIHA 5A14A 5JSMA 1J7UA 3ZEWA 3NUAA 1BI7A 5A3XA 3RWPA 2XZSA 1PYXA 4EH4A 3SG9A 3K2LA 4EORA 1NY3A 3QGWA 3KGAA 1OUYA 3WZKA 2YA9A 4U8ZA 5AWMA 3VHEA 4Y46A 4CXAA 4LV5A 4APCA 1UNHA 3HDNA 3OOMA 4IM2A 2WO6A 4UYAA 4YTCA 3NNWA 4ZJIA 3RCDA 4C2VA 3KK9A 4HOKA 1UA2A 3N4VA 4S30A 4W9XA 5LWNA 1OPJA 3BI6A 3JY0A 4HJOA 3QGYA 2PE0A 4E20A 1W82A 4JG7A 2OXXA 3KXMA 5CVGA 3DU8A 3BU6A 2PULA 2YM7A 3TEIA 2RFDA 3Q6UA 5HG9A 3VUTA 3ZTXA 2VN9A 4M0YA 4EOJA 2X0OA 3PSDA 5FP5A 5AV3A 3Q9YA 4EZ5A 2BHHA 3LMGA 4I1ZA 3ERKA 3G0EA 3KVXA 5EOLA 4ASXA 1LUFA 2GNLA 2CGXA 4RA4A 3CPCA 5F20A 1G8JA 4I6HA 4NWMA 3DXQA 4ZK5A 4AN3A 1WAKA 4LOOA 4ZJVA 2WOUA 3A2CA 2QLUA 1XH7A 1KSWA 3TNHA 1WBNA 2NO3A 4DGLC 2XYUA 4EOPA 2YFXA 5IDNA 4F78A 5KCVA 3NUYA 4B0GA 2PVFA 3OEZA 2E9OA 4AW2A 4C4EA 1O9UA 3TJCA 3IKAA 2J0IA 2VD5A 4U0IA 3D5VA 3FYKX 1Q41A 3HP5A 3PVUA 4ZTLA 3KF4A 4WA9A 3UC4A 3VJOA 3ATSA 5KMIA 3LPBA 1P5EA 3TYKA 3HAVA 4OAVB 2WIHA 3TKIA 2GNJA 3O7LB 4FOBA 4QQTA 3DXPA 4HGSA 3OTVA 2XNOA 1QPEA 2O8YA 1B6CB 1R39A 4OTQA 3MFTA 2C1AA 5DLSA 4RJ3A 4XCUA 4FZAB 4QTAA 5TKDA 3ORKA 4JX7A 5LCKA 1TQPA 2JGZA 3QTWA 4H36A 4ANBA 4H1MA 4IWQA 3D9VA 1UU8A 2QKRA 3ATTA 3F5UA 3EN7A 5IZFA 3NR9A 1RQQA 3DLSA 2J5EA 3DK7A 3A7GA 5HBJA 2JDSA 1LEZA 2IVUA 3GI3A 4U80A 1FBNA 4BCIA 4LOPA 4QP2A 3R83A 4BDBA 2QO2A 2ERZE 5B0XA 2PUPA 4ZP5A 3W0QA 3A7IA 4F65A 4ZEGA 3TV6A 4PDSA 4WO5A 4E4MA 4C4GA 3R7VA 4BDEA 4OTRA 4LRMA 3VW8A 3JPVA 4L6QA 2BUJA 4RVLA 3QRIA 4ZSEA 4OBPA 4DITA 3CTQA 3TIZA 2F4JA 5IKWA 2W4OA 4EK8A 3TMOA 5AAGA 2OJ9A 1UU9A 2WHBA 3CS9A 4NH1A 3AD6A 4BB4A 3VBVA 3L8PA 3ORIA 5CVHA 4FV1A 4D2VA 3FLYA 2VWIA 3HA6A 3P23A 4NM7A 5ETFA 3VS0A 1KOBA 4YU2A 4GG7A 5GJFA 4U44A 3H9RA 5CS6A 2AUHA 4FSYA 4CYIA 