4HWHA

Crystal structure of atbag4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
87
structure length
84
Chain Sequence
LAIAAVNAVTGEVDKLSDRVVALEVAVNGGTQVAVREFDMAAELLMRQLLKLDGIEAAKVQRKAEVRRIQNLQEAVDKLKARCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 4
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 36
structure length 84
sequence length 87
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwhA00
5AQHB 1UK5A 1M7KA 5AQMB 3M3ZB 5AQQB 5AQFB 5AQVB 4HWFA 2D9DA 1M62A 5AQKB 5AQSB 5AQGB 5AQOB 5AQPB 3LDQB 1T7SA 3A8YC 3FZFB 5AQRB 5AQNB 4HWDA 4HWCA 5AQUB 3FZKB 3FZHB 5AQIB 1I6ZA 5AQLB 3FZMB 5AQJB 1HX1B 4HWHA 1UGOA 5AQTB 3FZLB 4HWIB
chains in the Genus database with same CATH superfamily
4HTEA 3RI5A 1O3XA 2XPKA 2KWIB 4IL4A 4X1IE 3M65A 1U5PA 2YU1A 4WBNE 1HNXT 4AQFA 3O1IA 5LHIB 1H7CA 3N2KE 4XZCA 3F31A 1YQ3A 3RGLA 1M7KA 4TWHA 2NP9A 3C4ZA 1UCUA 4YJ3E 5AQPB 2X0LB 3ZT5A 4ZI7E 4EB6E 2KT9A 4KX6A 2LEHA 4A5XA 1NWMX 3RYHE 3JCFA 3I9WA 3H3MA 4O4LE 3U78A 1UUSA 1KNRA 2FJEA 2WSSV 3AAEB 3TKLB 4DR2T 4YY3T 1FJGT 1E1HB 2K9AA 2WM9A 3VR9A 2RPAA 4ISSA 5HEGA 3DJBA 1OEDC 3GA8A 4EYYR 4QH5A 3NVOA 3EDUA 1ZP0A 5ABEA 4DR7T 4X1YE 4MHCA 3NRXA 2CXLA 4YTMA 5AQGB 1UURA 4DMVA 2IHR1 4HKAA 3UU5A 5AQUB 2C5KT 3MJXA 3UUMA 1D0YA 1XNQT 4ZS2A 2CE7A 2BS3A 2IUBA 1ZV4X 5LGNB 2EHOC 3OVUA 2CEAA 2CHOA 5LHHB 4X64T 5C8YE 2JRKA 4TNVA 2VKDA 3P4QA 2KLQA 5KXJA 2WY2A 5LGUB 5KX5E 2NWBA 2V1DB 5FVLA 3V5UA 3CQXC 3Q5DA 3ESLA 3CK6A 3QNUA 2XTLA 5LOVE 4AXPA 2X9WA 5IWAT 3FZKB 2DWKA 4F6RC 1G73A 3Q2MA 3HL6A 2VURA 4HFIA 3C64A 2NR4A 4QH1A 2Y6XA 4U33A 3JC6D 3R84B 1D1BA 3KBUA 5BR8T 3IA3A 3ZLIA 4HWDA 4HFCA 2WCAA 3AAAB 3RRWA 4ZZBA 5HXHA 4H9OC 5LHGB 4I4TE 5F8PA 2UXNB 1U4QA 5ADXL 2MTQA 2W66A 4JI0T 1VOMA 2W61A 2XSBA 4NXNT 1S94A 4GYRA 1Z8UA 4H9RC 2E9XA 2F4VT 1MMAA 4O2BE 2OLTA 4HFDA 5CB4E 3O1HA 3ZPOA 1IBKT 3F57A 3NRYA 1IJ6A 3PV0F 4DV7T 5FY0A 2BG9E 3AEAA 3PU3A 4EOZB 5FL0A 1WFDA 3HA4A 2V7KA 4TN7B 4UVBB 5HEUA 3O4XE 4JV5T 1YKEB 