4HVYA

A thermostable variant of human nudt18 nudix domain obtained by hot colony filtration
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
134
Chain Sequence
b'RKNVCYMVLAVFLSEQDEVLLIQEAKRECRGSWYLPAGRMEPGETIVEALQRVVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAHDILHLVLAAQYRQQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate-linked moiety X motif 18
publication title Engineering protein thermostability using a generic activity-independent biophysical screen inside the cell.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 35
structure length 134
sequence length 135
ec nomenclature ec 3.6.1.58: 8-oxo-dGDP phosphatase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4hvyA00
4ILQA 3X0NA 1PPXA 2Q9PA 1VK6A 2QJOA 1JKNA 1XSAA 3RH7A 5C7TA 3BM4A 1G9QA 4ICKA 3ZR0A 1JRKA 5GHQA 5DD4A 3G0QA 3GZ5A 1R67A 3N9UA 1PVFA 3EEUA 5FSKA 1QVJA 1GA7A 2O1CA 5ANWA 5ANSA 4ZG0A 1TUMA 5GHOA 5IW4A 4JZVA 2QKMB 4S2WA 4S2YA 1V8SA 1V8WA 3X0JA 1NQZA 1K2EA 2DUKA 3SONA 3A6VA 1SU2A 3A6UA 5HZXA 1RYAA 1X51A 5BONA 3O8SA 5GHPA 2A8PA 3BAPA 3X0LA 3A6SA 2I8UA 2FKBA 1V8RA 4YOQA 3MGMA 4K6EA 1V8MA 5ANTA 5GHNA 2YVOA 5C7QA 1MQWA 1HX3A 4NFXA 3X0QA 3Q93A 5GHMA 3GRNA 4V14A 3N77A 1V8UA 5ANVA 3I9XA 4HFQA 3DKUA 1V8VA 3CNGA 3BHOA 5I8UA 2A8QA 1X83A 1V8IA 3EF5A 3O52A 1Q54A 4DYWA 3Q1PA 3Q91A 1VCDA 2RRKA 5C8LA 3J7Ye 1NFZA 3HHJA 3COUA 1VHGA 1KTGA 3Q2SA 3A6TA 1MUTA 3DUPA 4MPOA 2A8RA 3MDIA 3EESA 3L85A 3QSJA 1RRQA 4KTBA 4S2VA 3U53A 1NFSA 1VRLA 1I9AA 3AC9A 3X0RA 1PPWA 3E57A 3FK9A 3GZ6A 1PUNA 3P6YA 2A8SA 3F6AA 3FCMA 1VHZA 3O6ZA 2G74A 2G73A 4C9WA 3I7UA 1NQYA 4JZSA 4JZTA 2B0VA 2JVBA 3X0PA 2GT2A 3ZR1A 1PUSA 3X0MA 2DSCA 5FSIA 2A6TA 2VNQA 3MCFA 3SHDA 3ID9A 1V8NA 1MK1A 1MR2A 1U20A 2AZWA 1MQEA 1K26A 2I6KA 2ICKA 2O5WA 2YVPA 3R03A 2VNPA 4KYXA 1X84A 3KVHA 5CFIA 3X0KA 3I7VA 3X0IA 4HVYA 3GZ8A 1VC9A 3X0OA 2W4EA 4KG4A 2PQVA 2DSDA 2GT4A 1HZTA 1MP2A 2FMLA 1VIQA 5DDGA 3O61A 2B06A 2ICJA 4N1TA 4NFWA 3GWYA 5IW5A 1SOIA 3Q2TA 3GG6A 1OW2A 4JZUA 1SZ3A 1XSBA 