4HVMA

Crystal structure of tallysomycin biosynthesis protein tlmii
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
456
structure length
393
Chain Sequence
GLRRASFLQRGAWRWLREAPPAAAFAARGLLGSGRIDDDRLAAAADEVLDAFPLLRVNFVDDDGLWMRTRENADALVRSDLRGHPDPQARCVELLRADRDRPTDPERDPLVRLHLVRLSETDVVLGVVAHQMLLDARSRYMVLGAVWQAYYGRFRPAQYRDFAEVADFHPLDRETVRVARHRWWSRRLPALPVRGPPETSRLRVPGSRWQALTEPNGSLAMAALTAWWLWTQDSLYLSTEVDLRDHLQLGSVVGPLTDRVVFGVDLTGLREPSFRDLMSRTQAGFLDAVVHYLPYHDVVDLAVDLGVVTPPRVAARWDVAVHLVSIELFREADLIGDTWDGTDTWDGTTTDLSVGELGEDMVIVLDQRRSALLDGLDAAMAQAVADPSAPLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TlmII
publication title Crystal structure of tallysomycin biosynthesis protein TlmII
rcsb
source organism Streptoalloteichus hindustanus
molecule tags Biosynthetic protein
total genus 109
structure length 393
sequence length 456
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00668 Condensation Condensation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4hvmA01
3.30.559.30 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 4hvmA02
1E2OA 3B30A 1EAAA 3CLAA 5KJTA 2VSQA 2CLAA 5DU9A 3MAEA 2RKTA 2XHGA 1EACA 1XL8A 3U9BA 4N72A 4JN3A 2E1TA 1CLAA 2RKVA 4HVMA 3FP0A 1DPCA 1DPDA 3L60A 2II4A 4G2MA 4JN5A 1PD5A 4G0BA 3B2SA 1EAFA 5KJVA 2IHWA 4KE4A 5KJSA 1C4TA 1DPBA 1QCAA 2II3A 2ZBAA 4KECA 1Q9JA 5FALA 2BGHA 2E1VA 1SCZA 5T3EA 5FANA 1L5AA 1EABA 1Q23A 1CIAA 3FOTA 3U9FA 1EAEA 2I9DA 4CLAA 1XMCA 5KJWA 5KJUA 1NOCB 1XMDA 1XL7A 2JGPA 5DUAA 2E1UA 2II5A 4G22A 1EADA 2XR7A
chains in the Genus database with same CATH superfamily
1NDIA 1NM8A 2CLAA 2FYOA 2XHGA 1XL8A 3U9BA 4JN3A 4HVMA 4EP9A 2H4TA 2IHWA 2II3A 2FY4A 4EYWA 1L5AA 1Q23A 3U9FA 5KJWA 2JGPA 1EADA 2XR7A 1E2OA 3CLAA 5KJTA 5DU9A 1T7OA 2RKTA 4N72A 2FY5A 1DPDA 2H3WA 2H3PA 2II4A 4G0BA 5KJVA 1T1UA 4KE4A 1C4TA 4KECA 5FALA 2BGHA 5T3EA 1CIAA 3FOTA 2I9DA 4CLAA 1NOCB 1XMDA 1XL7A 5DUAA 2E1UA 4G22A 3B30A 1EAAA 2VSQA 3MAEA 1EACA 1CLAA 4JN5A 4G2MA 3B2SA 1EAFA 5KJSA 1DPBA 1SCZA 5FANA 1EABA 1NDBA 2RCUA 1T7NA 5KJUA 2FW3A 2H3UA 2FY2A 1T7QA 2E1TA 2RKVA 1Q6XA 3FP0A 1DPCA 3L60A 1PD5A 2FY3A 1QCAA 2ZBAA 1NDFA 1Q9JA 2E1VA 4EPHA 1EAEA 1XMCA 2DEBA 2II5A 1S5OA
chains in the Genus database with same CATH topology
1NDIA 1NM8A 2CLAA 2FYOA 2XHGA 1XL8A 3U9BA 4JN3A 4HVMA 4EP9A 2H4TA 2IHWA 2II3A 2FY4A 4EYWA 1L5AA 1Q23A 3U9FA 5KJWA 2JGPA 1EADA 2XR7A 1E2OA 3CLAA 5KJTA 5DU9A 1T7OA 2RKTA 4N72A 2FY5A 1DPDA 2H3WA 2II4A 2H3PA 4G0BA 5KJVA 1T1UA 4KE4A 1C4TA 4KECA 5FALA 2BGHA 5T3EA 1CIAA 3FOTA 2I9DA 4CLAA 1NOCB 1XMDA 1XL7A 5DUAA 2E1UA 4G22A 3B30A 1EAAA 2VSQA 3MAEA 1EACA 1CLAA 4JN5A 4G2MA 3B2SA 1EAFA 5KJSA 1DPBA 1SCZA 5FANA 1EABA 1NDBA 2RCUA 1T7NA 5KJUA 2FW3A 2H3UA 2FY2A 1T7QA 2E1TA 2RKVA 1Q6XA 3FP0A 