1BL7A 3G2FA 3D0EA 1W98A 2VWBA 3V5LA 3BGQA 3WIGA 2VV9A 2CKPA 1OIUA 4W4XA 4LV7A 5IDPA 4IFGA 5FRIA 3KK8A 4LUDA 3ENHA 4MAOA 1PYEA 1XH8A 3L8VA 3POZA 3OVVA 3H4JA 4WSQA 1YWVA 2REIA 4IQ6A 4LMUA 3UG2A 4J52A 2BALA 1XJDA 3ZU7A 3EKNA 5J8IA 4EOLA 3U9NA 4FA2A 3ALNA 2I0VA 1QMZA 2GPHA 3QWKA 4LI5A 3R7YA 4AACA 3KXXA 4DBXA 1PXKA 1FQ1B 2C1BA 2QG5A 2GS6A 5IMXA 1KE7A 3T8OA 4FNYA 5BX0A 5C8NA 2UW6A 4RVTA 2C5NA 3I0OA 4IX3A 2ZMCA 5AP7A 3R7UA 1K3AA 2IJMA 4KRDA 5CQWA 3RTPA 4NL0A 2A0CX 2XYNA 1OIQA 3L9NA 3FXZA 4YHTA 2GU8A 2JIUA 2YITA 5J7BA 3DT1A 4L43A 5BUEA 4RJ8A 5J9ZA 2RG5A 3D4QA 3BL9A 2BAJA 1BUHA 1XH6A 2R7BA 3VNTA 4M15A 1YI3A 3OS3A 1IEPA 3UTOA 2PSQA 4MYGA 1J7IA 2EXCX 2Y4IC 4M14A 5HQ0A 4MUQA 3AG9A 5D10A 4BDIA 3CGOA 5H9BA 3ZRMA 4F7LA 4A4XA 4JX3A 2CN5A 4CZUA 3QTRA 3UOLA 2CMWA 3UIUA 5L2IA 1PHKA 3GCUA 3PXFA 4RWIA 4GS6A 3L9LA 3LMHA 4O38A 3W1FA 4FKJA 1URWA 4PP7A 5HKMA 3LXKA 3DY7A 1Q8TA 1T46A 4NT4A 4FKVA 4G6OA 4I5CA 3H10A 3BEAA 3A62A 5AX9A 4C3PA 2X7FA 4CSVA 4DGNA 4OAUC 2JD5A 1STCE 3PA3A 4XEYA 4EH6A 3G6HA 2VTRA 1ZMUA 3IS5A 4LOQA 4O0VA 4L7SA 4Z9LA 4YHJA 3NVMB 2I7QA 4FV0A 4O7LA 1RE8A 1ZYLA 5JFSA 4C3FA 2PVKA 2HENA 4BIDA 3QTZA 3PJCA 3AC5A 1M2RA 3Q5IA 4XG3A 1M2PA 2W4KA 3RPRA 2X0PA 3WF9A 2BRNA 4DFZE 3FQHA 3EN6A 3TNIA 3TZ7A 1H28A 1UNLA 3AC8A 3CCNA 4RQKA 2JLDA 4DG0E 2XK4A 3MESA 2OZOA 2YCRA 4LGDA 3LFSA 2XA4A 4GK2A 4XG6A 4EJNA 5EW8A 5LVNA 1Q61A 2QHNA 3OTUA 1PRYA 1U54B 2BMCA 4R5YA 5AR2A 4MNEA 2PHKA 5I9VA 3LQ3A 4FZ7A 4CMOA 3VBWA 3V8TA 4XRJA 4I6BA 3C4XA 2C6IA 4XG2A 3V8WA 4J95A 4EOQA 3MY0A 3PXRA 4L7FA 5J1VA 3T9TA 3NIZA 3L8XA 4ZTNA 2QNJA 3MI9A 2WMRA 2R0UA 3QALE 3TNWA 4XMOA 2B7AA 4Y5HA 4E4XA 2A19B 5M51A 2OH4A 4D1ZA 4ENYA 4QMWA 3C5IA 