2I8TA 1PUQA 2KDVA 5LPGA 2GB5A 2A8TA 4N1UA 3OGAA 2YYHA 3HYQA 3ACAA 1V8YA 1V8TA 1RRSA 5DPKA 2YVNA 2B2KA 2KDWA 1SJYA 2XSQA 5FSNA 5FSLA 1Q33A 3FFUA 4C9XA 4S2XA 3H95A 2O5FA 2QJTA 2R5WA 3SMDA 1VC8A 4IJXA 3WHWA 1Q27A 3Q4IA 4KG3A 3X0SA 2YVMA 3FSPA 3FJYA 1VIUA 1XSCA 5ISYA 1KHZA 1IRYA 5GHJA 2PNYA 1KT9A 3P5TA 4YPRA 5CFJA 2J8QA 5GHIA 1G0SA 5FSMA 2DSBA 5DEQA 5FSOA 4YPHA 1PPVA 2DHOA 2FVVA 5ANUA 3MDGA 1F3YA 3O69A 5BS6A 1V8LA 2CL3A 3EXQA 3F13A
chains in the Genus database with same CATH superfamily
4ILQA 3X0NA 1PPXA 2Q9PA 1VK6A 2QJOA 1JKNA 1XSAA 3RH7A 5C7TA 3BM4A 1G9QA 4ICKA 3ZR0A 1JRKA 5GHQA 5DD4A 3G0QA 3GZ5A 1R67A 3N9UA 1PVFA 3EEUA 5FSKA 1QVJA 1GA7A 2O1CA 5ANWA 5ANSA 4ZG0A 1TUMA 5GHOA 5IW4A 4JZVA 2QKMB 4S2WA 4S2YA 1V8SA 1V8WA 3X0JA 1NQZA 1K2EA 2DUKA 3SONA 3A6VA 1SU2A 3A6UA 5HZXA 1RYAA 1X51A 5BONA 3O8SA 5GHPA 2A8PA 3BAPA 3X0LA 3A6SA 2I8UA 2FKBA 1V8RA 4YOQA 3MGMA 4K6EA 1V8MA 2CZRA 5ANTA 5GHNA 2YVOA 5C7QA 1MQWA 1HX3A 4NFXA 3X0QA 3Q93A 5GHMA 3GRNA 4V14A 3N77A 1V8UA 5ANVA 3I9XA 4HFQA 3DKUA 1V8VA 3CNGA 3BHOA 5I8UA 2A8QA 1X83A 1V8IA 3EF5A 3O52A 1Q54A 4DYWA 3Q1PA 3Q91A 1VCDA 2RRKA 5C8LA 3J7Ye 1NFZA 3HHJA 3COUA 1VHGA 1KTGA 3Q2SA 3A6TA 1MUTA 3DUPA 4MPOA 2A8RA 3MDIA 3EESA 3L85A 3QSJA 1RRQA 4KTBA 4S2VA 3U53A 1NFSA 1VRLA 1I9AA 3AC9A 3X0RA 1PPWA 3E57A 3FK9A 3GZ6A 1PUNA 3P6YA 2A8SA 3F6AA 3FCMA 1VHZA 3O6ZA 2G74A 2G73A 4C9WA 3I7UA 1NQYA 4JZSA 4JZTA 2B0VA 2JVBA 3X0PA 2GT2A 3ZR1A 1PUSA 3X0MA 2DSCA 5FSIA 2A6TA 2VNQA 3MCFA 3SHDA 3ID9A 1V8NA 1MK1A 1MR2A 1U20A 2AZWA 1MQEA 1K26A 2I6KA 2ICKA 2O5WA 2YVPA 3R03A 2VNPA 4KYXA 1X84A 3KVHA 5CFIA 3X0KA 3I7VA 3X0IA 4HVYA 3GZ8A 1VC9A 3X0OA 2W4EA 4KG4A 2PQVA 2DSDA 2GT4A 1HZTA 1MP2A 2FMLA 1VIQA 5DDGA 3O61A 2B06A 2ICJA 4N1TA 4NFWA 3GWYA 5IW5A 1SOIA 3Q2TA 3GG6A 1OW2A 4JZUA 1SZ3A 1XSBA 2I8TA 1PUQA 2KDVA 5LPGA 2GB5A 2A8TA 4N1UA 3OGAA 2YYHA 3HYQA 3ACAA 1V8YA 1V8TA 1RRSA 5DPKA 2YVNA 2B2KA 2KDWA 1SJYA 2XSQA 5FSNA 5FSLA 1Q33A 3FFUA 4C9XA 4S2XA 3H95A 2O5FA 2QJTA 2R5WA 3SMDA 1VC8A 4IJXA 3WHWA 1Q27A 3Q4IA 4KG3A 3X0SA 2YVMA 3FSPA 3FJYA 1VIUA 1XSCA 5ISYA 1KHZA 1IRYA 5GHJA 2PNYA 1KT9A 3P5TA 4YPRA 5CFJA 2J8QA 5GHIA 1G0SA 5FSMA 2DSBA 5DEQA 4J7GA 5FSOA 4YPHA 1PPVA 2DHOA 2FVVA 5ANUA 3MDGA 4J7HA 1F3YA 3O69A 5BS6A 1V8LA 2CL3A 3EXQA 3F13A
