4HW8A

2.25 angstrom structure of the extracellular solute-binding protein from staphylococcus aureus in complex with maltose.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
376
structure length
376
Chain Sequence
KDKPNQLTMWVDGDKQMAFYKKITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEIKLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKLTDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQKWYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVKSSNPNLKVFEKQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.25 Angstrom Structure of the Extracellular Solute-binding Protein from Staphylococcus aureus in complex with Maltose.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Solute-binding protein
molecule keywords Bacterial extracellular solute-binding protein, putative
total genus 124
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4hw8A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4hw8A02
4KI0E 2REJA 2PT1A 5H8SA 3TPAA 2AIXA 3A3UA 4OQOA 2UXAA 4PQJA 4DE8A 3U92A 3RPWA 3B6TA 4F19A 1SQYA 4MLQA 5B7DA 5I2NB 1LCFA 1WDNA 5I56A 1M5CA 3K2DA 1GR2A 1MQJA 4M4GA 3FXQA 4TOZA 4FJPA 5I58A 2ZNTA 2Q2CA 2O1LA 2ALUA 4LATA 3KOSA 3PD9A 3UGWA 2ONSA 4KYEA 5CMKA 3S4UA 1LSTA 4E0WA 4K3FA 1TWYA 2F7BA 3V83A 4ESWA 4MFIA 5AA2D 1B7ZA 2NXOA 2I4BA 4IY5A 1OQHA 4OFOA 4XKNA 4U1ZA 2RC7A 4FEDA 2HAUA 3RT8A 3CFLA 1SI1A 1AL3A 2XXHA 4JSOA 1NH8A 2H4IA 1TFDA 3FJGA 4QSCA 3BKIB 3U8QA 1IXCA 4G68A 1B3GA 3K1PA 4XKPA 5CMMA 3S9NC 1NFTA 2RC9A 1IXIA 1PBPA 1VFDA 2V25A 4OTEA 4ZZEA 3SDFA 1UTBA 2F7AA 2G29A 4H67A 5KDTB 3ZKLA 2Q2AA 4G68C 3U94A 4EUOA 3CSBA 4XTCQ 4BDMA 4BDQA 1MH4A 1SDXA 4O3BA 5FTIA 2XHDA 4NF4A 4F18A 3Q28A 3UP9A 5H8HB 5HPQA 1PB9A 2ONKE 4GRKA 1DMBA 2B3BA 4R6YA 2DVCA 4MBPA 5DYHA 1R9LA 4OFLA 1SW5A 5DEXA 2ONRA 4MLVA 3VLWA 5AA2A 2GFEA 4GIZA 3A3CA 4IO2A 4NF5B 1B3LA 1QUKA 4QFKA 1B7UA 4F3BA 1Y1MA 2DWAA 3U93A 3T9VA 1B1HA 1XOCA 2VD2A 1Y20A 3H6UA 3CG3A 3KN7A 3UN6A 3SEXA 4IGRA 1DTZA 1QW0A 1OMPA 1WODA 3ZKKA 1ZJLA 2VHAA 2Y7KA 3PUWE 5JTYB 1CE2A 2ANJA 1QKBA 2H9BA 3K1NA 3FD3A 4N13A 1LB8A 1UQWA 3OD7A 4DZ1A 3IJXB 4TQUQ 3UK4A 5I59A 2I0CA 5J1DA 3HCQA 1FQEA 5F1QA 3K6WA 5HBCA 4IO3A 2RF1A 2V84A 1H44A 1YPNA 5AA1A 1B58A 1J1NA 2O51A 5M2VA 3B7DA 2A5SA 3PUYE 4IO7A 4OVJA 3RTWB 3EHSA 1M5DA 1USYH 2PT2A 1P1WA 2ZMBA 3EHUA 4IO5A 5L8DA 3BBRA 3T9UA 1A55A 1PC3A 3RGYA 4OMBA 4F22A 2RKMA 3IOTA 4OHNA 3CRBA 4NF4B 2W7YA 1M5FA 1D4NA 4NF8A 1M5BA 4F3PA 1MY4A 4LQ5A 4H65A 3TEPA 3IO6A 3IO4A 3C4MA 3TTLA 5DVJA 3W15C 1MDP1 3H03A 5I84A 1SBPA 3CG1A 2PYYA 3OSQA 3N6UA 4P0IA 4U4XA 3VXBA 5KZTA 1JEVA 3OEKA 3FJMA 2HAVA 1R6ZA 3ILUB 3MAMA 4QRZA 2D21A 3BFUA 4F1YA 4FAJA 5L9OA 3T22A 4H0WA 1BTJA 2PBWA 2DQVA 1XVXA 1Y3QA 3DM0A 3GZGA 2V93A 3IB1A 5H8HA 4RPOA 3TODA 3TTMA 1B1XA 1OVBA 3G3IA 4H5GA 4R72A 1MQDA 3BFTA 1N76A 3N94A 1YTVA 3K4UA 1IUDA 1RYXA 4OERA 4Q0CA 4BLAA 5ICQA 1B4ZA 2HQ0A 2Q9TA 4YKPA 4GVOA 4DXBA 2NWJA 4PFUA 5CBRA 2QPQA 4F1UA 2HCAA 1SYIA 1ZLQA 1LAHE 2UVIA 2Z8EA 3QIMA 4GL8A 1B0HA 2O68A 1B51A 1LAFE 2O6AA 4FEBA 4HTGA 4JWXA 4FIMA 3N6TA 4MF3A 4PETA 1QULA 4ELOA 1A8EA 5H8FB 4AQ4A 3DP6A 3RN8A 3C35A 3KGCA 1I6QA 1B05A 1D9YA 2F36A 3IAZA 3OENA 4GL0A 4ZEBA 2IA4A 5K2YA 3MP1A 3RTFB 3ECRA 3EQ1A 1I69A 2Y7PA 4G8NA 2THIA 3OEMA 3FJ7A 2ZYNA 5TP9A 1II5A 2HZKA 4AB6A 3MVZA 4OWDA 4NTLA 4E0XA 5EHMA 2B3FA 5CC2A 3U72A 4JDFA 4F31B 2H99A 2RCBA 3MC2A 3W9VA 4RPNA 1MPCA 1NNFA 2NOOA 2YJPA 3MVXA 3MZBA 3FXRA 3O6HA 3B6WA 4OFJA 4OEVA 3TZAA 1S7YA 4DCYA 3PPPA 4GD5A 2I58A 5I2KA 5ELVA 3V89B 3I5OA 2R6GE 2VOZA 3UORA 1H45A 2QMWA 4OEUA 3C32A 3DP4A 4UA8A 2Y84A 3FV2A 1LGBC 4X1BA 5A5XB 3MZ1A 1JW4A 3SEWA 2ZNSA 5DTBA 2O69A 2REGA 2DWHA 3H6VA 3IJOB 3DELB 1MQGA 2X7QA 3KBRA 4QFPA 4RJZA 5ITOA 1P1UA 3GXAA 5DEXB 1XT8A 1FTMA 4M1VA 1ZKBA 2PMSA 3G3GA 4X9TA 3FVKA 1MRPA 1Q35A 3R6UA 3LSWA 1FQCA 2UYEA 4R6KA 4KYDA 2GH9A 4R2FA 3OOAA 4ZEDA 1Y9UA 1Z7NE 3G3KA 3KG2A 2RINA 1MY2A 1MY3A 2ZYKA 2OWSA 1IQ7A 3CR9A 5CBSA 1AOVA 4IO6A 4PE5B 2X7PA 4QSEA 4THIA 3G7WA 2V3TA 5IAIA 1EZPA 4HCWA 2XXVA 3LSFB 4Q8RA 4YKKA 2XX8A 5CMBA 2B65A 1B52A 4F3SA 1FTKA 1SI0A 4OYVA 3JYRA 1B0LA 3HO7A 3MW0A 5CRYA 3TKDA 4ELRA 4ZE9A 1T0KA 1MQIA 3KN8A 1NL5A 4Q30B 3MUQA 3OO7A 4DDDA 2D3IA 4YAHX 4U23A 1F9BA 3E3KA 2OK2A 3IB0A 3TCHA 3USDA 4EF2A 5HM4B 3GBBA 3IK6B 3O66A 1N3WA 3V8XB 3PD8A 4FORA 5CMCA 2E0SA 1NNTA 1XHYA 2I49A 3H4ZA 3PMVA 4MH5A 1JVYA 4N6PA 4O3CA 4O3AA 3DLNA 1B32A 2GHAA 3VE1B 4LA9A 4QFNA 2Q89A 3I3VA 4KFQA 5L9MA 1JQFA 5TP9B 1MXZA 1GV8A 3WAFA 1DTGA 4WXJA 3EHTA 5H8QA 4F2QA 2F35A 3ILTB 4ZDMA 2QMXA 3CSGA 4RA1A 1NMUA 1JETA 2QS1A 3MP6A 4ONYA 1AIVA 5I57B 3VDFA 1S9TA 2FA7A 5DVIA 5EHSA 1IITA 1MQHA 3KZGA 2ABHA 1MPBA 1RKMA 3IOVA 2DVZA 3QUJA 1JW5A 2QS2A 3K1MA 4XKRA 1B2HA 1JEUA 3FIRA 4KHZE 4POWA 1SW4A 1B3EA 3OO8A 5JEIA 3HN0A 1MXWA 3MVYA 1P1OA 4U1OA 4KCCA 4LZ8A 4ZZAA 1MXXA 1MM6A 3TELA 4BDLA 4LP2B 1FCKA 4GXSB 1LBBA 4H5FA 4Q5TA 4R9FA 2R9JA 3AXFA 1O7TA 2DSFA 3T96B 1N7XA 4NWCA 2DWJA 2OZZA 3VV5A 2QS3A 4U4SA 2OJTA 3I6VA 2XD2A 4EQ7A 2DYXA 4YB5A 5FTHA 3RUMA 2ZXTA 1MXYA 2D5WA 3IOWA 3GLBA 2F6GA 4YB7A 2XX7A 1URSA 5I59B 3TQWA 3O29A 1MY1A 1O63A 3TMGA 5TPAB 3RY3A 5AE4A 1UTHA 4QFLA 1FQFA 2Z8DA 1B7HA 3H06B 3KSJA 4OENA 5AA3A 2Z23A 4KYSA 1EU8A 4FATA 1OVTA 3HHFA 4QSDA 3KOTA 4C0RA 4ECFA 2VGQA 5CI5A 1YCJA 2F97A 1JW1A 5CM6A 1UIUA 1B4HA 2FYIA 3S9LC 3C9HA 1MDQA 3SERA 1POTA 2E1SA 2BJJX 2IEEA 1Y3NA 1O64A 3Q26A 4HS7A 4EDPA 1ATGA 1N7WA 3KJTA 4RXLA 1SW1A 1HSLA 4FE8A 1R1NA 2WKYA 3LUYA 4R9GA 3CI8A 4DIGA 1PEBA 2UVHA 2VP1A 3K6UA 3OMBA 3PPRA 4QHQA 1USYE 1EH3A 1UTHB 2AL5A 3MQ9A 4G68B 4QFOA 4XKQA 5ISUA 1EZOA 2DWIA 2QRYA 4TLLB 1B5HA 4H8IA 1ELJA 3THIA 1UIVA 2CMOA 1SYHA 4F3GA 3K0VA 3PPNA 5KCJA 4G2ZA 2I4CA 1D9VA 2DXRA 3G3JA 3Q27A 4YMAA 1SD3A 4G77A 4NF5A 3FGSA 4I8CA 3IL1B 4X1DA 3EF7A 3O97A 4KQPA 4KCDA 5I2KB 5IKBA 3LC8A 3M3LA 1DPEA 3A09A 4ND9A 3TFLA 4GOTA 1LFGA 5K2XA 1YAEA 4XXUA 4LVQA 2YLNA 3MZ9A 1A8FA 3TTNA 1FTJA 4NE4A 3RQTA 5AA2B 2ZYOA 4GWOA 4RYAA 1LFHA 3S2VA 1OLCA 1OQGA 3QUFA 4OETA 4DLDA 1M5EA 1Y3PA 4LZ7A 4WEDA 4ZS9A 1IZ1A 3IR1A 1FTOA 4TLMB 3TTRA 3UIFA 5I58B 2PX1A 4YB6A 2XXXA 5JK4A 2GRVA 3S9EA 4AB5A 3KEIA 1LFIA 5BUUA 3V5AA 2HZLA 3CVGA 4ZEFA 2UVJA 4KR5A 1GGGA 4WEPA 4ELQA 4ZECA 1QUIA 4JWOA 1A40A 4G8HA 3K02A 1S50A 4I9DA 4LQ2A 2GHBA 3Q29A 2UYFA 3PPOA 4HW8A 5ICTA 4R2BA 3B6QA 1DOTA 1GVCA 4R6HA 3R7XA 1FQBA 2QS4A 3DP8A 1FQAA 1H43A 3W9WA 5H8FA 5FHMA 4GFRA 1DPPA 3H6TA 1VSOA 3RLFE 3S9MC 4EF1A 4WKMA 5H8QB 3T93B 3LR1A 4C1TA 1POY1 1RYOA 3QXMA 4KPTA 2ESNA 1BIYA 2HXWA 2P1SA 4I62A 4F39A 2F5XA 3TAJA 1NNPA 1PB7A 2I48A 4JWYA 4GF8A 1CB6A 5BWJA 5LOMA 2AYSA 4EXKA 4C1UA 1XVYA 1VE4A 3OXNA 3H3GA 3JV9A 4OESA 4U22A 3M3FA 1OIBA 2XXIA 1A54A 3LBSA 4G4PA 5H8NA 1NKXA 4IB2A 4Z7EA 2A5TB 1PDAA 2H25A 2V3QA 4JBZA 3SKPA 3H6WA 4XIGQ 1Q1KA 1QJMA 1ZMGA 1MXUA 3P7IA 4NF8B 5AA4A 2QSXA 3PGFA 2Q88A 1BLFA 3C36A 1ZTYA 3L6HA 3OSRA 4LZ5A 1N84A 2Y7RA 5A5XA 2DE3A 2KLFA 2XXUA 2HEUA 1JVXA 3PUVE 4YKIA 3MPLA 3WAEA 2XXYA 4R74A 1US5A 2OLBA 1B5IA 3C34A 2LAOA 2Q8JA 3LSXA 1B9JA 1MG1A 3PMWA 3TTKA 3F11A 3PPQA 4GXAA 3SEUA 3EPEA 4HCYA 4PFYA 3RT6B 3T9HB 2OCUA 1P1QA 4BDRA 2XXWA 3HPIA 3O9PA 3FV1A 3MP8A 3PU5A 2X26A 5TPAA 5KDTA 1D3KA 4POXA 4ISUA 1MXVA 4QF9A 3SESA 1BKAA 3O28A 3T9XB 3ZSFA 3D4CA 1WVJA 2O7IA 1P1NA 3FVGA 3N5LA 2F8DA 2R71A 3K6XA 3IORA 3PUXE 1Y1ZA 1VR5A 3QK6A 4PP0A 3TYHA 4NMYA 1ZBMA 4F2OA 1SW2A 1PBQA 4OXVA 3UA8A 4FECA 2RCAA 5FHNA 4RNSA 1P99A 2DE2A 1B6HA 3FVOA 2CZLA 3K01A 1N04A 3VVDA 2ZNUA 3D4GA 2I3VA 1XS5A 2DP8A 2XXRA 3HSTA 3K00A 1IIWA 1URDA 3MVWA 3O6IA 4RK2A 3VLVA 1IXGA 2O84X 1KWHA 3JZJA 4L17A 4PFTA 2I3WA 1AH5A 3ZS6A 1B40A 4LUBA 1MM7A 1QKAA 4RK9A 2F6PA 4X48A 4GQOA 1BP5A 4I1DA 3VVEA 3QYTA 5L9SA 4NF6B 1EZ9A 1MH3A 3IOUA 3K6VA 1NNKA 3SEVA 4ELPA 2I0BA 3RNNA 3PUZE 4EXLA 5I57A 2OBGA 3OELA 4BDOA 4DXCA 2M8CA 2UVGA 1IEJA 1GTKA 1B3HA 2DXYA 2XXPA 3CIJA 3M3KA 1IXHA 1LAXA 3VXCA 4OZ9A 3MJNA 2H98A 3SETA 3HHGA 1N0TA 2H5YA 4YU0A 1B46A 2YPNA 4RY1A 4KD5A 5B70A 2O1MA 4F1VA 1Y4CA 1MS7A 1B3FA 4R75A 1I6BA 3L6GA 3KJ7A 1PB8A 2ZYMA 4GLIA 4DCXA 1LLSA 2HFBA 3MWBA 3O2AA 5DVFA 2XXTA 2VD3A 1MY0A 3O6GA 4YKJA 1B5JA 1H76A 1LB9A 2FNCA 3CFZA 3G3FA 3ONMA 5F7VA 3PV0E 4NF6A 2QL3A 3MPKA 3FVNA 3R26A 2Y7IA 4U21A 3G3HA 4G8MA 3QSLA 3N26A 1R9QA 3Q25A 1URGA 1HSJA 3IX1A 3ODBA 4LONB 4UACA 1TT1A 1SVXB 1VFEA 1ZU0A 3FUZA 3E13X 1N3XA 3FATA 4U2RA 4YICA 4ZEIA 3TQLA 3T66A 3E9XA 3MBPA 4Z0IA 1ANFA 2O7UA 3GBAA 3FZVA 4IO4A 3OO6A 4JSDA 2RC8A 5TU0A 1OLAA 2XXQA 4H6DA 1QUJA 1H3DA 3KN3A 3SEYA 3PMXA 1MPDA 1FW0A 2DS9A 2NVUB 1LAGE 2F78A 4NEDA 2V3UA 4ZEKA 2DE4A 3TCGA 4H1XA 3CFXA 3OO9A 2PVUA 2Z8FA 1DSNA 1JNFA 2AL4A 2P2AA 4BDNA 1TXFA 3LSLA 5AA4B 2XD3A 5KCJB 3KSXA 2Z22A 4ESXA 1FQDA 4YMBA 4YZZA 1TFAA 1LCTA 3HV1A 1AMFA 3M8UA 3VFJA 5H8NB 5I56B 3U1OA 1A7LA 2A5TA 1HSEA 3FASA 4P0GA 4DXUA 4F29A 1L5TA 3TUSA 1A99A 2F7CA 4NWDA 3TCFA 4EQ9A 1I6AA 5JTYA 1ZIUA 5EYFA 4JXIA 1QVSA 1NH7A 2NUVA 4IY6A 4EQBA 5ITPA 4P11A 2I6EA 4H8JA 4JB7A 2XX9A 3TDJA 2P0SA 2QJEA 3EN3A 4IGTA 3VLUA 1FTLA 3C33A 3VVFA 3IB2A 3C31A 2G93A 3FXUA 3KFMA 5I2NA 1XC1A 5DT6A 1UTBB 2OWTA 5FHOA 1Y4TA 4N07A 2DOJA 3E4RA 3H7MA 3QAXA 1US4A 4PFWA 4ZE8A 2Y7WA 1LBCA 1Z7ME 2F34A 4R73A
