4HVVA

Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide app12
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
molecule tags Signaling protein/peptide
source organism Gallus gallus
publication title Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
pubmed doi rcsb
total genus 12
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hvvA00
1Y0MA 1AWWA 1WDXA 3ZL7C 2PZ1A 2ROTA 1B3QA 2CREA 2EGAA 3THKA 2J05A 2EKHA 2RQUA 1ZX6A 2OI3A 2RMOA 4OMMA 2ED0A 1JXMA 3R6NA 2FPFA 3EHRA 2RN8A 3UA6A 2LQWA 2EGEA 4RTVA 4GLMA 2K6DA 4AG1C 3QWXX 1PHTA 1K9AA 5FWBA 1AWOA 1ABQA 2NUZA 3RBBB 1T3LA 2VVKA 2DYBA 3PE0A 2LX7A 2GQIA 3I5RA 2EGCA 4AFQC 2DX1A 1X6GA 2CH4A 2DRMA 2V1QA 1H92A 1AOJA 2KT8A 1NEBA 2GTJA 3TVTA 1JEGA 2DMOA 3PVQA 4LUEA 3VRZA 4LN2A 4J9HA 1G83A 2OJ2A 1M27C 4QT7A 4RTYA 3REBB 2RNAA 2W0ZA 1NG2A 3A98A 2L2PA 1K0XA 1N5ZA 2J6KA 4HVUA 2DJQA 4D8DA 1V1CA 1AWXA 3EG0A 1B07A 3NGPA 5EC7A 1WX6A 2HCKA 4JJDA 3TSWA 2DA9A 1CSKA 1H3HA 3NHNA 4RTXA 4ESRA 2D1XA 1AZEA 5IHNA 1PKSA 2KRNA 2LJ3A 1GCQC 2EPDA 2FEIA 2JM9A 5IXBA 1UG1A 1BK2A 2M51A 2K9GA 3VS7A 3VS4A 1YP5A 1QWFA 3REAB 2KYBA 4X1VA 2D8HA 1I07A 1JO8A 2DBMA 2CSIA 1WXTA 1UE9A 2HBWA 2EBPA 1MUZA 1ZBJA 1UECA 3KFVA 3I35A 3GBQA 4ZNXA 3VRYA 4IIMA 1LCKA 1JQQA 2DILA 1UGVA 1ZLMA 3PVLA 3QWYA 2DVJA 1M8MA 1OPKA 4Y92A 3FJ5A 3I9QA 1IO6A 4OMQA 2DBKA 2AK5A 2B86A 3EG1A 3EHQA 2YUOA 4LUDA 2IIMA 3ULRB 1WYXA 1I0CA 1QCFA 1X6BA 2EYXA 2JM8A 3M0PA 2C0TA 2JMCA 4F16A 2K79A 1SRLA 2DL3A 1ZUKA 3M0SA 1NM7A 5IXFA 4E6RA 1RLQC 3M0UA 5IHIA 4JJBA 1RI9A 1GCQA 4GBQA 2D8JA 1CKAA 1PWTA 1PNJA 2XMFA 1OPLA 1UHFA 2DL8A 2DL4A 2LMJA 4FSSA 2LCSA 2EYZA 4DEYA 1A0NB 1TUCA 1ZUUA 4LE9A 1M3CA 1AZGB 1NLPC 2BZ8A 5GJWB 2ROLA 3VS3A 2RQRA 1XOVA 3SEMA 2PTKA 1SRMA 1NEGA 1BBZA 1T0JA 5GJVB 2W10A 2CUBA 1VYVA 5HCKA 1T0HA 4RTUA 1W6XA 1K0SA 1QWEA 1NLOC 2JTEA 2YUNA 4DEXA 3VS2A 4KRTA 4OMOA 2KT1A 3SHWA 4OMNA 1KJWA 4WCIA 1UHCA 2GNCA 4A63B 2C0OA 2J6FA 4J9FA 1QLYA 2I0NA 2OAWA 4RTTA 2BTTA 1M3AA 4J9EA 1SHGA 1RLPC 3H0HA 2VKNA 2ED1A 1PRLC 4J9DA 3EGUA 2FRWA 2EQIA 2MCNA 1SHFA 1Z9ZA 3EG2A 1YCSB 3EG3A 3H41A 2KXDA 2QDLA 2RPNA 2A28A 2L0AA 1K4US 1ZUYA 1FMKA 2CT3A 2O9SA 3H0IA 1T3SA 2KR3A 4R0KA 1RUWA 2F2XA 2RQTA 1YN8A 2JS2A 1OOTA 4RTZA 2CSQA 2YUPA 1BU1A 1NYGA 2LZ6B 2LJ0A 1GBRA 1E6GA 1JXOA 3H0FA 2MIOA 5IH2A 1TUDA 1Y57A 1PRMC 1YWOA 2KNBB 4M4ZA 1GCPA 2LNHB 4HCKA 3C0CA 2DLPA 3UATA 1MV3A 1S1NA 5ECAA 1MV0B 2AZSA 1KFZA 1UUEA 2YSQA 4J9IA 4HVVA 4F14A 2X3WD 4JZ3A 2KRMA 5FW9A 1KIKA 2YDLA 2LP5A 2DE0X 2KEAA 4JJCA 2AKKA 1X2KA 1W1FA 1M30A 3UA7A 2AKLA 1WI7A 2ECZA 1X69A 2M0YA 1G2BA 1KSWA 1SPKA 1U3OA 1WIEA 1H8KA 1JU5C 2A36A 2KBTA 2DNUA 4AFZC 2RF0A 2K2MA 3CQTA 2O31A 3O5ZA 2FO0A 2K3BA 2CT4A 1UJYA 2FPEA 2GTOA 2RQVA 3NPFA 2DL5A 3UF4A 4HXJA 2HEQA 2FRYA 3JV3A 4Z89A 1NYFA 4RUGA 2DRKA 5L23A 1UJ0A 2KE9A 1HD3A 2RQWA 3M0QA 1OV3A 1UFFA 2JT4A 2X3XD 2GBQA 3LH5A 2YUQA 2L3SA 2P4RA 1Z9QA 4J9CA 1WA7A 1VYUA 4IIOA 1SEMA 1VYTA 1I1JA 3IQLA 3RNJA 1PKTA 2EYYA 2C0IA 2A08A 1WFWA 2O88A 1QKXA 2ESWA 2CUDA 1BB9A 1UDLA 4ORZA 3VS0A 2FPDA 2VWFA 4Z88A 4LNPA 1UTIA 1WXUA 1W70A 2BZYA 4EIKA 1HJDA 2GGRA 2HDAA 2KYMA 1HSQA 1AVZC 4D8KA 1FYNA 2ABLA 1AWJA 4Z8AA 2JS0A 2NWMA 2J7IA 1SSHA 1J3TA 3VS5A 2V1RA 3M0RA 4JPBW 1TG0A 1YWPA 5FWCA 2O2OA 3VS1A 1AEYA 2DM1A 1CKBA 2J06A 1GL5A 2CH4W 2FG0A 1X27A 2KROA 2H8HA 1GBQA 1QKWA 1U5SA 2F2WA 2DL7A 4J9GA 1K1ZA 2O9VA 1WLPB 1WXBA 2K7AA 2AZVA 2YT6A 4JZ4A 4CC3A 2J6OA 1ZSGA 2JW4A 2E5KA 3U23A 4J9BA 1M3BA 2JXBA 4F17A 4OMPA 4AFUC 2EW3A 1OEBA 1GFCA 1ARKA 4OMLA 2KRSA 2KXCA 2L3PA 4CC4B 5I11A 4CC2A 5I22A 4AFSC 3I5SA 2JMAA 4AG2C 3TSZA 1VA7A 2HSPA 2KGTA 2L3QA 2G6FX 3NMZC 1YNZA 4K11A 1AD5A 2BZXA 3VS6A 2F2VA 4CC7A 1U06A 2LJ1A 1GFDA 2EYWA 1EFNA 2LQNA 1GRIA 1X2QA 2EVRA 4RTWA 2CDTA 5IHKA 4HVWA 2ENMA 2A37A 3M0TA 2D0NA 2PNIA 1E7OA 2DF6A 2MOXA 1K76A 1X43A 2SRCA 2SEMA 1E6HA 1ABOA
chains in the Genus database with same CATH superfamily
3V7RA 4BY6C 1AWWA 2X35A 3G6ET 3FDRA 3ZL7C 5D6WA 1PD1A 2CREA 3CBMA 3KUFA 1ZX6A 2RHZA 3L42A 5CCAA 3EHRA 2LQWA 2EGEA 1YITT 1U1TA 5LJ3e 4CRIA 2C06A 2HQEA 4PL6A 1PHTA 4B9WA 2D9TA 4FYXB 1PD0A 2CZ7B 1T3LA 4ZTJA 2CP2A 1XJWB 2K5LA 5GAMe 2NUPA 3OYIA 2XI9A 1N8RR 2EGCA 4AFQC 4M7AF 3CC7A 1YJWQ 1AOJA 1YIJQ 2GTJA 1SKUB 2DMOA 2P4TA 4HCZA 4OGCA 2AT1B 1G83A 3JCMX 4QT7A 4M78E 1VQLT 4R56A 2VYTA 1NG2A 2NLUA 5KH6A 1N5ZA 1MMDA 4ZGDB 1OZ2A 1G3TA 2HKNA 5EC7A 2P0KA 3M5AA 3OSVA 4JJDA 1CSKA 3CMEA 4XU1A 1HYOA 1XNIA 2D1XA 4ELYC 3N5BB 2P84A 4NOYA 4BACA 2DD5A 1IGQA 1YJWA 2DPPB 3CCVQ 1ZHIA 1PM3A 3CBPA 1Q82C 5CVIA 3LGLA 1Y96A 3VS4A 1QWFA 1PCXA 2OTJA 2CSIA 3CC2A 5A2QE 2EIFA 1YJ9T 3I35A 3GBQA 3VRYA 1RAIB 1BI0A 4J83A 1RAAB 2DILA 1UGVA 2DVJA 4PJOC 2E41A 1WHJA 4IUQA 3FJ5A 4M78D 2F5TX 3I9QA 4CI0C 3M53A 3OW2P 3RERA 1BI1A 4LDUA 2X51A 4M75A 3EG1A 4R55A 1NBEB 3EFSA 3V8KA 1WYXA 4DQ2A 3CCRQ 1W2BS 3EFRA 3M0PA 3OYBA 4DBFA 4F16A 1SRLA 2DL3A 4C8QB 5IXFA 3JB9F 3G71A 4OB0B 2F1LA 3M0UA 2B8AA 1PNJA 1IREB 1QVFS 3CCST 3SWNA 1H3ZA 2EYZA 3G4SQ 2MPXC 2DEUA 2VGMA 4LE9A 5GJWB 5LJ5h 1D09B 2RQRA 1M5Q1 3SEMA 5GAOm 1SRMA 1Q81C 1BBZA 3OS1A 1BYMA 4ZGJB 4LDYA 3PTAA 2W10A 5C0MA 2DO3A 3LYIA 3BDUA 1QWEA 4DEXA 2BUDA 5KYXB 2RH2A 3VS2A 2XDPA 4OMOA 4OMNA 2QAZA 4NS5A 4M78G 5KYXA 4A63B 2QQAA 4M75C 2QXFA 3GPLA 4J9FA 4C5HA 2I0NA 1WPYA 2OAWA 4DBRA 5CKEA 1YHQT 2LCCA 2K4YA 3P8BB 4J9EA 1SHGA 5GMKl 2AHJB 3QYGB 3EGDB 1PRLC 2E12A 2L5QA 2FRWA 2HNIA 3EGUA 4QVDA 1SHFA 1FMWA 1YJNA 4FW1A 2KXDA 2HBPA 1V76A 3OYMA 1K4US 4ZN1A 4J7FA 1B34A 3MEAA 3SWNC 2CT3A 4C0DC 1C0MA 1Q82U 4C5IA 1XTDA 2YRDA 2A7YA 1JJ2P 2XG8D 3EGXA 1UGRB 4RTZA 1QVFP 2YUPA 2LZ6B 4F7UB 1LOJA 2IPOB 1SG5A 1OQKA 1PRMC 1O9SA 3OY9A 4M4ZA 1GCPA 2LNHB 1TU0B 3O8VA 4OF1A 1WJQA 1MV3A 4NL3A 1WHHA 1R0CB 4MMLA 2AZSA 4J6WA 2JTFA 3LWIA 2YSQA 4J9IA 2PVDB 4HVVA 4JZ3A 2KRMA 5FW9A 5KCOA 4IUTA 2LQ8A 2QI2A 3C4SA 4BE2A 2NUPB 3FB9A 3V7SA 4FYVB 2KEAA 4JJCA 3CCQQ 1D0YA 2NUTA 2VASA 1W1FA 1S72T 2AKLA 1WJSA 1WI7A 4X9DA 3A8MB 2M0YA 4NL2A 1SPKA 5A0DA 3PNWC 3I56A 1RI0A 2KBTA 1BIAA 4XTXA 3MHXA 1U1SA 2X4JA 2K2MA 3CCET 3O5ZA 2P0QA 3MKDA 5CKDA 3CXCA 4LDWA 3UF4A 4HXJA 2FRYA 3OMGA 4IKFA 1NYFA 4RUGA 5LJ3g 2DRKA 1Q86C 4D6WA 3A5ZB 