chains in the Genus database with same CATH topology
4ILQA 3X0NA 1PPXA 2Q9PA 1VK6A 2QJOA 1JKNA 1XSAA 3RH7A 5C7TA 3BM4A 1G9QA 4ICKA 3ZR0A 1JRKA 5GHQA 5DD4A 3G0QA 3GZ5A 1R67A 3N9UA 1PVFA 3EEUA 5FSKA 1QVJA 1GA7A 2O1CA 5ANWA 5ANSA 4ZG0A 1TUMA 5GHOA 5IW4A 4JZVA 2QKMB 4S2WA 4S2YA 1V8SA 1V8WA 3X0JA 1NQZA 1K2EA 2DUKA 3SONA 3A6VA 1SU2A 3A6UA 5HZXA 1RYAA 1X51A 5BONA 3O8SA 5GHPA 2A8PA 3BAPA 3X0LA 3A6SA 2I8UA 2FKBA 1V8RA 4YOQA 3MGMA 4K6EA 1V8MA 2CZRA 5ANTA 5GHNA 2YVOA 5C7QA 1MQWA 1HX3A 4NFXA 3X0QA 3Q93A 5GHMA 3GRNA 4V14A 3N77A 1V8UA 5ANVA 3I9XA 4HFQA 3DKUA 1V8VA 3CNGA 3BHOA 5I8UA 2A8QA 1X83A 1V8IA 3EF5A 3O52A 1Q54A 4DYWA 3Q1PA 3Q91A 1VCDA 2RRKA 5C8LA 3J7Ye 1NFZA 3HHJA 3COUA 1VHGA 1KTGA 3Q2SA 3A6TA 1MUTA 3DUPA 4MPOA 2A8RA 3MDIA 3EESA 3L85A 3QSJA 1RRQA 4KTBA 4S2VA 3U53A 1NFSA 1VRLA 1I9AA 3AC9A 3X0RA 1PPWA 3E57A 3FK9A 3GZ6A 1PUNA 3P6YA 2A8SA 3F6AA 3FCMA 1VHZA 3O6ZA 2G74A 2G73A 4C9WA 3I7UA 1NQYA 4JZSA 4JZTA 2B0VA 2JVBA 3X0PA 2GT2A 3ZR1A 1PUSA 3X0MA 2DSCA 5FSIA 2A6TA 2VNQA 3MCFA 3SHDA 3ID9A 1V8NA 1MK1A 1MR2A 1U20A 2AZWA 1MQEA 1K26A 2I6KA 2ICKA 2O5WA 2YVPA 3R03A 2VNPA 4KYXA 1X84A 3KVHA 5CFIA 3X0KA 3I7VA 3X0IA 4HVYA 3GZ8A 1VC9A 3X0OA 2W4EA 4KG4A 2PQVA 2DSDA 2GT4A 1HZTA 1MP2A 2FMLA 1VIQA 5DDGA 3O61A 2B06A 2ICJA 4N1TA 4NFWA 3GWYA 5IW5A 1SOIA 3Q2TA 3GG6A 1OW2A 4JZUA 1SZ3A 1XSBA 2I8TA 1PUQA 2KDVA 5LPGA 2GB5A 2A8TA 4N1UA 3OGAA 2YYHA 3HYQA 3ACAA 1V8YA 1V8TA 1RRSA 5DPKA 2YVNA 2B2KA 2KDWA 1SJYA 2XSQA 5FSNA 5FSLA 1Q33A 3FFUA 4C9XA 4S2XA 3H95A 2O5FA 2QJTA 2R5WA 3SMDA 1VC8A 4IJXA 3WHWA 1Q27A 3Q4IA 4KG3A 3X0SA 2YVMA 3FSPA 3FJYA 1VIUA 1XSCA 5ISYA 1KHZA 1IRYA 5GHJA 2PNYA 1KT9A 3P5TA 4YPRA 5CFJA 2J8QA 5GHIA 1G0SA 5FSMA 2DSBA 5DEQA 4J7GA 5FSOA 4YPHA 1PPVA 2DHOA 2FVVA 5ANUA 3MDGA 4J7HA 1F3YA 3O69A 5BS6A 1V8LA 