4HVYA

A thermostable variant of human nudt18 nudix domain obtained by hot colony filtration
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
134
Chain Sequence
RKNVCYMVLAVFLSEQDEVLLIQEAKRECRGSWYLPAGRMEPGETIVEALQRVVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAHDILHLVLAAQYRQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate-linked moiety X motif 18
publication title Engineering protein thermostability using a generic activity-independent biophysical screen inside the cell.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 35
structure length 134
sequence length 135
ec nomenclature ec 3.6.1.58: 8-oxo-dGDP phosphatase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4hvyA00
1VIUA 3ZR0A 2GT2A 1MR2A 5CFJA 2I8UA 2W4EA 3O69A 3X0IA 4NFWA 5ANVA 5C8LA 2Q9PA 1V8VA 5DEQA 4KTBA 3SMDA 1NFSA 3EEUA 1I9AA 3O8SA 2R5WA 2O5WA 5C7TA 1Q54A 5FSIA 3X0OA 3G0QA 1RYAA 5CFIA 1KHZA 4JZUA 2A6TA 3O52A 2A8RA 3A6SA 5ANWA 4NFXA 4C9WA 4JZTA 5IW4A 1RRQA 1V8WA 5GHJA 2DSBA 3FSPA 1X51A 1VCDA 1V8UA 3AC9A 2I8TA 1JRKA 2XSQA 3X0JA 3GZ8A 3F6AA 1G9QA 1NQYA 1VC9A 3N77A 2G73A 2B06A 2J8QA 3HHJA 3X0RA 3SHDA 3X0NA 1G0SA 3Q2SA 5BS6A 1VRLA 3X0MA 5HZXA 1VHGA 4S2WA 2JVBA 2GB5A 1PUSA 4HFQA 2RRKA 3MDGA 1JKNA 2O5FA 3O61A 5DD4A 5FSMA 5I8UA 2DHOA 2VNQA 3EESA 3L85A 5C7QA 4S2XA 3Q2TA 1MK1A 3I7UA 5ANUA 2B2KA 1VK6A 3ZR1A 2A8QA 3E57A 2B0VA 1V8IA 1XSCA 2AZWA 1KTGA 3FJYA 3I7VA 1R67A 2O1CA 5GHPA 1RRSA 3GG6A 2PQVA 4HVYA 3A6UA 3HYQA 3X0KA 4S2YA 1PPXA 1K2EA 1MP2A 5GHQA 2QJTA 3COUA 1V8NA 3X0SA 1XSAA 5FSNA 3BM4A 3ACAA 5BONA 3FFUA 3MDIA 4ILQA 1SU2A 2DSCA 3KVHA 4S2VA 1SOIA 1U20A 1V8YA 3CNGA 4N1UA 5FSKA 3Q1PA 1SJYA 3MCFA 4ICKA 3X0LA 2YVNA 1PUNA 1V8MA 5GHMA 3P5TA 2YVPA 5ISYA 1F3YA 3N9UA 2FVVA 3Q93A 5GHOA 3P6YA 1X83A 5GHNA 3A6VA 1MQWA 1IRYA 1PVFA 5IW5A 3EXQA 4C9XA 5FSOA 1OW2A 1QVJA 2CL3A 1VHZA 3OGAA 1PPWA 1NFZA 2YVOA 3BAPA 3H95A 3X0PA 4ZG0A 3A6TA 3O6ZA 3FCMA 3Q4IA 4JZSA 4K6EA 2YYHA 1XSBA 2G74A 2QKMB 2QJOA 3U53A 3DUPA 4JZVA 3J7Ye 1K26A 2FKBA 