4E2FB 1YJNT 1IHWA 4QVZA 4QW2A 2XIDA 1M4ZA 1Z9QA 4PJOE 1WA7A 2DXUA 1OI1A 5EG2A 1SEMA 2K3YA 1VYTA 4O5VA 1I1JA 2HD0A 3CCUA 2E5QA 1PKTA 1S72Q 4XTWA 2QTXA 3VS0A 1D1AA 2RHXA 4Q5WA 3A1PA 2PVGB 4EIKA 2GGRA 2KYMA 1K8AC 1PC0A 3AT1B 1AVZC 1AWJA 4DBQA 1ZSZB 2LQKA 2NWMA 3R6OA 5GAOn 2EJFA 5FU7C 2RA2A 3MEVA 4WTOB 3VS1A 3CCQT 2EQUA 1GL5A 2K57A 3WVDB 2L89A 5FRMA 5J3BA 4ATOA 5FU6B 4C8QF 1VQMT 4M7DE 2KROA 3RKYA 3PT9A 3FEOA 2DL7A 1K1ZA 3LGFA 3G1JA 5LJ5j 1WXBA 2K7AA 2YT6A 4JZ4A 2QA4T 2J6OA 2E5KA 2QQRA 1KQ1A 4JRIA 5C6SA 2OTJT 1ARKA 1H641 4IUVA 1TOVA 1OX8A 3LX7A 2FVUA 4CC2A 2RK1A 5I22A 4RG8A 4C8QA 2XHCA 2EJ9A 2ZGWA 1QVGS 2D6FA 1VA7A 3OYLA 2HSPA 2FZKB 2VUBA 1VIEA 3NTIA 2PQWA 1AD5A 1RAFB 3META 3SWNB 3VUZA 2DFUA 2EYQA 2LQNA 4JDSA 1VQOA 4RTWA 5IHKA 1AHJB 3M0TA 4A4FA 3X26B 3JCMg 1NPPA 3MP8A 3QDRB 2LC4A 2FB7A 1BI3A 1KHIA 2HSEB 3T9NA 2JZ2A 3C95A 3JCMe 1B3QA 5D6YA 4E7LA 2E10A 2J05A 2H3EB 3HRSA 3JB9J 2OI3A 4OMMA 1N9SA 4E7IA 3UT1A 3OYDA 1JXMA 2Z0WA 4PJOG 5FRNA 3R6NA 1MMNA 2E6ZA 3UA6A 3CCUQ 4M75F 2PU9B 1AWOA 1YJWT 3RBBB 1RL2A 3RKWA 1I81A 2VVKA 5D7UA 3I5RA 1X6GA 4JRKA 1RADB 2EQKA 2V1QA 2RJFA 3ZBDA 4X9CA 2WSCE 3LH0A 1JEGA 4FT4A 3EH2A 4M77A 4N4HA 1PSFA 4LUEA 3QDFA 4XU3A 4J9HA 3JB9G 1M27C 2JTMA 3EFOA 4RTYA 3REBB 1D1BA 2MWOA 2W0ZA 3I56Q 1B34B 4HVUA 2DJQA 3OYGA 1ZA2B 2DXTA 3SD4A 1BI2A 2HCKA 3TSWA 2CP5A 3L2RA 2O4XB 3VU3C 4E7ZA 3CCQA 3SB2A 2LRQA 3H8ZA 4KBMB 3NTKA 3X24B 3E9FA 5CAIA 4M7AB 1QQJA 5IXBA 3MCAB 1UG1A 1BK2A 5I2MA 2K9GA 2RI2A 3VS7A 2QA4Q 1RABB 1K73R 1YP5A 3REAB 4X1VA 1FX7A 1I07A 2DBMA 3RESA 5GMKi 5GAOl 2KY9A 2FYKA 1UE9A 2IG0A 1UECA 1M90C 1BIBA 1LVKA 1LCKA 4N4GA 4VUBA 1JQQA 3OBYA 5GAN5 2MF2A 3PVLA 2VB6A 1VQLQ 1K73U 3X20B 4Y92A 2DVEA 3MO8A 2E4HA 2DBKA 4M77C 2AK5A 2B86A 3JB9I 1BKBA 1LJOA 2M1HA 4JUVA 3M55A 4X34A 3BFMA 5GAN4 1G5VA 2MK5A 3ULRB 3OYCA 2DAQA 2JUFA 5CKHA 4JRQA 1I0CA 1WHGA 2JM8A 2C0TA 1QVPA 3M0SA 4OGEA 3HKSA 1F1BB 4RCCA 4C5EA 1RLQC 4C8QG 1IRXA 4JJBA 1RI9A 1VQKT 2D8JA 1CKAA 1OPLA 2RB6A 2JOYA 4FSSA 1A0NB 1M3CA 1NLPC 1X01A 3VS3A 3OYFA 1VQ5A 4MDWA 4BE1A 3GF5A 5GJVB 1VQMA 3V8LA 4LD9K 2CUBA 1VYVA 3HL8A 4M78C 1JB0E 2ZZDA 5GMKe 4PNOA 3SHWA 4M75D 2RI3A 3LWHA 1KJWA 1UHCA 2GNCA 1M90R 1VQ7Q 3CCMA 2RHIA 3VYGA 1G3YA 7AT1B 4M78F 4RTTA 2BTTA 2DZCA 4PJOF 2CZ6B 4C92A 1K73C 1RLPC 3H0HA 2E70A 1ZA1B 4XU0A 2F69A 2IVWA 4M7AG 2DTHA 1Q7YC 3EG3A 2QDLA 3CCSA 4F7UE 2RPNA 2A28A 2L0AA 4N0AA 2HAXA 1ZUYA 2LT1A 4L6V5 1FMKA 2RHYA 3QJ6A 4M77G 2FL7A 2HL3A 2O9SA 3H0IA 3UWNA 1VQOT 2QGGA 1YJ9Q 1R0BG 1VQ8Q 2NUTB 2ZPBB 3CXCS 2M16A 1RUWA 3LW5E 4Y91A 2MAMA 3MP6A 5GANh 3EG9B 4A53A 1YN8A 2CP7A 2JS2A 1OOTA 1WGSA 2QQ9A 2ZPHB 4AMCA 1UEBA 2FHDA 2KSSA 2YWWA 1JXOA 3H0FA 3URGA 2MIOA 5IH2A 1TUDA 3CC2Q 1YWOA 2LCLA 5I21A 2QDYB 3UATA 5ECAA 1VUBA 1MMAA 1KFZA 1EZZB 1KIKA 3E9GA 1Q7YU 4C92C 2QK0A 4MZMA 1UGPB 1QP3A 3G4SA 3CCUT 2AKKA 1RAHB 3CMEQ 2LVMA 1M30A 4QQDA 3A8OB 1G2BA 1KSWA 1U3OA 1M1GA 5KE3A 3CCVA 2LT4A 4MZPA 2PUOB 3M9QA 1M2VB 2HKQB 3MP1A 4P5NA 3E2UA 2BE9B 1NZ9A 1KC8C 2QEXQ 3QIIA 2FPEA 2RQVA 5FU7B 3J80E 4Z89A 1HK9A 1Q82R 5L23A 1SSFA 1YITQ 3G4ST 1ZQ1A 1IB8A 5GANf 1OV3A 1VQ9Q 3PIOA 2LTOA 3DB3A 2DERA 2COYA 2P4RA 3CCJA 1VQKA 3CCJQ 3RNJA 4KUDK 3HHTB 3OYYA 2C0IA 2OX7A 2OTJQ 1UDLA 2O4XA 1I5OB 4ORZA 2VWFA 4Z88A 3AHUA 2DTIA 1D1CA 1UTIA 1WXUA 2BZYA 3LLRA 1UGQB 1HSQA 4E7JA 5GMKj 5GAN6 1FYNA 3M58A 4BI3A 3VUBA 4ZN3A 2V1RA 3M0RA 4RG2A 2H3JA 3GOXA 1MNEA 1AEYA 2DM1A 3OS2A 1CKBA 1YITA 1K8AU 5A0GA 2CH4W 4M7AA 3JAME 4BB7A 4C92F 4J9GA 2QQBA 3M57A 2K5IA 3OSSC 3CMAQ 1ZSGA 4UC4A 3S3NA 3JCMc 2PVOB 2QQSA 3GNFB 1M3BA 2GQVA 2JXBA 2JNGA 3RMQA 1GFCA 3PIPA 2XU8A 2L3PA 4CC4B 1MNDA 4AFSC 2R5MA 1R77A 3QO3A 2E1HA 4L5GA 3X25B 4RKUE 2L3QA 1YNZA 2X4WA 1LNXA 8ATCB 3ER0A 4OMFB 1B7TA 2L8DA 3G6EA 2LJ1A 2VC8A 2EYWA 2DXCA 2EVRA 4OB3B 4QQ6A 2D0NA 2LDMA 1E7OA 2DF6A 4HA8A 2ZPEB 2M02A 2R5AA 2SEMA 1WHMA 2JVVA 4KGZB 1ZBXA 1ABOA 3CPWA 3CCSQ 1Y0MA 2PUKB 3CCEQ 3TEEA 3CC2T 5LJ5d 1VQ8A 5GAMj 3QHSA 2EGAA 1YJ9A 5LL6S 2XKOC 4XK8E 2EKHA 3EGXB 3JSCA 4XTUA 4PJOD 2RMOA 2ED0A 3QYHB 2FPFA 1VQPA 4C92E 1M1KC 3CCRT 4RTVA 4GLMA 4ZTFA 2ZAEA 4AG1C 3QWXX 3EH1A 1ABQA 3HFNA 4HT8A 2NUZA 3QXEB 1SF9A 1KHCA 3EG9A 1WQWA 4F7UA 3M56A 4AT1B 4BD3A 4EMHA 4M7DA 2DTOA 4FM4B 2ZPIB 3OB9A 3VYHB 1VQLA 2LX7A 4MZTA 3E1SA 2DX1A 3ZEHA 2CH4A 5GAN3 3CCMQ 1AT1B 2KT8A 3QUIA 4KGXB 1NEBA 2JN0A 3PVQA 3VRZA 3CCLA 1N8RU 4LN2A 3C12A 2OJ2A 3JCMQ 1VQNQ 2RNAA 3JB9D 1K0XA 2L2PA 1WZOA 3TU4K 1VQ7T 4D8DA 3EG0A 1AWXA 5KCHA 3S3MA 1RAGB 4KH1B 4RMOA 1VOMA 4GLKA 1VQNA 1WX6A 1M1KR 1H3HA 2DA9A 1N6AA 4C92D 3NHNA 4RTXA 3DB4A 3L2ZA 2ZPFB 2KRNA 2LJ3A 1JJ2A 1GCQC 1FMVA 2FEIA 1K8AR 5KYNA 1IXDA 3CCLT 2WSEE 5IAYA 5D6XA 2D8HA 9ATCB 5KE2A 4M7AD 4M75G 3M54A 4XTZA 4M7DC 1QP2A 1WXTA 1KC8R 3FC3A 4A54A 3KFVA 2DXBA 1KD1U 5LJ3f 4A4KA 1ZLMA 2DYIA 3QWYA 1M8MA 2KMTA 1OPKA 5KYUB 2OTLA 2VXFA 2V8JA 1IO6A 3RR6A 4OMQA 5A0LA 5IN1A 1JJ2S 3CXCP 4FYYB 3EHQA 2YUOA 4C0GA 5DM7R 2IIMA 4XU2A 3M4YA 1KQ2A 4JRPA 1X6BA 2EYXA 4XTVA 2HQXA 4E7HA 3QSUA 5CKFA 5CKBA 2P0PA 2KI7A 3DLLA 1D0XA 4C92G 1KC8U 1IGUA 1EX4A 2CS7A 4JLIA 3J81E 1GCQA 4GBQA 5J39A 2XMFA 3L2VA 2DL8A 1X75C 3VJPA 4DEYA 1KD1C 3QJYA 2X4XA 4C0DB 5CK9A 1HXDA 1M90U 2PTKA 4PJOB 4A4EA 3JCMd 2MMPA 2YLBA 4J6YA 4RTUA 2JTEA 4TVRA 4PJOA 1TH7A 4KRTA 3JB9H 3BDLA 2K2VA 4WCIA 2Y4YA 3C94A 3I56T 4N4IA 2XDDA 2LNVA 2C0OA 2J6FA 2EWNA 2BE7D 2F5KA 3CC4Q 4M77E 1UGSB 2XDBA 3CPWS 3CCVT 3MJXA 2ZPGB 5M9OA 2EQIA 5DLOA 2M9UA 2R57A 1JRIA 2QYZA 5GAN7 1Z9ZA 4DOWA 1M9SA 4RCBA 4XTYA 4FCYA 5CQYA 4DA4A 4M77D 1TUGB 1FXXA 4M75E 1QVFA 3INZA 4E7SA 2KR3A 1NJIC 2MI6A 2RQTA 4FYWB 3MEWA 1VQKQ 2CSQA 1BU1A 2LJ0A 3FLGA 3PFSA 1E6GA 4FT2A 2OAUA 2KNBB 3L2UA 2RK2A 2DJZA 4E47A 4HCKA 3C0CA 1Q86R 1S1NA 5LJ5g 1S72A 1MV0B 1VQPT 2CP3A 1I8FA 1QCOA 1W2BP 3CC4A 1YFNA 4F14A 4BE0A 2X3WD 3JCMP 5GAOr 4A4GA 2QGFB 4M77B 3V8JA 3OW2A 1TTHB 2LP5A 1KQSS 4WF2A 1I5LA 2QEXA 4PJJA 4OB2B 5KYYA 3CPFA 1K9MC 3L2QA 3UA7A 2HZYA 4A4HA 1X69A 3DLMA 2EKOA 1H8KA 2CP0A 1JU5C 4YTLA 3V7CA 5GMKh 4ELZC 2K3XA 1K9MR 4AFZC 4BUGA 4M77F 3CQTA 2FO0A 5GANg 2VXEA 1VQ4A 3OYJA 4M7DG 4BY6B 2RI5A 4Z02A 4BI8B 2BIVA 4KULA 3OYNA 4BDYA 3E19A 3M0QA 2RQWA 3J7AF 1VQNT 