2CL3A 3EXQA 3F13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILQ A;  3X0N A;  1PPX A;  2Q9P A;  1VK6 A;  2QJO A;  1JKN A;  1XSA A;  3RH7 A;  5C7T A;  3BM4 A;  1G9Q A;  4ICK A;  3ZR0 A;  1JRK A;  5GHQ A;  5DD4 A;  3G0Q A;  3GZ5 A;  1R67 A;  3N9U A;  1PVF A;  3EEU A;  5FSK A;  1QVJ A;  1GA7 A;  2O1C A;  5ANW A;  5ANS A;  4ZG0 A;  1TUM A;  5GHO A;  5IW4 A;  4JZV A;  2QKM B;  4S2W A;  4S2Y A;  1V8S A;  1V8W A;  3X0J A;  1NQZ A;  1K2E A;  2DUK A;  3SON A;  3A6V A;  1SU2 A;  3A6U A;  5HZX A;  1RYA A;  1X51 A;  5BON A;  3O8S A;  5GHP A;  2A8P A;  3BAP A;  3X0L A;  3A6S A;  2I8U A;  2FKB A;  1V8R A;  4YOQ A;  3MGM A;  4K6E A;  1V8M A;  5ANT A;  5GHN A;  2YVO A;  5C7Q A;  1MQW A;  1HX3 A;  4NFX A;  3X0Q A;  3Q93 A;  5GHM A;  3GRN A;  4V14 A;  3N77 A;  1V8U A;  5ANV A;  3I9X A;  4HFQ A;  3DKU A;  1V8V A;  3CNG A;  3BHO A;  5I8U A;  2A8Q A;  1X83 A;  1V8I A;  3EF5 A;  3O52 A;  1Q54 A;  4DYW A;  3Q1P A;  3Q91 A;  1VCD A;  2RRK A;  5C8L A;  3J7Y e;  1NFZ A;  3HHJ A;  3COU A;  1VHG A;  1KTG A;  3Q2S A;  3A6T A;  1MUT A;  3DUP A;  4MPO A;  2A8R A;  3MDI A;  3EES A;  3L85 A;  3QSJ A;  1RRQ A;  4KTB A;  4S2V A;  3U53 A;  1NFS A;  1VRL A;  1I9A A;  3AC9 A;  3X0R A;  1PPW A;  3E57 A;  3FK9 A;  3GZ6 A;  1PUN A;  3P6Y A;  2A8S A;  3F6A A;  3FCM A;  1VHZ A;  3O6Z A;  2G74 A;  2G73 A;  4C9W A;  3I7U A;  1NQY A;  4JZS A;  4JZT A;  2B0V A;  2JVB A;  3X0P A;  2GT2 A;  3ZR1 A;  1PUS A;  3X0M A;  2DSC A;  5FSI A;  2A6T A;  2VNQ A;  3MCF A;  3SHD A;  3ID9 A;  1V8N A;  1MK1 A;  1MR2 A;  1U20 A;  2AZW A;  1MQE A;  1K26 A;  2I6K A;  2ICK A;  2O5W A;  2YVP A;  3R03 A;  2VNP A;  4KYX A;  1X84 A;  3KVH A;  5CFI A;  3X0K A;  3I7V A;  3X0I A;  4HVY A;  3GZ8 A;  1VC9 A;  3X0O A;  2W4E A;  4KG4 A;  2PQV A;  2DSD A;  2GT4 A;  1HZT A;  1MP2 A;  2FML A;  1VIQ A;  5DDG A;  3O61 A;  2B06 A;  2ICJ A;  4N1T A;  4NFW A;  3GWY A;  5IW5 A;  1SOI A;  3Q2T A;  3GG6 A;  1OW2 A;  4JZU A;  1SZ3 A;  1XSB A;  2I8T A;  1PUQ A;  2KDV A;  5LPG