3RH7A 1Q33A 3R03A 1SZ3A 2A8SA 1X84A 5GHIA 3DKUA 1HX3A 1TUMA 2DUKA 4YPHA 1MQEA 1KT9A 2A8TA 3GRNA 4KG3A 3WHWA 3BHOA 3I9XA 4V14A 4YPRA 4YOQA 1PPVA 2FMLA 3F13A 2I6KA 3QSJA 2VNPA 1PUQA 2DSDA 3SONA 5DDGA 5ANTA 3ID9A 1GA7A 1Q27A 3GZ5A 1V8RA 2ICKA 3MGMA 4KYXA 4IJXA 3GZ6A 1V8SA 2YVMA 3EF5A 1V8TA 1VIQA 2GT4A 2KDVA 5ANSA 1NQZA 3X0QA 5LPGA 4DYWA 3GWYA 3Q91A 2KDWA 3FK9A 4KG4A 2PNYA 2ICJA 4MPOA 1HZTA 5FSLA 2A8PA 4N1TA 1VC8A 1MUTA 1V8LA 5DPKA
chains in the Genus database with same CATH superfamily
1VIUA 3ZR0A 2GT2A 1MR2A 5CFJA 2I8UA 2W4EA 3O69A 3X0IA 4NFWA 5ANVA 5C8LA 4J7HA 2Q9PA 1V8VA 5DEQA 4KTBA 3SMDA 1NFSA 3EEUA 1I9AA 3O8SA 2R5WA 2O5WA 5C7TA 1Q54A 5FSIA 3X0OA 3G0QA 1RYAA 5CFIA 1KHZA 4JZUA 2A6TA 3O52A 2A8RA 3A6SA 5ANWA 4NFXA 4C9WA 4JZTA 5IW4A 1RRQA 1V8WA 5GHJA 2DSBA 3FSPA 1X51A 1VCDA 1V8UA 3AC9A 2I8TA 1JRKA 2XSQA 4J7GA 2CZRA 3X0JA 3GZ8A 3F6AA 1G9QA 1NQYA 1VC9A 3N77A 2G73A 2B06A 2J8QA 3HHJA 3X0RA 3SHDA 3X0NA 1G0SA 3Q2SA 5BS6A 1VRLA 3X0MA 5HZXA 1VHGA 4S2WA 2JVBA 2GB5A 1PUSA 4HFQA 2RRKA 3MDGA 1JKNA 2O5FA 3O61A 5DD4A 5FSMA 5I8UA 2DHOA 2VNQA 3EESA 3L85A 5C7QA 4S2XA 3Q2TA 1MK1A 3I7UA 5ANUA 2B2KA 1VK6A 3ZR1A 2A8QA 3E57A 2B0VA 1V8IA 1XSCA 2AZWA 1KTGA 3FJYA 3I7VA 1R67A 2O1CA 5GHPA 1RRSA 3GG6A 2PQVA 4HVYA 3A6UA 3HYQA 3X0KA 4S2YA 1PPXA 1K2EA 1MP2A 5GHQA 2QJTA 3COUA 1V8NA 3X0SA 1XSAA 5FSNA 3BM4A 3ACAA 5BONA 3FFUA 3MDIA 4ILQA 1SU2A 2DSCA 3KVHA 4S2VA 1SOIA 1U20A 1V8YA 3CNGA 4N1UA 5FSKA 3Q1PA 1SJYA 3MCFA 4ICKA 3X0LA 2YVNA 1PUNA 1V8MA 5GHMA 3P5TA 2YVPA 5ISYA 1F3YA 3N9UA 2FVVA 3Q93A 5GHOA 3P6YA 1X83A 5GHNA 3A6VA 1MQWA 1IRYA 1PVFA 5IW5A 3EXQA 4C9XA 5FSOA 1OW2A 1QVJA 2CL3A 1VHZA 3OGAA 1PPWA 1NFZA 2YVOA 3BAPA 3H95A 3X0PA 4ZG0A 3A6TA 3O6ZA 3FCMA 3Q4IA 4JZSA 4K6EA 2YYHA 1XSBA 2G74A 2QKMB 2QJOA 3U53A 3DUPA 4JZVA 3J7Ye 1K26A 2FKBA 3RH7A 1Q33A 3R03A 1SZ3A 2A8SA 1X84A 5GHIA 3DKUA 1HX3A 1TUMA 2DUKA 4YPHA 1MQEA 1KT9A 2A8TA 3GRNA 4KG3A 3WHWA 3BHOA 3I9XA 4V14A 4YPRA 4YOQA 1PPVA 2FMLA 3F13A 2I6KA 3QSJA 2VNPA 1PUQA 2DSDA 3SONA 5DDGA 5ANTA 3ID9A 1GA7A 1Q27A 3GZ5A 1V8RA 2ICKA 3MGMA 4KYXA 4IJXA 3GZ6A 1V8SA 2YVMA 3EF5A 1V8TA 1VIQA 2GT4A 2KDVA 5ANSA 1NQZA 3X0QA 5LPGA 4DYWA 3GWYA 3Q91A 2KDWA 3FK9A 4KG4A 2PNYA 2ICJA 4MPOA 1HZTA 5FSLA 2A8PA 4N1TA 1VC8A 1MUTA 1V8LA 5DPKA