1JAMA 3LZBA 4AU8A 4FT5A 4BFMA 2JIVA 4CMTA 3MA3A 3COIA 5DT0A 3UOKA 5HHWA 3QQKA 5EHOA 5AX3A 4F0FA 3BLAA 2E9NA 4CFWA 4E7WA 3F3WA 4D4RA 3SHEA 3ZXTA 2BRHA 3FL5A 3HMPA 3HP2A 5CTPA 4E93A 5LMBA 1CKJA 4EH5A 3FZPA 3DBEA 5GZ8A 2PZPA 3R73A 4TYHA 4E6DA 3E7VA 1JOWB 1QPCA 1YOMA 4G6NA 4JNWA 4PUZA 1PY5A 4UY9A 3CTHA 3II5A 4I5PA 4WG4A 4MQ1A 3EQPA 4AAAA 5J9YA 1H8FA 2W1DA 4HYIA 4NU1A 2PZ5A 5L6WL 4O2ZA 4CRSA 1YVJA 4AE6A 5I9XA 4BJJA 4IVCA 4IB3A 4UYNA 4EC8A 2J6MA 2OG8A 3TZMA 3QRJA 3W0PA 3Q6WA 3CPBA 2GNGA 4FX3A 2J0JA 4WOVA 3U9CA 2QR8A 4BDJA 4BZNA 5AEPA 4ZTSA 2VWWA 3BELA 1XKKA 2ITVA 5DPVA 2BFXA 3JUHA 2X1NA 3UO6A 3LFEA 4TL0A 3ZONA 4QDEA 4NKSA 2OH0E 3DOGA 3UGCA 4AXCA 3GP0A 4HYSA 2VUWA 3OCBA 4EBWA 4OTIA 3E88A 5AUTA 2Y6OA 1WBOA 3BGZA 5HVKA 2W17A 2UZTA 3EFWA 2UVXA 4L00A 4JIAA 3KL8A 4H3BA 1PKGA 3FJQE 4XS2A 3P86A 4CKRA 3ZFXA 4MWHA 3A7JA 3LFNA 3IK3A 2BAKA 5DI1A 2PUNA 5LWMA 4QMPA 3NRMA 4RFYA 4RLLA 1YHWA 1UU7A 2JBOA 4U7ZA 4XX9A 3REPA 3PVBA 2BZHB 2GCDA 4IAYA 4LG4A 1ND4A 3PSBA 4WBBB 5DRDA 4R7HA 1SNUA 4TXCA 3W10A 2J50A 3ZH8A 1XMMA 4FTQA 3FI8A 2WELA 5E8YA 4ZMFA 3ZFYA 3PSCA 2HZ4A 3BBTB 3BYOA 3MH3A 3OG7A 4GUEA 4F63A 4GKIA 4NCTC 4QNYA 3E8CA 2OI4X 4CCUA 3HVCA 4KKHA 3DAEA 5M4CA 1H1WA 1YXTA 2EUFB 2Y8OA 4D0WA 5AM6A 3W8QA 5IQFA 1MUOA 4IAKA 3LAUA 3PXQA 2CGUA 4LM5A 3PY0A 2ITNA 5HX8A 4ZY6A 4P2KA 4QQ5A 5IH6A 4FMQA 2YM5A 1H27A 5AUWA 1PMUA 3V01A 1DI8A 2WTKB 3KN6A 3VRYA 4EZ7A 1BLXA 4PPCA 3FY2A 4IZYA 4KKGA 4HCVA 2YACA 3K5VA 3UE4A 2IZSA 4OTPA 5HO7A 2V62A 3NW6A 4XOZA 1W2CA 3R7OA 2HOGA 2PE2A 1NXKA 1Q62A 3D94A 3RNYA 3DB8A 4KIKB 3DKCA 3LJ0A 3EOCA 4RIWB 4YLJA 3HKOA 3VUDA 3UQFA 4JL9A 1V1KA 3MVHA 4O96A 4RX8A 4PQNA 5CSXA 5J95A 3ZSGA 4D9TA 1MQ4A 2VRXA 