5JRCA 1BR1A 5HCJA 2YEVC 1WCRA 3LK3B 3ZT6A 3T1YT 3ZT7A 2D0UA 4H9SE 2Q9QD 3GWHA 3ZSSA 3TLWA 5FKYA 5ABFA 5EZYE 4C90A 4O4HE 3ZSTA 5TAOA 1FIOA 4CN4A 5BMVE 3O9XA 5HWXA 3P4RA 4YHHT 3I1AA 2LOSA 2WB5A 3OTOT 4X1KE 1OWAA 2MBGA 3WAJA 4MALA 2V7JA 3FZLB 4E7SA 1XDOA 4XBFB 1YXRA 1W0BA 3CPZA 1KNPA 4QX8B 3I0OA 3LSVA 4U74A 5HWYA 3P7IA 5LMUT 4IE6A 2CBJA 4JI3T 1I6ZA 4QKNA 2DCFA 3JC6C 3C50A 4P09A 1OEDE 4HWFA 5FL1A 4K0KT 4KMCA 4ILCA 2W62A 2NW8A 2AXDS 4UEMA 1XZYA 2V26A 3KVAA 4YXDA 4QH4A 2XAFB 1XWMA 2K48A 3FXEB 4DUYT 1W0AA 2BVLA 2CLYB 5E0OA 4JI8T 2D9DA 1J1JA 2JPFA 5JDQA 2CPTA 4O4IE 3FXDB 5HAXA 4GYSA 1KFYA 3UFEA 4IHJE 3FBLA 4LF5T 5FXWA 2BS2A 3PURA 2PTFA 1X79A 3LBXA 4BA9A 3PJAA 3ZC1A 3ZYLA 4AQGA 2JIWA 5L2LA 3A7MA 4P0AA 1VRBA 1JNRA 1J5ET 3HR0A 1IBMT 2LKHA 2BZBA 2G0UA 1WLXA 3UQ4A 2LM9A 2Y48B 5LMNT 4TV8E 1QSDA 2XASB 2WQYA 4IIJE 2PFVA 3VRBA 1HS7A 2CHNA 3SRZA 2FBWA 4KP3C 2DL1A 3RH3A 3ZN0B 3AA6B 2H7VC 3AA7B 4ASKA 2LM2A 5JREA 3AE8A 3CIRA 1W9RA 4LF4T 3UFGA 4N78D 5J2UE 2JMKA 4L0RA 3GMIA 1MNDA 3A8YC 5HEOA 2UXBT 2YU2A 2WU2A 2XY8B 3MA9A 4YFSA 2XQ8A 5CA1E 1NEKA 3ABVA 3RQUA 2VKHA 3MZKB 3AEEA 5JTGA 2X9HA 5LYJE 2IC6A 2CLYC 4IE4A 3RYFE 3MK7C 5JQGE 3QC9A 4NXMT 1OXZA 5J1GA 2JQKA 4U72A 2QVAA 1D0XA 2E8IA 3E22E 4TX5A 2HN1A 4M1PA 3IBPA 2WDRA 2ZM0A 2L3LA 4CI1B 2VB6A 2XAGB 4B6XA 3K3NA 4PJMA 2KMFA 1WR6A 2LSJA 1T72A 2YK0A 4GIWA 2LSGA 4OYKA 1FEWA 3AE7A 3A5XA 3N2OA 4HWCA 4MLKA 4HWHA 3CX8B 5FXZA 3PE0A 4EAHA 1MMGA 5HXSA 5GONE 2LSYA 4CXXA 1LVKA 2E5LT 4ZEYA 2CWOA 1EZ3A 2PG8A 5H6RB 3ZCJA 3ZMTB 3RKOA 4CQIA 2BG9A 2BS4A 3B13A 1KF6A 4LF7T 4P0BA 2JJ9A 4JBWF 4JYAT 3L3PA 3C4WA 1R8IA 4DV0T 4IDQA 4I50E 4PNIA 2Y8DA 3WAKA 3UTKA 2VWAA 2WU5A 4C91A 3N9OA 4AQFC 2MPKA 1NAFA 4O4JE 2E2AA 4UV8B 3OYXA 4IE0A 1ZEEA 2D5UA 3X1DA 3LK42 2XQAA 1UX5A 4PK6A 3PUGA 2VASA 5FP3A 5FY1A 4H63V 2N9DA 4JI5T 2XJ7A 2CA5A 4LF6T 4JEUB 4NUVA 4KUMB 3UUXB 3V5SA 5ETWA 2E9XD 2KZ7B 3VR8A 5JDLA 4JI2T 3RYCE 2VL8A 4EZHA 2NTXA 4A98A 3KDSE 3ZYMA 1UGOA 3WI3A 5EK2A 