chains in the Genus database with same CATH topology
1VIUA 3ZR0A 2GT2A 1MR2A 5CFJA 2I8UA 2W4EA 3O69A 3X0IA 4NFWA 5ANVA 5C8LA 4J7HA 2Q9PA 1V8VA 5DEQA 4KTBA 3SMDA 1NFSA 3EEUA 1I9AA 3O8SA 2R5WA 2O5WA 5C7TA 1Q54A 5FSIA 3X0OA 3G0QA 1RYAA 5CFIA 1KHZA 4JZUA 2A6TA 3O52A 2A8RA 3A6SA 5ANWA 4NFXA 4C9WA 4JZTA 5IW4A 1RRQA 1V8WA 5GHJA 2DSBA 3FSPA 1X51A 1VCDA 1V8UA 3AC9A 2I8TA 1JRKA 2XSQA 4J7GA 2CZRA 3X0JA 3GZ8A 3F6AA 1G9QA 1NQYA 1VC9A 3N77A 2G73A 2B06A 2J8QA 3HHJA 3X0RA 3SHDA 3X0NA 1G0SA 3Q2SA 5BS6A 1VRLA 3X0MA 5HZXA 1VHGA 4S2WA 2JVBA 2GB5A 1PUSA 4HFQA 2RRKA 3MDGA 1JKNA 2O5FA 3O61A 5DD4A 5FSMA 5I8UA 2DHOA 2VNQA 3EESA 3L85A 5C7QA 4S2XA 3Q2TA 1MK1A 3I7UA 5ANUA 2B2KA 1VK6A 3ZR1A 2A8QA 3E57A 2B0VA 1V8IA 1XSCA 2AZWA 1KTGA 3FJYA 3I7VA 1R67A 2O1CA 5GHPA 1RRSA 3GG6A 2PQVA 4HVYA 3A6UA 3HYQA 3X0KA 4S2YA 1PPXA 1K2EA 1MP2A 5GHQA 2QJTA 3COUA 1V8NA 3X0SA 1XSAA 5FSNA 3BM4A 3ACAA 5BONA 3FFUA 3MDIA 4ILQA 1SU2A 2DSCA 3KVHA 4S2VA 1SOIA 1U20A 1V8YA 3CNGA 4N1UA 5FSKA 3Q1PA 1SJYA 3MCFA 4ICKA 3X0LA 2YVNA 1PUNA 1V8MA 5GHMA 3P5TA 2YVPA 5ISYA 1F3YA 3N9UA 2FVVA 3Q93A 5GHOA 3P6YA 1X83A 5GHNA 3A6VA 1MQWA 1IRYA 1PVFA 5IW5A 3EXQA 4C9XA 5FSOA 1OW2A 1QVJA 2CL3A 1VHZA 3OGAA 1PPWA 1NFZA 2YVOA 3BAPA 3H95A 3X0PA 4ZG0A 3A6TA 3O6ZA 3FCMA 3Q4IA 4JZSA 4K6EA 2YYHA 1XSBA 2G74A 2QKMB 2QJOA 3U53A 3DUPA 4JZVA 3J7Ye 1K26A 2FKBA 3RH7A 1Q33A 3R03A 1SZ3A 2A8SA 1X84A 5GHIA 3DKUA 1HX3A 1TUMA 2DUKA 4YPHA 1MQEA 1KT9A 2A8TA 3GRNA 4KG3A 3WHWA 3BHOA 3I9XA 4V14A 4YPRA 4YOQA 1PPVA 2FMLA 3F13A 2I6KA 3QSJA 2VNPA 1PUQA 2DSDA 3SONA 5DDGA 5ANTA 3ID9A 1GA7A 1Q27A 3GZ5A 1V8RA 2ICKA 3MGMA 4KYXA 4IJXA 3GZ6A 1V8SA 2YVMA 3EF5A 1V8TA 1VIQA 2GT4A 2KDVA 5ANSA 1NQZA 3X0QA 5LPGA 4DYWA 3GWYA 3Q91A 2KDWA 3FK9A 4KG4A 2PNYA 2ICJA 4MPOA 1HZTA 5FSLA 2A8PA 4N1TA 1VC8A 