4HVMA

Crystal structure of tallysomycin biosynthesis protein tlmii
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
456
structure length
393
Chain Sequence
GLRRASFLQRGAWRWLREAPPAAAFAARGLLGSGRIDDDRLAAAADEVLDAFPLLRVNFVDDDGLWMRTRENADALVRSDLRGHPDPQARCVELLRADRDRPTDPERDPLVRLHLVRLSETDVVLGVVAHQMLLDARSRYMVLGAVWQAYYGRFRPAQYRDFAEVADFHPLDRETVRVARHRWWSRRLPALPVRGPPETSRLRVPGSRWQALTEPNGSLAMAALTAWWLWTQDSLYLSTEVDLRDHLQLGSVVGPLTDRVVFGVDLTGLREPSFRDLMSRTQAGFLDAVVHYLPYHDVVDLAVDLGVVTPPRVAARWDVAVHLVSIELFREADLIGDTWDGTDTWDGTTTDLSVGELGEDMVIVLDQRRSALLDGLDAAMAQAVADPSAPLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TlmII
publication title Crystal structure of tallysomycin biosynthesis protein TlmII
rcsb
source organism Streptoalloteichus hindustanus
molecule tags Biosynthetic protein
total genus 109
structure length 393
sequence length 456
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00668 Condensation Condensation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4hvmA01
3.30.559.30 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 4hvmA02
5KJSA 3U9FA 2II3A 2II4A 3L60A 1EAEA 4G22A 1SCZA 5KJTA 1EAAA 5KJWA 1CLAA 1XL7A 2RKTA 2CLAA 1L5AA 2RKVA 2XHGA 2VSQA 2JGPA 2E1UA 5KJUA 1QCAA 2XR7A 1EADA 4G0BA 3MAEA 1E2OA 2E1VA 5FALA 2E1TA 1EACA 1XMCA 2ZBAA 4N72A 1EABA 1EAFA 2II5A 1XL8A 1DPCA 1Q23A 1PD5A 3FP0A 3B30A 4KE4A 5T3EA 2I9DA 5DU9A 3CLAA 3FOTA 4KECA 3B2SA 5KJVA 1Q9JA 1NOCB 1XMDA 3U9BA 4CLAA 1DPDA 1DPBA 2IHWA 4JN5A 5DUAA 1CIAA 4JN3A 1C4TA 5FANA 2BGHA 4G2MA 4HVMA
chains in the Genus database with same CATH superfamily
3U9FA 2II3A 5KJWA 1L5AA 2H4TA 2VSQA 1T1UA 1QCAA 2FY2A 2XR7A 4G0BA 3MAEA 1E2OA 5FALA 1XL8A 1DPCA 1Q23A 5DU9A 3FOTA 2FY4A 3B2SA 1NOCB 1DPBA 2FY5A 2IHWA 4JN5A 1CIAA 5DUAA 2E1VA 2II4A 1Q6XA 3U9BA 2H3WA 1EAEA 4G22A 2FYOA 1CLAA 5KJUA 2E1UA 4EP9A 1EACA 1XMCA 2ZBAA 5KJVA 2I9DA 3CLAA 4KECA 1DPDA 5FANA 1NDIA 4HVMA 3L60A 1EAAA 2FY3A 1XL7A 1T7OA 2RKVA 2XHGA 2H3PA 2JGPA 1S5OA 1EADA 2H3UA 2RCUA 2E1TA 1EAFA 5KJTA 1PD5A 3B30A 1XMDA 2BGHA 4G2MA 5KJSA 4EPHA 4EYWA 2DEBA 1SCZA 1T7NA 2RKTA 2CLAA 1NDBA 1T7QA 1NDFA 4N72A 1EABA 2II5A 1NM8A 3FP0A 4KE4A 5T3EA 1Q9JA 4CLAA 1C4TA 4JN3A 2FW3A
chains in the Genus database with same CATH topology
3U9FA 2II3A 5KJWA 1L5AA 2H4TA 2VSQA 1T1UA 1QCAA 2XR7A 2FY2A 4G0BA 3MAEA 1E2OA 5FALA 1XL8A 1DPCA 1Q23A 5DU9A 3FOTA 2FY4A 3B2SA 1NOCB 1DPBA 2IHWA 4JN5A 5DUAA 1CIAA 2FY5A 2E1VA 2II4A 1Q6XA 3U9BA 2H3WA 1EAEA 4G22A 2FYOA 1CLAA 5KJUA 2E1UA 4EP9A 1EACA 1XMCA 2ZBAA 5KJVA 2I9DA 3CLAA 4KECA 1DPDA 5FANA 1NDIA 4HVMA 3L60A 1EAAA 2FY3A 1XL7A 1T7OA 2RKVA 2XHGA 2H3PA 2JGPA 1S5OA 1EADA 2H3UA 2RCUA 2E1TA 1EAFA 5KJTA 1PD5A 3B30A 1XMDA 2BGHA 4G2MA 5KJSA 4EPHA 4EYWA 2DEBA 1SCZA 1T7NA 2RKTA 2CLAA 