5L4HA 4NIQA 4IREA 4YSZA 4QXHB 4AISA 4OYJA 3AEGA 1D1AA 4WBOA 3JAEA 4YJ2E 2QYWA 3VKHA 2K24A 2WMOA 3CWZB 3AEFA 5LBQB 2K3WA 3BQLA 2LHRA 2KSRA 4ILAA 2WMNA 4QXBB 5KMGP 2IIUA 3ZC0A 2EHOA 3GN5A 5A1LA 4MBQA 4ZI2D 3VU7H 2B1EA 5DQVA 3AA0B 5JRCB 2ZM2A 3RIAA 2NW7A 5HEHA 5AQNB 4HFHA 5ABFB 1HR0T 3SFDA 3RIUC 2BBHA 3AECA 3F2EA 1E2AA 1X9BA 2IW5B 3EDVA 4X65T 5JDNA 2BKNA 1IAPA 2L9QA 4IE7A 1LRZA 2FJDA 4E7ZA 5FVKA 1ZOYA 3KINB 4AQYT 3N5LA 3KV4A 4WZXA 2C5IT 4DMWA 3C4XA 3CQGB 3DTOA 3T1HT 4V1Av 5HCMA 3AE1A 5AQRB 3RF1A 4B3TT 2BVMA 2YKSA 4B3RT 4AIUA 3B57A 4HFVA 4EV6A 5AQMB 4UVAB 3M3ZB 4AI6A 2V6YA 3ZYKA 3JADA 2J1DG 4G2AA 3CKDA 4UVCB 4ILUA 1Y64B 5C2TA 4AKIA 2H89A 2LHNA 1UX4A 3HKBE 4BJMA 3LFMA 3ZMSB 1XNRT 2R6GF 2PJQA 4OHFA 1ZKEA 3E08A 4HFBA 2UUBT 5L4EA 4LMLA 5L3BB 2MAWA 5JR9A 3I0QA 3AE9A 2UUAT 2NOXA 2I0MA 4BAYB 4XAXB 3B5MA 4OK0A 2RP4A 2W0GA 2J47A 3SFEA 5C3JA 2ES0A 4AKRB 2UXDT 4LF9T 4LFCT 4PK4A 4ZI2C 3IHRA 2V6XA 1HX8A 2Q9QB 2Z6EA 1D1CA 2WS3A 2DNXA 5LXTE 3K3QC 5H6QB 3FZFB 2NW9A 4IGUA 3KV6A 2X67A 1DU2A 2VQET 4GKJT 5JDHA 3Q9DA 4PJNA 2ZM8A 3Q5WA 3N9LA 1FMVA 4IT4A 2LJLA 2UXXB 3LJCA 5M4YA 4UIGA 2XQ6A 5LB7B 3JAFA 4HN9A 4ZXLA 3HI2A 5FXXA 1HX1B 4L5GA 2BBJA 3CQCB 4H9QC 2XZEA 3PUYF 3PUSA 3ZMZB 5L3CB 2RA1A 4CXYA 2FJAA 4EGWA 3D0TA 4UELA 2AE9A 2CWYA 1VCTA 4GK5E 4DV1T 3NBXX 4TUYE 5HYAA 2X9YA 3N9NA 4ZI3D 1CHUA 5IYZE 3L8RA 2WAUA 2QGSA 4IDNA 3ZJ2A 2M6BA 2XM1A 4PW8A 1MIVA 2DI4A 3BQKA 1MIYA 2ZLYA 5AQLB 3AEBA 4HGAA 1IBLT 2QRXA 1BR4A 2YINA 4KHZF 3J7Yq 1ZHCA 4UF0B 2Q9QC 4H9PC 4TWFA 5IHYA 3W15B 3Q5XA 1VCSA 4YTPA 5LGTB 1WYBA 3EABA 1D0ZA 4DV5T 4YT0A 1XDPA 4U2YA 4X62T 2IDOB 3ANWA 5L3EB 3KFWX 1HNWT 3SWHA 3KV5A 4TWDA 3AXJB 1HG2A 2M67A 4X20E 2UU9T 3UU6A 3RYIE 2OA5A 5AQVB 1YD8G 4IDZA 1HF8A 2J62A 3AE4A 2V7IA 4HEAA 2H88A 2HPLA 1SA0E 3H37A 1FMWA 4LMJA 2D0TA 2MOZA 5HEJA 1QLBA 2LSKA 1J5WA 1BR2A 1CUNA 4MFRA 4PFOA 1SUMB 4GKKT 4Z91A 4KI0F 3ZMVB 5EK4A 2X68A 2CBIA 3N2GE 3OKQA 3P50A 2XQYA 2KWHA 2X66A 2D2SA 1T98A 4DBRA 1T7SA 