1MUTA 1V8LA 5DPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIU A;  3ZR0 A;  2GT2 A;  1MR2 A;  5CFJ A;  2I8U A;  2W4E A;  3O69 A;  3X0I A;  4NFW A;  5ANV A;  5C8L A;  2Q9P A;  1V8V A;  5DEQ A;  4KTB A;  3SMD A;  1NFS A;  3EEU A;  1I9A A;  3O8S A;  2R5W A;  2O5W A;  5C7T A;  1Q54 A;  5FSI A;  3X0O A;  3G0Q A;  1RYA A;  5CFI A;  1KHZ A;  4JZU A;  2A6T A;  3O52 A;  2A8R A;  3A6S A;  5ANW A;  4NFX A;  4C9W A;  4JZT A;  5IW4 A;  1RRQ A;  1V8W A;  5GHJ A;  2DSB A;  3FSP A;  1X51 A;  1VCD A;  1V8U A;  3AC9 A;  2I8T A;  1JRK A;  2XSQ A;  3X0J A;  3GZ8 A;  3F6A A;  1G9Q A;  1NQY A;  1VC9 A;  3N77 A;  2G73 A;  2B06 A;  2J8Q A;  3HHJ A;  3X0R A;  3SHD A;  3X0N A;  1G0S A;  3Q2S A;  5BS6 A;  1VRL A;  3X0M A;  5HZX A;  1VHG A;  4S2W A;  2JVB A;  2GB5 A;  1PUS A;  4HFQ A;  2RRK A;  3MDG A;  1JKN A;  2O5F A;  3O61 A;  5DD4 A;  5FSM A;  5I8U A;  2DHO A;  2VNQ A;  3EES A;  3L85 A;  5C7Q A;  4S2X A;  3Q2T A;  1MK1 A;  3I7U A;  5ANU A;  2B2K A;  1VK6 A;  3ZR1 A;  2A8Q A;  3E57 A;  2B0V A;  1V8I A;  1XSC A;  2AZW A;  1KTG A;  3FJY A;  3I7V A;  1R67 A;  2O1C A;  5GHP A;  1RRS A;  3GG6 A;  2PQV A;  4HVY A;  3A6U A;  3HYQ A;  3X0K A;  4S2Y A;  1PPX A;  1K2E A;  1MP2 A;  5GHQ A;  2QJT A;  3COU A;  1V8N A;  3X0S A;  1XSA A;  5FSN A;  3BM4 A;  3ACA A;  5BON A;  3FFU A;  3MDI A;  4ILQ A;  1SU2 A;  2DSC A;  3KVH A;  4S2V A;  1SOI A;  1U20 A;  1V8Y A;  3CNG A;  4N1U A;  5FSK A;  3Q1P A;  1SJY A;  3MCF A;  4ICK A;  3X0L A;  2YVN A;  1PUN A;  1V8M A;  5GHM A;  3P5T A;  2YVP A;  5ISY A;  1F3Y A;  3N9U A;  2FVV A;  3Q93 A;  5GHO A;  3P6Y A;  1X83 A;  5GHN A;  3A6V A;  1MQW A;  1IRY A;  1PVF A;  5IW5 A;  3EXQ A;  4C9X A;  5FSO A;  1OW2 A;  1QVJ A;  2CL3 A;  1VHZ A;  3OGA A;  1PPW A;  1NFZ A;  2YVO A;  3BAP A;  3H95 A;  3X0P A;  4ZG0 A;  3A6T A;  3O6Z A;  3FCM A;  3Q4I A;  4JZS A;  4K6E A;  2YYH A;  1XSB A;  2G74 A;  2QKM B;  2QJO A;  3U53 A;  3DUP A;  4JZV A;  3J7Y e;  1K26 A;  2FKB A;  3RH7 A;  1Q33 A;  3R03 A;  1SZ3 