4OP0A 1M8VA 2ZCFB 1RAEB 1UFFA 2JT4A 2NYSA 2RJDA 4PLIA 2GBQA 3KXTA 2YUQA 2L3SA 2COWA 2MWPA 2YRCA 2X4YA 1MMGA 3IQLA 5GANd 1KQSA 2EYYA 4MDXA 2A08A 2V26A 1QKXA 1XQHA 1W4SA 1I4K1 1VQ9T 3OYEA 2FPDA 3GNGA 2YHTA 1W70A 4C8QD 2HDAA 1UB4A 2XK0A 2KQWA 1ZSZC 4E7KA 4D8KA 3H6ZA 3H9NA 2KDSA 2JS0A 3OS0A 3BY7A 4HKEA 2DZ9A 1LPLA 1SSHA 1J3TA 3VS5A 4JPBW 3TQ7P 5FWCA 3CD6Q 5CR2A 1KQSP 1WQ7A 2J06A 4FU6A 3X28B 1X27A 3QZ9B 3NTHA 4XQ3A 4QKUA 1R8OB 2H8HA 1QKWA 1U5SA 2WSFE 2F2WA 1YJNQ 1WLPB 4KT0E 4OVAA 4BDZA 2AZVA 3RIRA 3RUXA 1MHNA 2JW4A 4JLGA 2E65A 3TCJA 3U23A 4J9BA 2CKKA 3GP8A 1QW1A 4F17A 4OMPA 1QCNA 1OEBA 4AFUC 4J5YA 2KRSA 4EDUA 4PJLA 3QZ5B 3JCMb 5I11A 3S3OA 3I5SA 4AG2C 3TSZA 5LJ5e 2KVQG 1Y71A 2KAFA 3CD6T 4QQGA 4K11A 2A3LA 5CO7A 4C92B 1ZSZA 4XAXB 3MPUB 2COZA 5DLQE 4CC7A 4IURA 3ME9A 3CBOA 1GFDA 2QASA 1EFNA 1GRIA 1X2QA 4PFPA 3ZFJA 3KBGA 2PNIA 1N27A 4M7DB 1Q95G 3CMAT 1X43A 2SRCA 3RMSA 3BE3A 5GMKm 1E6HA 2CZ1B 2HMAA 3PGGA 3CC4T 1Q86U 1WDXA 3M4GA 4J8OA 2PZ1A 5FROA 4JS4A 2ROTA 2X9HA 3THKA 2RQUA 4DOVA 5LJ3h 1IHVA 3CCRA 2ATCB 2RN8A 4LD6A 3A8HB 2V8KA 2K6DA 4LDXA 1K9AA 5FWBA 3CCMT 3A8GB 4C8QC 4FW2A 2DYBA 3PE0A 3JCMW 1OU9A 3GIBA 2G3RA 2QA4A 3PMIA 1WHKA 3ASKA 2GQIA 5HK3A 2KK4A 3L2WA 5KYWB 4KGVB 4ANJA 2DRMA 5GAOq 1JBMA 2DIQA 5HKCA 2WACA 3HRTA 1H92A 3CC7T 2CGHA 3TVTA 4HCBA 5LJ3d 2RJEA 4PJMA 2DD4A 2EQMA 1V29B 1KG1A 3A98A 4PKCC 1YIJT 4PFOA 2J6KA 1VIFA 4QVCA 4M78B 1V1CA 2DEQA 3PMTA 5KYYB 1B07A 3NGPA 4Y28E 5GAMd 1VQ4Q 4ESRA 3CD6A 1BCOA 1M2OA 1AZEA 5IHNA 1PKSA 2BKDN 2O01E 2EPDA 2MYSA 2JM9A 2GF7A 5HY6A 4EMKB 3G71Q 2M51A 1OX9A 3DKMA 2KYBA 1JO8A 2XICA 3OYHA 2HBWA 1YIJA 5KYUA 1Y96B 3L1AA 1DJ7B 1MUZA 2EBPA 1ZBJA 4ZNXA 1Q81U 3CC7Q 3OMCA 4IIMA 3QPHA 2VV5A 3OW2S 3JCMh 3NFCA 3FRNA 1TSFA 2GFUA 5FU6C 4LUDA 1QVGA 3OYKA 1G8XA 3HP9A 2HL5C 1YI2T 1QCFA 3UPUA 4F04B 2JMCA 4M7AE 1VQ9A 3S6WA 1KK7A 3WVEB 2K79A 1VQ8T 1ZUKA 1NM7A 2Y90A 4E6RA 5I2SA 1VQOQ 3CEYA 2YLCA 5IHIA 3QG1A 2EAYA 4N0AC 1PWTA 4C0ZA 1PSEA 3JCMV 2AIRB 1UHFA 3P8HA 2DL4A 3BW1A 1IZ6A 2LMJA 2LCSA 2EQJA 1TUCA 4O6JA 1ZUUA 4JJNK 2YXYA 1AZGB 2BZ8A 2ROLA 1QMCA 4HCCA 1U8RA 1XOVA 3HFOA 1NEGA 4FL6A 1T0JA 1FWZA 1YCYA 2EFIA 5HCKA 1T0HA 1K0SA 1W6XA 4J7IA 1W2BA 1NLOC 2YUNA 4V2SA 2KT1A 5GAOp 4B9XA 3VV0A 4FIBA 3HPWA 5GAN8 3G7ZA 4PLLA 5L8RE 3OQ5A 3WXMB 1NE8A 1QLYA 1OYXA 2R58A 1D3BB 1M3AA 2VKNA 2ED1A 4J9DA 4FSXA 1NJIU 4KH0B 3MEUA 1MGQA 2MCNA 2L3RA 3OS5A 3H41A 3EG2A 1YCSB 2I2LA 2E3HA 3JCMJ 3HSBA 4C8QE 3EGDA 2QEXT 1N8RC 1C1AA 1TWBA 2VGNA 2RHUA 3OBWA 5GANe 1T3SA 5LJ3j 4R0KA 6AT1B 3QBYA 3OYAA 2JJ9A 2OTLQ 1TXQA 4J6XA 1YI2A 2F2XA 5AT1B 3Q1JA 2GFAA 2K5FA 3RDVA 2DETA 3P8DA 1GBRA 1NYGA 4M78A 2DK3A 3JRZA 4PJNA 1VQ6Q 1Y57A 3FJPA 3RKXA 4II1A 2DLPA 5GAMf 5LJ5f 3QKJA 1UUEA 2RJCA 1RACB 1VQ5T 1C6VX 1VQ7A 2YDLA 3HTRA 1K9MU 3D7SB 2DE0X 2QG9B 3I55Q 1OZ3A 1X2KA 1YHQA 3CCJT 3I55T 2ECZA 1BCMA 4L59A 1VQMQ 1Q7YR 1WIEA 1EIFA 1OU8A 1VQ5Q 2A36A 4F7UG 2DNUA 2Y4XA 5GAN2 4ZGEB 2FZGB 5DY9A 2RF0A 2M0OA 1M1KU 2O31A 1M1FA 2K3BA 1G3SA 2CT4A 1UJYA 1WHLA 3GLXA 4M7AC 3F70A 2GTOA 1G3WA 4M7DF 3NPFA 4M75B 2DL5A 1VQ6T 2LX9A 4EMKC 2HEQA 1X6OA 2D0QB 3JV3A 8AT1B 1P92A 4PFZA 1UJ0A 1D0ZA 2KE9A 1HD3A 1NPRA 1YHQQ 4LXCA 3VKIA 2OTLT 3I55A 2E64A 2X3XD 3LH5A 5GAMg 4J9CA 1O75A 2YRVA 5KYWA 1VYUA 4OB1B 3HRUA 4IIOA 3SDZA 1N9RA 4LDVA 5FLXE 4MMKA 1WFWA 3A8LB 3FIFA 2O88A 1YBYA 1VQPQ 2ESWA 2CUDA 1BB9A 1Y7XA 2CP6A 4LNPA 3TREA 4JS5A 3G71T 5J26A 1HJDA 1ACMB 1PG5B 4BI4A 3OA6A 1GXIE 3CCEA 1TS9A 2ABLA 2A0FB 4Z8AA 5HK0A 1M2VA 2J7IA 4F7UF 2FZCB 2E6NA 1VQ4T 1TG0A 1YWPA 2DIGA 3CMET 2O2OA 4KUIA 3UDCA 4EMGA 2CYZB 4C5GA 5AYFA 5IT9E 2FG0A 1KD1R 1NJIR 4EMKA 1GBQA 3M59A 2EJGA 2O9VA 4B6MA 2E3IA 3CCLQ 4PK4A 4CC3A 4GY5A 1WJRA 3G6EQ 2QTVA 5CIUA 4C0FA 2EW3A 4OMLA 5GANj 5CQXA 2KXCA 2CZ0B 1OULA 1VQ6A 2JMAA 3EAEA 2KGTA 2DKGA 4DBHA 4M7DD 2G6FX 3NMZC 4IUUA 2BZXA 3VS6A 4HT9A 2F2VA 4IUPA 1U06A 1YI2Q 3SFMA 4ME7A 2RM4A 1Y07A 1WNLA 3CPWP 2RD1A 3JCMf 2CDTA 4HVWA 2ENMA 2A37A 3CMAA 1QVGP 1Q81R 2MOXA 1K76A 2RO0A 1D3BA 4EPCA 2GCXA 3EFOB 2HQHA 2V8IA 2XD0A 5GAMh
chains in the Genus database with same CATH topology
1Y0MA 1AWWA 1WDXA 3ZL7C 2PZ1A 2ROTA 1B3QA 2CREA 2EGAA 3THKA 2J05A 2EKHA 2RQUA 1ZX6A 2OI3A 2RMOA 4OMMA 2ED0A 1JXMA 3R6NA 2FPFA 3EHRA 2RN8A 3UA6A 2LQWA 2EGEA 4RTVA 4GLMA 2K6DA 4AG1C 3QWXX 1PHTA 1K9AA 5FWBA 1AWOA 1ABQA 2NUZA 3RBBB 1T3LA 2VVKA 2DYBA 3PE0A 2LX7A 2GQIA 3I5RA 2EGCA 4AFQC 2DX1A 1X6GA 2CH4A 2DRMA 2V1QA 1H92A 1AOJA 2KT8A 1NEBA 2GTJA 3TVTA 1JEGA 2DMOA 3PVQA 4LUEA 3VRZA 4LN2A 4J9HA 1G83A 2OJ2A 1M27C 4QT7A 4RTYA 3REBB 2RNAA 2W0ZA 1NG2A 3A98A 2L2PA 1K0XA 1N5ZA 2J6KA 4HVUA 2DJQA 4D8DA 1V1CA 1AWXA 3EG0A 1B07A 3NGPA 5EC7A 1WX6A 2HCKA 4JJDA 3TSWA 2DA9A 1CSKA 1H3HA 3NHNA 4RTXA 4ESRA 2D1XA 1AZEA 5IHNA 1PKSA 2KRNA 2LJ3A 1GCQC 2EPDA 2FEIA 2JM9A 5IXBA 1UG1A 1BK2A 2M51A 2K9GA 3VS7A 3VS4A 1YP5A 1QWFA 3REAB 2KYBA 4X1VA 2D8HA 1I07A 1JO8A 2DBMA 2CSIA 1WXTA 1UE9A 2HBWA 2EBPA 1MUZA 1ZBJA 1UECA 3KFVA 3I35A 3GBQA 4ZNXA 3VRYA 4IIMA 1LCKA 1JQQA 2DILA 1UGVA 1ZLMA 3PVLA 3QWYA 2DVJA 1M8MA 1OPKA 4Y92A 3FJ5A 3I9QA 1IO6A 4OMQA 2DBKA 2AK5A 2B86A 3EG1A 3EHQA 2YUOA 4LUDA 2IIMA 3ULRB 1WYXA 1I0CA 1QCFA 1X6BA 2EYXA 2JM8A 3M0PA 2C0TA 2JMCA 4F16A 2K79A 1SRLA 2DL3A 1ZUKA 3M0SA 1NM7A 5IXFA 4E6RA 1RLQC 3M0UA 5IHIA 4JJBA 1RI9A 1GCQA 4GBQA 2D8JA 1CKAA 1PWTA 1PNJA 2XMFA 1OPLA 1UHFA 2DL8A 2DL4A 2LMJA 4FSSA 2LCSA 2EYZA 4DEYA 1A0NB 1TUCA 1ZUUA 4LE9A 1M3CA 1AZGB 1NLPC 2BZ8A 5GJWB 2ROLA 3VS3A 2RQRA 1XOVA 3SEMA 2PTKA 1SRMA 1NEGA 1BBZA 1T0JA 5GJVB 2W10A 2CUBA 1VYVA 5HCKA 1T0HA 4RTUA 1W6XA 1K0SA 1QWEA 1NLOC 2JTEA 2YUNA 4DEXA 3VS2A 4KRTA 4OMOA 2KT1A 3SHWA 4OMNA 1KJWA 4WCIA 1UHCA 2GNCA 4A63B 2C0OA 2J6FA 4J9FA 1QLYA 2I0NA 2OAWA 4RTTA 2BTTA 1M3AA 4J9EA 1SHGA 1RLPC 3H0HA 2VKNA 2ED1A 1PRLC 4J9DA 3EGUA 2FRWA 2EQIA 2MCNA 1SHFA 1Z9ZA 3EG2A 1YCSB 3EG3A 3H41A 2KXDA 2QDLA 2RPNA 2A28A 2L0AA 1K4US 1ZUYA 1FMKA 2CT3A 2O9SA 3H0IA 1T3SA 2KR3A 4R0KA 1RUWA 2F2XA 2RQTA 1YN8A 2JS2A 1OOTA 4RTZA 2CSQA 2YUPA 1BU1A 1NYGA 2LZ6B 2LJ0A 1GBRA 1E6GA 1JXOA 3H0FA 2MIOA 5IH2A 1TUDA 1Y57A 1PRMC 1YWOA 2KNBB 4M4ZA 1GCPA 2LNHB 4HCKA 3C0CA 2DLPA 3UATA 1MV3A 1S1NA 5ECAA 1MV0B 