3SW7A 3QA8A 3MTFA 2IW9A 5I9ZA 3SD0A 1JKKA 4QEBA 3AT2A 4ONAA 4UMRA 3B2WA 3TV4A 1NVRA 4FTTA 4BKJA 5BVDA 5G1XA 3O0GA 3QTIA 4A9UA 1SNXA 4PMPA 5JMSA 2H9VA 3I81A 3VUMA 1O6KA 3I0QA 3PXZA 2YEXA 4XHKB 4I4EA 4IZ7A 2XH5A 5ETCA 3UG1A 2QOOA 4YJSA 1OL5A 4M66A 4X3FA 4ZIMA 4IC7A 2ZV7A 5CU0A 1XBBA 3CXWA 4BC6A 4E6QA 1FINA 4WUAA 4PMTA 3OFMA 3D2IA 5CEMA 3KMUA 5EHLA 4L52A 3LLAA 3S4QA 3ZO3A 2X8DA 3AT3A 4AX8A 3EFJA 4Z7HA 2ZAZA 4E73A 5IPJA 3P5KA 4C35A 5HCYA 4Y95A 5AP5A 2B4SB 5LOHA 3ID6C 4KIOA 4BZOA 4I3ZA 5ANEA 2C68A 5IQGA 1OIYA 4K11A 2YJSA 4L3LA 3IECA 5CAOA 3EZVA 4ITJA 4J97A 3IDPA 5D12A 2BHEA 3FKOA 3ZLSA 3DB6A 5JFVA 4UBAA 4YC8A 3ZRLA 2R3NA 1H07A 4GVAA 4FSUA 3DGKA 4MVFA 3Q2MA 4YJVA 1LPUA 5A4TA 2ZVAA 1G5SA 2DWBA 1PXIA 4FSNA 2QU6A 1ZMVA 3FHRA 4YLKA 2ZFYA 5DE2A 3LOKA 3MYGA 3ML1A 3GFEA 3R01A 4CV8A 4R3CA 1PKDA 3K3IA 1UNGA 3BV2A 4ZOGA 4G1WA 5HNBA 1OPKA 5CLPA 3S1HA 1E1VA 3P7AA 3O7LD 4FV3A 4QP7A 4YJOA 3QZHA 3MSSA 4C61A 1MRUA 3DV3A 1F5QA 5FXQA 2IEWA 5ICPA 3CP9A 5AR5A 3JY9A 3EKKA 4WD5A 1OGUA 4G3FA 4L01A 1NVQA 2XRUA 4XH6A 2Z02A 3OF0A 3QTQA 3ORMA 2VTNA 4YR8A 5K4IA 3PDTA 4D9UA 2CPKE 5EI6A 3AXWA 4X2NA 4BVUA 2XK7A 3TXOA 3VS2A 2GHLA 3WZEA 4W8EA 2C0OA 3F6XA 2OWBA 4OTWA 4AA5A 4AZEA 5JRQA 3R1SA 3GB2A 1JWHA 5A4LA 3OCSA 3C9WA 4ZS4A 4U3ZA 3UDTA 3QD4A 2Z7LA 2ONLA 3FMNA 4FL3A 4NCTA 2ITXA 3RAHA 3QU0A 2VTHA 3EQHA 4HYHA 4TWCA 4BDKA 4RX5A 2AYPA 4IEBA 4G3EA 5EW3A 4B99A 3QQUA 3OOGA 3PA4A 4Y73A 4EKLA 3LW0A 1M7QA 3ZC6A 3COKA 2YHVA 3PA5A 2WEVA 4D58A 4YSJA 1OI9A 5CU6A 5KUPA 4AW1A 4P7EA 5EDQA 2R7IA 3NPCA 3V5WA 2SRCA 2ZV9A 4V05A 4B9DA 4JLCA 4D2WA 3ITZA 4QMXA 2OK1A 2GS2A 3FZTA 5C27A 4YHFA 4HVHA 3ZS5A 4W4VA 2O5KA 1K9AA 4I6LA 1H08A 5KBQA 4IWOA 