A;  2A8S A;  1X84 A;  5GHI A;  3DKU A;  1HX3 A;  1TUM A;  2DUK A;  4YPH A;  1MQE A;  1KT9 A;  2A8T A;  3GRN A;  4KG3 A;  3WHW A;  3BHO A;  3I9X A;  4V14 A;  4YPR A;  4YOQ A;  1PPV A;  2FML A;  3F13 A;  2I6K A;  3QSJ A;  2VNP A;  1PUQ A;  2DSD A;  3SON A;  5DDG A;  5ANT A;  3ID9 A;  1GA7 A;  1Q27 A;  3GZ5 A;  1V8R A;  2ICK A;  3MGM A;  4KYX A;  4IJX A;  3GZ6 A;  1V8S A;  2YVM A;  3EF5 A;  1V8T A;  1VIQ A;  2GT4 A;  2KDV A;  5ANS A;  1NQZ A;  3X0Q A;  5LPG A;  4DYW A;  3GWY A;  3Q91 A;  2KDW A;  3FK9 A;  4KG4 A;  2PNY A;  2ICJ A;  4MPO A;  1HZT A;  5FSL A;  2A8P A;  4N1T A;  1VC8 A;  1MUT A;  1V8L A;  5DPK A; 
#chains in the Genus database with same CATH topology
 1VIU A;  3ZR0 A;  2GT2 A;  1MR2 A;  5CFJ A;  2I8U A;  2W4E A;  3O69 A;  3X0I A;  4NFW A;  5ANV A;  5C8L A;  4J7H A;  2Q9P A;  1V8V A;  5DEQ A;  4KTB A;  3SMD A;  1NFS A;  3EEU A;  1I9A A;  3O8S A;  2R5W A;  2O5W A;  5C7T A;  1Q54 A;  5FSI A;  3X0O A;  3G0Q A;  1RYA A;  5CFI A;  1KHZ A;  4JZU A;  2A6T A;  3O52 A;  2A8R A;  3A6S A;  5ANW A;  4NFX A;  4C9W A;  4JZT A;  5IW4 A;  1RRQ A;  1V8W A;  5GHJ A;  2DSB A;  3FSP A;  1X51 A;  1VCD A;  1V8U A;  3AC9 A;  2I8T A;  1JRK A;  2XSQ A;  4J7G A;  2CZR A;  3X0J A;  3GZ8 A;  3F6A A;  1G9Q A;  1NQY A;  1VC9 A;  3N77 A;  2G73 A;  2B06 A;  2J8Q A;  3HHJ A;  3X0R A;  3SHD A;  3X0N A;  1G0S A;  3Q2S A;  5BS6 A;  1VRL A;  3X0M A;  5HZX A;  1VHG A;  4S2W A;  2JVB A;  2GB5 A;  1PUS A;  4HFQ A;  2RRK A;  3MDG A;  1JKN A;  2O5F A;  3O61 A;  5DD4 A;  5FSM A;  5I8U A;  2DHO A;  2VNQ A;  3EES A;  3L85 A;  5C7Q A;  4S2X A;  3Q2T A;  1MK1 A;  3I7U A;  5ANU A;  2B2K A;  1VK6 A;  3ZR1 A;  2A8Q A;  3E57 A;  2B0V A;  1V8I A;  1XSC A;  2AZW A;  1KTG A;  3FJY A;  3I7V A;  1R67 A;  2O1C A;  5GHP A;  1RRS A;  3GG6 A;  2PQV A;  4HVY A;  3A6U A;  3HYQ A;  3X0K A;  4S2Y A;  1PPX A;  1K2E A;  1MP2 A;  5GHQ A;  2QJT A;  3COU A;  1V8N A;  3X0S A;  1XSA A;  5FSN A;  3BM4 A;  3ACA A;  5BON A;  3FFU A;  3MDI A;  4ILQ A;  1SU2 