chains in the Genus database with same CATH superfamily
5H8SA 3B50A 3B6TA 3RPWA 1LCFA 1M5CA 3BIGA 2ZNTA 4LATA 4NGUA 3PD9A 4PC9A 2WEFA 1LSTA 2F7BA 4XKNA 3RT8A 3CFLA 1NH8A 2F3DA 2H4IA 3S9NC 2RC9A 4OTEA 5KDTB 4G68C 4O3BA 5FTIA 4NF4A 3Q28A 4GWXA 4N91A 4GRKA 1DMBA 5DYHA 2XA5A 2GFEA 4NF5B 1B3LA 1Y1MA 3T9VA 2ZZVA 3UN6A 1QW0A 1OMPA 3ZKKA 4NX1A 4N13A 3FD3A 1UQWA 3IJXB 1USYH 1P1WA 3EHUA 4I3YA 2B4LA 3BBRA 1A55A 4F22A 3IOTA 3CRBA 2P3NA 2FIEA 1M5FA 4GWWA 4NF8A 1M5BA 4N6DA 4H65A 3TTLA 2XWIA 5I84A 1MDP1 4U4XA 4FBPA 2HAVA 3MAMA 2D21A 1JP4A 3GZGA 1XVXA 3TYHA 3TTMA 1OVBA 4H5GA 1B4ZA 4DXBA 4F1UA 2HCAA 1ZLQA 3QIMA 5H8FB 1LAFE 4TQUQ 2O6AA 4FEBA 3RN8A 4NF0A 1BK4A 2Y7PA 2THIA 2HZKA 4NTLA 5CC2A 2H99A 4RPNA 1MPCA 1NNFA 2YJPA 3O6HA 3MVXA 3MZBA 4OEVA 3B6WA 2Q8MA 1FPJA 3PPPA 5I2KA 3UORA 4OEUA 3MZ1A 5DTBA 1DCUA 2O69A 2REGA 2Y5KA 4RJZA 3DELB 2X7QA 5ITOA 1XT8A 2PMSA 3G3GA 3LSWA 4R2FA 3OOAA 2RINA 1MY3A 4OVQA 5CBSA 2X7PA 4THIA 3G7WA 3FXBA 4YKKA 2XX8A 4ELRA 3T1BA 4YAHX 1F9BA 3E3KA 4GWYA 3GBBA 1FPDA 3PD8A 2E0SA 3H4ZA 3DLNA 4LA9A 4GWUA 1DTGA 1FJ9A 3EHTA 2F35A 4GX3A 2R8TA 1JETA 1RDYA 3VDFA 2QS2A 4XKRA 1JEUA 3FIRA 5JEIA 3HN0A 1MXWA 1P1OA 3ROJA 1FBGA 3TELA 1FCKA 4N8YA 4MNIA 1CNQA 2R9JA 3AXFA 1N7XA 2QS3A 1NV3A 2ZXTA 1MXYA 2D5WA 4YB7A 4MEVA 5TPAB 4NHBA 3IFAA 5ET7A 4QFLA 1LBZA 2Z8DA 3H06B 5AA3A 4FATA 4OVPA 1UIUA 3SERA 2E1SA 4P56A 4HS7A 4RXLA 1SW1A 5T3JA 5IM2A 2UVHA 2VP1A 2XWOA 1FRPA 4QHQA 3MQ9A 4G68B 5ISUA 2BJIA 1B5HA 4H8IA 1ELJA 3ISPA 2CMOA 1SYHA 3K0VA 1D9VA 2QVVA 1Q9DA 5EYHA 5I2KB 3O97A 4KCDA 4ND9A 3TFLA 5AA2B 3QMFA 4GWOA 3S2VA 1OQGA 4N6KA 4P1LA 4YB6A 4MX6A 3CVGA 4WEPA 2HXRA 1S50A 4I9DA 3PPOA 4HW8A 5IZ3A 4GBVA 1GVCA 1DOTA 3R7XA 2QS4A 5H8FA 1VSOA 3RLFE 4WKMA 3A29A 3RPLB 1RYOA 4I62A 4F39A 2F5XA 1NNPA 3GYYA 5LOMA 4JWYA 4GF8A 5BWJA 3OXNA 4U22A 2XXIA 1QJMA 3PGFA 1BLFA 3L6HA 3OSRA 4H46A 1N84A 4LZ5A 2DE3A 3PUVE 1US5A 2OLBA 3C34A 2Q8JA 3LSXA 1MG1A 3PMWA 3F11A 3RT6B 4PFYA 3T9HB 2OCUA 2HHMA 3HPIA 3PU5A 4OA4A 1D3KA 4ISUA 1KA1A 3T9XB 2O7IA 3K6XA 3PUXE 4NMYA 4F2OA 1YYZA 2RCAA 5FHNA 1B6HA 3FVOA 3K01A 4MAGA 3HSTA 4RK2A 1URDA 3O6IA 1KWHA 4LUBA 1MM7A 2FIXA 4I1DA 4QXDA 5L9SA 1EZ9A 1MH3A 3IOUA 4GX4A 2OBGA 4BDOA 4MNCA 2M8CA 1IEJA 1GTKA 2DXYA 2XXPA 3M3KA 4NN3A 2V4CA 3MJNA 3HHGA 1N0TA 2H5YA 5DW8A 4KD5A 2ZYMA 3MWBA 5DVFA 1B5JA 2QL3A 5F24A 3R26A 1HSJA 4I3EA 4PGPA 1TT1A 5I2NB 3FUZA 3KBZA 4ZEIA 3FATA 4YICA 2CZKA 5J16A 4IO4A 4P3LA 5TU0A 4H6DA 4AS5A 3SEYA 2DS9A 4NEDA 3TCGA 4QBAA 2AL4A 2XD3A 4N4UA 1TFAA 3HV1A 3M8UA 1AMFA 4DXUA 3TUSA 4EQ9A 4EQBA 2I6EA 4H8JA 4JB7A 3VLUA 2QJEA 1FTLA 3IB2A 2G93A 3FXUA 2CZIA 5I2NA 1XC1A 2OWTA 4OVSA 2Y7WA 2F34A 4OQOA 4PQJA 1SQYA 5B7DA 4PFIA 1MQJA 3FXQA 2ALUA 5EQAA 4E0WA 4K3FA 1B7ZA 2WX9A 2I4BA 1AL3A 5I3SA 1TFDA 3FJGA 4QSCA 3BKIB 2ZZWA 1IXCA 2WBBA 4H67A 4EUOA 3U94A 4BDMA 1MH4A 1SDXA 5IAIA 4F18A 5H8HB 1PB9A 5LDZA 4R6YA 1R9LA 4OFLA 2ONRA 3VLWA 1QUKA 4F3BA 2DWAA 3H6UA 3KN7A 4O7MA 1DTZA 1WODA 1ZJLA 2VHAA 4XTCQ 4DZ1A 3UK4A 5F1QA 1H44A 1B58A 2A5SA 4OVJA 3T9UA 1PC3A 3RGYA 4NF4B 5EQ9A 1IMBA 1D4NA 4MJOA 4O94A 3IO6A 1QGXA 2FBPA 3C4MA 2KR0A 3CG1A 5KZTA 3OSQA 5ESYA 3VXBA 3OEKA 3FJMA 4QRZA 4FAJA 4XFEA 3T22A 2DQVA 3DM0A 3IB1A 2V93A 1B1XA 4MCOA 3BFTA 1N76A 3N94A 1YTVA 4BLAA 1IUDA 1RYXA 4OERA 4Q0CA 5CBRA 4YKPA 1FBEA 2NWJA 4PFUA 2L5VA 1B0HA 4JWXA 3N6TA 3KGCA 1D9YA 4GL0A 5K2YA 3RTFB 1I69A 3OEMA 5EHMA 4F31B 2RCBA 4P47A 4OFJA 3TZAA 1S7YA 4DCYA 4GD5A 2R6GE 1H45A 1NUZA 2Y84A 1LGBC 4X1BA 3SEWA 2ZNSA 2DWHA 3H6VA 3GXAA 5DEXB 3FVKA 1Q35A 1FQCA 4GWSA 4MMPA 3G3KA 4HE2A 4OVTA 2V3TA 3LSFB 4F3SA 1B52A 1FTKA 4OYVA 3JYRA 3MW0A 5CRYA 4ZE9A 4JVDA 4Q30B 3OO7A 4DDDA 2D3IA 4PCDA 2QVUA 3IK6B 3O66A 3V8XB 4FORA 5CMCA 2I49A 3PMVA 5EQ8A 2GHAA 2Q89A 3WAFA 5L9MA 5H8QA 3ILTB 4HE0A 4ONYA 3E79A 1AIVA 5EHSA 3KZGA 1MQHA 5EYGA 3IOVA 1JW5A 3K1MA 1SW4A 5EQ7A 4U1OA 4LZ8A 4LP2B 2DWJA 4N8GA 2OZZA 4U4SA 4EQ7A 3I6VA 3RUMA 5FTHA 3GLBA 3LV0A 3O29A 3TMGA 4O7IA 3U65A 1OVTA 3HHFA 4C0RA 4ECFA 2F97A 5CM6A 1B4HA 1MDQA 2BJJX 1O64A 1N7WA 3KJTA 4DIGA 1UTHB 1EZOA 3THIA 3PPNA 3G3JA 4YMAA 4G77A 4I8CA 3IL1B 4X1DA 3EF7A 4KQPA 3SZPA 1DPEA 1IMAA 5K2XA 4XXUA 4UABA 2YLNA 3MZ9A 4NE4A 2ZYOA 1IMFA 4RYAA 5A5XB 4OETA 1M5EA 5L9OA 4TLMB 5JK4A 3S9EA 2GRVA 4AB5A 3KEIA 3V5AA 4ZECA 4ELQA 4KR5A 4G8HA 1INPA 3B6QA 1FQBA 3DP8A 1FQAA 1H43A 3W9WA 4GFRA 1DPPA 3S9MC 5H8QB 4C1TA 1POY1 5A5LA 3H3GA 4OESA 4Z7EA 2V3QA 4PBHA 4JBZA 4NF8B 4N15A 2QSXA 1ZTYA 2P3VA 2XXKA 5A5XA 3WAEA 5I5PA 4LN5A 1B5IA 3PPQA 3SEUA 1KZ8A 4HCYA 4BDRA 1XI6A 1FBFA 4NAPA 3O9PA 3MP8A 5TPAA 1MXVA 4N81A 2OWZA 3SESA 3ZSFA 1Y1ZA 1VR5A 4PP0A 1PBQA 4FECA 4RNSA 1P99A 1NV6A 2ZNUA 3D4GA 2XXRA 3VLVA 2JJKA 1IXGA 2O84X 4X48A 2F6PA 1BP5A 3VVEA 4ELPA 1NNKA 4NG7A 3PUZE 3OELA 4DXCA 2H98A 5IZZA 1G0HA 1NUWA 4RY1A 5B70A 4F1VA 4JVCA 1LLSA 4JVIA 3O6GA 5F7VA 3PV0E 2XWVA 3N26A 4U2RA 1ANFA 2RC8A 1FSAA 1QUJA 1H3DA 2NVUB 1LAGE 4H1XA 3CFXA 3OO9A 2PVUA 2Z8FA 1DSNA 4PTKA 2P2AA 4BDNA 1TXFA 4YZZA 1LCTA 3VFJA 3MYUA 3U1OA 1A7LA 3FASA 4F29A 1I6AA 1ZIUA 5EYFA 4X8RA 5ITPA 1FPEA 3TDJA 2P0SA 3C33A 3VVFA 5DT6A 1UTBB 3H7MA 4XF5A 5IZ3B 3U72A 1Z7ME 2REJA 2PT1A 3TPAA 2AIXA 3A3UA 2UXAA 3U92A 4F19A 4P9KA 1WDNA 4FJPA 2Q2CA 3KOSA 3HFUA 1TWYA 3V83A 4MFIA 2NXOA 4IY5A 4OFOA 1OQHA 4U1ZA 2RC7A 4FEDA 4N17A 1KA0A 2HAUA 3U8QA 4G68A 1B3GA 3K1PA 4XKPA 3NOHA 1PBPA 1UTBA 2F7AA 2G29A 2Q2AA 3CSBA 4BDQA 2XHDA 5HPQA 3UP9A 2B3BA 5DEXA 5AA2A 4GIZA 1B7UA 3U93A 1B1HA 1FPBA 2VD2A 3SEXA 4IGRA 2Y7KA 2H9BA 2ANJA 3K1NA 2VT5A 5J1DA 3OD7A 1NV1A 2I0CA 2RF1A 2V84A 1D9QA 1YPNA 5IZ1A 1J1NA 5AA1A 5M2VA 4IO7A 2PFZA 3EHSA 1M5DA 4PAFA 2ZMBA 4OMBA 2KQZA 4OHNA 2W7YA 4F3PA 4LQ5A 3IO4A 3H03A 4P0IA 3N6UA 1R6ZA 3ILUB 4F1YA 3BFUA 1EYKA 4H0WA 2PBWA 5H8HA 1Y3QA 4RPOA 3G3IA 4R72A 3K4UA 5ICQA 1SYIA 4GL8A 3D1RA 1B51A 4FIMA 4MF3A 4ELOA 1QULA 1A8EA 3PTYA 3DP6A 1I6QA 1B05A 3IAZA 4ZEBA 2IA4A 2WYPA 3MP1A 3ECRA 3EQ1A 4G8NA 1II5A 2B3FA 4JDFA 2I58A 5ELVA 2VOZA 2QMWA 3DP4A 3EKIA 1NV5A 3IJOB 3KBRA 4OVRA 1MQGA 4GX6A 1MRPA 3R6UA 4R6KA 4KYDA 2GH9A 1Y9UA 1Z7NE 2WBDA 3RYDA 1MY2A 4Q8RA 2B65A 1SI0A 2CZHA 3B8BA 1T0KA 1MQIA 3KN8A 1NL5A 4DI4B 3TCHA 4PF8A 2OK2A 4EF2A 5HM4B 5ET6A 4MH5A 1NNTA 4O3AA 4DE8A 1FPLA 1B32A 4QFNA 5ET5A 3RPLA 3I3VA 1MXZA 1FBCA 3BIHA 4ZDMA 2QMXA 1NMUA 5I57B 1S9TA 3LUZA 1IITA 1FJ6A 2ABHA 1MPBA 1RKMA 2DVZA 1B2HA 4KHZE 3OO8A 2PCRA 1IMCA 4KCCA 4BDLA 4GXSB 1LBBA 4Q5TA 4PAKA 3T96B 2XD2A 4YB5A 1AWBA 3IOWA 5I59B 2XX7A 1URSA 3TQWA 1MY1A 4P8BA 1UTHA 1FQFA 4OENA 2Z23A 4QSDA 3KOTA 2VGQA 5CI5A 1YCJA 5I7IA 1JW1A 2FYIA 2WYKA 1POTA 1Y3NA 1HSLA 4FE8A 2WKYA 4R9GA 3K6UA 3PPRA 1EH3A 2QRYA 4TLLB 4F3GA 1UIVA 5KCJA 3FBPA 2I4CA 2DXRA 2B4MA 3Q27A 1SD3A 1K9YA 4GOTA 1LFGA 3TTNA 1A8FA 1OLCA 4DLDA 4WEDA 1Y3PA 4LZ7A 4ZS9A 3IR1A 1FTOA 3TTRA 2XXXA 1LFIA 5BUUA 4ZEFA 1GGGA 4PFRA 4JWOA 4LQ2A 2GHBA 2UYFA 1NI9A 4R2BA 4XEQA 4GBWA 1VDWA 2HPGA 3T93B 4KPTA 2HXWA 1BIYA 3TAJA 1FBPA 4IR8A 2I48A 2QFLA 4EXKA 4C1UA 1YZ0A 3JV9A 5JTYB 5H8NA 1A54A 4G4PA 4IB2A 1RDZA 2A5TB 3SKPA 5AA4A 3P7IA 2Q88A 3C36A 2Y7RA 2KLFA 2XXUA 4YKIA 2HEUA 1JVXA 3MPLA 4R74A 1LBXA 2LAOA 1B9JA 3TTKA 4G61A 2XXWA 3FV1A 2X26A 4QF9A 1BKAA 1WVJA 3FVGA 1P1NA 4X04A 1SW2A 3UA8A 2PFYA 2DE2A 1XS5A 3MVWA 3K00A 3JZJA 4PFTA 3ZS6A 1QKAA 1DK4A 1FPFA 1FTAA 2VPNA 3SEVA 2I0BA 3RNNA 1LBYA 2VPOA 2FVZA 1B3HA 1IXHA 4OZ9A 3SETA 2CEYA 2YPNA 2O1MA 1MS7A 4R75A 4DI3D 1PB8A 2HFBA 3O2AA 1MY0A 4YKJA 1LB9A 2FNCA 3MPKA 2Y7IA 4U21A 3G3HA 3QSLA 1R9QA 3Q25A 3IX1A 4UACA 3KC0A 1VFEA 3E13X 1N3XA 3TQLA 3T66A 4JSDA 3OO6A 3E78A 1OLAA 1YXIA 2XXQA 1FW0A 1JNFA 5KCJB 2Z22A 1FQDA 4YMBA 2F3BA 2A5TA 4P0GA 3TCFA 5JTYA 4PF6A 2NUVA 4IY6A 4P11A 3EN3A 4IGTA 5ET8A 3C31A 1DBZA 4N07A 2DOJA 5LTCA 4PFWA 