1DPCA 3L60A 1PD5A 2FY3A 1QCAA 2ZBAA 1NDFA 1Q9JA 2E1VA 4EPHA 1EAEA 1XMCA 2DEBA 2II5A 1S5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2O A;  3B30 A;  1EAA A;  3CLA A;  5KJT A;  2VSQ A;  2CLA A;  5DU9 A;  3MAE A;  2RKT A;  2XHG A;  1EAC A;  1XL8 A;  3U9B A;  4N72 A;  4JN3 A;  2E1T A;  1CLA A;  2RKV A;  4HVM A;  3FP0 A;  1DPC A;  1DPD A;  3L60 A;  2II4 A;  4G2M A;  4JN5 A;  1PD5 A;  4G0B A;  3B2S A;  1EAF A;  5KJV A;  2IHW A;  4KE4 A;  5KJS A;  1C4T A;  1DPB A;  1QCA A;  2II3 A;  2ZBA A;  4KEC A;  1Q9J A;  5FAL A;  2BGH A;  2E1V A;  1SCZ A;  5T3E A;  5FAN A;  1L5A A;  1EAB A;  1Q23 A;  1CIA A;  3FOT A;  3U9F A;  1EAE A;  2I9D A;  4CLA A;  1XMC A;  5KJW A;  5KJU A;  1NOC B;  1XMD A;  1XL7 A;  2JGP A;  5DUA A;  2E1U A;  2II5 A;  4G22 A;  1EAD A;  2XR7 A; 
#chains in the Genus database with same CATH topology
 1NDI A;  1NM8 A;  2CLA A;  2FYO A;  2XHG A;  1XL8 A;  3U9B A;  4JN3 A;  4HVM A;  4EP9 A;  2H4T A;  2IHW A;  2II3 A;  2FY4 A;  4EYW A;  1L5A A;  1Q23 A;  3U9F A;  5KJW A;  2JGP A;  1EAD A;  2XR7 A;  1E2O A;  3CLA A;  5KJT A;  5DU9 A;  1T7O A;  2RKT A;  4N72 A;  2FY5 A;  1DPD A;  2H3W A;  2H3P A;  2II4 A;  4G0B A;  5KJV A;  1T1U A;  4KE4 A;  1C4T A;  4KEC A;  5FAL A;  2BGH A;  5T3E A;  1CIA A;  3FOT A;  2I9D A;  4CLA A;  1NOC B;  1XMD A;  1XL7 A;  5DUA A;  2E1U A;  4G22 A;  3B30 A;  1EAA A;  2VSQ A;  3MAE A;  1EAC A;  1CLA A;  4JN5 A;  4G2M A;  3B2S A;  1EAF A;  5KJS A;  1DPB A;  1SCZ A;  5FAN A;  1EAB A;  1NDB A;  2RCU A;  1T7N A;  5KJU A;  2FW3 A;  2H3U A;  2FY2 A;  1T7Q A;  2E1T A;  2RKV A;  1Q6X A;  3FP0 A;  1DPC A;  3L60 A;  1PD5 A;  2FY3 A;  1QCA A;  2ZBA A;  1NDF A;  1Q9J A;  2E1V A;  4EPH A;  1EAE A;  1XMC A;  2DEB A;  2II5 A;  1S5O A; 
#chains in the Genus database with same CATH homology
 1NDI A;  1NM8 A;  2CLA A;  2FYO A;  2XHG A;  1XL8 A;  3U9B A;  4JN3 A;  4HVM A;  4EP9 A;  2H4T A;  2IHW A;  2II3 A;  2FY4 A;  4EYW A;  1L5A A;  1Q23 A;  3U9F A;  5KJW A;  2JGP A;  1EAD A;  2XR7 A;  1E2O A;  3CLA A;  5KJT A;  5DU9 A;  1T7O A;  2RKT A;  4N72 A;  2FY5 A;  1DPD A;  2H3W A;  2II4 A;  2H3P A;  4G0B A;  5KJV A;  1T1U A;  4KE4 A;  1C4T A;  4KEC A;  5FAL A;  2BGH A;  5T3E A;  1CIA A;  3FOT A;  2I9D A;  4CLA A;  1NOC B;  1XMD A;  1XL7 A;  5DUA A;  2E1U A;  4G22 A;  3B30 A;  1EAA A;  2VSQ A;  3MAE A;  1EAC A;  1CLA A;  4JN5 A;  4G2M A;  3B2S A;  1EAF A;  5KJS A;  1DPB A;  1SCZ A;  5FAN A;  1EAB A;  1NDB A;  2RCU A;  1T7N A;  5KJU A;  2FW3 A;  2H3U A;  2FY2 A;  1T7Q A;  2E1T A;  2RKV A;  1Q6X A;  3FP0 A;  1DPC A;  3L60 A;  1PD5 A;  2FY3 A;  1QCA A;  2ZBA A;  1NDF A;  1Q9J A;  2E1V A;  4EPH A;  1EAE A;  1XMC A;  2DEB A;  2II5 A;  1S5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...