A;  2DSC A;  3KVH A;  4S2V A;  1SOI A;  1U20 A;  1V8Y A;  3CNG A;  4N1U A;  5FSK A;  3Q1P A;  1SJY A;  3MCF A;  4ICK A;  3X0L A;  2YVN A;  1PUN A;  1V8M A;  5GHM A;  3P5T A;  2YVP A;  5ISY A;  1F3Y A;  3N9U A;  2FVV A;  3Q93 A;  5GHO A;  3P6Y A;  1X83 A;  5GHN A;  3A6V A;  1MQW A;  1IRY A;  1PVF A;  5IW5 A;  3EXQ A;  4C9X A;  5FSO A;  1OW2 A;  1QVJ A;  2CL3 A;  1VHZ A;  3OGA A;  1PPW A;  1NFZ A;  2YVO A;  3BAP A;  3H95 A;  3X0P A;  4ZG0 A;  3A6T A;  3O6Z A;  3FCM A;  3Q4I A;  4JZS A;  4K6E A;  2YYH A;  1XSB A;  2G74 A;  2QKM B;  2QJO A;  3U53 A;  3DUP A;  4JZV A;  3J7Y e;  1K26 A;  2FKB A;  3RH7 A;  1Q33 A;  3R03 A;  1SZ3 A;  2A8S A;  1X84 A;  5GHI A;  3DKU A;  1HX3 A;  1TUM A;  2DUK A;  4YPH A;  1MQE A;  1KT9 A;  2A8T A;  3GRN A;  4KG3 A;  3WHW A;  3BHO A;  3I9X A;  4V14 A;  4YPR A;  4YOQ A;  1PPV A;  2FML A;  3F13 A;  2I6K A;  3QSJ A;  2VNP A;  1PUQ A;  2DSD A;  3SON A;  5DDG A;  5ANT A;  3ID9 A;  1GA7 A;  1Q27 A;  3GZ5 A;  1V8R A;  2ICK A;  3MGM A;  4KYX A;  4IJX A;  3GZ6 A;  1V8S A;  2YVM A;  3EF5 A;  1V8T A;  1VIQ A;  2GT4 A;  2KDV A;  5ANS A;  1NQZ A;  3X0Q A;  5LPG A;  4DYW A;  3GWY A;  3Q91 A;  2KDW A;  3FK9 A;  4KG4 A;  2PNY A;  2ICJ A;  4MPO A;  1HZT A;  5FSL A;  2A8P A;  4N1T A;  1VC8 A;  1MUT A;  1V8L A;  5DPK A; 
#chains in the Genus database with same CATH homology
 1VIU A;  3ZR0 A;  2GT2 A;  1MR2 A;  5CFJ A;  2I8U A;  2W4E A;  3O69 A;  3X0I A;  4NFW A;  5ANV A;  5C8L A;  4J7H A;  2Q9P A;  1V8V A;  5DEQ A;  4KTB A;  3SMD A;  1NFS A;  3EEU A;  1I9A A;  3O8S A;  2R5W A;  2O5W A;  5C7T A;  1Q54 A;  5FSI A;  3X0O A;  3G0Q A;  1RYA A;  5CFI A;  1KHZ A;  4JZU A;  2A6T A;  3O52 A;  2A8R A;  3A6S A;  5ANW A;  4NFX A;  4C9W A;  4JZT A;  5IW4 A;  1RRQ A;  1V8W A;  5GHJ A;  2DSB A;  3FSP A;  1X51 A;  1VCD A;  1V8U A;  3AC9 A;  2I8T A;  1JRK A;  2XSQ A;  4J7G A;  2CZR A;  3X0J A;  3GZ8 A;  3F6A A;  1G9Q A;  1NQY A;  1VC9 A;  3N77 A;  2G73 A;  2B06 A;  2J8Q A;  3HHJ A;  3X0R A;  3SHD A;  3X0N