1US4A 3QUJA 1LBCA 3MVYA 4KI0E 4MLQA 4M4GA 3K2DA 1GR2A 4TOZA 5I58A 2O1LA 3UGWA 2ONSA 4KYEA 5CMKA 3S4UA 3T0JA 4ESWA 5AA2D 1LFHA 1RDXA 1SI1A 2XXHA 4JSOA 4HXVA 1IMDA 5CMMA 1NFTA 1IXIA 1VFDA 2V25A 4ZZEA 3SDFA 3ZKLA 1IMEA 2ONKE 2DVCA 4MBPA 1EYJA 4PDDA 1SW5A 4MLVA 4O8MA 4IO2A 3A3CA 4QFKA 1XOCA 1Y20A 3CG3A 1EYIA 4MHFA 3PUWE 5I56A 1CE2A 1QKBA 1LB8A 5I59A 3HCQA 1FQEA 3K6WA 5HBCA 4IO3A 5IGAA 2O51A 3B7DA 3PUYE 3RTWB 2PT2A 4IO5A 5L8DA 2RKMA 1MY4A 3TEPA 5DVJA 3W15C 1SBPA 4PE3A 2PYYA 1JEVA 4PBQA 1BTJA 3TODA 1MQDA 4PAIA 2HQ0A 2Q9TA 4GVOA 2QPQA 4AS4A 2UVIA 1LAHE 4HTGA 2Z8EA 2O68A 3KC1A 4PETA 4AQ4A 3C35A 2Q74A 4PDHA 2F36A 3OENA 1NUXA 3FJ7A 2ZYNA 5TP9A 4AB6A 3MVZA 4E0XA 3MC2A 3W9VA 2NOOA 3FXRA 2OX3A 3I5OA 3IFCA 3C32A 4UA8A 1LEVA 3FV2A 1JW4A 1K9ZA 3V89B 4QFPA 1P1UA 1FTMA 4M1VA 1ZKBA 4I40A 4X9TA 2UYEA 4ZEDA 3KG2A 4PGNA 2ZYKA 3CR9A 2OWSA 1IQ7A 1AOVA 4IO6A 4PE5B 4QSEA 1EZPA 4MIJA 4HCWA 2XXVA 5CMBA 1SPIA 1B0LA 3HO7A 3TKDA 3MUQA 4U23A 3IB0A 3USDA 1N3WA 4Z0IA 1XHYA 4N6PA 1JVYA 4O3CA 4KFQA 5TP9B 1JQFA 1GV8A 4WXJA 4F2QA 3CSGA 4RA1A 3MP6A 2QS1A 2FA7A 5DVIA 4POWA 1B3EA 4ZZAA 1MXXA 1MM6A 4H5FA 4R9FA 1NV4A 1O7TA 2DSFA 4NWCA 3VV5A 2OJTA 2DYXA 1FBHA 2F6GA 1O63A 3RY3A 5AE4A 3KSJA 1B7HA 4KYSA 1EU8A 3S9LC 3C9HA 2ZZXA 2IEEA 3Q26A 1ATGA 1R1NA 3LUYA 3CI8A 1PEBA 3OMBA 1USYE 2AL5A 4QFOA 4XKQA 2DWIA 1NUYA 4G2ZA 4NF5A 3FGSA 5IKBA 3LC8A 3M3LA 3A09A 4PFBA 4H45A 1YAEA 4LVQA 1FTJA 3RQTA 1NV2A 2GQ1A 3QUFA 3UIFA 5I58B 1IZ1A 2PX1A 2HZLA 2UVJA 1QUIA 1A40A 1LBWA 3K02A 4GWZA 3Q29A 5ICTA 4R6HA 4MNPA 5FHMA 3H6TA 4EF1A 3LR1A 3QXMA 2ESNA 2P1SA 1PB7A 1CB6A 2AYSA 1XVYA 1VE4A 3VE1B 3M3FA 1OIBA 3LBSA 1NKXA 1PDAA 2H25A 1LBVA 3H6WA 4XIGQ 1Q1KA 1ZMGA 1MXUA 1FBDA 2XXYA 3MSTA 2MKZA 4GXAA 4NQ8A 3EPEA 1P1QA 5KDTA 4POXA 3O28A 4OWDA 3D4CA 3N5LA 4EDPA 2XWKA 2F8DA 2R71A 3QK6A 3IORA 1FPIA 1ZBMA 1G0IA 4OXVA 2CZLA 3VVDA 1N04A 2I3VA 2DP8A 1IIWA 4HE1A 4L17A 4OANA 2I3WA 1AH5A 1B40A 4RK9A 4GQOA 3QYTA 4NF6B 3K6VA 5I57A 4EXLA 2CEXA 5FBPA 2UVGA 3CIJA 1LAXA 3VXCA 3CHGA 1NV7A 4YU0A 1B46A 1Y4CA 1B3FA 1I6BA 3L6GA 3KJ7A 4GLIA 4DCXA 2XXTA 2VD3A 1H76A 3G3FA 3CFZA 4P1EA 3ONMA 4NF6A 3FVNA 4G8MA 2FHYA 4KXPA 1URGA 3ODBA 1NV0A 4LONB 1SVXB 1ZU0A 3E9XA 3MBPA 2O7UA 3GBAA 3FZVA 2QVRA 3KN3A 3PMXA 1MPDA 2F78A 2V3UA 4ZEKA 2DE4A 2Y5LA 3LSLA 5AA4B 1FPGA 3KSXA 4ESXA 5H8NB 5I56B 1HSEA 1L5TA 1A99A 2F7CA 4NWDA 4JXIA 1QVSA 1NH7A 1FPKA 2XX9A 3KFMA 2DDKA 5FHOA 1Y4TA 3E4RA 3QAXA 4ZE8A 4R73A
chains in the Genus database with same CATH topology
4KI0E 2REJA 2PT1A 5H8SA 3TPAA 2AIXA 3A3UA 4OQOA 2UXAA 4PQJA 4DE8A 3U92A 3RPWA 3B6TA 4F19A 1SQYA 4MLQA 5B7DA 5I2NB 1LCFA 1WDNA 5I56A 1M5CA 3K2DA 1GR2A 1MQJA 4M4GA 3FXQA 4TOZA 4FJPA 5I58A 2ZNTA 2Q2CA 2O1LA 2ALUA 4LATA 3KOSA 3PD9A 3UGWA 2ONSA 4KYEA 5CMKA 3S4UA 1LSTA 4E0WA 4K3FA 1TWYA 2F7BA 3V83A 4ESWA 4MFIA 5AA2D 1B7ZA 2NXOA 2I4BA 4IY5A 1OQHA 4OFOA 4XKNA 4U1ZA 2RC7A 4FEDA 2HAUA 3RT8A 3CFLA 1SI1A 1AL3A 2XXHA 4JSOA 1NH8A 2H4IA 1TFDA 3FJGA 4QSCA 3BKIB 3U8QA 1IXCA 4G68A 1B3GA 3K1PA 4XKPA 5CMMA 3S9NC 1NFTA 2RC9A 1IXIA 1PBPA 1VFDA 2V25A 4OTEA 4ZZEA 3SDFA 1UTBA 2F7AA 2G29A 4H67A 5KDTB 3ZKLA 2Q2AA 4G68C 3U94A 4EUOA 3CSBA 4XTCQ 4BDMA 4BDQA 1MH4A 1SDXA 4O3BA 5FTIA 2XHDA 4NF4A 4F18A 3Q28A 3UP9A 5H8HB 5HPQA 1PB9A 2ONKE 4GRKA 1DMBA 2B3BA 4R6YA 2DVCA 4MBPA 5DYHA 1R9LA 4OFLA 1SW5A 5DEXA 2ONRA 4MLVA 3VLWA 5AA2A 2GFEA 4GIZA 3A3CA 4IO2A 4NF5B 1B3LA 1QUKA 4QFKA 1B7UA 4F3BA 1Y1MA 2DWAA 3U93A 3T9VA 1B1HA 1XOCA 2VD2A 1Y20A 3H6UA 3CG3A 3KN7A 3UN6A 3SEXA 4IGRA 1DTZA 1QW0A 1OMPA 1WODA 3ZKKA 1ZJLA 2VHAA 2Y7KA 3PUWE 5JTYB 1CE2A 2ANJA 1QKBA 2H9BA 3K1NA 3FD3A 4N13A 1LB8A 1UQWA 3OD7A 4DZ1A 3IJXB 4TQUQ 3UK4A 5I59A 2I0CA 5J1DA 3HCQA 1FQEA 5F1QA 3K6WA 5HBCA 4IO3A 2RF1A 2V84A 1H44A 1YPNA 5AA1A 1B58A 1J1NA 2O51A 5M2VA 3B7DA 2A5SA 3PUYE 4IO7A 4OVJA 3RTWB 3EHSA 1M5DA 1USYH 2PT2A 1P1WA 2ZMBA 3EHUA 4IO5A 5L8DA 3BBRA 3T9UA 1A55A 1PC3A 3RGYA 4OMBA 4F22A 2RKMA 3IOTA 4OHNA 3CRBA 4NF4B 2W7YA 1M5FA 1D4NA 4NF8A 1M5BA 4F3PA 1MY4A 4LQ5A 4H65A 3TEPA 3IO6A 3IO4A 3C4MA 3TTLA 5DVJA 3W15C 1MDP1 3H03A 5I84A 1SBPA 3CG1A 2PYYA 3OSQA 3N6UA 4P0IA 4U4XA 3VXBA 5KZTA 1JEVA 3OEKA 3FJMA 2HAVA 1R6ZA 3ILUB 3MAMA 4QRZA 2D21A 3BFUA 4F1YA 4FAJA 5L9OA 3T22A 4H0WA 1BTJA 2PBWA 2DQVA 1XVXA 1Y3QA 3DM0A 3GZGA 2V93A 3IB1A 5H8HA 4RPOA 3TODA 3TTMA 1B1XA 1OVBA 3G3IA 4H5GA 4R72A 1MQDA 3BFTA 1N76A 3N94A 1YTVA 3K4UA 1IUDA 1RYXA 4OERA 4Q0CA 4BLAA 5ICQA 1B4ZA 2HQ0A 2Q9TA 4YKPA 4GVOA 4DXBA 2NWJA 4PFUA 5CBRA 2QPQA 4F1UA 2HCAA 1SYIA 1ZLQA 1LAHE 2UVIA 2Z8EA 3QIMA 4GL8A 1B0HA 2O68A 1B51A 1LAFE 2O6AA 4FEBA 4HTGA 4JWXA 4FIMA 3N6TA 4MF3A 4PETA 1QULA 4ELOA 1A8EA 5H8FB 4AQ4A 3DP6A 3RN8A 3C35A 3KGCA 1I6QA 1B05A 1D9YA 2F36A 3IAZA 3OENA 4GL0A 4ZEBA 2IA4A 5K2YA 3MP1A 3RTFB 3ECRA 3EQ1A 1I69A 2Y7PA 4G8NA 2THIA 3OEMA 3FJ7A 2ZYNA 5TP9A 1II5A 2HZKA 4AB6A 3MVZA 4OWDA 4NTLA 4E0XA 5EHMA 2B3FA 5CC2A 3U72A 4JDFA 4F31B 2H99A 2RCBA 3MC2A 3W9VA 4RPNA 1MPCA 1NNFA 2NOOA 2YJPA 3MVXA 3MZBA 3FXRA 3O6HA 3B6WA 4OFJA 4OEVA 3TZAA 1S7YA 4DCYA 3PPPA 4GD5A 2I58A 5I2KA 5ELVA 3V89B 3I5OA 2R6GE 2VOZA 3UORA 1H45A 2QMWA 4OEUA 3C32A 3DP4A 4UA8A 2Y84A 3FV2A 1LGBC 4X1BA 5A5XB 3MZ1A 1JW4A 3SEWA 2ZNSA 5DTBA 2O69A 2REGA 2DWHA 3H6VA 3IJOB 3DELB 1MQGA 2X7QA 3KBRA 4QFPA 4RJZA 5ITOA 1P1UA 3GXAA 5DEXB 1XT8A 1FTMA 4M1VA 1ZKBA 2PMSA 3G3GA 4X9TA 3FVKA 1MRPA 1Q35A 3R6UA 3LSWA 1FQCA 2UYEA 4R6KA 4KYDA 2GH9A 4R2FA 3OOAA 4ZEDA 1Y9UA 1Z7NE 3G3KA 3KG2A 2RINA 1MY2A 1MY3A 2ZYKA 2OWSA 1IQ7A 3CR9A 5CBSA 1AOVA 4IO6A 4PE5B 2X7PA 4QSEA 4THIA 3G7WA 2V3TA 5IAIA 1EZPA 4HCWA 2XXVA 3LSFB 4Q8RA 4YKKA 2XX8A 5CMBA 2B65A 1B52A 4F3SA 1FTKA 1SI0A 4OYVA 3JYRA 1B0LA 3HO7A 3MW0A 5CRYA 3TKDA 4ELRA 4ZE9A 1T0KA 1MQIA 3KN8A 1NL5A 4Q30B 3MUQA 3OO7A 4DDDA 2D3IA 4YAHX 4U23A 1F9BA 3E3KA 2OK2A 3IB0A 3TCHA 3USDA 4EF2A 5HM4B 3GBBA 3IK6B 3O66A 1N3WA 3V8XB 3PD8A 4FORA 5CMCA 2E0SA 1NNTA 1XHYA 2I49A 3H4ZA 3PMVA 4MH5A 1JVYA 4N6PA 4O3CA 4O3AA 3DLNA 1B32A 2GHAA 3VE1B 4LA9A 4QFNA 2Q89A 3I3VA 4KFQA 5L9MA 1JQFA 5TP9B 1MXZA 1GV8A 3WAFA 1DTGA 4WXJA 3EHTA 5H8QA 4F2QA 2F35A 3ILTB 4ZDMA 2QMXA 3CSGA 4RA1A 1NMUA 1JETA 2QS1A 3MP6A 4ONYA 1AIVA 5I57B 3VDFA 1S9TA 2FA7A 5DVIA 5EHSA 1IITA 1MQHA 3KZGA 2ABHA 1MPBA 1RKMA 3IOVA 2DVZA 3QUJA 1JW5A 2QS2A 3K1MA 4XKRA 1B2HA 1JEUA 3FIRA 4KHZE 4POWA 1SW4A 1B3EA 3OO8A 5JEIA 3HN0A 1MXWA 3MVYA 1P1OA 4U1OA 4KCCA 4LZ8A 4ZZAA 1MXXA 1MM6A 3TELA 4BDLA 4LP2B 1FCKA 4GXSB 1LBBA 4H5FA 4Q5TA 4R9FA 2R9JA 3AXFA 1O7TA 2DSFA 3T96B 1N7XA 4NWCA 2DWJA 2OZZA 3VV5A 2QS3A 4U4SA 2OJTA 3I6VA 2XD2A 4EQ7A 2DYXA 4YB5A 5FTHA 3RUMA 2ZXTA 1MXYA 2D5WA 3IOWA 3GLBA 2F6GA 4YB7A 2XX7A 1URSA 5I59B 3TQWA 3O29A 1MY1A 1O63A 3TMGA 5TPAB 3RY3A 5AE4A 1UTHA 4QFLA 1FQFA 2Z8DA 1B7HA 3H06B 3KSJA 4OENA 5AA3A 2Z23A 4KYSA 1EU8A 4FATA 1OVTA 3HHFA 4QSDA 3KOTA 4C0RA 4ECFA 2VGQA 5CI5A 1YCJA 2F97A 1JW1A 5CM6A 1UIUA 1B4HA 2FYIA 3S9LC 3C9HA 1MDQA 3SERA 1POTA 2E1SA 2BJJX 2IEEA 1Y3NA 1O64A 3Q26A 4HS7A 4EDPA 1ATGA 1N7WA 3KJTA 4RXLA 1SW1A 1HSLA 4FE8A 1R1NA 2WKYA 3LUYA 4R9GA 3CI8A 4DIGA 1PEBA 2UVHA 2VP1A 3K6UA 3OMBA 3PPRA 4QHQA 1USYE 1EH3A 1UTHB 2AL5A 3MQ9A 4G68B 4QFOA 4XKQA 5ISUA 1EZOA 2DWIA 2QRYA 4TLLB 1B5HA 4H8IA 1ELJA 3THIA 1UIVA 2CMOA 1SYHA 4F3GA 3K0VA 3PPNA 5KCJA 4G2ZA 2I4CA 1D9VA 2DXRA 3G3JA 3Q27A 4YMAA 1SD3A 4G77A 4NF5A 3FGSA 4I8CA 3IL1B 4X1DA 3EF7A 3O97A 4KQPA 4KCDA 5I2KB 5IKBA 3LC8A 3M3LA 1DPEA 3A09A 4ND9A 3TFLA 4GOTA 1LFGA 5K2XA 1YAEA 4XXUA 4LVQA 2YLNA 3MZ9A 1A8FA 3TTNA 1FTJA 4NE4A 3RQTA 5AA2B 2ZYOA 4GWOA 4RYAA 1LFHA 3S2VA 1OLCA 1OQGA 3QUFA 4OETA 4DLDA 1M5EA 1Y3PA 4LZ7A 4WEDA 4ZS9A 1IZ1A 3IR1A 1FTOA 4TLMB 3TTRA 3UIFA 5I58B 2PX1A 4YB6A 2XXXA 5JK4A 2GRVA 3S9EA 4AB5A 3KEIA 1LFIA 5BUUA 3V5AA 2HZLA 3CVGA 4ZEFA 2UVJA 4KR5A 1GGGA 4WEPA 4ELQA 4ZECA 1QUIA 4JWOA 1A40A 4G8HA 3K02A 1S50A 4I9DA 4LQ2A 2GHBA 3Q29A 2UYFA 3PPOA 4HW8A 5ICTA 4R2BA 3B6QA 1DOTA 1GVCA 4R6HA 3R7XA 1FQBA 2QS4A 3DP8A 1FQAA 1H43A 3W9WA 5H8FA 5FHMA 4GFRA 1DPPA 3H6TA 1VSOA 3RLFE 3S9MC 4EF1A 4WKMA 5H8QB 3T93B 3LR1A 4C1TA 1POY1 1RYOA 3QXMA 4KPTA 2ESNA 1BIYA 2HXWA 2P1SA 4I62A 4F39A 2F5XA 3TAJA 1NNPA 1PB7A 2I48A 4JWYA 4GF8A 1CB6A 5BWJA 5LOMA 2AYSA 4EXKA 4C1UA 1XVYA 1VE4A 3OXNA 3H3GA 3JV9A 4OESA 4U22A 3M3FA 1OIBA 2XXIA 1A54A 3LBSA 4G4PA 5H8NA 1NKXA 4IB2A 4Z7EA 2A5TB 1PDAA 2H25A 2V3QA 4JBZA 3SKPA 3H6WA 4XIGQ 1Q1KA 1QJMA 1ZMGA 1MXUA 3P7IA 4NF8B 5AA4A 2QSXA 3PGFA 2Q88A 1BLFA 3C36A 1ZTYA 3L6HA 3OSRA 4LZ5A 1N84A 2Y7RA 5A5XA 