2AZSA 1KFZA 1UUEA 2YSQA 4J9IA 4HVVA 4F14A 2X3WD 4JZ3A 2KRMA 5FW9A 1KIKA 2YDLA 2LP5A 2DE0X 2KEAA 4JJCA 2AKKA 1X2KA 1W1FA 1M30A 3UA7A 2AKLA 1WI7A 2ECZA 1X69A 2M0YA 1G2BA 1KSWA 1SPKA 1U3OA 1WIEA 1H8KA 1JU5C 2A36A 2KBTA 2DNUA 4AFZC 2RF0A 2K2MA 3CQTA 2O31A 3O5ZA 2FO0A 2K3BA 2CT4A 1UJYA 2FPEA 2GTOA 2RQVA 3NPFA 2DL5A 3UF4A 4HXJA 2HEQA 2FRYA 3JV3A 4Z89A 1NYFA 4RUGA 2DRKA 5L23A 1UJ0A 2KE9A 1HD3A 2RQWA 3M0QA 1OV3A 1UFFA 2JT4A 2X3XD 2GBQA 3LH5A 2YUQA 2L3SA 2P4RA 1Z9QA 4J9CA 1WA7A 1VYUA 4IIOA 1SEMA 1VYTA 1I1JA 3IQLA 3RNJA 1PKTA 2EYYA 2C0IA 2A08A 1WFWA 2O88A 1QKXA 2ESWA 2CUDA 1BB9A 1UDLA 4ORZA 3VS0A 2FPDA 2VWFA 4Z88A 4LNPA 1UTIA 1WXUA 1W70A 2BZYA 4EIKA 1HJDA 2GGRA 2HDAA 2KYMA 1HSQA 1AVZC 4D8KA 1FYNA 2ABLA 1AWJA 4Z8AA 2JS0A 2NWMA 2J7IA 1SSHA 1J3TA 3VS5A 2V1RA 3M0RA 4JPBW 1TG0A 1YWPA 5FWCA 2O2OA 3VS1A 1AEYA 2DM1A 1CKBA 2J06A 1GL5A 2CH4W 2FG0A 1X27A 2KROA 2H8HA 1GBQA 1QKWA 1U5SA 2F2WA 2DL7A 4J9GA 1K1ZA 2O9VA 1WLPB 1WXBA 2K7AA 2AZVA 2YT6A 4JZ4A 4CC3A 2J6OA 1ZSGA 2JW4A 2E5KA 3U23A 4J9BA 1M3BA 2JXBA 4F17A 4OMPA 4AFUC 2EW3A 1OEBA 1GFCA 1ARKA 4OMLA 2KRSA 2KXCA 2L3PA 4CC4B 5I11A 4CC2A 5I22A 4AFSC 3I5SA 2JMAA 4AG2C 3TSZA 1VA7A 2HSPA 2KGTA 2L3QA 2G6FX 3NMZC 1YNZA 4K11A 1AD5A 2BZXA 3VS6A 2F2VA 4CC7A 1U06A 2LJ1A 1GFDA 2EYWA 1EFNA 2LQNA 1GRIA 1X2QA 2EVRA 4RTWA 2CDTA 5IHKA 4HVWA 2ENMA 2A37A 3M0TA 2D0NA 2PNIA 1E7OA 2DF6A 2MOXA 1K76A 1X43A 2SRCA 2SEMA 1E6HA 1ABOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0M A;  1AWW A;  1WDX A;  3ZL7 C;  2PZ1 A;  2ROT A;  1B3Q A;  2CRE A;  2EGA A;  3THK A;  2J05 A;  2EKH A;  2RQU A;  1ZX6 A;  2OI3 A;  2RMO A;  4OMM A;  2ED0 A;  1JXM A;  3R6N A;  2FPF A;  3EHR A;  2RN8 A;  3UA6 A;  2LQW A;  2EGE A;  4RTV A;  4GLM A;  2K6D A;  4AG1 C;  3QWX X;  1PHT A;  1K9A A;  5FWB A;  1AWO A;  1ABQ A;  2NUZ A;  3RBB B;  1T3L A;  2VVK A;  2DYB A;  3PE0 A;  2LX7 A;  2GQI A;  3I5R A;  2EGC A;  4AFQ C;  2DX1 A;  1X6G A;  2CH4 A;  2DRM A;  2V1Q A;  1H92 A;  1AOJ A;  2KT8 A;  1NEB A;  2GTJ A;  3TVT A;  1JEG A;  2DMO A;  3PVQ A;  4LUE A;  3VRZ A;  4LN2 A;  4J9H A;  1G83 A;  2OJ2 A;  1M27 C;  4QT7 A;  4RTY A;  3REB B;  2RNA A;  2W0Z A;  1NG2 A;  3A98 A;  2L2P A;  1K0X A;  1N5Z A;  2J6K A;  4HVU A;  2DJQ A;  4D8D A;  1V1C A;  1AWX A;  3EG0 A;  1B07 A;  3NGP A;  5EC7 A;  1WX6 A;  2HCK A;  4JJD A;  3TSW A;  2DA9 A;  1CSK A;  1H3H A;  3NHN A;  4RTX A;  4ESR A;  2D1X A;  1AZE A;  5IHN A;  1PKS A;  2KRN A;  2LJ3 A;  1GCQ C;  2EPD A;  2FEI A;  2JM9 A;  5IXB A;  1UG1 A;  1BK2 A;  2M51 A;  2K9G A;  3VS7 A;  3VS4 A;  1YP5 A;  1QWF A;  3REA B;  2KYB A;  4X1V A;  2D8H A;  1I07 A;  1JO8 A;  2DBM A;  2CSI A;  1WXT A;  1UE9 A;  2HBW A;  2EBP A;  1MUZ A;  1ZBJ A;  1UEC A;  3KFV A;  3I35 A;  3GBQ A;  4ZNX A;  3VRY A;  4IIM A;  1LCK A;  1JQQ A;  2DIL A;  1UGV A;  1ZLM A;  3PVL A;  3QWY A;  2DVJ A;  1M8M A;  1OPK A;  4Y92 A;  3FJ5 A;  3I9Q A;  1IO6 A;  4OMQ A;  2DBK A;  2AK5 A;  2B86 A;  3EG1 A;  3EHQ A;  2YUO A;  4LUD A;  2IIM A;  3ULR B;  1WYX A;  1I0C A;  1QCF A;  1X6B A;  2EYX A;  2JM8 A;  3M0P A;  2C0T A;  2JMC A;  4F16 A;  2K79 A;  1SRL A;  2DL3 A;  1ZUK A;  3M0S A;  1NM7 A;  5IXF A;  4E6R A;  1RLQ C;  3M0U A;  5IHI A;  4JJB A;  1RI9 A;  1GCQ A;  4GBQ A;  2D8J A;  1CKA A;  1PWT A;  1PNJ A;  2XMF A;  1OPL A;  1UHF A;  2DL8 A;  2DL4 A;  2LMJ A;  4FSS A;  2LCS A;  2EYZ A;  4DEY A;  1A0N B;  1TUC A;  1ZUU A;  4LE9 A;  1M3C A;  1AZG B;  1NLP C;  2BZ8 A;  5GJW B;  2ROL A;  3VS3 A;  2RQR A;  1XOV A;  3SEM A;  2PTK A;  1SRM A;  1NEG A;  1BBZ A;  1T0J A;  5GJV B;  2W10 A;  2CUB A;  1VYV A;  5HCK A;  1T0H A;  4RTU A;  1W6X A;  1K0S A;  1QWE A;  1NLO C;  2JTE A;  2YUN A;  4DEX A;  3VS2 A;  4KRT A;  4OMO A;  2KT1 A;  3SHW A;  4OMN A;  1KJW A;  4WCI A;  1UHC A;  2GNC A;  4A63 B;  2C0O A;  2J6F A;  4J9F A;  1QLY A;  2I0N A;  2OAW A;  4RTT A;  2BTT A;  1M3A A;  4J9E A;  1SHG A;  1RLP C;  3H0H A;  2VKN A;  2ED1 A;  1PRL C;  4J9D A;  3EGU A;  2FRW A;  2EQI A;  2MCN A;  1SHF A;  1Z9Z A;  3EG2 A;  1YCS B;  3EG3 A;  3H41 A;  2KXD A;  2QDL A;  2RPN A;  2A28 A;  2L0A A;  1K4U S;  1ZUY A;  1FMK A;  2CT3 A;  2O9S A;  3H0I A;  1T3S A;  2KR3 A;  4R0K A;  1RUW A;  2F2X A;  2RQT A;  1YN8 A;  2JS2 A;  1OOT A;  4RTZ A;  2CSQ A;  2YUP A;  1BU1 A;  1NYG A;  2LZ6 B;  2LJ0 A;  1GBR A;  1E6G A;  1JXO A;  3H0F A;  2MIO A;  5IH2 A;  1TUD A;  1Y57 A;  1PRM C;  1YWO A;  2KNB B;  4M4Z A;  1GCP A;  2LNH B;  4HCK A;  3C0C A;  2DLP A;  3UAT A;  1MV3 A;  1S1N A;  5ECA A;  1MV0 B;  2AZS A;  1KFZ A;  1UUE A;  2YSQ A;  4J9I A;  4HVV A;  4F14 A;  2X3W D;  4JZ3 A;  2KRM A;  5FW9 A;  1KIK A;  2YDL A;  2LP5 A;  2DE0 X;  2KEA A;  4JJC A;  2AKK A;  1X2K A;  1W1F A;  1M30 A;  3UA7 A;  2AKL A;  1WI7 A;  2ECZ A;  1X69 A;  2M0Y A;  1G2B A;  1KSW A;  1SPK A;  1U3O A;  1WIE A;  1H8K A;  1JU5 C;  2A36 A;  2KBT A;  2DNU A;  4AFZ C;  2RF0 A;  2K2M A;  3CQT A;  2O31 A;  3O5Z A;  2FO0 A;  2K3B A;  2CT4 A;  1UJY A;  2FPE A;  2GTO A;  2RQV A;  3NPF A;  2DL5 A;  3UF4 A;  4HXJ A;  2HEQ A;  2FRY A;  3JV3 A;  4Z89 A;  1NYF A;  4RUG A;  2DRK A;  5L23 A;  1UJ0 A;  2KE9 A;  1HD3 A;  2RQW A;  3M0Q A;  1OV3 A;  1UFF A;  2JT4 A;  2X3X D;  2GBQ A;  3LH5 A;  2YUQ A;  2L3S A;  2P4R A;  1Z9Q A;  4J9C A;  1WA7 A;  1VYU A;  4IIO A;  1SEM A;  1VYT A;  1I1J A;  3IQL A;  3RNJ A;  1PKT A;  2EYY A;  2C0I A;  2A08 A;  1WFW A;  2O88 A;  1QKX A;  2ESW A;  2CUD A;  1BB9 A;  1UDL A;  4ORZ A;  3VS0 A;  2FPD A;  2VWF A;  4Z88 A;  4LNP A;  1UTI A;  1WXU A;  1W70 A;  2BZY A;  4EIK A;  1HJD A;  2GGR A;  2HDA A;  2KYM A;  1HSQ A;  1AVZ C;  4D8K A;  1FYN A;  2ABL A;  1AWJ A;  4Z8A A;  2JS0 A;  2NWM A;  2J7I A;  1SSH A;  1J3T A;  3VS5 A;  2V1R A;  3M0R A;  4JPB W;  1TG0 A;  1YWP A;  5FWC A;  2O2O A;  3VS1 A;  1AEY A;  2DM1 A;  1CKB A;  2J06 A;  1GL5 A;  2CH4 W;  2FG0 A;  1X27 A;  2KRO A;  2H8H A;  1GBQ A;  1QKW A;  1U5S A;  2F2W A;  2DL7 A;  4J9G A;  1K1Z A;  2O9V A;  1WLP B;  1WXB A;  2K7A A;  2AZV A;  2YT6 A;  4JZ4 A;  4CC3 A;  2J6O A;  1ZSG A;  2JW4 A;  2E5K A;  3U23 A;  4J9B A;  1M3B A;  2JXB A;  4F17 A;  4OMP A;  4AFU C;  2EW3 A;  1OEB A;  1GFC A;  1ARK A;  4OML A;  2KRS A;  2KXC A;  2L3P A;  4CC4 B;  5I11 A;  4CC2 A;  5I22 A;  4AFS C;  3I5S A;  2JMA A;  4AG2 C;  3TSZ A;  1VA7 A;  2HSP A;  2KGT A;  2L3Q A;  2G6F X;  3NMZ C;  1YNZ A;  4K11 A;  1AD5 A;  2BZX A;  3VS6 A;  2F2V A;  4CC7 A;  1U06 A;  2LJ1 A;  1GFD A;  2EYW A;  1EFN A;  2LQN A;  1GRI A;  1X2Q A;  2EVR A;  4RTW A;  2CDT A;  5IHK A;  4HVW A;  2ENM A;  2A37 A;  3M0T A;  2D0N A;  2PNI A;  1E7O A;  2DF6 A;  2MOX A;  1K76 A;  1X43 A;  2SRC A;  2SEM A;  1E6H A;  1ABO A; 