2IAKA 4ILBA 2XQ4A 2A3DA 3MKDA 4ZI3C 4CI3B 5ABGA 3C51A 3LG7A 3VRAA 4TZ4C 5CGMA 2HPJA 3ETVA 2BDEA 2XQ7A 1IZNB 2XQ5A 4QHOA 2XM2A 3LDQB 3N9MA 3NZPA 3TLUA 2EHOD 4ERRA 3AVSA 2X0YA 2YDSA 1S35A 2W00A 4EEDA 2VQFT 1E7PA 4DR3T 5DJQC 5DQWA 2ACXA 2A72A 1YKHB 3N9PA 4FJOA 2VVNA 3PUZF 4GK0E 4YHJA 5KDMC 3VKGA 2WZHA 3GN5B 2V5CA 5ABHA 4U31A 3QOFA 2YDRA 3I9YA 2K5BB 1T8BA 1HNZT 2LLYA 3O1JA 4ANJA 2W4XA 2M6IA 3OPCA 3UT5E 3IF8B 2CXFA 4DV3T 3RRCA 2HH7A 4JLEA 4EXTA 2LOPA 4JI7T 3SOLA 2XAJB 3KBTA 4P1NA 5LCYA 4LF8T 2WWVA 2CRBA 4AKHA 2ODUA 3U3IA 2ODVA 3CVRA 3HKDE 4X5TA 3FZHB 4A97A 2E5VA 4LFBT 4ISTA 3AE5A 4DR1T 3PUVF 2N2NA 1L0VA 5AQFB 3BK9A 5AFUL 4YSXA 4PJLA 1QUUA 5LJMA 1OEDA 5DABA 3ZEFB 4OFZA 2C5JA 5JDMA 2E9XB 1V9DA 3PTRB 5LJNA 2H3RA 3ONLC 4EEBA 2OV9A 4IDPA 1G8XA 2V6YB 4IE5A 4BJNA 3SS1A 3PUAA 4ZS3A 4DV2T 2SPCA 3UUBA 1MMNA 5AQJB 3RC8A 3HKEE 1HG5A 2B76A 4WYVA 5AQKB 1KNZA 4U7IA 5JR9B 3NZQA 5JVDE 4WW0A 1US7B 4O2AE 3UQ7A 4ZOLE 3AVRA 3EHZA 3ZJ1A 3NKZA 5L47A 1JNZA 3FZMB 3UULA 3RHWA 2ACZA 5IUXA 2FJBA 3E0ZA 1MIWA 3AE2A 2ZMAA 5AQQB 4K0UA 4QX7B 3RKGA 4WNKA 2LKGA 4DVDA 3RIUA 3PU8A 1W09A 3MXZA 4JEHB 4J2CA 2KINB 3OYZA 2DWGA 4CXWA 1XMQT 2V8SV 4H9NC 4KBMB 4COFA 4O8SA 2CM0A 5LG3A 3CX6B 1Z0PA 3PJAJ 3QUJA 2NTYA 1I94T 3QB5K 4CI2B 2WZIA 4DBQA 5AQOB 3P8CD 1HTJF 1LKXA 2W63A 3UUNA 2KNDA 3PUXF 1YQ4A 3ONJA 5AQHB 2VVSA 3CMLA 2XSAA 4I55E 2IMLA 2E9XC 2DLRA 5AQSB 4DR4T 3R6NA 5L3FB 1GQEA 1KK7A 3AA1B 5F5WA 5AQIB 5JDFA 2UUCT 5FMNA 4CZZB 1MNEA 3T8OA 2HHHT 2XQ3A 3TLSA 1SE7A 3L09A 4ZHQE 2L8KA 4AKGA 4UR9A 2W67A 3PUQA 3LBXB 5JR9C 4PFPA 2H7OA 3FB2A 3ONXA 4PJJA 5HXRA 3AAIA 2DHRA 3C98B 4F8HA 2XAHB 3UU4A 3FBZA 5LP6E 2JQQA 4IL9A 4U3CA 3S4UA 3RC3A 3PUWF 2XUEA 4ZZCA 4LMKA 4KHPT 4HWIB 2BKOA 2N1GA 3AE6A 4PAGA 1N36T 5JDGA 4U7YA 1LVFA 4ADZA 2X0HA 2WP9A 4PK5A 4Z8XA 2LRKA 4OX9T 2CMRA 3AB3B 4U2ZA 4FI5A 3ANWB 3DP7A 1AJ3A 4DNDA 1SHZC 2BKPA 1KEYA 2WBLA 1IJ5A 3AE3A 4JI4T 1UK5A 4TV9E 3EAMA 4HFEA 3K3OA 5CFBA 5LA6E 5HXCA 3MACA 5FXVA 1MMDA 