2DE3A 2KLFA 2XXUA 2HEUA 1JVXA 3PUVE 4YKIA 3MPLA 3WAEA 2XXYA 4R74A 1US5A 2OLBA 1B5IA 3C34A 2LAOA 2Q8JA 3LSXA 1B9JA 1MG1A 3PMWA 3TTKA 3F11A 3PPQA 4GXAA 3SEUA 3EPEA 4HCYA 4PFYA 3RT6B 3T9HB 2OCUA 1P1QA 4BDRA 2XXWA 3HPIA 3O9PA 3FV1A 3MP8A 3PU5A 2X26A 5TPAA 5KDTA 1D3KA 4POXA 4ISUA 1MXVA 4QF9A 3SESA 1BKAA 3O28A 3T9XB 3ZSFA 3D4CA 1WVJA 2O7IA 1P1NA 3FVGA 3N5LA 2F8DA 2R71A 3K6XA 3IORA 3PUXE 1Y1ZA 1VR5A 3QK6A 4PP0A 3TYHA 4NMYA 1ZBMA 4F2OA 1SW2A 1PBQA 4OXVA 3UA8A 4FECA 2RCAA 5FHNA 4RNSA 1P99A 2DE2A 1B6HA 3FVOA 2CZLA 3K01A 1N04A 3VVDA 2ZNUA 3D4GA 2I3VA 1XS5A 2DP8A 2XXRA 3HSTA 3K00A 1IIWA 1URDA 3MVWA 3O6IA 4RK2A 3VLVA 1IXGA 2O84X 1KWHA 3JZJA 4L17A 4PFTA 2I3WA 1AH5A 3ZS6A 1B40A 4LUBA 1MM7A 1QKAA 4RK9A 2F6PA 4X48A 4GQOA 1BP5A 4I1DA 3VVEA 3QYTA 5L9SA 4NF6B 1EZ9A 1MH3A 3IOUA 3K6VA 1NNKA 3SEVA 4ELPA 2I0BA 3RNNA 3PUZE 4EXLA 5I57A 2OBGA 3OELA 4BDOA 4DXCA 2M8CA 2UVGA 1IEJA 1GTKA 1B3HA 2DXYA 2XXPA 3CIJA 3M3KA 1IXHA 1LAXA 3VXCA 4OZ9A 3MJNA 2H98A 3SETA 3HHGA 1N0TA 2H5YA 4YU0A 1B46A 2YPNA 4RY1A 4KD5A 5B70A 2O1MA 4F1VA 1Y4CA 1MS7A 1B3FA 4R75A 1I6BA 3L6GA 3KJ7A 1PB8A 2ZYMA 4GLIA 4DCXA 1LLSA 2HFBA 3MWBA 3O2AA 5DVFA 2XXTA 2VD3A 1MY0A 3O6GA 4YKJA 1B5JA 1H76A 1LB9A 2FNCA 3CFZA 3G3FA 3ONMA 5F7VA 3PV0E 4NF6A 2QL3A 3MPKA 3FVNA 3R26A 2Y7IA 4U21A 3G3HA 4G8MA 3QSLA 3N26A 1R9QA 3Q25A 1URGA 1HSJA 3IX1A 3ODBA 4LONB 4UACA 1TT1A 1SVXB 1VFEA 1ZU0A 3FUZA 3E13X 1N3XA 3FATA 4U2RA 4YICA 4ZEIA 3TQLA 3T66A 3E9XA 3MBPA 4Z0IA 1ANFA 2O7UA 3GBAA 3FZVA 4IO4A 3OO6A 4JSDA 2RC8A 5TU0A 1OLAA 2XXQA 4H6DA 1QUJA 1H3DA 3KN3A 3SEYA 3PMXA 1MPDA 1FW0A 2DS9A 2NVUB 1LAGE 2F78A 4NEDA 2V3UA 4ZEKA 2DE4A 3TCGA 4H1XA 3CFXA 3OO9A 2PVUA 2Z8FA 1DSNA 1JNFA 2AL4A 2P2AA 4BDNA 1TXFA 3LSLA 5AA4B 2XD3A 5KCJB 3KSXA 2Z22A 4ESXA 1FQDA 4YMBA 4YZZA 1TFAA 1LCTA 3HV1A 1AMFA 3M8UA 3VFJA 5H8NB 5I56B 3U1OA 1A7LA 2A5TA 1HSEA 3FASA 4P0GA 4DXUA 4F29A 1L5TA 3TUSA 1A99A 2F7CA 4NWDA 3TCFA 4EQ9A 1I6AA 5JTYA 1ZIUA 5EYFA 4JXIA 1QVSA 1NH7A 2NUVA 4IY6A 4EQBA 5ITPA 4P11A 2I6EA 4H8JA 4JB7A 2XX9A 3TDJA 2P0SA 2QJEA 3EN3A 4IGTA 3VLUA 1FTLA 3C33A 3VVFA 3IB2A 3C31A 2G93A 3FXUA 3KFMA 5I2NA 1XC1A 5DT6A 1UTBB 2OWTA 5FHOA 1Y4TA 4N07A 2DOJA 3E4RA 3H7MA 3QAXA 1US4A 4PFWA 4ZE8A 2Y7WA 1LBCA 1Z7ME 2F34A 4R73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KI0 E;  2REJ A;  2PT1 A;  5H8S A;  3TPA A;  2AIX A;  3A3U A;  4OQO A;  2UXA A;  4PQJ A;  4DE8 A;  3U92 A;  3RPW A;  3B6T A;  4F19 A;  1SQY A;  4MLQ A;  5B7D A;  5I2N B;  1LCF A;  1WDN A;  5I56 A;  1M5C A;  3K2D A;  1GR2 A;  1MQJ A;  4M4G A;  3FXQ A;  4TOZ A;  4FJP A;  5I58 A;  2ZNT A;  2Q2C A;  2O1L A;  2ALU A;  4LAT A;  3KOS A;  3PD9 A;  3UGW A;  2ONS A;  4KYE A;  5CMK A;  3S4U A;  1LST A;  4E0W A;  4K3F A;  1TWY A;  2F7B A;  3V83 A;  4ESW A;  4MFI A;  5AA2 D;  1B7Z A;  2NXO A;  2I4B A;  4IY5 A;  1OQH A;  4OFO A;  4XKN A;  4U1Z A;  2RC7 A;  4FED A;  2HAU A;  3RT8 A;  3CFL A;  1SI1 A;  1AL3 A;  2XXH A;  4JSO A;  1NH8 A;  2H4I A;  1TFD A;  3FJG A;  4QSC A;  3BKI B;  3U8Q A;  1IXC A;  4G68 A;  1B3G A;  3K1P A;  4XKP A;  5CMM A;  3S9N C;  1NFT A;  2RC9 A;  1IXI A;  1PBP A;  1VFD A;  2V25 A;  4OTE A;  4ZZE A;  3SDF A;  1UTB A;  2F7A A;  2G29 A;  4H67 A;  5KDT B;  3ZKL A;  2Q2A A;  4G68 C;  3U94 A;  4EUO A;  3CSB A;  4XTC Q;  4BDM A;  4BDQ A;  1MH4 A;  1SDX A;  4O3B A;  5FTI A;  2XHD A;  4NF4 A;  4F18 A;  3Q28 A;  3UP9 A;  5H8H B;  5HPQ A;  1PB9 A;  2ONK E;  4GRK A;  1DMB A;  2B3B A;  4R6Y A;  2DVC A;  4MBP A;  5DYH A;  1R9L A;  4OFL A;  1SW5 A;  5DEX A;  2ONR A;  4MLV A;  3VLW A;  5AA2 A;  2GFE A;  4GIZ A;  3A3C A;  4IO2 A;  4NF5 B;  1B3L A;  1QUK A;  4QFK A;  1B7U A;  4F3B A;  1Y1M A;  2DWA A;  3U93 A;  3T9V A;  1B1H A;  1XOC A;  2VD2 A;  1Y20 A;  3H6U A;  3CG3 A;  3KN7 A;  3UN6 A;  3SEX A;  4IGR A;  1DTZ A;  1QW0 A;  1OMP A;  1WOD A;  3ZKK A;  1ZJL A;  2VHA A;  2Y7K A;  3PUW E;  5JTY B;  1CE2 A;  2ANJ A;  1QKB A;  2H9B A;  3K1N A;  3FD3 A;  4N13 A;  1LB8 A;  1UQW A;  3OD7 A;  4DZ1 A;  3IJX B;  4TQU Q;  3UK4 A;  5I59 A;  2I0C A;  5J1D A;  3HCQ A;  1FQE A;  5F1Q A;  3K6W A;  5HBC A;  4IO3 A;  2RF1 A;  2V84 A;  1H44 A;  1YPN A;  5AA1 A;  1B58 A;  1J1N A;  2O51 A;  5M2V A;  3B7D A;  2A5S A;  3PUY E;  4IO7 A;  4OVJ A;  3RTW B;  3EHS A;  1M5D A;  1USY H;  2PT2 A;  1P1W A;  2ZMB A;  3EHU A;  4IO5 A;  5L8D A;  3BBR A;  3T9U A;  1A55 A;  1PC3 A;  3RGY A;  4OMB A;  4F22 A;  2RKM A;  3IOT A;  4OHN A;  3CRB A;  4NF4 B;  2W7Y A;  1M5F A;  1D4N A;  4NF8 A;  1M5B A;  4F3P A;  1MY4 A;  4LQ5 A;  4H65 A;  3TEP A;  3IO6 A;  3IO4 A;  3C4M A;  3TTL A;  5DVJ A;  3W15 C;  1MDP 1;  3H03 A;  5I84 A;  1SBP A;  3CG1 A;  2PYY A;  3OSQ A;  3N6U A;  4P0I A;  4U4X A;  3VXB A;  5KZT A;  1JEV A;  3OEK A;  3FJM A;  2HAV A;  1R6Z A;  3ILU B;  3MAM A;  4QRZ A;  2D21 A;  3BFU A;  4F1Y A;  4FAJ A;  5L9O A;  3T22 A;  4H0W A;  1BTJ A;  2PBW A;  2DQV A;  1XVX A;  1Y3Q A;  3DM0 A;  3GZG A;  2V93 A;  3IB1 A;  5H8H A;  4RPO A;  3TOD A;  3TTM A;  1B1X A;  1OVB A;  3G3I A;  4H5G A;  4R72 A;  1MQD A;  3BFT A;  1N76 A;  3N94 A;  1YTV A;  3K4U A;  1IUD A;  1RYX A;  4OER A;  4Q0C A;  4BLA A;  5ICQ A;  1B4Z A;  2HQ0 A;  2Q9T A;  4YKP A;  4GVO A;  4DXB A;  2NWJ A;  4PFU A;  5CBR A;  2QPQ A;  4F1U A;  2HCA A;  1SYI A;  1ZLQ A;  1LAH E;  2UVI A;  2Z8E A;  3QIM A;  4GL8 A;  1B0H A;  2O68 A;  1B51 A;  1LAF E;  2O6A A;  4FEB A;  4HTG A;  4JWX A;  4FIM A;  3N6T A;  4MF3 A;  4PET A;  1QUL A;  4ELO A;  1A8E A;  5H8F B;  4AQ4 A;  3DP6 A;  3RN8 A;  3C35 A;  3KGC A;  1I6Q A;  1B05 A;  1D9Y A;  2F36 A;  3IAZ A;  3OEN A;  4GL0 A;  4ZEB A;  2IA4 A;  5K2Y A;  3MP1 A;  3RTF B;  3ECR A;  3EQ1 A;  1I69 A;  2Y7P A;  4G8N A;  2THI A;  3OEM A;  3FJ7 A;  2ZYN A;  5TP9 A;  1II5 A;  2HZK A;  4AB6 A;  3MVZ A;  4OWD A;  4NTL A;  4E0X A;  5EHM A;  2B3F A;  5CC2 A;  3U72 A;  4JDF A;  4F31 B;  2H99 A;  2RCB A;  3MC2 A;  3W9V A;  4RPN A;  1MPC A;  1NNF A;  2NOO A;  2YJP A;  3MVX A;  3MZB A;  3FXR A;  3O6H A;  3B6W A;  4OFJ A;  4OEV A;  3TZA A;  1S7Y A;  4DCY A;  3PPP A;  4GD5 A;  2I58 A;  5I2K A;  5ELV A;  3V89 B;  3I5O A;  2R6G E;  2VOZ A;  3UOR A;  1H45 A;  2QMW A;  4OEU A;  3C32 A;  3DP4 A;  4UA8 A;  2Y84 A;  3FV2 A;  1LGB C;  4X1B A;  5A5X B;  3MZ1 A;  1JW4 A;  3SEW A;  2ZNS A;  5DTB A;  2O69 A;  2REG A;  2DWH A;  3H6V A;  3IJO B;  3DEL B;  1MQG A;  2X7Q A;  3KBR A;  4QFP A;  4RJZ A;  5ITO A;  1P1U A;  3GXA A;  5DEX B;  1XT8 A;  1FTM A;  4M1V A;  1ZKB A;  2PMS A;  3G3G A;  4X9T A;  3FVK A;  1MRP A;  1Q35 A;  3R6U A;  3LSW A;  1FQC A;  2UYE A;  4R6K A;  4KYD A;  2GH9 A;  4R2F A;  3OOA A;  4ZED A;  1Y9U A;  1Z7N E;  3G3K A;  3KG2 A;  2RIN A;  1MY2 A;  1MY3 A;  2ZYK A;  2OWS A;  1IQ7 A;  3CR9 A;  5CBS A;  1AOV A;  4IO6 A;  4PE5 B;  2X7P A;  4QSE A;  4THI A;  3G7W A;  2V3T A;  5IAI A;  1EZP A;  4HCW A;  2XXV A;  3LSF B;  4Q8R A;  4YKK A;  2XX8 A;  5CMB A;  2B65 A;  1B52 A;  4F3S A;  1FTK A;  1SI0 A;  4OYV A;  3JYR A;  1B0L A;  3HO7 A;  3MW0 A;  5CRY A;  3TKD A;  4ELR A;  4ZE9 A;  1T0K A;  1MQI A;  3KN8 A;  1NL5 A;  4Q30 B;  3MUQ A;  3OO7 A;  4DDD A;  2D3I A;  4YAH X;  4U23 A;  1F9B A;  3E3K A;  2OK2 A;  3IB0 A;  3TCH A;  3USD A;  4EF2 A;  5HM4 B;  3GBB A;  3IK6 B;  3O66 A;  1N3W A;  3V8X B;  3PD8 A;  4FOR A;  5CMC A;  2E0S A;  1NNT A;  1XHY A;  2I49 A;  3H4Z A;  3PMV A;  4MH5 A;  1JVY A;  4N6P A;  4O3C A;  4O3A A;  3DLN A;  1B32 A;  2GHA A;  3VE1 B;  4LA9 A;  4QFN A;  2Q89 A;  3I3V A;  4KFQ A;  5L9M A;  1JQF A;  5TP9 B;  1MXZ A;  1GV8 A;  3WAF A;  1DTG A;  4WXJ A;  3EHT A;  5H8Q A;  4F2Q A;  2F35 A;  3ILT B;  4ZDM A;  2QMX A;  3CSG A;  4RA1 A;  1NMU A;  1JET A;  2QS1 A;  3MP6 A;  4ONY A;  1AIV A;  5I57 B;  3VDF A;  1S9T A;  2FA7 A;  5DVI A;  5EHS A;  1IIT A;  1MQH A;  3KZG A;  2ABH A;  1MPB A;  1RKM A;  3IOV A;  2DVZ A;  3QUJ A;  1JW5 A;  2QS2 A;  3K1M A;  4XKR A;  1B2H A;  1JEU A;  3FIR A;  4KHZ E;  4POW A;  1SW4 A;  1B3E A;  3OO8 A;  5JEI A;  3HN0 A;  1MXW A;  3MVY A;  1P1O A;  4U1O A;  4KCC A;  4LZ8 A;  4ZZA A;  1MXX A;  1MM6 A;  3TEL A;  4BDL A;  4LP2 B;  1FCK A;  4GXS B;  1LBB A;  4H5F A;  4Q5T A;  4R9F A;  2R9J A;  3AXF A;  1O7T A;  2DSF A;  3T96 B;  1N7X A;  4NWC A;  2DWJ A;  2OZZ A;  3VV5 A;  2QS3 A;  4U4S A;  2OJT A;  3I6V A;  2XD2 A;  4EQ7 A;  2DYX A;  4YB5 A;  5FTH A;  3RUM A;  2ZXT A;  1MXY A;  2D5W A;  3IOW A;  3GLB