#chains in the Genus database with same CATH topology
 3V7R A;  4BY6 C;  1AWW A;  2X35 A;  3G6E T;  3FDR A;  3ZL7 C;  5D6W A;  1PD1 A;  2CRE A;  3CBM A;  3KUF A;  1ZX6 A;  2RHZ A;  3L42 A;  5CCA A;  3EHR A;  2LQW A;  2EGE A;  1YIT T;  1U1T A;  5LJ3 e;  4CRI A;  2C06 A;  2HQE A;  4PL6 A;  1PHT A;  4B9W A;  2D9T A;  4FYX B;  1PD0 A;  2CZ7 B;  1T3L A;  4ZTJ A;  2CP2 A;  1XJW B;  2K5L A;  5GAM e;  2NUP A;  3OYI A;  2XI9 A;  1N8R R;  2EGC A;  4AFQ C;  4M7A F;  3CC7 A;  1YJW Q;  1AOJ A;  1YIJ Q;  2GTJ A;  1SKU B;  2DMO A;  2P4T A;  4HCZ A;  4OGC A;  2AT1 B;  1G83 A;  3JCM X;  4QT7 A;  4M78 E;  1VQL T;  4R56 A;  2VYT A;  1NG2 A;  2NLU A;  5KH6 A;  1N5Z A;  1MMD A;  4ZGD B;  1OZ2 A;  1G3T A;  2HKN A;  5EC7 A;  2P0K A;  3M5A A;  3OSV A;  4JJD A;  1CSK A;  3CME A;  4XU1 A;  1HYO A;  1XNI A;  2D1X A;  4ELY C;  3N5B B;  2P84 A;  4NOY A;  4BAC A;  2DD5 A;  1IGQ A;  1YJW A;  2DPP B;  3CCV Q;  1ZHI A;  1PM3 A;  3CBP A;  1Q82 C;  5CVI A;  3LGL A;  1Y96 A;  3VS4 A;  1QWF A;  1PCX A;  2OTJ A;  2CSI A;  3CC2 A;  5A2Q E;  2EIF A;  1YJ9 T;  3I35 A;  3GBQ A;  3VRY A;  1RAI B;  1BI0 A;  4J83 A;  1RAA B;  2DIL A;  1UGV A;  2DVJ A;  4PJO C;  2E41 A;  1WHJ A;  4IUQ A;  3FJ5 A;  4M78 D;  2F5T X;  3I9Q A;  4CI0 C;  3M53 A;  3OW2 P;  3RER A;  1BI1 A;  4LDU A;  2X51 A;  4M75 A;  3EG1 A;  4R55 A;  1NBE B;  3EFS A;  3V8K A;  1WYX A;  4DQ2 A;  3CCR Q;  1W2B S;  3EFR A;  3M0P A;  3OYB A;  4DBF A;  4F16 A;  1SRL A;  2DL3 A;  4C8Q B;  5IXF A;  3JB9 F;  3G71 A;  4OB0 B;  2F1L A;  3M0U A;  2B8A A;  1PNJ A;  1IRE B;  1QVF S;  3CCS T;  3SWN A;  1H3Z A;  2EYZ A;  3G4S Q;  2MPX C;  2DEU A;  2VGM A;  4LE9 A;  5GJW B;  5LJ5 h;  1D09 B;  2RQR A;  1M5Q 1;  3SEM A;  5GAO m;  1SRM A;  1Q81 C;  1BBZ A;  3OS1 A;  1BYM A;  4ZGJ B;  4LDY A;  3PTA A;  2W10 A;  5C0M A;  2DO3 A;  3LYI A;  3BDU A;  1QWE A;  4DEX A;  2BUD A;  5KYX B;  2RH2 A;  3VS2 A;  2XDP A;  4OMO A;  4OMN A;  2QAZ A;  4NS5 A;  4M78 G;  5KYX A;  4A63 B;  2QQA A;  4M75 C;  2QXF A;  3GPL A;  4J9F A;  4C5H A;  2I0N A;  1WPY A;  2OAW A;  4DBR A;  5CKE A;  1YHQ T;  2LCC A;  2K4Y A;  3P8B B;  4J9E A;  1SHG A;  5GMK l;  2AHJ B;  3QYG B;  3EGD B;  1PRL C;  2E12 A;  2L5Q A;  2FRW A;  2HNI A;  3EGU A;  4QVD A;  1SHF A;  1FMW A;  1YJN A;  4FW1 A;  2KXD A;  2HBP A;  1V76 A;  3OYM A;  1K4U S;  4ZN1 A;  4J7F A;  1B34 A;  3MEA A;  3SWN C;  2CT3 A;  4C0D C;  1C0M A;  1Q82 U;  4C5I A;  1XTD A;  2YRD A;  2A7Y A;  1JJ2 P;  2XG8 D;  3EGX A;  1UGR B;  4RTZ A;  1QVF P;  2YUP A;  2LZ6 B;  4F7U B;  1LOJ A;  2IPO B;  1SG5 A;  1OQK A;  1PRM C;  1O9S A;  3OY9 A;  4M4Z A;  1GCP A;  2LNH B;  1TU0 B;  3O8V A;  4OF1 A;  1WJQ A;  1MV3 A;  4NL3 A;  1WHH A;  1R0C B;  4MML A;  2AZS A;  4J6W A;  2JTF A;  3LWI A;  2YSQ A;  4J9I A;  2PVD B;  4HVV A;  4JZ3 A;  2KRM A;  5FW9 A;  5KCO A;  4IUT A;  2LQ8 A;  2QI2 A;  3C4S A;  4BE2 A;  2NUP B;  3FB9 A;  3V7S A;  4FYV B;  2KEA A;  4JJC A;  3CCQ Q;  1D0Y A;  2NUT A;  2VAS A;  1W1F A;  1S72 T;  2AKL A;  1WJS A;  1WI7 A;  4X9D A;  3A8M B;  2M0Y A;  4NL2 A;  1SPK A;  5A0D A;  3PNW C;  3I56 A;  1RI0 A;  2KBT A;  1BIA A;  4XTX A;  3MHX A;  1U1S A;  2X4J A;  2K2M A;  3CCE T;  3O5Z A;  2P0Q A;  3MKD A;  5CKD A;  3CXC A;  4LDW A;  3UF4 A;  4HXJ A;  2FRY A;  3OMG A;  4IKF A;  1NYF A;  4RUG A;  5LJ3 g;  2DRK A;  1Q86 C;  4D6W A;  3A5Z B;  4E2F B;  1YJN T;  1IHW A;  4QVZ A;  4QW2 A;  2XID A;  1M4Z A;  1Z9Q A;  4PJO E;  1WA7 A;  2DXU A;  1OI1 A;  5EG2 A;  1SEM A;  2K3Y A;  1VYT A;  4O5V A;  1I1J A;  2HD0 A;  3CCU A;  2E5Q A;  1PKT A;  1S72 Q;  4XTW A;  2QTX A;  3VS0 A;  1D1A A;  2RHX A;  4Q5W A;  3A1P A;  2PVG B;  4EIK A;  2GGR A;  2KYM A;  1K8A C;  1PC0 A;  3AT1 B;  1AVZ C;  1AWJ A;  4DBQ A;  1ZSZ B;  2LQK A;  2NWM A;  3R6O A;  5GAO n;  2EJF A;  5FU7 C;  2RA2 A;  3MEV A;  4WTO B;  3VS1 A;  3CCQ T;  2EQU A;  1GL5 A;  2K57 A;  3WVD B;  2L89 A;  5FRM A;  5J3B A;  4ATO A;  5FU6 B;  4C8Q F;  1VQM T;  4M7D E;  2KRO A;  3RKY A;  3PT9 A;  3FEO A;  2DL7 A;  1K1Z A;  3LGF A;  3G1J A;  5LJ5 j;  1WXB A;  2K7A A;  2YT6 A;  4JZ4 A;  2QA4 T;  2J6O A;  2E5K A;  2QQR A;  1KQ1 A;  4JRI A;  5C6S A;  2OTJ T;  1ARK A;  1H64 1;  4IUV A;  1TOV A;  1OX8 A;  3LX7 A;  2FVU A;  4CC2 A;  2RK1 A;  5I22 A;  4RG8 A;  4C8Q A;  2XHC A;  2EJ9 A;  2ZGW A;  1QVG S;  2D6F A;  1VA7 A;  3OYL A;  2HSP A;  2FZK B;  2VUB A;  1VIE A;  3NTI A;  2PQW A;  1AD5 A;  1RAF B;  3MET A;  3SWN B;  3VUZ A;  2DFU A;  2EYQ A;  2LQN A;  4JDS A;  1VQO A;  4RTW A;  5IHK A;  1AHJ B;  3M0T A;  4A4F A;  3X26 B;  3JCM g;  1NPP A;  3MP8 A;  3QDR B;  2LC4 A;  2FB7 A;  1BI3 A;  1KHI A;  2HSE B;  3T9N A;  2JZ2 A;  3C95 A;  3JCM e;  1B3Q A;  5D6Y A;  4E7L A;  2E10 A;  2J05 A;  2H3E B;  3HRS A;  3JB9 J;  2OI3 A;  4OMM A;  1N9S A;  4E7I A;  3UT1 A;  3OYD A;  1JXM A;  2Z0W A;  4PJO G;  5FRN A;  3R6N A;  1MMN A;  2E6Z A;  3UA6 A;  3CCU Q;  4M75 F;  2PU9 B;  1AWO A;  1YJW T;  3RBB B;  1RL2 A;  3RKW A;  1I81 A;  2VVK A;  5D7U A;  3I5R A;  1X6G A;  4JRK A;  1RAD B;  2EQK A;  2V1Q A;  2RJF A;  3ZBD A;  4X9C A;  2WSC E;  3LH0 A;  1JEG A;  4FT4 A;  3EH2 A;  4M77 A;  4N4H A;  1PSF A;  4LUE A;  3QDF A;  4XU3 A;  4J9H A;  3JB9 G;  1M27 C;  2JTM A;  3EFO A;  4RTY A;  3REB B;  1D1B A;  2MWO A;  2W0Z A;  3I56 Q;  1B34 B;  4HVU A;  2DJQ A;  3OYG A;  1ZA2 B;  2DXT A;  3SD4 A;  1BI2 A;  2HCK A;  3TSW A;  2CP5 A;  3L2R A;  2O4X B;  3VU3 C;  4E7Z A;  3CCQ A;  3SB2 A;  2LRQ A;  3H8Z A;  4KBM B;  3NTK A;  3X24 B;  3E9F A;  5CAI A;  4M7A B;  1QQJ A;  