A;  1G0S A;  3Q2S A;  5BS6 A;  1VRL A;  3X0M A;  5HZX A;  1VHG A;  4S2W A;  2JVB A;  2GB5 A;  1PUS A;  4HFQ A;  2RRK A;  3MDG A;  1JKN A;  2O5F A;  3O61 A;  5DD4 A;  5FSM A;  5I8U A;  2DHO A;  2VNQ A;  3EES A;  3L85 A;  5C7Q A;  4S2X A;  3Q2T A;  1MK1 A;  3I7U A;  5ANU A;  2B2K A;  1VK6 A;  3ZR1 A;  2A8Q A;  3E57 A;  2B0V A;  1V8I A;  1XSC A;  2AZW A;  1KTG A;  3FJY A;  3I7V A;  1R67 A;  2O1C A;  5GHP A;  1RRS A;  3GG6 A;  2PQV A;  4HVY A;  3A6U A;  3HYQ A;  3X0K A;  4S2Y A;  1PPX A;  1K2E A;  1MP2 A;  5GHQ A;  2QJT A;  3COU A;  1V8N A;  3X0S A;  1XSA A;  5FSN A;  3BM4 A;  3ACA A;  5BON A;  3FFU A;  3MDI A;  4ILQ A;  1SU2 A;  2DSC A;  3KVH A;  4S2V A;  1SOI A;  1U20 A;  1V8Y A;  3CNG A;  4N1U A;  5FSK A;  3Q1P A;  1SJY A;  3MCF A;  4ICK A;  3X0L A;  2YVN A;  1PUN A;  1V8M A;  5GHM A;  3P5T A;  2YVP A;  5ISY A;  1F3Y A;  3N9U A;  2FVV A;  3Q93 A;  5GHO A;  3P6Y A;  1X83 A;  5GHN A;  3A6V A;  1MQW A;  1IRY A;  1PVF A;  5IW5 A;  3EXQ A;  4C9X A;  5FSO A;  1OW2 A;  1QVJ A;  2CL3 A;  1VHZ A;  3OGA A;  1PPW A;  1NFZ A;  2YVO A;  3BAP A;  3H95 A;  3X0P A;  4ZG0 A;  3A6T A;  3O6Z A;  3FCM A;  3Q4I A;  4JZS A;  4K6E A;  2YYH A;  1XSB A;  2G74 A;  2QKM B;  2QJO A;  3U53 A;  3DUP A;  4JZV A;  3J7Y e;  1K26 A;  2FKB A;  3RH7 A;  1Q33 A;  3R03 A;  1SZ3 A;  2A8S A;  1X84 A;  5GHI A;  3DKU A;  1HX3 A;  1TUM A;  2DUK A;  4YPH A;  1MQE A;  1KT9 A;  2A8T A;  3GRN A;  4KG3 A;  3WHW A;  3BHO A;  3I9X A;  4V14 A;  4YPR A;  4YOQ A;  1PPV A;  2FML A;  3F13 A;  2I6K A;  3QSJ A;  2VNP A;  1PUQ A;  2DSD A;  3SON A;  5DDG A;  5ANT A;  3ID9 A;  1GA7 A;  1Q27 A;  3GZ5 A;  1V8R A;  2ICK A;  3MGM A;  4KYX A;  4IJX A;  3GZ6 A;  1V8S A;  2YVM A;  3EF5 A;  1V8T A;  1VIQ A;  2GT4 A;  2KDV A;  5ANS A;  1NQZ A;  3X0Q A;  5LPG A;  4DYW A;  3GWY A;  3Q91 A;  2KDW A;  3FK9 A;  4KG4 A;  2PNY A;  2ICJ A;  4MPO A;  1HZT A;  5FSL A;  2A8P A;  4N1T A;  1VC8 A;  1MUT A;  1V8L A;  5DPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...