A;  2F6G A;  4YB7 A;  2XX7 A;  1URS A;  5I59 B;  3TQW A;  3O29 A;  1MY1 A;  1O63 A;  3TMG A;  5TPA B;  3RY3 A;  5AE4 A;  1UTH A;  4QFL A;  1FQF A;  2Z8D A;  1B7H A;  3H06 B;  3KSJ A;  4OEN A;  5AA3 A;  2Z23 A;  4KYS A;  1EU8 A;  4FAT A;  1OVT A;  3HHF A;  4QSD A;  3KOT A;  4C0R A;  4ECF A;  2VGQ A;  5CI5 A;  1YCJ A;  2F97 A;  1JW1 A;  5CM6 A;  1UIU A;  1B4H A;  2FYI A;  3S9L C;  3C9H A;  1MDQ A;  3SER A;  1POT A;  2E1S A;  2BJJ X;  2IEE A;  1Y3N A;  1O64 A;  3Q26 A;  4HS7 A;  4EDP A;  1ATG A;  1N7W A;  3KJT A;  4RXL A;  1SW1 A;  1HSL A;  4FE8 A;  1R1N A;  2WKY A;  3LUY A;  4R9G A;  3CI8 A;  4DIG A;  1PEB A;  2UVH A;  2VP1 A;  3K6U A;  3OMB A;  3PPR A;  4QHQ A;  1USY E;  1EH3 A;  1UTH B;  2AL5 A;  3MQ9 A;  4G68 B;  4QFO A;  4XKQ A;  5ISU A;  1EZO A;  2DWI A;  2QRY A;  4TLL B;  1B5H A;  4H8I A;  1ELJ A;  3THI A;  1UIV A;  2CMO A;  1SYH A;  4F3G A;  3K0V A;  3PPN A;  5KCJ A;  4G2Z A;  2I4C A;  1D9V A;  2DXR A;  3G3J A;  3Q27 A;  4YMA A;  1SD3 A;  4G77 A;  4NF5 A;  3FGS A;  4I8C A;  3IL1 B;  4X1D A;  3EF7 A;  3O97 A;  4KQP A;  4KCD A;  5I2K B;  5IKB A;  3LC8 A;  3M3L A;  1DPE A;  3A09 A;  4ND9 A;  3TFL A;  4GOT A;  1LFG A;  5K2X A;  1YAE A;  4XXU A;  4LVQ A;  2YLN A;  3MZ9 A;  1A8F A;  3TTN A;  1FTJ A;  4NE4 A;  3RQT A;  5AA2 B;  2ZYO A;  4GWO A;  4RYA A;  1LFH A;  3S2V A;  1OLC A;  1OQG A;  3QUF A;  4OET A;  4DLD A;  1M5E A;  1Y3P A;  4LZ7 A;  4WED A;  4ZS9 A;  1IZ1 A;  3IR1 A;  1FTO A;  4TLM B;  3TTR A;  3UIF A;  5I58 B;  2PX1 A;  4YB6 A;  2XXX A;  5JK4 A;  2GRV A;  3S9E A;  4AB5 A;  3KEI A;  1LFI A;  5BUU A;  3V5A A;  2HZL A;  3CVG A;  4ZEF A;  2UVJ A;  4KR5 A;  1GGG A;  4WEP A;  4ELQ A;  4ZEC A;  1QUI A;  4JWO A;  1A40 A;  4G8H A;  3K02 A;  1S50 A;  4I9D A;  4LQ2 A;  2GHB A;  3Q29 A;  2UYF A;  3PPO A;  4HW8 A;  5ICT A;  4R2B A;  3B6Q A;  1DOT A;  1GVC A;  4R6H A;  3R7X A;  1FQB A;  2QS4 A;  3DP8 A;  1FQA A;  1H43 A;  3W9W A;  5H8F A;  5FHM A;  4GFR A;  1DPP A;  3H6T A;  1VSO A;  3RLF E;  3S9M C;  4EF1 A;  4WKM A;  5H8Q B;  3T93 B;  3LR1 A;  4C1T A;  1POY 1;  1RYO A;  3QXM A;  4KPT A;  2ESN A;  1BIY A;  2HXW A;  2P1S A;  4I62 A;  4F39 A;  2F5X A;  3TAJ A;  1NNP A;  1PB7 A;  2I48 A;  4JWY A;  4GF8 A;  1CB6 A;  5BWJ A;  5LOM A;  2AYS A;  4EXK A;  4C1U A;  1XVY A;  1VE4 A;  3OXN A;  3H3G A;  3JV9 A;  4OES A;  4U22 A;  3M3F A;  1OIB A;  2XXI A;  1A54 A;  3LBS A;  4G4P A;  5H8N A;  1NKX A;  4IB2 A;  4Z7E A;  2A5T B;  1PDA A;  2H25 A;  2V3Q A;  4JBZ A;  3SKP A;  3H6W A;  4XIG Q;  1Q1K A;  1QJM A;  1ZMG A;  1MXU A;  3P7I A;  4NF8 B;  5AA4 A;  2QSX A;  3PGF A;  2Q88 A;  1BLF A;  3C36 A;  1ZTY A;  3L6H A;  3OSR A;  4LZ5 A;  1N84 A;  2Y7R A;  5A5X A;  2DE3 A;  2KLF A;  2XXU A;  2HEU A;  1JVX A;  3PUV E;  4YKI A;  3MPL A;  3WAE A;  2XXY A;  4R74 A;  1US5 A;  2OLB A;  1B5I A;  3C34 A;  2LAO A;  2Q8J A;  3LSX A;  1B9J A;  1MG1 A;  3PMW A;  3TTK A;  3F11 A;  3PPQ A;  4GXA A;  3SEU A;  3EPE A;  4HCY A;  4PFY A;  3RT6 B;  3T9H B;  2OCU A;  1P1Q A;  4BDR A;  2XXW A;  3HPI A;  3O9P A;  3FV1 A;  3MP8 A;  3PU5 A;  2X26 A;  5TPA A;  5KDT A;  1D3K A;  4POX A;  4ISU A;  1MXV A;  4QF9 A;  3SES A;  1BKA A;  3O28 A;  3T9X B;  3ZSF A;  3D4C A;  1WVJ A;  2O7I A;  1P1N A;  3FVG A;  3N5L A;  2F8D A;  2R71 A;  3K6X A;  3IOR A;  3PUX E;  1Y1Z A;  1VR5 A;  3QK6 A;  4PP0 A;  3TYH A;  4NMY A;  1ZBM A;  4F2O A;  1SW2 A;  1PBQ A;  4OXV A;  3UA8 A;  4FEC A;  2RCA A;  5FHN A;  4RNS A;  1P99 A;  2DE2 A;  1B6H A;  3FVO A;  2CZL A;  3K01 A;  1N04 A;  3VVD A;  2ZNU A;  3D4G A;  2I3V A;  1XS5 A;  2DP8 A;  2XXR A;  3HST A;  3K00 A;  1IIW A;  1URD A;  3MVW A;  3O6I A;  4RK2 A;  3VLV A;  1IXG A;  2O84 X;  1KWH A;  3JZJ A;  4L17 A;  4PFT A;  2I3W A;  1AH5 A;  3ZS6 A;  1B40 A;  4LUB A;  1MM7 A;  1QKA A;  4RK9 A;  2F6P A;  4X48 A;  4GQO A;  1BP5 A;  4I1D A;  3VVE A;  3QYT A;  5L9S A;  4NF6 B;  1EZ9 A;  1MH3 A;  3IOU A;  3K6V A;  1NNK A;  3SEV A;  4ELP A;  2I0B A;  3RNN A;  3PUZ E;  4EXL A;  5I57 A;  2OBG A;  3OEL A;  4BDO A;  4DXC A;  2M8C A;  2UVG A;  1IEJ A;  1GTK A;  1B3H A;  2DXY A;  2XXP A;  3CIJ A;  3M3K A;  1IXH A;  1LAX A;  3VXC A;  4OZ9 A;  3MJN A;  2H98 A;  3SET A;  3HHG A;  1N0T A;  2H5Y A;  4YU0 A;  1B46 A;  2YPN A;  4RY1 A;  4KD5 A;  5B70 A;  2O1M A;  4F1V A;  1Y4C A;  1MS7 A;  1B3F A;  4R75 A;  1I6B A;  3L6G A;  3KJ7 A;  1PB8 A;  2ZYM A;  4GLI A;  4DCX A;  1LLS A;  2HFB A;  3MWB A;  3O2A A;  5DVF A;  2XXT A;  2VD3 A;  1MY0 A;  3O6G A;  4YKJ A;  1B5J A;  1H76 A;  1LB9 A;  2FNC A;  3CFZ A;  3G3F A;  3ONM A;  5F7V A;  3PV0 E;  4NF6 A;  2QL3 A;  3MPK A;  3FVN A;  3R26 A;  2Y7I A;  4U21 A;  3G3H A;  4G8M A;  3QSL A;  3N26 A;  1R9Q A;  3Q25 A;  1URG A;  1HSJ A;  3IX1 A;  3ODB A;  4LON B;  4UAC A;  1TT1 A;  1SVX B;  1VFE A;  1ZU0 A;  3FUZ A;  3E13 X;  1N3X A;  3FAT A;  4U2R A;  4YIC A;  4ZEI A;  3TQL A;  3T66 A;  3E9X A;  3MBP A;  4Z0I A;  1ANF A;  2O7U A;  3GBA A;  3FZV A;  4IO4 A;  3OO6 A;  4JSD A;  2RC8 A;  5TU0 A;  1OLA A;  2XXQ A;  4H6D A;  1QUJ A;  1H3D A;  3KN3 A;  3SEY A;  3PMX A;  1MPD A;  1FW0 A;  2DS9 A;  2NVU B;  1LAG E;  2F78 A;  4NED A;  2V3U A;  4ZEK A;  2DE4 A;  3TCG A;  4H1X A;  3CFX A;  3OO9 A;  2PVU A;  2Z8F A;  1DSN A;  1JNF A;  2AL4 A;  2P2A A;  4BDN A;  1TXF A;  3LSL A;  5AA4 B;  2XD3 A;  5KCJ B;  3KSX A;  2Z22 A;  4ESX A;  1FQD A;  4YMB A;  4YZZ A;  1TFA A;  1LCT A;  3HV1 A;  1AMF A;  3M8U A;  3VFJ A;  5H8N B;  5I56 B;  3U1O A;  1A7L A;  2A5T A;  1HSE A;  3FAS A;  4P0G A;  4DXU A;  4F29 A;  1L5T A;  3TUS A;  1A99 A;  2F7C A;  4NWD A;  3TCF A;  4EQ9 A;  1I6A A;  5JTY A;  1ZIU A;  5EYF A;  4JXI A;  1QVS A;  1NH7 A;  2NUV A;  4IY6 A;  4EQB A;  5ITP A;  4P11 A;  2I6E A;  4H8J A;  4JB7 A;  2XX9 A;  3TDJ A;  2P0S A;  2QJE A;  3EN3 A;  4IGT A;  3VLU A;  1FTL A;  3C33 A;  3VVF A;  3IB2 A;  3C31 A;  2G93 A;  3FXU A;  3KFM A;  5I2N A;  1XC1 A;  5DT6 A;  1UTB B;  2OWT A;  5FHO A;  1Y4T A;  4N07 A;  2DOJ A;  3E4R A;  3H7M A;  3QAX A;  1US4 A;  4PFW A;  4ZE8 A;  2Y7W A;  1LBC A;  1Z7M E;  2F34 A;  4R73 A; 
#chains in the Genus database with same CATH topology
 5H8S A;  3B50 A;  3B6T A;  3RPW A;  1LCF A;  1M5C A;  3BIG A;  2ZNT A;  4LAT A;  4NGU A;  3PD9 A;  4PC9 A;  2WEF A;  1LST A;  2F7B A;  4XKN A;  3RT8 A;  3CFL A;  1NH8 A;  2F3D A;  2H4I A;  3S9N C;  2RC9 A;  4OTE A;  5KDT B;  4G68 C;  4O3B A;  5FTI A;  4NF4 A;  3Q28 A;  4GWX A;  4N91 A;  4GRK A;  1DMB A;  5DYH A;  2XA5 A;  2GFE A;  4NF5 B;  1B3L A;  1Y1M A;  3T9V A;  2ZZV A;  3UN6 A;  1QW0 A;  1OMP A;  3ZKK A;  4NX1 A;  4N13 A;  3FD3 A;  1UQW A;  3IJX B;  1USY H;  1P1W A;  3EHU A;  4I3Y A;  2B4L A;  3BBR A;  1A55 A;  4F22 A;  3IOT A;  3CRB A;  2P3N A;  2FIE A;  1M5F A;  4GWW A;  4NF8 A;  1M5B A;  4N6D A;  4H65 A;  3TTL A;  2XWI A;  5I84 A;  1MDP 1;  4U4X A;  4FBP A;  2HAV A;  3MAM A;  2D21 A;  1JP4 A;  3GZG A;  1XVX A;  3TYH A;  3TTM A;  1OVB A;  4H5G A;  1B4Z A;  4DXB A;  4F1U A;  2HCA A;  1ZLQ A;  3QIM A;  5H8F B;  1LAF E;  4TQU Q;  2O6A A;  4FEB A;  3RN8 A;  4NF0 A;  1BK4 A;  2Y7P A;  2THI A;  2HZK A;  4NTL A;  5CC2 A;  2H99 A;  4RPN A;  1MPC A;  1NNF A;  2YJP A;  3O6H A;  3MVX A;  3MZB A;  4OEV A;  3B6W A;  2Q8M A;  1FPJ A;  3PPP A;  5I2K A;  3UOR A;  4OEU A;  3MZ1 A;  5DTB A;  1DCU A;  2O69 A;  2REG A;  2Y5K A;  4RJZ A;  3DEL B;  2X7Q A;  5ITO A;  1XT8 A;  2PMS A;  3G3G A;  3LSW A;  4R2F A;  3OOA A;  2RIN A;  1MY3 A;  4OVQ A;  5CBS A;  2X7P A;  4THI A;  3G7W A;  3FXB A;  4YKK A;  2XX8 A;  4ELR A;  3T1B A;  4YAH X;  1F9B A;  3E3K A;  4GWY A;  3GBB A;  1FPD A;  3PD8 A;  2E0S A;  3H4Z A;  3DLN A;  4LA9 A;  4GWU A;  1DTG A;  1FJ9 A;  3EHT A;  2F35 A;  4GX3 A;  2R8T A;  1JET A;  1RDY A;  3VDF A;  2QS2 A;  4XKR A;  1JEU A;  3FIR A;  5JEI A;  3HN0 A;  1MXW A;  1P1O A;  3ROJ A;  1FBG A;  3TEL A;  1FCK A;  4N8Y A;  4MNI A;  1CNQ A;  2R9J A;  3AXF A;  1N7X A;  2QS3 A;  1NV3 A;  2ZXT A;  1MXY A;  2D5W A;  4YB7 A;  4MEV A;  5TPA B;  4NHB A;  3IFA A;  5ET7 A;  4QFL A;  1LBZ A;  2Z8D A;  3H06 B;  5AA3 A;  4FAT A;  4OVP A;  1UIU A;  3SER A;  2E1S A;  4P56 A;  4HS7 A;  4RXL A;  1SW1 A;  5T3J A;  5IM2 A;  2UVH A;  2VP1 A;  2XWO A;  1FRP A;  4QHQ A;  3MQ9 A;  4G68 B;  5ISU A;  2BJI A;  1B5H A;  4H8I A;  1ELJ A;  3ISP A;  2CMO A;  1SYH A;  3K0V A;  1D9V A;  2QVV A;  1Q9D A;  