4BHZA 4M67A 3TUDA 1OL7A 5DEYA 5L8JA 2CGVA 1FPUA 3EB0A 5FG8A 2ZOQA 3LCTA 4H58A 2QOFA 3SG8A 3COMA 5IA4A 3FQEA 3ORNA 3ZC5A 4FT0A 5JZJA 3P08A 2F57A 5A4QA 4V0GA 1SYKA 4DH1A 5HZNA 3F2RA 3OXIA 3NUSA 2CCIA 3SQQA 3ULIA 3GU7A 4K6ZA 2CKOA 4GJ3A 4I93A 4X6RA 4YJPA 3VVHA 4IXPA 5EYKA 4B8LA 1J7LA 3VWAA 2WTVA 3BE2A 2IWIA 2WQEA 3MS9A 3U55A 5CSVA 3U8WA 3HV6A 4P5QA 4XRLA 1XBCA 4UN0C 3VO3A 2XK3A 3G9NA 3MFSA 4RJ6A 4BDHA 2PZYA 3FMLA 3K54A 5GIOE 1KWPA 3MB7A 4L44A 4GVJA 1NT2A 3FZRA 3RWQA 3C4FA 4J98A 4CQEA 1TQMA 4GL9A 4MTAA 4C4JA 2W1CA 3IGGA 2VWYA 3ZSHA 1PW2A 5GINE 3ACKA 4AG8A 3PWYA 4PP9A 1G8SA 5DG5A 4B4LA 3RZBA 5HCXA 2XS0A 5AUUA 4FK6A 2UZDA 1H4LA 3W2RA 3DNEA 4X2FA 4FK3A 3DNDA 4ZJJA 5JRSA 4O0WA 3VS4A 3NLBA 4BL1A 4YBJA 2IZUA 4O2PA 4PWNA 3KXHA 3C4EA 4BTFA 3LMIA 2IVVA 2WTCA 2GDOA 3C4ZA 4GT5A 4F0GA 3F88A 4Q9ZA 2XEYA 4AOTA 2VGPA 5LMKC 2XB7A 2B9HA 2F9GA 2OF4A 2VTMA 3NUNA 2PMIA 5FTQA 2QOLA 4FG7A 3R8MA 3V8SA 4KWPA 2W5BA 5DWRA 2NP8A 3R9RA 3MPTA 5E8UA 4CVAA 3E92A 1YXXA 4FL1A 4NK9A 1Z9XA 1L8TA 4PMMA 5HO8A 4ACGA 2ZM3A 3NAXA 4ZZMA 4RWJA 1ZZLA 4PNIA 2QURA 4U3YA 4EH9A 3ORZA 4R1VA 5H8GA 3QC9A 2QOKA 4QOXA 4DEGA 3CR0A 3VS1A 4UEUA 2IO6A 3UOHA 3VS7A 5BVOA 4NZWB 5CEPA 4JBOA 4YJTA 3MGYA 5CNOA 5IH4A 3U6HA 1OPLA 2QOHA 2WIPA 4MBJA 1WZYA 3CKWA 3HGKA 2QLQA 3MH1A 3OROA 3OUKA 3IQ7A 5CXZA 2F2CB 3CQWA 4QO9A 3R1NA 4L46A 3OY3A 4ANLA 5KHWA 4USFA 3HV5A 3ORLA 4D2SA 2H34A 3RKBA 3SOCA 2ACXA 4XUFA 5DR2A 3NS9A 4FKWA 1XHAA 4E4NA 5IEYA 1S9IA 5LJJA 4ZTMA 5AV0A 1WCCA 2X9EA 1XWSA 4F6WA 4A4LA 2RKUA 3WF6A 2X0QA 2FH9A 2XEZA 2XNGA 3VBXA 3RVGA 3O17A 4ZZNA 1QCFA 1CDKA 2WMTA 3QUEA 1Q4LA 4AT5A 3V51A 2PL0A 2BIYA 2Q0NA 3WYXA 3DFAA 2HYYA 3UIBA 3EQFA 4FODA 4R7IA 