5IXB A;  3MCA B;  1UG1 A;  1BK2 A;  5I2M A;  2K9G A;  2RI2 A;  3VS7 A;  2QA4 Q;  1RAB B;  1K73 R;  1YP5 A;  3REA B;  4X1V A;  1FX7 A;  1I07 A;  2DBM A;  3RES A;  5GMK i;  5GAO l;  2KY9 A;  2FYK A;  1UE9 A;  2IG0 A;  1UEC A;  1M90 C;  1BIB A;  1LVK A;  1LCK A;  4N4G A;  4VUB A;  1JQQ A;  3OBY A;  5GAN 5;  2MF2 A;  3PVL A;  2VB6 A;  1VQL Q;  1K73 U;  3X20 B;  4Y92 A;  2DVE A;  3MO8 A;  2E4H A;  2DBK A;  4M77 C;  2AK5 A;  2B86 A;  3JB9 I;  1BKB A;  1LJO A;  2M1H A;  4JUV A;  3M55 A;  4X34 A;  3BFM A;  5GAN 4;  1G5V A;  2MK5 A;  3ULR B;  3OYC A;  2DAQ A;  2JUF A;  5CKH A;  4JRQ A;  1I0C A;  1WHG A;  2JM8 A;  2C0T A;  1QVP A;  3M0S A;  4OGE A;  3HKS A;  1F1B B;  4RCC A;  4C5E A;  1RLQ C;  4C8Q G;  1IRX A;  4JJB A;  1RI9 A;  1VQK T;  2D8J A;  1CKA A;  1OPL A;  2RB6 A;  2JOY A;  4FSS A;  1A0N B;  1M3C A;  1NLP C;  1X01 A;  3VS3 A;  3OYF A;  1VQ5 A;  4MDW A;  4BE1 A;  3GF5 A;  5GJV B;  1VQM A;  3V8L A;  4LD9 K;  2CUB A;  1VYV A;  3HL8 A;  4M78 C;  1JB0 E;  2ZZD A;  5GMK e;  4PNO A;  3SHW A;  4M75 D;  2RI3 A;  3LWH A;  1KJW A;  1UHC A;  2GNC A;  1M90 R;  1VQ7 Q;  3CCM A;  2RHI A;  3VYG A;  1G3Y A;  7AT1 B;  4M78 F;  4RTT A;  2BTT A;  2DZC A;  4PJO F;  2CZ6 B;  4C92 A;  1K73 C;  1RLP C;  3H0H A;  2E70 A;  1ZA1 B;  4XU0 A;  2F69 A;  2IVW A;  4M7A G;  2DTH A;  1Q7Y C;  3EG3 A;  2QDL A;  3CCS A;  4F7U E;  2RPN A;  2A28 A;  2L0A A;  4N0A A;  2HAX A;  1ZUY A;  2LT1 A;  4L6V 5;  1FMK A;  2RHY A;  3QJ6 A;  4M77 G;  2FL7 A;  2HL3 A;  2O9S A;  3H0I A;  3UWN A;  1VQO T;  2QGG A;  1YJ9 Q;  1R0B G;  1VQ8 Q;  2NUT B;  2ZPB B;  3CXC S;  2M16 A;  1RUW A;  3LW5 E;  4Y91 A;  2MAM A;  3MP6 A;  5GAN h;  3EG9 B;  4A53 A;  1YN8 A;  2CP7 A;  2JS2 A;  1OOT A;  1WGS A;  2QQ9 A;  2ZPH B;  4AMC A;  1UEB A;  2FHD A;  2KSS A;  2YWW A;  1JXO A;  3H0F A;  3URG A;  2MIO A;  5IH2 A;  1TUD A;  3CC2 Q;  1YWO A;  2LCL A;  5I21 A;  2QDY B;  3UAT A;  5ECA A;  1VUB A;  1MMA A;  1KFZ A;  1EZZ B;  1KIK A;  3E9G A;  1Q7Y U;  4C92 C;  2QK0 A;  4MZM A;  1UGP B;  1QP3 A;  3G4S A;  3CCU T;  2AKK A;  1RAH B;  3CME Q;  2LVM A;  1M30 A;  4QQD A;  3A8O B;  1G2B A;  1KSW A;  1U3O A;  1M1G A;  5KE3 A;  3CCV A;  2LT4 A;  4MZP A;  2PUO B;  3M9Q A;  1M2V B;  2HKQ B;  3MP1 A;  4P5N A;  3E2U A;  2BE9 B;  1NZ9 A;  1KC8 C;  2QEX Q;  3QII A;  2FPE A;  2RQV A;  5FU7 B;  3J80 E;  4Z89 A;  1HK9 A;  1Q82 R;  5L23 A;  1SSF A;  1YIT Q;  3G4S T;  1ZQ1 A;  1IB8 A;  5GAN f;  1OV3 A;  1VQ9 Q;  3PIO A;  2LTO A;  3DB3 A;  2DER A;  2COY A;  2P4R A;  3CCJ A;  1VQK A;  3CCJ Q;  3RNJ A;  4KUD K;  3HHT B;  3OYY A;  2C0I A;  2OX7 A;  2OTJ Q;  1UDL A;  2O4X A;  1I5O B;  4ORZ A;  2VWF A;  4Z88 A;  3AHU A;  2DTI A;  1D1C A;  1UTI A;  1WXU A;  2BZY A;  3LLR A;  1UGQ B;  1HSQ A;  4E7J A;  5GMK j;  5GAN 6;  1FYN A;  3M58 A;  4BI3 A;  3VUB A;  4ZN3 A;  2V1R A;  3M0R A;  4RG2 A;  2H3J A;  3GOX A;  1MNE A;  1AEY A;  2DM1 A;  3OS2 A;  1CKB A;  1YIT A;  1K8A U;  5A0G A;  2CH4 W;  4M7A A;  3JAM E;  4BB7 A;  4C92 F;  4J9G A;  2QQB A;  3M57 A;  2K5I A;  3OSS C;  3CMA Q;  1ZSG A;  4UC4 A;  3S3N A;  3JCM c;  2PVO B;  2QQS A;  3GNF B;  1M3B A;  2GQV A;  2JXB A;  2JNG A;  3RMQ A;  1GFC A;  3PIP A;  2XU8 A;  2L3P A;  4CC4 B;  1MND A;  4AFS C;  2R5M A;  1R77 A;  3QO3 A;  2E1H A;  4L5G A;  3X25 B;  4RKU E;  2L3Q A;  1YNZ A;  2X4W A;  1LNX A;  8ATC B;  3ER0 A;  4OMF B;  1B7T A;  2L8D A;  3G6E A;  2LJ1 A;  2VC8 A;  2EYW A;  2DXC A;  2EVR A;  4OB3 B;  4QQ6 A;  2D0N A;  2LDM A;  1E7O A;  2DF6 A;  4HA8 A;  2ZPE B;  2M02 A;  2R5A A;  2SEM A;  1WHM A;  2JVV A;  4KGZ B;  1ZBX A;  1ABO A;  3CPW A;  3CCS Q;  1Y0M A;  2PUK B;  3CCE Q;  3TEE A;  3CC2 T;  5LJ5 d;  1VQ8 A;  5GAM j;  3QHS A;  2EGA A;  1YJ9 A;  5LL6 S;  2XKO C;  4XK8 E;  2EKH A;  3EGX B;  3JSC A;  4XTU A;  4PJO D;  2RMO A;  2ED0 A;  3QYH B;  2FPF A;  1VQP A;  4C92 E;  1M1K C;  3CCR T;  4RTV A;  4GLM A;  4ZTF A;  2ZAE A;  4AG1 C;  3QWX X;  3EH1 A;  1ABQ A;  3HFN A;  4HT8 A;  2NUZ A;  3QXE B;  1SF9 A;  1KHC A;  3EG9 A;  1WQW A;  4F7U A;  3M56 A;  4AT1 B;  4BD3 A;  4EMH A;  4M7D A;  2DTO A;  4FM4 B;  2ZPI B;  3OB9 A;  3VYH B;  1VQL A;  2LX7 A;  4MZT A;  3E1S A;  2DX1 A;  3ZEH A;  2CH4 A;  5GAN 3;  3CCM Q;  1AT1 B;  2KT8 A;  3QUI A;  4KGX B;  1NEB A;  2JN0 A;  3PVQ A;  3VRZ A;  3CCL A;  1N8R U;  4LN2 A;  3C12 A;  2OJ2 A;  3JCM Q;  1VQN Q;  2RNA A;  3JB9 D;  1K0X A;  2L2P A;  1WZO A;  3TU4 K;  1VQ7 T;  4D8D A;  3EG0 A;  1AWX A;  5KCH A;  3S3M A;  1RAG B;  4KH1 B;  4RMO A;  1VOM A;  4GLK A;  1VQN A;  1WX6 A;  1M1K R;  1H3H A;  2DA9 A;  1N6A A;  4C92 D;  3NHN A;  4RTX A;  3DB4 A;  3L2Z A;  2ZPF B;  2KRN A;  2LJ3 A;  1JJ2 A;  1GCQ C;  1FMV A;  2FEI A;  1K8A R;  5KYN A;  1IXD A;  3CCL T;  2WSE E;  5IAY A;  5D6X A;  2D8H A;  9ATC B;  5KE2 A;  4M7A D;  4M75 G;  3M54 A;  4XTZ A;  4M7D C;  1QP2 A;  1WXT A;  1KC8 R;  3FC3 A;  4A54 A;  3KFV A;  2DXB A;  1KD1 U;  5LJ3 f;  4A4K A;  1ZLM A;  2DYI A;  3QWY A;  1M8M A;  2KMT A;  1OPK A;  5KYU B;  2OTL A;  2VXF A;  2V8J A;  1IO6 A;  3RR6 A;  4OMQ A;  5A0L A;  5IN1 A;  1JJ2 S;  3CXC P;  4FYY B;  3EHQ A;  2YUO A;  4C0G A;  5DM7 R;  2IIM A;  4XU2 A;  3M4Y A;  1KQ2 A;  4JRP A;  1X6B A;  2EYX A;  4XTV A;  2HQX A;  4E7H A;  3QSU A;  5CKF A;  5CKB A;  2P0P A;  2KI7 A;  3DLL A;  1D0X A;  4C92 G;  1KC8 U;  1IGU A;  1EX4 A;  2CS7 A;  4JLI A;  3J81 E;  1GCQ A;  4GBQ A;  5J39 A;  2XMF A;  3L2V A;  2DL8 A;  1X75 C;  3VJP A;  4DEY A;  1KD1 C;  3QJY A;  2X4X A;  4C0D B;  5CK9 A;  1HXD A;  1M90 U;  2PTK A;  4PJO B;  4A4E A;  3JCM d;  2MMP A;  2YLB A;  4J6Y A;  4RTU A;  2JTE A;  4TVR A;  4PJO A;  1TH7 A;  4KRT A;  3JB9 H;  3BDL A;  2K2V A;  4WCI A;  2Y4Y A;  3C94 A;  3I56 T;  4N4I A;  2XDD A;  2LNV A;  2C0O A;  2J6F A;  2EWN A;  2BE7 D;  2F5K A;  3CC4 Q;  4M77 E;  1UGS B;  2XDB A;  3CPW S;  3CCV T;  3MJX A;  2ZPG B;  5M9O A;  2EQI A;  5DLO A;  2M9U A;  2R57 A;  1JRI A;  2QYZ A;  5GAN 7;  1Z9Z A;  4DOW A;  1M9S A;  4RCB A;  4XTY A;  4FCY A;  5CQY A;  4DA4 A;  4M77 D;  1TUG B;  1FXX A;  4M75 E;  1QVF A;  3INZ A;  4E7S A;  2KR3 A;  