5EYH A;  5I2K B;  3O97 A;  4KCD A;  4ND9 A;  3TFL A;  5AA2 B;  3QMF A;  4GWO A;  3S2V A;  1OQG A;  4N6K A;  4P1L A;  4YB6 A;  4MX6 A;  3CVG A;  4WEP A;  2HXR A;  1S50 A;  4I9D A;  3PPO A;  4HW8 A;  5IZ3 A;  4GBV A;  1GVC A;  1DOT A;  3R7X A;  2QS4 A;  5H8F A;  1VSO A;  3RLF E;  4WKM A;  3A29 A;  3RPL B;  1RYO A;  4I62 A;  4F39 A;  2F5X A;  1NNP A;  3GYY A;  5LOM A;  4JWY A;  4GF8 A;  5BWJ A;  3OXN A;  4U22 A;  2XXI A;  1QJM A;  3PGF A;  1BLF A;  3L6H A;  3OSR A;  4H46 A;  1N84 A;  4LZ5 A;  2DE3 A;  3PUV E;  1US5 A;  2OLB A;  3C34 A;  2Q8J A;  3LSX A;  1MG1 A;  3PMW A;  3F11 A;  3RT6 B;  4PFY A;  3T9H B;  2OCU A;  2HHM A;  3HPI A;  3PU5 A;  4OA4 A;  1D3K A;  4ISU A;  1KA1 A;  3T9X B;  2O7I A;  3K6X A;  3PUX E;  4NMY A;  4F2O A;  1YYZ A;  2RCA A;  5FHN A;  1B6H A;  3FVO A;  3K01 A;  4MAG A;  3HST A;  4RK2 A;  1URD A;  3O6I A;  1KWH A;  4LUB A;  1MM7 A;  2FIX A;  4I1D A;  4QXD A;  5L9S A;  1EZ9 A;  1MH3 A;  3IOU A;  4GX4 A;  2OBG A;  4BDO A;  4MNC A;  2M8C A;  1IEJ A;  1GTK A;  2DXY A;  2XXP A;  3M3K A;  4NN3 A;  2V4C A;  3MJN A;  3HHG A;  1N0T A;  2H5Y A;  5DW8 A;  4KD5 A;  2ZYM A;  3MWB A;  5DVF A;  1B5J A;  2QL3 A;  5F24 A;  3R26 A;  1HSJ A;  4I3E A;  4PGP A;  1TT1 A;  5I2N B;  3FUZ A;  3KBZ A;  4ZEI A;  3FAT A;  4YIC A;  2CZK A;  5J16 A;  4IO4 A;  4P3L A;  5TU0 A;  4H6D A;  4AS5 A;  3SEY A;  2DS9 A;  4NED A;  3TCG A;  4QBA A;  2AL4 A;  2XD3 A;  4N4U A;  1TFA A;  3HV1 A;  3M8U A;  1AMF A;  4DXU A;  3TUS A;  4EQ9 A;  4EQB A;  2I6E A;  4H8J A;  4JB7 A;  3VLU A;  2QJE A;  1FTL A;  3IB2 A;  2G93 A;  3FXU A;  2CZI A;  5I2N A;  1XC1 A;  2OWT A;  4OVS A;  2Y7W A;  2F34 A;  4OQO A;  4PQJ A;  1SQY A;  5B7D A;  4PFI A;  1MQJ A;  3FXQ A;  2ALU A;  5EQA A;  4E0W A;  4K3F A;  1B7Z A;  2WX9 A;  2I4B A;  1AL3 A;  5I3S A;  1TFD A;  3FJG A;  4QSC A;  3BKI B;  2ZZW A;  1IXC A;  2WBB A;  4H67 A;  4EUO A;  3U94 A;  4BDM A;  1MH4 A;  1SDX A;  5IAI A;  4F18 A;  5H8H B;  1PB9 A;  5LDZ A;  4R6Y A;  1R9L A;  4OFL A;  2ONR A;  3VLW A;  1QUK A;  4F3B A;  2DWA A;  3H6U A;  3KN7 A;  4O7M A;  1DTZ A;  1WOD A;  1ZJL A;  2VHA A;  4XTC Q;  4DZ1 A;  3UK4 A;  5F1Q A;  1H44 A;  1B58 A;  2A5S A;  4OVJ A;  3T9U A;  1PC3 A;  3RGY A;  4NF4 B;  5EQ9 A;  1IMB A;  1D4N A;  4MJO A;  4O94 A;  3IO6 A;  1QGX A;  2FBP A;  3C4M A;  2KR0 A;  3CG1 A;  5KZT A;  3OSQ A;  5ESY A;  3VXB A;  3OEK A;  3FJM A;  4QRZ A;  4FAJ A;  4XFE A;  3T22 A;  2DQV A;  3DM0 A;  3IB1 A;  2V93 A;  1B1X A;  4MCO A;  3BFT A;  1N76 A;  3N94 A;  1YTV A;  4BLA A;  1IUD A;  1RYX A;  4OER A;  4Q0C A;  5CBR A;  4YKP A;  1FBE A;  2NWJ A;  4PFU A;  2L5V A;  1B0H A;  4JWX A;  3N6T A;  3KGC A;  1D9Y A;  4GL0 A;  5K2Y A;  3RTF B;  1I69 A;  3OEM A;  5EHM A;  4F31 B;  2RCB A;  4P47 A;  4OFJ A;  3TZA A;  1S7Y A;  4DCY A;  4GD5 A;  2R6G E;  1H45 A;  1NUZ A;  2Y84 A;  1LGB C;  4X1B A;  3SEW A;  2ZNS A;  2DWH A;  3H6V A;  3GXA A;  5DEX B;  3FVK A;  1Q35 A;  1FQC A;  4GWS A;  4MMP A;  3G3K A;  4HE2 A;  4OVT A;  2V3T A;  3LSF B;  4F3S A;  1B52 A;  1FTK A;  4OYV A;  3JYR A;  3MW0 A;  5CRY A;  4ZE9 A;  4JVD A;  4Q30 B;  3OO7 A;  4DDD A;  2D3I A;  4PCD A;  2QVU A;  3IK6 B;  3O66 A;  3V8X B;  4FOR A;  5CMC A;  2I49 A;  3PMV A;  5EQ8 A;  2GHA A;  2Q89 A;  3WAF A;  5L9M A;  5H8Q A;  3ILT B;  4HE0 A;  4ONY A;  3E79 A;  1AIV A;  5EHS A;  3KZG A;  1MQH A;  5EYG A;  3IOV A;  1JW5 A;  3K1M A;  1SW4 A;  5EQ7 A;  4U1O A;  4LZ8 A;  4LP2 B;  2DWJ A;  4N8G A;  2OZZ A;  4U4S A;  4EQ7 A;  3I6V A;  3RUM A;  5FTH A;  3GLB A;  3LV0 A;  3O29 A;  3TMG A;  4O7I A;  3U65 A;  1OVT A;  3HHF A;  4C0R A;  4ECF A;  2F97 A;  5CM6 A;  1B4H A;  1MDQ A;  2BJJ X;  1O64 A;  1N7W A;  3KJT A;  4DIG A;  1UTH B;  1EZO A;  3THI A;  3PPN A;  3G3J A;  4YMA A;  4G77 A;  4I8C A;  3IL1 B;  4X1D A;  3EF7 A;  4KQP A;  3SZP A;  1DPE A;  1IMA A;  5K2X A;  4XXU A;  4UAB A;  2YLN A;  3MZ9 A;  4NE4 A;  2ZYO A;  1IMF A;  4RYA A;  5A5X B;  4OET A;  1M5E A;  5L9O A;  4TLM B;  5JK4 A;  3S9E A;  2GRV A;  4AB5 A;  3KEI A;  3V5A A;  4ZEC A;  4ELQ A;  4KR5 A;  4G8H A;  1INP A;  3B6Q A;  1FQB A;  3DP8 A;  1FQA A;  1H43 A;  3W9W A;  4GFR A;  1DPP A;  3S9M C;  5H8Q B;  4C1T A;  1POY 1;  5A5L A;  3H3G A;  4OES A;  4Z7E A;  2V3Q A;  4PBH A;  4JBZ A;  4NF8 B;  4N15 A;  2QSX A;  1ZTY A;  2P3V A;  2XXK A;  5A5X A;  3WAE A;  5I5P A;  4LN5 A;  1B5I A;  3PPQ A;  3SEU A;  1KZ8 A;  4HCY A;  4BDR A;  1XI6 A;  1FBF A;  4NAP A;  3O9P A;  3MP8 A;  5TPA A;  1MXV A;  4N81 A;  2OWZ A;  3SES A;  3ZSF A;  1Y1Z A;  1VR5 A;  4PP0 A;  1PBQ A;  4FEC A;  4RNS A;  1P99 A;  1NV6 A;  2ZNU A;  3D4G A;  2XXR A;  3VLV A;  2JJK A;  1IXG A;  2O84 X;  4X48 A;  2F6P A;  1BP5 A;  3VVE A;  4ELP A;  1NNK A;  4NG7 A;  3PUZ E;  3OEL A;  4DXC A;  2H98 A;  5IZZ A;  1G0H A;  1NUW A;  4RY1 A;  5B70 A;  4F1V A;  4JVC A;  1LLS A;  4JVI A;  3O6G A;  5F7V A;  3PV0 E;  2XWV A;  3N26 A;  4U2R A;  1ANF A;  2RC8 A;  1FSA A;  1QUJ A;  1H3D A;  2NVU B;  1LAG E;  4H1X A;  3CFX A;  3OO9 A;  2PVU A;  2Z8F A;  1DSN A;  4PTK A;  2P2A A;  4BDN A;  1TXF A;  4YZZ A;  1LCT A;  3VFJ A;  3MYU A;  3U1O A;  1A7L A;  3FAS A;  4F29 A;  1I6A A;  1ZIU A;  5EYF A;  4X8R A;  5ITP A;  1FPE A;  3TDJ A;  2P0S A;  3C33 A;  3VVF A;  5DT6 A;  1UTB B;  3H7M A;  4XF5 A;  5IZ3 B;  3U72 A;  1Z7M E;  2REJ A;  2PT1 A;  3TPA A;  2AIX A;  3A3U A;  2UXA A;  3U92 A;  4F19 A;  4P9K A;  1WDN A;  4FJP A;  2Q2C A;  3KOS A;  3HFU A;  1TWY A;  3V83 A;  4MFI A;  2NXO A;  4IY5 A;  4OFO A;  1OQH A;  4U1Z A;  2RC7 A;  4FED A;  4N17 A;  1KA0 A;  2HAU A;  3U8Q A;  4G68 A;  1B3G A;  3K1P A;  4XKP A;  3NOH A;  1PBP A;  1UTB A;  2F7A A;  2G29 A;  2Q2A A;  3CSB A;  4BDQ A;  2XHD A;  5HPQ A;  3UP9 A;  2B3B A;  5DEX A;  5AA2 A;  4GIZ A;  1B7U A;  3U93 A;  1B1H A;  1FPB A;  2VD2 A;  3SEX A;  4IGR A;  2Y7K A;  2H9B A;  2ANJ A;  3K1N A;  2VT5 A;  5J1D A;  3OD7 A;  1NV1 A;  2I0C A;  2RF1 A;  2V84 A;  1D9Q A;  1YPN A;  5IZ1 A;  1J1N A;  5AA1 A;  5M2V A;  4IO7 A;  2PFZ A;  3EHS A;  1M5D A;  4PAF A;  2ZMB A;  4OMB A;  2KQZ A;  4OHN A;  2W7Y A;  4F3P A;  4LQ5 A;  3IO4 A;  3H03 A;  4P0I A;  3N6U A;  1R6Z A;  3ILU B;  4F1Y A;  3BFU A;  1EYK A;  4H0W A;  2PBW A;  5H8H A;  1Y3Q A;  4RPO A;  3G3I A;  4R72 A;  3K4U A;  5ICQ A;  1SYI A;  4GL8 A;  3D1R A;  1B51 A;  4FIM A;  4MF3 A;  4ELO A;  1QUL A;  1A8E A;  3PTY A;  3DP6 A;  1I6Q A;  1B05 A;  3IAZ A;  4ZEB A;  2IA4 A;  2WYP A;  3MP1 A;  3ECR A;  3EQ1 A;  4G8N A;  1II5 A;  2B3F A;  4JDF A;  2I58 A;  5ELV A;  2VOZ A;  2QMW A;  3DP4 A;  3EKI A;  1NV5 A;  3IJO B;  3KBR A;  4OVR A;  1MQG A;  4GX6 A;  1MRP A;  3R6U A;  4R6K A;  4KYD A;  2GH9 A;  1Y9U A;  1Z7N E;  2WBD A;  3RYD A;  1MY2 A;  4Q8R A;  2B65 A;  1SI0 A;  2CZH A;  3B8B A;  1T0K A;  1MQI A;  3KN8 A;  1NL5 A;  4DI4 B;  3TCH A;  4PF8 A;  2OK2 A;  4EF2 A;  5HM4 B;  5ET6 A;  4MH5 A;  1NNT A;  4O3A A;  4DE8 A;  1FPL A;  1B32 A;  4QFN A;  5ET5 A;  3RPL A;  3I3V A;  1MXZ A;  1FBC A;  3BIH A;  4ZDM A;  2QMX A;  1NMU A;  5I57 B;  1S9T A;  3LUZ A;  1IIT A;  1FJ6 A;  2ABH A;  1MPB A;  1RKM A;  2DVZ A;  1B2H A;  4KHZ E;  3OO8 A;  2PCR A;  1IMC A;  4KCC A;  4BDL A;  4GXS B;  1LBB A;  4Q5T A;  4PAK A;  3T96 B;  2XD2 A;  4YB5 A;  1AWB A;  3IOW A;  5I59 B;  2XX7 A;  1URS A;  3TQW A;  1MY1 A;  4P8B A;  1UTH A;  1FQF A;  4OEN A;  2Z23 A;  4QSD A;  3KOT A;  2VGQ A;  5CI5 A;  1YCJ A;  5I7I A;  1JW1 A;  2FYI A;  2WYK A;  1POT A;  1Y3N A;  1HSL A;  4FE8 A;  2WKY A;  4R9G A;  3K6U A;  3PPR A;  1EH3 A;  2QRY A;  4TLL B;  4F3G A;  1UIV A;  5KCJ A;  3FBP A;  2I4C A;  2DXR A;  2B4M A;  3Q27 A;  1SD3 A;  1K9Y A;  4GOT A;  1LFG A;  3TTN A;  1A8F A;  1OLC A;  4DLD A;  4WED A;  1Y3P A;  4LZ7 A;  4ZS9 A;  3IR1 A;  1FTO A;  3TTR A;  2XXX A;  1LFI A;  5BUU A;  4ZEF A;  1GGG A;  4PFR A;  4JWO A;  4LQ2 A;  2GHB A;  2UYF A;  1NI9 A;  4R2B A;  4XEQ A;  4GBW A;  1VDW A;  2HPG A;  3T93 B;  4KPT A;  2HXW A;  1BIY A;  3TAJ A;  1FBP A;  4IR8 A;  2I48 A;  2QFL A;  4EXK A;  4C1U A;  1YZ0 A;  3JV9 A;  5JTY B;  5H8N A;  1A54 A;  4G4P A;  4IB2 A;  1RDZ A;  2A5T B;  3SKP A;  5AA4 A;  3P7I A;  2Q88 A;  3C36 A;  2Y7R A;  2KLF A;  2XXU A;  4YKI A;  2HEU A;  1JVX A;  3MPL A;  4R74 A;  1LBX A;  2LAO A;  1B9J A;  3TTK A;  4G61 A;  2XXW A;  3FV1 A;  2X26 A;  4QF9 A;  1BKA A;  1WVJ A;  3FVG A;  1P1N A;  4X04 A;  