A;  2GB5 A;  2A8T A;  4N1U A;  3OGA A;  2YYH A;  3HYQ A;  3ACA A;  1V8Y A;  1V8T A;  1RRS A;  5DPK A;  2YVN A;  2B2K A;  2KDW A;  1SJY A;  2XSQ A;  5FSN A;  5FSL A;  1Q33 A;  3FFU A;  4C9X A;  4S2X A;  3H95 A;  2O5F A;  2QJT A;  2R5W A;  3SMD A;  1VC8 A;  4IJX A;  3WHW A;  1Q27 A;  3Q4I A;  4KG3 A;  3X0S A;  2YVM A;  3FSP A;  3FJY A;  1VIU A;  1XSC A;  5ISY A;  1KHZ A;  1IRY A;  5GHJ A;  2PNY A;  1KT9 A;  3P5T A;  4YPR A;  5CFJ A;  2J8Q A;  5GHI A;  1G0S A;  5FSM A;  2DSB A;  5DEQ A;  5FSO A;  4YPH A;  1PPV A;  2DHO A;  2FVV A;  5ANU A;  3MDG A;  1F3Y A;  3O69 A;  5BS6 A;  1V8L A;  2CL3 A;  3EXQ A;  3F13 A; 
#chains in the Genus database with same CATH topology
 4ILQ A;  3X0N A;  1PPX A;  2Q9P A;  1VK6 A;  2QJO A;  1JKN A;  1XSA A;  3RH7 A;  5C7T A;  3BM4 A;  1G9Q A;  4ICK A;  3ZR0 A;  1JRK A;  5GHQ A;  5DD4 A;  3G0Q A;  3GZ5 A;  1R67 A;  3N9U A;  1PVF A;  3EEU A;  5FSK A;  1QVJ A;  1GA7 A;  2O1C A;  5ANW A;  5ANS A;  4ZG0 A;  1TUM A;  5GHO A;  5IW4 A;  4JZV A;  2QKM B;  4S2W A;  4S2Y A;  1V8S A;  1V8W A;  3X0J A;  1NQZ A;  1K2E A;  2DUK A;  3SON A;  3A6V A;  1SU2 A;  3A6U A;  5HZX A;  1RYA A;  1X51 A;  5BON A;  3O8S A;  5GHP A;  2A8P A;  3BAP A;  3X0L A;  3A6S A;  2I8U A;  2FKB A;  1V8R A;  4YOQ A;  3MGM A;  4K6E A;  1V8M A;  2CZR A;  5ANT A;  5GHN A;  2YVO A;  5C7Q A;  1MQW A;  1HX3 A;  4NFX A;  3X0Q A;  3Q93 A;  5GHM A;  3GRN A;  4V14 A;  3N77 A;  1V8U A;  5ANV A;  3I9X A;  4HFQ A;  3DKU A;  1V8V A;  3CNG A;  3BHO A;  5I8U A;  2A8Q A;  1X83 A;  1V8I A;  3EF5 A;  3O52 A;  1Q54 A;  4DYW A;  3Q1P A;  3Q91 A;  1VCD A;  2RRK A;  5C8L A;  3J7Y e;  1NFZ A;  3HHJ A;  3COU A;  1VHG A;  1KTG A;  3Q2S A;  3A6T A;  1MUT A;  3DUP A;  4MPO A;  2A8R A;  3MDI A;  3EES A;  3L85 A;  3QSJ A;  1RRQ A;  4KTB A;  4S2V A;  3U53 A;  1NFS A;  1VRL A;  1I9A A;  3AC9 A;  3X0R A;  1PPW A;  3E57 A;  3FK9 A;  3GZ6 A;  1PUN A;  3P6Y A;  2A8S A;  3F6A A;  3FCM A;  1VHZ A;  3O6Z A;  2G74 A;  2G73 A;  4C9W A;  3I7U A;  1NQY