1NJI C;  2MI6 A;  2RQT A;  4FYW B;  3MEW A;  1VQK Q;  2CSQ A;  1BU1 A;  2LJ0 A;  3FLG A;  3PFS A;  1E6G A;  4FT2 A;  2OAU A;  2KNB B;  3L2U A;  2RK2 A;  2DJZ A;  4E47 A;  4HCK A;  3C0C A;  1Q86 R;  1S1N A;  5LJ5 g;  1S72 A;  1MV0 B;  1VQP T;  2CP3 A;  1I8F A;  1QCO A;  1W2B P;  3CC4 A;  1YFN A;  4F14 A;  4BE0 A;  2X3W D;  3JCM P;  5GAO r;  4A4G A;  2QGF B;  4M77 B;  3V8J A;  3OW2 A;  1TTH B;  2LP5 A;  1KQS S;  4WF2 A;  1I5L A;  2QEX A;  4PJJ A;  4OB2 B;  5KYY A;  3CPF A;  1K9M C;  3L2Q A;  3UA7 A;  2HZY A;  4A4H A;  1X69 A;  3DLM A;  2EKO A;  1H8K A;  2CP0 A;  1JU5 C;  4YTL A;  3V7C A;  5GMK h;  4ELZ C;  2K3X A;  1K9M R;  4AFZ C;  4BUG A;  4M77 F;  3CQT A;  2FO0 A;  5GAN g;  2VXE A;  1VQ4 A;  3OYJ A;  4M7D G;  4BY6 B;  2RI5 A;  4Z02 A;  4BI8 B;  2BIV A;  4KUL A;  3OYN A;  4BDY A;  3E19 A;  3M0Q A;  2RQW A;  3J7A F;  1VQN T;  4OP0 A;  1M8V A;  2ZCF B;  1RAE B;  1UFF A;  2JT4 A;  2NYS A;  2RJD A;  4PLI A;  2GBQ A;  3KXT A;  2YUQ A;  2L3S A;  2COW A;  2MWP A;  2YRC A;  2X4Y A;  1MMG A;  3IQL A;  5GAN d;  1KQS A;  2EYY A;  4MDX A;  2A08 A;  2V26 A;  1QKX A;  1XQH A;  1W4S A;  1I4K 1;  1VQ9 T;  3OYE A;  2FPD A;  3GNG A;  2YHT A;  1W70 A;  4C8Q D;  2HDA A;  1UB4 A;  2XK0 A;  2KQW A;  1ZSZ C;  4E7K A;  4D8K A;  3H6Z A;  3H9N A;  2KDS A;  2JS0 A;  3OS0 A;  3BY7 A;  4HKE A;  2DZ9 A;  1LPL A;  1SSH A;  1J3T A;  3VS5 A;  4JPB W;  3TQ7 P;  5FWC A;  3CD6 Q;  5CR2 A;  1KQS P;  1WQ7 A;  2J06 A;  4FU6 A;  3X28 B;  1X27 A;  3QZ9 B;  3NTH A;  4XQ3 A;  4QKU A;  1R8O B;  2H8H A;  1QKW A;  1U5S A;  2WSF E;  2F2W A;  1YJN Q;  1WLP B;  4KT0 E;  4OVA A;  4BDZ A;  2AZV A;  3RIR A;  3RUX A;  1MHN A;  2JW4 A;  4JLG A;  2E65 A;  3TCJ A;  3U23 A;  4J9B A;  2CKK A;  3GP8 A;  1QW1 A;  4F17 A;  4OMP A;  1QCN A;  1OEB A;  4AFU C;  4J5Y A;  2KRS A;  4EDU A;  4PJL A;  3QZ5 B;  3JCM b;  5I11 A;  3S3O A;  3I5S A;  4AG2 C;  3TSZ A;  5LJ5 e;  2KVQ G;  1Y71 A;  2KAF A;  3CD6 T;  4QQG A;  4K11 A;  2A3L A;  5CO7 A;  4C92 B;  1ZSZ A;  4XAX B;  3MPU B;  2COZ A;  5DLQ E;  4CC7 A;  4IUR A;  3ME9 A;  3CBO A;  1GFD A;  2QAS A;  1EFN A;  1GRI A;  1X2Q A;  4PFP A;  3ZFJ A;  3KBG A;  2PNI A;  1N27 A;  4M7D B;  1Q95 G;  3CMA T;  1X43 A;  2SRC A;  3RMS A;  3BE3 A;  5GMK m;  1E6H A;  2CZ1 B;  2HMA A;  3PGG A;  3CC4 T;  1Q86 U;  1WDX A;  3M4G A;  4J8O A;  2PZ1 A;  5FRO A;  4JS4 A;  2ROT A;  2X9H A;  3THK A;  2RQU A;  4DOV A;  5LJ3 h;  1IHV A;  3CCR A;  2ATC B;  2RN8 A;  4LD6 A;  3A8H B;  2V8K A;  2K6D A;  4LDX A;  1K9A A;  5FWB A;  3CCM T;  3A8G B;  4C8Q C;  4FW2 A;  2DYB A;  3PE0 A;  3JCM W;  1OU9 A;  3GIB A;  2G3R A;  2QA4 A;  3PMI A;  1WHK A;  3ASK A;  2GQI A;  5HK3 A;  2KK4 A;  3L2W A;  5KYW B;  4KGV B;  4ANJ A;  2DRM A;  5GAO q;  1JBM A;  2DIQ A;  5HKC A;  2WAC A;  3HRT A;  1H92 A;  3CC7 T;  2CGH A;  3TVT A;  4HCB A;  5LJ3 d;  2RJE A;  4PJM A;  2DD4 A;  2EQM A;  1V29 B;  1KG1 A;  3A98 A;  4PKC C;  1YIJ T;  4PFO A;  2J6K A;  1VIF A;  4QVC A;  4M78 B;  1V1C A;  2DEQ A;  3PMT A;  5KYY B;  1B07 A;  3NGP A;  4Y28 E;  5GAM d;  1VQ4 Q;  4ESR A;  3CD6 A;  1BCO A;  1M2O A;  1AZE A;  5IHN A;  1PKS A;  2BKD N;  2O01 E;  2EPD A;  2MYS A;  2JM9 A;  2GF7 A;  5HY6 A;  4EMK B;  3G71 Q;  2M51 A;  1OX9 A;  3DKM A;  2KYB A;  1JO8 A;  2XIC A;  3OYH A;  2HBW A;  1YIJ A;  5KYU A;  1Y96 B;  3L1A A;  1DJ7 B;  1MUZ A;  2EBP A;  1ZBJ A;  4ZNX A;  1Q81 U;  3CC7 Q;  3OMC A;  4IIM A;  3QPH A;  2VV5 A;  3OW2 S;  3JCM h;  3NFC A;  3FRN A;  1TSF A;  2GFU A;  5FU6 C;  4LUD A;  1QVG A;  3OYK A;  1G8X A;  3HP9 A;  2HL5 C;  1YI2 T;  1QCF A;  3UPU A;  4F04 B;  2JMC A;  4M7A E;  1VQ9 A;  3S6W A;  1KK7 A;  3WVE B;  2K79 A;  1VQ8 T;  1ZUK A;  1NM7 A;  2Y90 A;  4E6R A;  5I2S A;  1VQO Q;  3CEY A;  2YLC A;  5IHI A;  3QG1 A;  2EAY A;  4N0A C;  1PWT A;  4C0Z A;  1PSE A;  3JCM V;  2AIR B;  1UHF A;  3P8H A;  2DL4 A;  3BW1 A;  1IZ6 A;  2LMJ A;  2LCS A;  2EQJ A;  1TUC A;  4O6J A;  1ZUU A;  4JJN K;  2YXY A;  1AZG B;  2BZ8 A;  2ROL A;  1QMC A;  4HCC A;  1U8R A;  1XOV A;  3HFO A;  1NEG A;  4FL6 A;  1T0J A;  1FWZ A;  1YCY A;  2EFI A;  5HCK A;  1T0H A;  1K0S A;  1W6X A;  4J7I A;  1W2B A;  1NLO C;  2YUN A;  4V2S A;  2KT1 A;  5GAO p;  4B9X A;  3VV0 A;  4FIB A;  3HPW A;  5GAN 8;  3G7Z A;  4PLL A;  5L8R E;  3OQ5 A;  3WXM B;  1NE8 A;  1QLY A;  1OYX A;  2R58 A;  1D3B B;  1M3A A;  2VKN A;  2ED1 A;  4J9D A;  4FSX A;  1NJI U;  4KH0 B;  3MEU A;  1MGQ A;  2MCN A;  2L3R A;  3OS5 A;  3H41 A;  3EG2 A;  1YCS B;  2I2L A;  2E3H A;  3JCM J;  3HSB A;  4C8Q E;  3EGD A;  2QEX T;  1N8R C;  1C1A A;  1TWB A;  2VGN A;  2RHU A;  3OBW A;  5GAN e;  1T3S A;  5LJ3 j;  4R0K A;  6AT1 B;  3QBY A;  3OYA A;  2JJ9 A;  2OTL Q;  1TXQ A;  4J6X A;  1YI2 A;  2F2X A;  5AT1 B;  3Q1J A;  2GFA A;  2K5F A;  3RDV A;  2DET A;  3P8D A;  1GBR A;  1NYG A;  4M78 A;  2DK3 A;  3JRZ A;  4PJN A;  1VQ6 Q;  1Y57 A;  3FJP A;  3RKX A;  4II1 A;  2DLP A;  5GAM f;  5LJ5 f;  3QKJ A;  1UUE A;  2RJC A;  1RAC B;  1VQ5 T;  1C6V X;  1VQ7 A;  2YDL A;  3HTR A;  1K9M U;  3D7S B;  2DE0 X;  2QG9 B;  3I55 Q;  1OZ3 A;  1X2K A;  1YHQ A;  3CCJ T;  3I55 T;  2ECZ A;  1BCM A;  4L59 A;  1VQM Q;  1Q7Y R;  1WIE A;  1EIF A;  1OU8 A;  1VQ5 Q;  2A36 A;  4F7U G;  2DNU A;  2Y4X A;  5GAN 2;  4ZGE B;  2FZG B;  5DY9 A;  2RF0 A;  2M0O A;  1M1K U;  2O31 A;  1M1F A;  2K3B A;  1G3S A;  2CT4 A;  1UJY A;  1WHL A;  3GLX A;  4M7A C;  3F70 A;  2GTO A;  1G3W A;  4M7D F;  3NPF A;  4M75 B;  2DL5 A;  1VQ6 T;  2LX9 A;  4EMK C;  2HEQ A;  1X6O A;  2D0Q B;  3JV3 A;  8AT1 B;  1P92 A;  4PFZ A;  1UJ0 A;  1D0Z A;  2KE9 A;  1HD3 A;  1NPR A;  1YHQ Q;  4LXC A;  3VKI A;  2OTL T;  3I55 A;  2E64 A;  2X3X D;  3LH5 A;  5GAM g;  4J9C A;  1O75 A;  2YRV A;  5KYW A;  1VYU A;  4OB1 B;  3HRU A;  4IIO A;  3SDZ A;  1N9R A;  4LDV A;  5FLX E;  4MMK A;  1WFW A;  3A8L B;  3FIF A;  2O88 A;  1YBY A;  1VQP Q;  2ESW A;  2CUD A;  1BB9 A;  1Y7X A;  2CP6 A;  4LNP A;  3TRE A;  4JS5 A;  3G71 T;  5J26 A;  1HJD A;  1ACM B;  1PG5 B;  4BI4 A;  3OA6 A;  1GXI E;  3CCE A;  1TS9 A;  2ABL A;  2A0F B;  4Z8A A;  5HK0 A;  1M2V A;  2J7I A;  4F7U F;  2FZC B;  2E6N A;  1VQ4 T;  1TG0 A;  1YWP A;  2DIG A;  3CME T;  2O2O A;  4KUI A;  3UDC A;  4EMG A;  2CYZ B;  4C5G A;  5AYF A;  5IT9 E;  2FG0 A;  1KD1 R;  1NJI R;  4EMK A;  1GBQ A;  3M59 A;  2EJG A;  2O9V A;  4B6M A;  2E3I A;  3CCL Q;  4PK4 A;  4CC3 A;  4GY5 A;  1WJR A;  3G6E Q;  2QTV A;  5CIU A;  4C0F A;  2EW3 A;  4OML A;  5GAN j;  5CQX A;  2KXC A;  2CZ0 B;  1OUL A;  1VQ6 A;  2JMA A;  3EAE A;  2KGT A;  2DKG A;  4DBH A;  4M7D D;  2G6F X;  3NMZ C;  4IUU A;  2BZX A;  3VS6 A;  4HT9 A;  2F2V A;  4IUP A;  1U06 A;  1YI2 Q;  3SFM A;  4ME7 A;  2RM4 A;  1Y07 A;  1WNL A;  3CPW P;  2RD1 A;  3JCM f;  2CDT A;  4HVW A;  2ENM A;  2A37 A;  3CMA A;  1QVG P;  1Q81 R;  2MOX A;  1K76 A;  2RO0 A;  1D3B A;  4EPC A;  2GCX A;  3EFO B;  2HQH A;  2V8I A;  2XD0 A;  5GAM h; 