1SW2 A;  3UA8 A;  2PFY A;  2DE2 A;  1XS5 A;  3MVW A;  3K00 A;  3JZJ A;  4PFT A;  3ZS6 A;  1QKA A;  1DK4 A;  1FPF A;  1FTA A;  2VPN A;  3SEV A;  2I0B A;  3RNN A;  1LBY A;  2VPO A;  2FVZ A;  1B3H A;  1IXH A;  4OZ9 A;  3SET A;  2CEY A;  2YPN A;  2O1M A;  1MS7 A;  4R75 A;  4DI3 D;  1PB8 A;  2HFB A;  3O2A A;  1MY0 A;  4YKJ A;  1LB9 A;  2FNC A;  3MPK A;  2Y7I A;  4U21 A;  3G3H A;  3QSL A;  1R9Q A;  3Q25 A;  3IX1 A;  4UAC A;  3KC0 A;  1VFE A;  3E13 X;  1N3X A;  3TQL A;  3T66 A;  4JSD A;  3OO6 A;  3E78 A;  1OLA A;  1YXI A;  2XXQ A;  1FW0 A;  1JNF A;  5KCJ B;  2Z22 A;  1FQD A;  4YMB A;  2F3B A;  2A5T A;  4P0G A;  3TCF A;  5JTY A;  4PF6 A;  2NUV A;  4IY6 A;  4P11 A;  3EN3 A;  4IGT A;  5ET8 A;  3C31 A;  1DBZ A;  4N07 A;  2DOJ A;  5LTC A;  4PFW A;  1US4 A;  3QUJ A;  1LBC A;  3MVY A;  4KI0 E;  4MLQ A;  4M4G A;  3K2D A;  1GR2 A;  4TOZ A;  5I58 A;  2O1L A;  3UGW A;  2ONS A;  4KYE A;  5CMK A;  3S4U A;  3T0J A;  4ESW A;  5AA2 D;  1LFH A;  1RDX A;  1SI1 A;  2XXH A;  4JSO A;  4HXV A;  1IMD A;  5CMM A;  1NFT A;  1IXI A;  1VFD A;  2V25 A;  4ZZE A;  3SDF A;  3ZKL A;  1IME A;  2ONK E;  2DVC A;  4MBP A;  1EYJ A;  4PDD A;  1SW5 A;  4MLV A;  4O8M A;  4IO2 A;  3A3C A;  4QFK A;  1XOC A;  1Y20 A;  3CG3 A;  1EYI A;  4MHF A;  3PUW E;  5I56 A;  1CE2 A;  1QKB A;  1LB8 A;  5I59 A;  3HCQ A;  1FQE A;  3K6W A;  5HBC A;  4IO3 A;  5IGA A;  2O51 A;  3B7D A;  3PUY E;  3RTW B;  2PT2 A;  4IO5 A;  5L8D A;  2RKM A;  1MY4 A;  3TEP A;  5DVJ A;  3W15 C;  1SBP A;  4PE3 A;  2PYY A;  1JEV A;  4PBQ A;  1BTJ A;  3TOD A;  1MQD A;  4PAI A;  2HQ0 A;  2Q9T A;  4GVO A;  2QPQ A;  4AS4 A;  2UVI A;  1LAH E;  4HTG A;  2Z8E A;  2O68 A;  3KC1 A;  4PET A;  4AQ4 A;  3C35 A;  2Q74 A;  4PDH A;  2F36 A;  3OEN A;  1NUX A;  3FJ7 A;  2ZYN A;  5TP9 A;  4AB6 A;  3MVZ A;  4E0X A;  3MC2 A;  3W9V A;  2NOO A;  3FXR A;  2OX3 A;  3I5O A;  3IFC A;  3C32 A;  4UA8 A;  1LEV A;  3FV2 A;  1JW4 A;  1K9Z A;  3V89 B;  4QFP A;  1P1U A;  1FTM A;  4M1V A;  1ZKB A;  4I40 A;  4X9T A;  2UYE A;  4ZED A;  3KG2 A;  4PGN A;  2ZYK A;  3CR9 A;  2OWS A;  1IQ7 A;  1AOV A;  4IO6 A;  4PE5 B;  4QSE A;  1EZP A;  4MIJ A;  4HCW A;  2XXV A;  5CMB A;  1SPI A;  1B0L A;  3HO7 A;  3TKD A;  3MUQ A;  4U23 A;  3IB0 A;  3USD A;  1N3W A;  4Z0I A;  1XHY A;  4N6P A;  1JVY A;  4O3C A;  4KFQ A;  5TP9 B;  1JQF A;  1GV8 A;  4WXJ A;  4F2Q A;  3CSG A;  4RA1 A;  3MP6 A;  2QS1 A;  2FA7 A;  5DVI A;  4POW A;  1B3E A;  4ZZA A;  1MXX A;  1MM6 A;  4H5F A;  4R9F A;  1NV4 A;  1O7T A;  2DSF A;  4NWC A;  3VV5 A;  2OJT A;  2DYX A;  1FBH A;  2F6G A;  1O63 A;  3RY3 A;  5AE4 A;  3KSJ A;  1B7H A;  4KYS A;  1EU8 A;  3S9L C;  3C9H A;  2ZZX A;  2IEE A;  3Q26 A;  1ATG A;  1R1N A;  3LUY A;  3CI8 A;  1PEB A;  3OMB A;  1USY E;  2AL5 A;  4QFO A;  4XKQ A;  2DWI A;  1NUY A;  4G2Z A;  4NF5 A;  3FGS A;  5IKB A;  3LC8 A;  3M3L A;  3A09 A;  4PFB A;  4H45 A;  1YAE A;  4LVQ A;  1FTJ A;  3RQT A;  1NV2 A;  2GQ1 A;  3QUF A;  3UIF A;  5I58 B;  1IZ1 A;  2PX1 A;  2HZL A;  2UVJ A;  1QUI A;  1A40 A;  1LBW A;  3K02 A;  4GWZ A;  3Q29 A;  5ICT A;  4R6H A;  4MNP A;  5FHM A;  3H6T A;  4EF1 A;  3LR1 A;  3QXM A;  2ESN A;  2P1S A;  1PB7 A;  1CB6 A;  2AYS A;  1XVY A;  1VE4 A;  3VE1 B;  3M3F A;  1OIB A;  3LBS A;  1NKX A;  1PDA A;  2H25 A;  1LBV A;  3H6W A;  4XIG Q;  1Q1K A;  1ZMG A;  1MXU A;  1FBD A;  2XXY A;  3MST A;  2MKZ A;  4GXA A;  4NQ8 A;  3EPE A;  1P1Q A;  5KDT A;  4POX A;  3O28 A;  4OWD A;  3D4C A;  3N5L A;  4EDP A;  2XWK A;  2F8D A;  2R71 A;  3QK6 A;  3IOR A;  1FPI A;  1ZBM A;  1G0I A;  4OXV A;  2CZL A;  3VVD A;  1N04 A;  2I3V A;  2DP8 A;  1IIW A;  4HE1 A;  4L17 A;  4OAN A;  2I3W A;  1AH5 A;  1B40 A;  4RK9 A;  4GQO A;  3QYT A;  4NF6 B;  3K6V A;  5I57 A;  4EXL A;  2CEX A;  5FBP A;  2UVG A;  3CIJ A;  1LAX A;  3VXC A;  3CHG A;  1NV7 A;  4YU0 A;  1B46 A;  1Y4C A;  1B3F A;  1I6B A;  3L6G A;  3KJ7 A;  4GLI A;  4DCX A;  2XXT A;  2VD3 A;  1H76 A;  3G3F A;  3CFZ A;  4P1E A;  3ONM A;  4NF6 A;  3FVN A;  4G8M A;  2FHY A;  4KXP A;  1URG A;  3ODB A;  1NV0 A;  4LON B;  1SVX B;  1ZU0 A;  3E9X A;  3MBP A;  2O7U A;  3GBA A;  3FZV A;  2QVR A;  3KN3 A;  3PMX A;  1MPD A;  2F78 A;  2V3U A;  4ZEK A;  2DE4 A;  2Y5L A;  3LSL A;  5AA4 B;  1FPG A;  3KSX A;  4ESX A;  5H8N B;  5I56 B;  1HSE A;  1L5T A;  1A99 A;  2F7C A;  4NWD A;  4JXI A;  1QVS A;  1NH7 A;  1FPK A;  2XX9 A;  3KFM A;  2DDK A;  5FHO A;  1Y4T A;  3E4R A;  3QAX A;  4ZE8 A;  4R73 A; 
#chains in the Genus database with same CATH homology
 4KI0 E;  2REJ A;  2PT1 A;  5H8S A;  3TPA A;  2AIX A;  3A3U A;  4OQO A;  2UXA A;  4PQJ A;  4DE8 A;  3U92 A;  3RPW A;  3B6T A;  4F19 A;  1SQY A;  4MLQ A;  5B7D A;  5I2N B;  1LCF A;  1WDN A;  5I56 A;  1M5C A;  3K2D A;  1GR2 A;  1MQJ A;  4M4G A;  3FXQ A;  4TOZ A;  4FJP A;  5I58 A;  2ZNT A;  2Q2C A;  2O1L A;  2ALU A;  4LAT A;  3KOS A;  3PD9 A;  3UGW A;  2ONS A;  4KYE A;  5CMK A;  3S4U A;  1LST A;  4E0W A;  4K3F A;  1TWY A;  2F7B A;  3V83 A;  4ESW A;  4MFI A;  5AA2 D;  1B7Z A;  2NXO A;  2I4B A;  4IY5 A;  1OQH A;  4OFO A;  4XKN A;  4U1Z A;  2RC7 A;  4FED A;  2HAU A;  3RT8 A;  3CFL A;  1SI1 A;  1AL3 A;  2XXH A;  4JSO A;  1NH8 A;  2H4I A;  1TFD A;  3FJG A;  4QSC A;  3BKI B;  3U8Q A;  1IXC A;  4G68 A;  1B3G A;  3K1P A;  4XKP A;  5CMM A;  3S9N C;  1NFT A;  2RC9 A;  1IXI A;  1PBP A;  1VFD A;  2V25 A;  4OTE A;  4ZZE A;  3SDF A;  1UTB A;  2F7A A;  2G29 A;  4H67 A;  5KDT B;  3ZKL A;  2Q2A A;  4G68 C;  3U94 A;  4EUO A;  3CSB A;  4XTC Q;  4BDM A;  4BDQ A;  1MH4 A;  1SDX A;  4O3B A;  5FTI A;  2XHD A;  4NF4 A;  4F18 A;  3Q28 A;  3UP9 A;  5H8H B;  5HPQ A;  1PB9 A;  2ONK E;  4GRK A;  1DMB A;  2B3B A;  4R6Y A;  2DVC A;  4MBP A;  5DYH A;  1R9L A;  4OFL A;  1SW5 A;  5DEX A;  2ONR A;  4MLV A;  3VLW A;  5AA2 A;  2GFE A;  4GIZ A;  3A3C A;  4IO2 A;  4NF5 B;  1B3L A;  1QUK A;  4QFK A;  1B7U A;  4F3B A;  1Y1M A;  2DWA A;  3U93 A;  3T9V A;  1B1H A;  1XOC A;  2VD2 A;  1Y20 A;  3H6U A;  3CG3 A;  3KN7 A;  3UN6 A;  3SEX A;  4IGR A;  1DTZ A;  1QW0 A;  1OMP A;  1WOD A;  3ZKK A;  1ZJL A;  2VHA A;  2Y7K A;  3PUW E;  5JTY B;  1CE2 A;  2ANJ A;  1QKB A;  2H9B A;  3K1N A;  3FD3 A;  4N13 A;  1LB8 A;  1UQW A;  3OD7 A;  4DZ1 A;  3IJX B;  4TQU Q;  3UK4 A;  5I59 A;  2I0C A;  5J1D A;  3HCQ A;  1FQE A;  5F1Q A;  3K6W A;  5HBC A;  4IO3 A;  2RF1 A;  2V84 A;  1H44 A;  1YPN A;  5AA1 A;  1B58 A;  1J1N A;  2O51 A;  5M2V A;  3B7D A;  2A5S A;  3PUY E;  4IO7 A;  4OVJ A;  3RTW B;  3EHS A;  1M5D A;  1USY H;  2PT2 A;  1P1W A;  2ZMB A;  3EHU A;  4IO5 A;  5L8D A;  3BBR A;  3T9U A;  1A55 A;  1PC3 A;  3RGY A;  4OMB A;  4F22 A;  2RKM A;  3IOT A;  4OHN A;  3CRB A;  4NF4 B;  2W7Y A;  1M5F A;  1D4N A;  4NF8 A;  1M5B A;  4F3P A;  1MY4 A;  4LQ5 A;  4H65 A;  3TEP A;  3IO6 A;  3IO4 A;  3C4M A;  3TTL A;  5DVJ A;  3W15 C;  1MDP 1;  3H03 A;  5I84 A;  1SBP A;  3CG1 A;  2PYY A;  3OSQ A;  3N6U A;  4P0I A;  4U4X A;  3VXB A;  5KZT A;  1JEV A;  3OEK A;  3FJM A;  2HAV A;  1R6Z A;  3ILU B;  3MAM A;  4QRZ A;  2D21 A;  3BFU A;  4F1Y A;  4FAJ A;  5L9O A;  3T22 A;  4H0W A;  1BTJ A;  2PBW A;  2DQV A;  1XVX A;  1Y3Q A;  3DM0 A;  3GZG A;  2V93 A;  3IB1 A;  5H8H A;  4RPO A;  3TOD A;  3TTM A;  1B1X A;  1OVB A;  3G3I A;  4H5G A;  4R72 A;  1MQD A;  3BFT A;  1N76 A;  3N94 A;  1YTV A;  3K4U A;  1IUD A;  1RYX A;  4OER A;  4Q0C A;  4BLA A;  5ICQ A;  1B4Z A;  2HQ0 A;  2Q9T A;  4YKP A;  4GVO A;  4DXB A;  2NWJ A;  4PFU A;  5CBR A;  2QPQ A;  4F1U A;  2HCA A;  1SYI A;  1ZLQ A;  1LAH E;  2UVI A;  2Z8E A;  3QIM A;  4GL8 A;  1B0H A;  2O68 A;  1B51 A;  1LAF E;  2O6A A;  4FEB A;  4HTG A;  4JWX A;  4FIM A;  3N6T A;  4MF3 A;  4PET A;  1QUL A;  4ELO A;  1A8E A;  5H8F B;  4AQ4 A;  3DP6 A;  3RN8 A;  3C35 A;  3KGC A;  1I6Q A;  1B05 A;  1D9Y A;  2F36 A;  3IAZ A;  3OEN A;  4GL0 A;  4ZEB A;  2IA4 A;  5K2Y A;  3MP1 A;  3RTF B;  3ECR A;  3EQ1 A;  1I69 A;  2Y7P A;  4G8N A;  2THI A;  3OEM A;  3FJ7 A;  2ZYN A;  5TP9 A;  1II5 A;  2HZK A;  4AB6 A;  3MVZ A;  4OWD A;  4NTL A;  4E0X A;  5EHM A;  2B3F A;  5CC2 A;  3U72 A;  4JDF A;  4F31 B;  2H99 A;  2RCB A;  3MC2 A;  3W9V A;  4RPN A;  1MPC A;  1NNF A;  2NOO A;  2YJP A;  3MVX A;  3MZB A;  3FXR A;  3O6H A;  3B6W A;  4OFJ A;  4OEV A;  3TZA A;  1S7Y A;  4DCY A;  3PPP A;  4GD5 A;  2I58 A;  5I2K A;  5ELV A;  3V89 B;  3I5O A;  2R6G E;  2VOZ A;  3UOR A;  1H45 A;  2QMW A;  