2J4GA 3J9X1 5EK3A 4DV6T 2VKJA 2IC9A 2VK9A 3RX6A 3RLFF 4B3ST 2WWUA 3TLTA 5J0ZA 3ZCIA 2V7MA 2CXDA 4EIWA 2YOEA 3EI0A 4IDOA 2I59A 4HE8A 1N33T 2X9XA 2V7LA 4DO0A 3KV9A 2XHEB 4EYUA 2WDVA 4CN6A 4DR6T 2QA7A 4GOUA 3EVYA 2LSIA 4Z90A 2PBIA 1WRDA 2A9UA 5FYMA 4YLHA 1YW0A 4JI1T 3TLVA 5LNKA 2YDQA 2GK9A 2A2FX 2Q9QA 3P4WA 5HXEA 5FNVE 2JMHA 3BQIA 3Q5EA 3LK2B 4UV9B 3G06A 1XMOT 4I43B 4TNWA 2UXCT 1BR0A 2WDQA 3ZKRA 3K1SA 1B7TA 4CN1A 3PDYA 5FY7A 2LT3A 2BG9B 4QWNB 4JI6T 3IEEA 3UU3A 5L3GB 2KXPB 1HCIA 5LBMA 2YN6A 2MYSA 4YTNA 5JH7E 1N34T 2XQ9A 4UXNB 2JQ9A 3OJAA 3QK6A 3RIFA 3KVBA 2X51A 2HN2A 3UU8A 3FHNA 5J2TE 4EZ4A 2FUPA 3ZN1B 2LRLA 4LFAT 3VHLA 5L3DB 2VL0A 2W2UA 4QXCB 3ZMUB 4A56A 4DUZT 3RQWA 2ZM6T 4B3MT 1M62A 4H63H 1NENA 3RPUA 4DIDB 3N9QA 5CA0E 4JUYA 4L9IA 4DV4T 3NWIA 2XAQB 3HKCE 5F3JA 1N32T 4G63A 2VKOA 3EUHA 3H3AA 4AKLA 1OEDB 4UF0A 4DR5T 3K8PC 4NPPA 4I0UA 4X66T 2P9BA 2LE8A 1WYCA 1WR0A 3ETUA 1HFAA 3P4SA 3CX7B 1Y01A 4NUUA 3AEDA 3P4PA 2V5DA 2CCQA 2BG9C 5LG4A 3L39A 4Q25A 5CJ5A 2C0SA 3AXJA 3OBVE 3QB5A 2EHOB 2I6HA 2JQHA 4YSYA 5AQTB
chains in the Genus database with same CATH topology
5AQHB 1UK5A 1M7KA 5AQMB 3M3ZB 5AQQB 5AQFB 5AQVB 4HWFA 2D9DA 1M62A 5AQKB 5AQSB 5AQGB 5AQOB 5AQPB 3LDQB 1T7SA 3A8YC 3FZFB 5AQRB 5AQNB 4HWDA 4HWCA 5AQUB 3FZKB 3FZHB 5AQIB 1I6ZA 5AQLB 3FZMB 5AQJB 1HX1B 4HWHA 1UGOA 5AQTB 3FZLB 4HWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQH B;  1UK5 A;  1M7K A;  5AQM B;  3M3Z B;  5AQQ B;  5AQF B;  5AQV B;  4HWF A;  2D9D A;  1M62 A;  5AQK B;  5AQS B;  5AQG B;  5AQO B;  5AQP B;  3LDQ B;  1T7S A;  3A8Y C;  3FZF B;  5AQR B;  5AQN B;  4HWD A;  4HWC A;  5AQU B;  3FZK B;  3FZH B;  5AQI B;  1I6Z A;  5AQL B;  3FZM B;  5AQJ B;  1HX1 B;  4HWH A;  1UGO A;  5AQT B;  3FZL B;  4HWI B; 
#chains in the Genus database with same CATH topology