5EI2A 1JLUE 1KUTA 4BHNA 3OWKA 2X7GA 3E8DA 5B2LA 3DJ5A 4B6LA 1M2QA 5IU2A 4TWPA 5AIRA 4D5HA 1PMVA 4DEEA 2R3PA 4RVMA 3UP2A 3W0RA 4KA3A 5HLNA 4GSBA 4CMUA 2XBAA 4ERWA 2FSLX 4GK3A 2UW4A 4AS0A 5CI6A 2F49A 4AAYA 3KN5A 1H01A 3MV5A 5BUJA 3WF7A 2W05A 4QTDA 3KREA 4BCHA 4Z55A 4R78A 4OBOA 3VS5A 4TYIA 4ASZA 4BN1A 4DN5A 2CLQA 2AC3A 3F3TA 4XG8A 2HY0A 3ZMMA 1A48A 2VTOA 3JVRA 4MF0A 2BZIB 4R5SA 3OW4A 4RBLA 5AV1A 3WI6A 3ZEPA 3NUXA 4PNKA 2GHGA 3I4BA 4Y85A 1Q3WA 3D5WA 3R1QA 1REJA 3WZUA 5C4LA 3VQHA 5EDPA 3UO4A 3BHHA 2C6MA 5DR6A 5I0BA 3G15A 1GJOA 3F5GA 5DVRA 4DT8A 2YCSA 3N4TA 4RGJA 2IZRA 5KZIA 3FMJA 4L3JA 3R9NA 5AR7A 3AD5A 4ERKA 5IQIA 3WYYA 2WEIA 3KF7A 5IA5A 5IISA 3BHTA 3D5UA 4EZ3A 4FIEA 2HZNA 2OFVA 3ELJA 3GC0A 3NUPA 2ZM4A 3DZOA 4D1XA 2DUVA 2X2KA 3OUNB 5J7HA 3RK5A 3O8TA 4Z7GA 4JOAA 4FVPA 3U51A 4O0XA 4CLIA 1JQHA 4IW0A 4RVKA 4CFNA 5LMKA 3Q3BA 2YIXA 2X6DA 3IGOA 4FTJA 3QX4A 3WIKA 3MWUA 4EOOA 2G2HA 2PY3A 3V04A 2VNWA 2Y9QA 3LQ5A 3VAPA 3BL7A 4JDJA 4GEOA 3R9OA 4BI2A 3LXPA 4R77A 4OR5A 3FMHA 2YM3A 3V5PA 3SV0A 3QZIA 5T3QA 2QU5A 4KS8A 5EM8A 4FGBA 3QKKA 4AN2A 3TTJA 2EWAA 4X2JA 4FSRA 5CQUA 5D7AA 2HK5A 1OUKA 3KEXA 3UC3A 2WPAA 4YJQA 2B1PA 4BRXA 3FWQA 3MW1A 5HLWA 2GFCA 5AJQA 4BYIA 3K5UA 5FQDC 4RWLA 2X6EA 4Y72A 4QTEA 2BZJA 3MN3A 4Y83A 2IW8A 5CNNA 4BTKA 4C62A 2RSVA 3LCDA 4OLIA 4DH3A 1XH5A 4JXFA 1VYZA 2WMXA 5AAFA 3GQIA 2QKWB 2OO8X 5DEWA 5EYMA 2J0MB 4MEDA 5HLPA 3VHKA 5L8KA 5HICA 3R2YA 3LFQA 3OWJA 4DTKA 4HYUA 3PLAE 4BI0A 2VGOA 4WRGA 4F70A 3UVRA 3HNGA 2R3JA 3O50A 2EXEA 4FKOA 5TF9A 2BDJA 1CKPA 2X4ZA 3L8SA 2XARA 3IW6A 2PUUA 4A9TA 1OB3A 1XO2B 3R8LA 5IQCA 2DS1A 2JC6A 4G6LA 3QRUA 4XV1A 3PJ8A 5EYDA 4JI9A 1VJYA 4CG8A 1Q5KA 2UW3A 4FTCA