4OEU A;  3C32 A;  3DP4 A;  4UA8 A;  2Y84 A;  3FV2 A;  1LGB C;  4X1B A;  5A5X B;  3MZ1 A;  1JW4 A;  3SEW A;  2ZNS A;  5DTB A;  2O69 A;  2REG A;  2DWH A;  3H6V A;  3IJO B;  3DEL B;  1MQG A;  2X7Q A;  3KBR A;  4QFP A;  4RJZ A;  5ITO A;  1P1U A;  3GXA A;  5DEX B;  1XT8 A;  1FTM A;  4M1V A;  1ZKB A;  2PMS A;  3G3G A;  4X9T A;  3FVK A;  1MRP A;  1Q35 A;  3R6U A;  3LSW A;  1FQC A;  2UYE A;  4R6K A;  4KYD A;  2GH9 A;  4R2F A;  3OOA A;  4ZED A;  1Y9U A;  1Z7N E;  3G3K A;  3KG2 A;  2RIN A;  1MY2 A;  1MY3 A;  2ZYK A;  2OWS A;  1IQ7 A;  3CR9 A;  5CBS A;  1AOV A;  4IO6 A;  4PE5 B;  2X7P A;  4QSE A;  4THI A;  3G7W A;  2V3T A;  5IAI A;  1EZP A;  4HCW A;  2XXV A;  3LSF B;  4Q8R A;  4YKK A;  2XX8 A;  5CMB A;  2B65 A;  1B52 A;  4F3S A;  1FTK A;  1SI0 A;  4OYV A;  3JYR A;  1B0L A;  3HO7 A;  3MW0 A;  5CRY A;  3TKD A;  4ELR A;  4ZE9 A;  1T0K A;  1MQI A;  3KN8 A;  1NL5 A;  4Q30 B;  3MUQ A;  3OO7 A;  4DDD A;  2D3I A;  4YAH X;  4U23 A;  1F9B A;  3E3K A;  2OK2 A;  3IB0 A;  3TCH A;  3USD A;  4EF2 A;  5HM4 B;  3GBB A;  3IK6 B;  3O66 A;  1N3W A;  3V8X B;  3PD8 A;  4FOR A;  5CMC A;  2E0S A;  1NNT A;  1XHY A;  2I49 A;  3H4Z A;  3PMV A;  4MH5 A;  1JVY A;  4N6P A;  4O3C A;  4O3A A;  3DLN A;  1B32 A;  2GHA A;  3VE1 B;  4LA9 A;  4QFN A;  2Q89 A;  3I3V A;  4KFQ A;  5L9M A;  1JQF A;  5TP9 B;  1MXZ A;  1GV8 A;  3WAF A;  1DTG A;  4WXJ A;  3EHT A;  5H8Q A;  4F2Q A;  2F35 A;  3ILT B;  4ZDM A;  2QMX A;  3CSG A;  4RA1 A;  1NMU A;  1JET A;  2QS1 A;  3MP6 A;  4ONY A;  1AIV A;  5I57 B;  3VDF A;  1S9T A;  2FA7 A;  5DVI A;  5EHS A;  1IIT A;  1MQH A;  3KZG A;  2ABH A;  1MPB A;  1RKM A;  3IOV A;  2DVZ A;  3QUJ A;  1JW5 A;  2QS2 A;  3K1M A;  4XKR A;  1B2H A;  1JEU A;  3FIR A;  4KHZ E;  4POW A;  1SW4 A;  1B3E A;  3OO8 A;  5JEI A;  3HN0 A;  1MXW A;  3MVY A;  1P1O A;  4U1O A;  4KCC A;  4LZ8 A;  4ZZA A;  1MXX A;  1MM6 A;  3TEL A;  4BDL A;  4LP2 B;  1FCK A;  4GXS B;  1LBB A;  4H5F A;  4Q5T A;  4R9F A;  2R9J A;  3AXF A;  1O7T A;  2DSF A;  3T96 B;  1N7X A;  4NWC A;  2DWJ A;  2OZZ A;  3VV5 A;  2QS3 A;  4U4S A;  2OJT A;  3I6V A;  2XD2 A;  4EQ7 A;  2DYX A;  4YB5 A;  5FTH A;  3RUM A;  2ZXT A;  1MXY A;  2D5W A;  3IOW A;  3GLB A;  2F6G A;  4YB7 A;  2XX7 A;  1URS A;  5I59 B;  3TQW A;  3O29 A;  1MY1 A;  1O63 A;  3TMG A;  5TPA B;  3RY3 A;  5AE4 A;  1UTH A;  4QFL A;  1FQF A;  2Z8D A;  1B7H A;  3H06 B;  3KSJ A;  4OEN A;  5AA3 A;  2Z23 A;  4KYS A;  1EU8 A;  4FAT A;  1OVT A;  3HHF A;  4QSD A;  3KOT A;  4C0R A;  4ECF A;  2VGQ A;  5CI5 A;  1YCJ A;  2F97 A;  1JW1 A;  5CM6 A;  1UIU A;  1B4H A;  2FYI A;  3S9L C;  3C9H A;  1MDQ A;  3SER A;  1POT A;  2E1S A;  2BJJ X;  2IEE A;  1Y3N A;  1O64 A;  3Q26 A;  4HS7 A;  4EDP A;  1ATG A;  1N7W A;  3KJT A;  4RXL A;  1SW1 A;  1HSL A;  4FE8 A;  1R1N A;  2WKY A;  3LUY A;  4R9G A;  3CI8 A;  4DIG A;  1PEB A;  2UVH A;  2VP1 A;  3K6U A;  3OMB A;  3PPR A;  4QHQ A;  1USY E;  1EH3 A;  1UTH B;  2AL5 A;  3MQ9 A;  4G68 B;  4QFO A;  4XKQ A;  5ISU A;  1EZO A;  2DWI A;  2QRY A;  4TLL B;  1B5H A;  4H8I A;  1ELJ A;  3THI A;  1UIV A;  2CMO A;  1SYH A;  4F3G A;  3K0V A;  3PPN A;  5KCJ A;  4G2Z A;  2I4C A;  1D9V A;  2DXR A;  3G3J A;  3Q27 A;  4YMA A;  1SD3 A;  4G77 A;  4NF5 A;  3FGS A;  4I8C A;  3IL1 B;  4X1D A;  3EF7 A;  3O97 A;  4KQP A;  4KCD A;  5I2K B;  5IKB A;  3LC8 A;  3M3L A;  1DPE A;  3A09 A;  4ND9 A;  3TFL A;  4GOT A;  1LFG A;  5K2X A;  1YAE A;  4XXU A;  4LVQ A;  2YLN A;  3MZ9 A;  1A8F A;  3TTN A;  1FTJ A;  4NE4 A;  3RQT A;  5AA2 B;  2ZYO A;  4GWO A;  4RYA A;  1LFH A;  3S2V A;  1OLC A;  1OQG A;  3QUF A;  4OET A;  4DLD A;  1M5E A;  1Y3P A;  4LZ7 A;  4WED A;  4ZS9 A;  1IZ1 A;  3IR1 A;  1FTO A;  4TLM B;  3TTR A;  3UIF A;  5I58 B;  2PX1 A;  4YB6 A;  2XXX A;  5JK4 A;  2GRV A;  3S9E A;  4AB5 A;  3KEI A;  1LFI A;  5BUU A;  3V5A A;  2HZL A;  3CVG A;  4ZEF A;  2UVJ A;  4KR5 A;  1GGG A;  4WEP A;  4ELQ A;  4ZEC A;  1QUI A;  4JWO A;  1A40 A;  4G8H A;  3K02 A;  1S50 A;  4I9D A;  4LQ2 A;  2GHB A;  3Q29 A;  2UYF A;  3PPO A;  4HW8 A;  5ICT A;  4R2B A;  3B6Q A;  1DOT A;  1GVC A;  4R6H A;  3R7X A;  1FQB A;  2QS4 A;  3DP8 A;  1FQA A;  1H43 A;  3W9W A;  5H8F A;  5FHM A;  4GFR A;  1DPP A;  3H6T A;  1VSO A;  3RLF E;  3S9M C;  4EF1 A;  4WKM A;  5H8Q B;  3T93 B;  3LR1 A;  4C1T A;  1POY 1;  1RYO A;  3QXM A;  4KPT A;  2ESN A;  1BIY A;  2HXW A;  2P1S A;  4I62 A;  4F39 A;  2F5X A;  3TAJ A;  1NNP A;  1PB7 A;  2I48 A;  4JWY A;  4GF8 A;  1CB6 A;  5BWJ A;  5LOM A;  2AYS A;  4EXK A;  4C1U A;  1XVY A;  1VE4 A;  3OXN A;  3H3G A;  3JV9 A;  4OES A;  4U22 A;  3M3F A;  1OIB A;  2XXI A;  1A54 A;  3LBS A;  4G4P A;  5H8N A;  1NKX A;  4IB2 A;  4Z7E A;  2A5T B;  1PDA A;  2H25 A;  2V3Q A;  4JBZ A;  3SKP A;  3H6W A;  4XIG Q;  1Q1K A;  1QJM A;  1ZMG A;  1MXU A;  3P7I A;  4NF8 B;  5AA4 A;  2QSX A;  3PGF A;  2Q88 A;  1BLF A;  3C36 A;  1ZTY A;  3L6H A;  3OSR A;  4LZ5 A;  1N84 A;  2Y7R A;  5A5X A;  2DE3 A;  2KLF A;  2XXU A;  2HEU A;  1JVX A;  3PUV E;  4YKI A;  3MPL A;  3WAE A;  2XXY A;  4R74 A;  1US5 A;  2OLB A;  1B5I A;  3C34 A;  2LAO A;  2Q8J A;  3LSX A;  1B9J A;  1MG1 A;  3PMW A;  3TTK A;  3F11 A;  3PPQ A;  4GXA A;  3SEU A;  3EPE A;  4HCY A;  4PFY A;  3RT6 B;  3T9H B;  2OCU A;  1P1Q A;  4BDR A;  2XXW A;  3HPI A;  3O9P A;  3FV1 A;  3MP8 A;  3PU5 A;  2X26 A;  5TPA A;  5KDT A;  1D3K A;  4POX A;  4ISU A;  1MXV A;  4QF9 A;  3SES A;  1BKA A;  3O28 A;  3T9X B;  3ZSF A;  3D4C A;  1WVJ A;  2O7I A;  1P1N A;  3FVG A;  3N5L A;  2F8D A;  2R71 A;  3K6X A;  3IOR A;  3PUX E;  1Y1Z A;  1VR5 A;  3QK6 A;  4PP0 A;  3TYH A;  4NMY A;  1ZBM A;  4F2O A;  1SW2 A;  1PBQ A;  4OXV A;  3UA8 A;  4FEC A;  2RCA A;  5FHN A;  4RNS A;  1P99 A;  2DE2 A;  1B6H A;  3FVO A;  2CZL A;  3K01 A;  1N04 A;  3VVD A;  2ZNU A;  3D4G A;  2I3V A;  1XS5 A;  2DP8 A;  2XXR A;  3HST A;  3K00 A;  1IIW A;  1URD A;  3MVW A;  3O6I A;  4RK2 A;  3VLV A;  1IXG A;  2O84 X;  1KWH A;  3JZJ A;  4L17 A;  4PFT A;  2I3W A;  1AH5 A;  3ZS6 A;  1B40 A;  4LUB A;  1MM7 A;  1QKA A;  4RK9 A;  2F6P A;  4X48 A;  4GQO A;  1BP5 A;  4I1D A;  3VVE A;  3QYT A;  5L9S A;  4NF6 B;  1EZ9 A;  1MH3 A;  3IOU A;  3K6V A;  1NNK A;  3SEV A;  4ELP A;  2I0B A;  3RNN A;  3PUZ E;  4EXL A;  5I57 A;  2OBG A;  3OEL A;  4BDO A;  4DXC A;  2M8C A;  2UVG A;  1IEJ A;  1GTK A;  1B3H A;  2DXY A;  2XXP A;  3CIJ A;  3M3K A;  1IXH A;  1LAX A;  3VXC A;  4OZ9 A;  3MJN A;  2H98 A;  3SET A;  3HHG A;  1N0T A;  2H5Y A;  4YU0 A;  1B46 A;  2YPN A;  4RY1 A;  4KD5 A;  5B70 A;  2O1M A;  4F1V A;  1Y4C A;  1MS7 A;  1B3F A;  4R75 A;  1I6B A;  3L6G A;  3KJ7 A;  1PB8 A;  2ZYM A;  4GLI A;  4DCX A;  1LLS A;  2HFB A;  3MWB A;  3O2A A;  5DVF A;  2XXT A;  2VD3 A;  1MY0 A;  3O6G A;  4YKJ A;  1B5J A;  1H76 A;  1LB9 A;  2FNC A;  3CFZ A;  3G3F A;  3ONM A;  5F7V A;  3PV0 E;  4NF6 A;  2QL3 A;  3MPK A;  3FVN A;  3R26 A;  2Y7I A;  4U21 A;  3G3H A;  4G8M A;  3QSL A;  3N26 A;  1R9Q A;  3Q25 A;  1URG A;  1HSJ A;  3IX1 A;  3ODB A;  4LON B;  4UAC A;  1TT1 A;  1SVX B;  1VFE A;  1ZU0 A;  3FUZ A;  3E13 X;  1N3X A;  3FAT A;  4U2R A;  4YIC A;  4ZEI A;  3TQL A;  3T66 A;  3E9X A;  3MBP A;  4Z0I A;  1ANF A;  2O7U A;  3GBA A;  3FZV A;  4IO4 A;  3OO6 A;  4JSD A;  2RC8 A;  5TU0 A;  1OLA A;  2XXQ A;  4H6D A;  1QUJ A;  1H3D A;  3KN3 A;  3SEY A;  3PMX A;  1MPD A;  1FW0 A;  2DS9 A;  2NVU B;  1LAG E;  2F78 A;  4NED A;  2V3U A;  4ZEK A;  2DE4 A;  3TCG A;  4H1X A;  3CFX A;  3OO9 A;  2PVU A;  2Z8F A;  1DSN A;  1JNF A;  2AL4 A;  2P2A A;  4BDN A;  1TXF A;  3LSL A;  5AA4 B;  2XD3 A;  5KCJ B;  3KSX A;  2Z22 A;  4ESX A;  1FQD A;  4YMB A;  4YZZ A;  1TFA A;  1LCT A;  3HV1 A;  1AMF A;  3M8U A;  3VFJ A;  5H8N B;  5I56 B;  3U1O A;  1A7L A;  2A5T A;  1HSE A;  3FAS A;  4P0G A;  4DXU A;  4F29 A;  1L5T A;  3TUS A;  1A99 A;  2F7C A;  4NWD A;  3TCF A;  4EQ9 A;  1I6A A;  5JTY A;  1ZIU A;  5EYF A;  4JXI A;  1QVS A;  1NH7 A;  2NUV A;  4IY6 A;  4EQB A;  5ITP A;  4P11 A;  2I6E A;  4H8J A;  4JB7 A;  2XX9 A;  3TDJ A;  2P0S A;  2QJE A;  3EN3 A;  4IGT A;  3VLU A;  1FTL A;  3C33 A;  3VVF A;  3IB2 A;  3C31 A;  2G93 A;  3FXU A;  3KFM A;  5I2N A;  1XC1 A;  5DT6 A;  1UTB B;  2OWT A;  5FHO A;  1Y4T A;  4N07 A;  2DOJ A;  3E4R A;  3H7M A;  3QAX A;  1US4 A;  4PFW A;  4ZE8 A;  2Y7W A;  1LBC A;  1Z7M E;  2F34 A;  4R73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...