1NDBA 1T7QA 1NDFA 4N72A 1EABA 2II5A 1NM8A 3FP0A 4KE4A 5T3EA 1Q9JA 4CLAA 1C4TA 4JN3A 2FW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJS A;  3U9F A;  2II3 A;  2II4 A;  3L60 A;  1EAE A;  4G22 A;  1SCZ A;  5KJT A;  1EAA A;  5KJW A;  1CLA A;  1XL7 A;  2RKT A;  2CLA A;  1L5A A;  2RKV A;  2XHG A;  2VSQ A;  2JGP A;  2E1U A;  5KJU A;  1QCA A;  2XR7 A;  1EAD A;  4G0B A;  3MAE A;  1E2O A;  2E1V A;  5FAL A;  2E1T A;  1EAC A;  1XMC A;  2ZBA A;  4N72 A;  1EAB A;  1EAF A;  2II5 A;  1XL8 A;  1DPC A;  1Q23 A;  1PD5 A;  3FP0 A;  3B30 A;  4KE4 A;  5T3E A;  2I9D A;  5DU9 A;  3CLA A;  3FOT A;  4KEC A;  3B2S A;  5KJV A;  1Q9J A;  1NOC B;  1XMD A;  3U9B A;  4CLA A;  1DPD A;  1DPB A;  2IHW A;  4JN5 A;  5DUA A;  1CIA A;  4JN3 A;  1C4T A;  5FAN A;  2BGH A;  4G2M A;  4HVM A; 
#chains in the Genus database with same CATH topology
 3U9F A;  2II3 A;  5KJW A;  1L5A A;  2H4T A;  2VSQ A;  1T1U A;  1QCA A;  2FY2 A;  2XR7 A;  4G0B A;  3MAE A;  1E2O A;  5FAL A;  1XL8 A;  1DPC A;  1Q23 A;  5DU9 A;  3FOT A;  2FY4 A;  3B2S A;  1NOC B;  1DPB A;  2FY5 A;  2IHW A;  4JN5 A;  1CIA A;  5DUA A;  2E1V A;  2II4 A;  1Q6X A;  3U9B A;  2H3W A;  1EAE A;  4G22 A;  2FYO A;  1CLA A;  5KJU A;  2E1U A;  4EP9 A;  1EAC A;  1XMC A;  2ZBA A;  5KJV A;  2I9D A;  3CLA A;  4KEC A;  1DPD A;  5FAN A;  1NDI A;  4HVM A;  3L60 A;  1EAA A;  2FY3 A;  1XL7 A;  1T7O A;  2RKV A;  2XHG A;  2H3P A;  2JGP A;  1S5O A;  1EAD A;  2H3U A;  2RCU A;  2E1T A;  1EAF A;  5KJT A;  1PD5 A;  3B30 A;  1XMD A;  2BGH A;  4G2M A;  5KJS A;  4EPH A;  4EYW A;  2DEB A;  1SCZ A;  1T7N A;  2RKT A;  2CLA A;  1NDB A;  1T7Q A;  1NDF A;  4N72 A;  1EAB A;  2II5 A;  1NM8 A;  3FP0 A;  4KE4 A;  5T3E A;  1Q9J A;  4CLA A;  1C4T A;  4JN3 A;  2FW3 A; 
#chains in the Genus database with same CATH homology
 3U9F A;  2II3 A;  5KJW A;  1L5A A;  2H4T A;  2VSQ A;  1T1U A;  1QCA A;  2XR7 A;  2FY2 A;  4G0B A;  3MAE A;  1E2O A;  5FAL A;  1XL8 A;  1DPC A;  1Q23 A;  5DU9 A;  3FOT A;  2FY4 A;  3B2S A;  1NOC B;  1DPB A;  2IHW A;  4JN5 A;  5DUA A;  1CIA A;  2FY5 A;  2E1V A;  2II4 A;  1Q6X A;  3U9B A;  2H3W A;  1EAE A;  4G22 A;  2FYO A;  1CLA A;  5KJU A;  2E1U A;  4EP9 A;  1EAC A;  1XMC A;  2ZBA A;  5KJV A;  2I9D A;  3CLA A;  4KEC A;  1DPD A;  5FAN A;  1NDI A;  4HVM A;  3L60 A;  1EAA A;  2FY3 A;  1XL7 A;  1T7O A;  2RKV A;  2XHG A;  2H3P A;  2JGP A;  1S5O A;  1EAD A;  2H3U A;  2RCU A;  2E1T A;  1EAF A;  5KJT A;  1PD5 A;  3B30 A;  1XMD A;  2BGH A;  4G2M A;  5KJS A;  4EPH A;  4EYW A;  2DEB A;  1SCZ A;  1T7N A;  2RKT A;  2CLA A;  1NDB A;  1T7Q A;  1NDF A;  4N72 A;  1EAB A;  2II5 A;  1NM8 A;  3FP0 A;  4KE4 A;  5T3E A;  1Q9J A;  4CLA A;  1C4T A;  4JN3 A;  2FW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...