A;  4JZS A;  4JZT A;  2B0V A;  2JVB A;  3X0P A;  2GT2 A;  3ZR1 A;  1PUS A;  3X0M A;  2DSC A;  5FSI A;  2A6T A;  2VNQ A;  3MCF A;  3SHD A;  3ID9 A;  1V8N A;  1MK1 A;  1MR2 A;  1U20 A;  2AZW A;  1MQE A;  1K26 A;  2I6K A;  2ICK A;  2O5W A;  2YVP A;  3R03 A;  2VNP A;  4KYX A;  1X84 A;  3KVH A;  5CFI A;  3X0K A;  3I7V A;  3X0I A;  4HVY A;  3GZ8 A;  1VC9 A;  3X0O A;  2W4E A;  4KG4 A;  2PQV A;  2DSD A;  2GT4 A;  1HZT A;  1MP2 A;  2FML A;  1VIQ A;  5DDG A;  3O61 A;  2B06 A;  2ICJ A;  4N1T A;  4NFW A;  3GWY A;  5IW5 A;  1SOI A;  3Q2T A;  3GG6 A;  1OW2 A;  4JZU A;  1SZ3 A;  1XSB A;  2I8T A;  1PUQ A;  2KDV A;  5LPG A;  2GB5 A;  2A8T A;  4N1U A;  3OGA A;  2YYH A;  3HYQ A;  3ACA A;  1V8Y A;  1V8T A;  1RRS A;  5DPK A;  2YVN A;  2B2K A;  2KDW A;  1SJY A;  2XSQ A;  5FSN A;  5FSL A;  1Q33 A;  3FFU A;  4C9X A;  4S2X A;  3H95 A;  2O5F A;  2QJT A;  2R5W A;  3SMD A;  1VC8 A;  4IJX A;  3WHW A;  1Q27 A;  3Q4I A;  4KG3 A;  3X0S A;  2YVM A;  3FSP A;  3FJY A;  1VIU A;  1XSC A;  5ISY A;  1KHZ A;  1IRY A;  5GHJ A;  2PNY A;  1KT9 A;  3P5T A;  4YPR A;  5CFJ A;  2J8Q A;  5GHI A;  1G0S A;  5FSM A;  2DSB A;  5DEQ A;  4J7G A;  5FSO A;  4YPH A;  1PPV A;  2DHO A;  2FVV A;  5ANU A;  3MDG A;  4J7H A;  1F3Y A;  3O69 A;  5BS6 A;  1V8L A;  2CL3 A;  3EXQ A;  3F13 A; 
#chains in the Genus database with same CATH homology
 4ILQ A;  3X0N A;  1PPX A;  2Q9P A;  1VK6 A;  2QJO A;  1JKN A;  1XSA A;  3RH7 A;  5C7T A;  3BM4 A;  1G9Q A;  4ICK A;  3ZR0 A;  1JRK A;  5GHQ A;  5DD4 A;  3G0Q A;  3GZ5 A;  1R67 A;  3N9U A;  1PVF A;  3EEU A;  5FSK A;  1QVJ A;  1GA7 A;  2O1C A;  5ANW A;  5ANS A;  4ZG0 A;  1TUM A;  5GHO A;  5IW4 A;  4JZV A;  2QKM B;  4S2W A;  4S2Y A;  1V8S A;  1V8W A;  3X0J A;  1NQZ A;  1K2E A;  2DUK A;  3SON A;  3A6V A;  1SU2 A;  3A6U A;  5HZX A;  1RYA A;  1X51 A;  5BON A;  3O8S A;  5GHP A;  2A8P A;  3BAP A;  3X0L A;  3A6S A;  2I8U A;  2FKB A;  1V8R A;  4YOQ A;  3MGM A;  4K6E A;  1V8M A;  2CZR A;  5ANT A;  5GHN A;  2YVO A;  5C7Q A;  1MQW