#chains in the Genus database with same CATH homology
 1Y0M A;  1AWW A;  1WDX A;  3ZL7 C;  2PZ1 A;  2ROT A;  1B3Q A;  2CRE A;  2EGA A;  3THK A;  2J05 A;  2EKH A;  2RQU A;  1ZX6 A;  2OI3 A;  2RMO A;  4OMM A;  2ED0 A;  1JXM A;  3R6N A;  2FPF A;  3EHR A;  2RN8 A;  3UA6 A;  2LQW A;  2EGE A;  4RTV A;  4GLM A;  2K6D A;  4AG1 C;  3QWX X;  1PHT A;  1K9A A;  5FWB A;  1AWO A;  1ABQ A;  2NUZ A;  3RBB B;  1T3L A;  2VVK A;  2DYB A;  3PE0 A;  2LX7 A;  2GQI A;  3I5R A;  2EGC A;  4AFQ C;  2DX1 A;  1X6G A;  2CH4 A;  2DRM A;  2V1Q A;  1H92 A;  1AOJ A;  2KT8 A;  1NEB A;  2GTJ A;  3TVT A;  1JEG A;  2DMO A;  3PVQ A;  4LUE A;  3VRZ A;  4LN2 A;  4J9H A;  1G83 A;  2OJ2 A;  1M27 C;  4QT7 A;  4RTY A;  3REB B;  2RNA A;  2W0Z A;  1NG2 A;  3A98 A;  2L2P A;  1K0X A;  1N5Z A;  2J6K A;  4HVU A;  2DJQ A;  4D8D A;  1V1C A;  1AWX A;  3EG0 A;  1B07 A;  3NGP A;  5EC7 A;  1WX6 A;  2HCK A;  4JJD A;  3TSW A;  2DA9 A;  1CSK A;  1H3H A;  3NHN A;  4RTX A;  4ESR A;  2D1X A;  1AZE A;  5IHN A;  1PKS A;  2KRN A;  2LJ3 A;  1GCQ C;  2EPD A;  2FEI A;  2JM9 A;  5IXB A;  1UG1 A;  1BK2 A;  2M51 A;  2K9G A;  3VS7 A;  3VS4 A;  1YP5 A;  1QWF A;  3REA B;  2KYB A;  4X1V A;  2D8H A;  1I07 A;  1JO8 A;  2DBM A;  2CSI A;  1WXT A;  1UE9 A;  2HBW A;  2EBP A;  1MUZ A;  1ZBJ A;  1UEC A;  3KFV A;  3I35 A;  3GBQ A;  4ZNX A;  3VRY A;  4IIM A;  1LCK A;  1JQQ A;  2DIL A;  1UGV A;  1ZLM A;  3PVL A;  3QWY A;  2DVJ A;  1M8M A;  1OPK A;  4Y92 A;  3FJ5 A;  3I9Q A;  1IO6 A;  4OMQ A;  2DBK A;  2AK5 A;  2B86 A;  3EG1 A;  3EHQ A;  2YUO A;  4LUD A;  2IIM A;  3ULR B;  1WYX A;  1I0C A;  1QCF A;  1X6B A;  2EYX A;  2JM8 A;  3M0P A;  2C0T A;  2JMC A;  4F16 A;  2K79 A;  1SRL A;  2DL3 A;  1ZUK A;  3M0S A;  1NM7 A;  5IXF A;  4E6R A;  1RLQ C;  3M0U A;  5IHI A;  4JJB A;  1RI9 A;  1GCQ A;  4GBQ A;  2D8J A;  1CKA A;  1PWT A;  1PNJ A;  2XMF A;  1OPL A;  1UHF A;  2DL8 A;  2DL4 A;  2LMJ A;  4FSS A;  2LCS A;  2EYZ A;  4DEY A;  1A0N B;  1TUC A;  1ZUU A;  4LE9 A;  1M3C A;  1AZG B;  1NLP C;  2BZ8 A;  5GJW B;  2ROL A;  3VS3 A;  2RQR A;  1XOV A;  3SEM A;  2PTK A;  1SRM A;  1NEG A;  1BBZ A;  1T0J A;  5GJV B;  2W10 A;  2CUB A;  1VYV A;  5HCK A;  1T0H A;  4RTU A;  1W6X A;  1K0S A;  1QWE A;  1NLO C;  2JTE A;  2YUN A;  4DEX A;  3VS2 A;  4KRT A;  4OMO A;  2KT1 A;  3SHW A;  4OMN A;  1KJW A;  4WCI A;  1UHC A;  2GNC A;  4A63 B;  2C0O A;  2J6F A;  4J9F A;  1QLY A;  2I0N A;  2OAW A;  4RTT A;  2BTT A;  1M3A A;  4J9E A;  1SHG A;  1RLP C;  3H0H A;  2VKN A;  2ED1 A;  1PRL C;  4J9D A;  3EGU A;  2FRW A;  2EQI A;  2MCN A;  1SHF A;  1Z9Z A;  3EG2 A;  1YCS B;  3EG3 A;  3H41 A;  2KXD A;  2QDL A;  2RPN A;  2A28 A;  2L0A A;  1K4U S;  1ZUY A;  1FMK A;  2CT3 A;  2O9S A;  3H0I A;  1T3S A;  2KR3 A;  4R0K A;  1RUW A;  2F2X A;  2RQT A;  1YN8 A;  2JS2 A;  1OOT A;  4RTZ A;  2CSQ A;  2YUP A;  1BU1 A;  1NYG A;  2LZ6 B;  2LJ0 A;  1GBR A;  1E6G A;  1JXO A;  3H0F A;  2MIO A;  5IH2 A;  1TUD A;  1Y57 A;  1PRM C;  1YWO A;  2KNB B;  4M4Z A;  1GCP A;  2LNH B;  4HCK A;  3C0C A;  2DLP A;  3UAT A;  1MV3 A;  1S1N A;  5ECA A;  1MV0 B;  2AZS A;  1KFZ A;  1UUE A;  2YSQ A;  4J9I A;  4HVV A;  4F14 A;  2X3W D;  4JZ3 A;  2KRM A;  5FW9 A;  1KIK A;  2YDL A;  2LP5 A;  2DE0 X;  2KEA A;  4JJC A;  2AKK A;  1X2K A;  1W1F A;  1M30 A;  3UA7 A;  2AKL A;  1WI7 A;  2ECZ A;  1X69 A;  2M0Y A;  1G2B A;  1KSW A;  1SPK A;  1U3O A;  1WIE A;  1H8K A;  1JU5 C;  2A36 A;  2KBT A;  2DNU A;  4AFZ C;  2RF0 A;  2K2M A;  3CQT A;  2O31 A;  3O5Z A;  2FO0 A;  2K3B A;  2CT4 A;  1UJY A;  2FPE A;  2GTO A;  2RQV A;  3NPF A;  2DL5 A;  3UF4 A;  4HXJ A;  2HEQ A;  2FRY A;  3JV3 A;  4Z89 A;  1NYF A;  4RUG A;  2DRK A;  5L23 A;  1UJ0 A;  2KE9 A;  1HD3 A;  2RQW A;  3M0Q A;  1OV3 A;  1UFF A;  2JT4 A;  2X3X D;  2GBQ A;  3LH5 A;  2YUQ A;  2L3S A;  2P4R A;  1Z9Q A;  4J9C A;  1WA7 A;  1VYU A;  4IIO A;  1SEM A;  1VYT A;  1I1J A;  3IQL A;  3RNJ A;  1PKT A;  2EYY A;  2C0I A;  2A08 A;  1WFW A;  2O88 A;  1QKX A;  2ESW A;  2CUD A;  1BB9 A;  1UDL A;  4ORZ A;  3VS0 A;  2FPD A;  2VWF A;  4Z88 A;  4LNP A;  1UTI A;  1WXU A;  1W70 A;  2BZY A;  4EIK A;  1HJD A;  2GGR A;  2HDA A;  2KYM A;  1HSQ A;  1AVZ C;  4D8K A;  1FYN A;  2ABL A;  1AWJ A;  4Z8A A;  2JS0 A;  2NWM A;  2J7I A;  1SSH A;  1J3T A;  3VS5 A;  2V1R A;  3M0R A;  4JPB W;  1TG0 A;  1YWP A;  5FWC A;  2O2O A;  3VS1 A;  1AEY A;  2DM1 A;  1CKB A;  2J06 A;  1GL5 A;  2CH4 W;  2FG0 A;  1X27 A;  2KRO A;  2H8H A;  1GBQ A;  1QKW A;  1U5S A;  2F2W A;  2DL7 A;  4J9G A;  1K1Z A;  2O9V A;  1WLP B;  1WXB A;  2K7A A;  2AZV A;  2YT6 A;  4JZ4 A;  4CC3 A;  2J6O A;  1ZSG A;  2JW4 A;  2E5K A;  3U23 A;  4J9B A;  1M3B A;  2JXB A;  4F17 A;  4OMP A;  4AFU C;  2EW3 A;  1OEB A;  1GFC A;  1ARK A;  4OML A;  2KRS A;  2KXC A;  2L3P A;  4CC4 B;  5I11 A;  4CC2 A;  5I22 A;  4AFS C;  3I5S A;  2JMA A;  4AG2 C;  3TSZ A;  1VA7 A;  2HSP A;  2KGT A;  2L3Q A;  2G6F X;  3NMZ C;  1YNZ A;  4K11 A;  1AD5 A;  2BZX A;  3VS6 A;  2F2V A;  4CC7 A;  1U06 A;  2LJ1 A;  1GFD A;  2EYW A;  1EFN A;  2LQN A;  1GRI A;  1X2Q A;  2EVR A;  4RTW A;  2CDT A;  5IHK A;  4HVW A;  2ENM A;  2A37 A;  3M0T A;  2D0N A;  2PNI A;  1E7O A;  2DF6 A;  2MOX A;  1K76 A;  1X43 A;  2SRC A;  2SEM A;  1E6H A;  1ABO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...