A;  1HX3 A;  4NFX A;  3X0Q A;  3Q93 A;  5GHM A;  3GRN A;  4V14 A;  3N77 A;  1V8U A;  5ANV A;  3I9X A;  4HFQ A;  3DKU A;  1V8V A;  3CNG A;  3BHO A;  5I8U A;  2A8Q A;  1X83 A;  1V8I A;  3EF5 A;  3O52 A;  1Q54 A;  4DYW A;  3Q1P A;  3Q91 A;  1VCD A;  2RRK A;  5C8L A;  3J7Y e;  1NFZ A;  3HHJ A;  3COU A;  1VHG A;  1KTG A;  3Q2S A;  3A6T A;  1MUT A;  3DUP A;  4MPO A;  2A8R A;  3MDI A;  3EES A;  3L85 A;  3QSJ A;  1RRQ A;  4KTB A;  4S2V A;  3U53 A;  1NFS A;  1VRL A;  1I9A A;  3AC9 A;  3X0R A;  1PPW A;  3E57 A;  3FK9 A;  3GZ6 A;  1PUN A;  3P6Y A;  2A8S A;  3F6A A;  3FCM A;  1VHZ A;  3O6Z A;  2G74 A;  2G73 A;  4C9W A;  3I7U A;  1NQY A;  4JZS A;  4JZT A;  2B0V A;  2JVB A;  3X0P A;  2GT2 A;  3ZR1 A;  1PUS A;  3X0M A;  2DSC A;  5FSI A;  2A6T A;  2VNQ A;  3MCF A;  3SHD A;  3ID9 A;  1V8N A;  1MK1 A;  1MR2 A;  1U20 A;  2AZW A;  1MQE A;  1K26 A;  2I6K A;  2ICK A;  2O5W A;  2YVP A;  3R03 A;  2VNP A;  4KYX A;  1X84 A;  3KVH A;  5CFI A;  3X0K A;  3I7V A;  3X0I A;  4HVY A;  3GZ8 A;  1VC9 A;  3X0O A;  2W4E A;  4KG4 A;  2PQV A;  2DSD A;  2GT4 A;  1HZT A;  1MP2 A;  2FML A;  1VIQ A;  5DDG A;  3O61 A;  2B06 A;  2ICJ A;  4N1T A;  4NFW A;  3GWY A;  5IW5 A;  1SOI A;  3Q2T A;  3GG6 A;  1OW2 A;  4JZU A;  1SZ3 A;  1XSB A;  2I8T A;  1PUQ A;  2KDV A;  5LPG A;  2GB5 A;  2A8T A;  4N1U A;  3OGA A;  2YYH A;  3HYQ A;  3ACA A;  1V8Y A;  1V8T A;  1RRS A;  5DPK A;  2YVN A;  2B2K A;  2KDW A;  1SJY A;  2XSQ A;  5FSN A;  5FSL A;  1Q33 A;  3FFU A;  4C9X A;  4S2X A;  3H95 A;  2O5F A;  2QJT A;  2R5W A;  3SMD A;  1VC8 A;  4IJX A;  3WHW A;  1Q27 A;  3Q4I A;  4KG3 A;  3X0S A;  2YVM A;  3FSP A;  3FJY A;  1VIU A;  1XSC A;  5ISY A;  1KHZ A;  1IRY A;  5GHJ A;  2PNY A;  1KT9 A;  3P5T A;  4YPR A;  5CFJ A;  2J8Q A;  5GHI A;  1G0S A;  5FSM A;  2DSB A;  5DEQ A;  4J7G A;  5FSO A;  4YPH A;  1PPV A;  2DHO A;  2FVV A;  5ANU A;  3MDG A;  4J7H A;  1F3Y A;  3O69 A;  5BS6 A;  1V8L A;  2CL3 A;  3EXQ A;  3F13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...