 4HTE A;  3RI5 A;  1O3X A;  2XPK A;  2KWI B;  4IL4 A;  4X1I E;  3M65 A;  1U5P A;  2YU1 A;  4WBN E;  1HNX T;  4AQF A;  3O1I A;  5LHI B;  1H7C A;  3N2K E;  4XZC A;  3F31 A;  1YQ3 A;  3RGL A;  1M7K A;  4TWH A;  2NP9 A;  3C4Z A;  1UCU A;  4YJ3 E;  5AQP B;  2X0L B;  3ZT5 A;  4ZI7 E;  4EB6 E;  2KT9 A;  4KX6 A;  2LEH A;  4A5X A;  1NWM X;  3RYH E;  3JCF A;  3I9W A;  3H3M A;  4O4L E;  3U78 A;  1UUS A;  1KNR A;  2FJE A;  2WSS V;  3AAE B;  3TKL B;  4DR2 T;  4YY3 T;  1FJG T;  1E1H B;  2K9A A;  2WM9 A;  3VR9 A;  2RPA A;  4ISS A;  5HEG A;  3DJB A;  1OED C;  3GA8 A;  4EYY R;  4QH5 A;  3NVO A;  3EDU A;  1ZP0 A;  5ABE A;  4DR7 T;  4X1Y E;  4MHC A;  3NRX A;  2CXL A;  4YTM A;  5AQG B;  1UUR A;  4DMV A;  2IHR 1;  4HKA A;  3UU5 A;  5AQU B;  2C5K T;  3MJX A;  3UUM A;  1D0Y A;  1XNQ T;  4ZS2 A;  2CE7 A;  2BS3 A;  2IUB A;  1ZV4 X;  5LGN B;  2EHO C;  3OVU A;  2CEA A;  2CHO A;  5LHH B;  4X64 T;  5C8Y E;  2JRK A;  4TNV A;  2VKD A;  3P4Q A;  2KLQ A;  5KXJ A;  2WY2 A;  5LGU B;  5KX5 E;  2NWB A;  2V1D B;  5FVL A;  3V5U A;  3CQX C;  3Q5D A;  3ESL A;  3CK6 A;  3QNU A;  2XTL A;  5LOV E;  4AXP A;  2X9W A;  5IWA T;  3FZK B;  2DWK A;  4F6R C;  1G73 A;  3Q2M A;  3HL6 A;  2VUR A;  4HFI A;  3C64 A;  2NR4 A;  4QH1 A;  2Y6X A;  4U33 A;  3JC6 D;  3R84 B;  1D1B A;  3KBU A;  5BR8 T;  3IA3 A;  3ZLI A;  4HWD A;  4HFC A;  2WCA A;  3AAA B;  3RRW A;  4ZZB A;  5HXH A;  4H9O C;  5LHG B;  4I4T E;  5F8P A;  2UXN B;  1U4Q A;  5ADX L;  2MTQ A;  2W66 A;  4JI0 T;  1VOM A;  2W61 A;  2XSB A;  4NXN T;  1S94 A;  4GYR A;  1Z8U A;  4H9R C;  2E9X A;  2F4V T;  1MMA A;  4O2B E;  2OLT A;  4HFD A;  5CB4 E;  3O1H A;  3ZPO A;  1IBK T;  3F57 A;  3NRY A;  1IJ6 A;  3PV0 F;  4DV7 T;  5FY0 A;  2BG9 E;  3AEA A;  3PU3 A;  4EOZ B;  5FL0 A;  1WFD A;  3HA4 A;  2V7K A;  4TN7 B;  4UVB B;  5HEU A;  3O4X E;  4JV5 T;  1YKE B;  5JRC A;  1BR1 A;  5HCJ A;  2YEV C;  1WCR A;  3LK3 B;  3ZT6 A;  3T1Y T;  3ZT7 A;  2D0U A;  4H9S E;  2Q9Q D;  3GWH A;  3ZSS A;  3TLW A;  5FKY A;  5ABF A;  5EZY E;  4C90 A;  4O4H E;  3ZST A;  5TAO A;  1FIO A;  4CN4 A;  5BMV E;  3O9X A;  5HWX A;  3P4R A;  4YHH T;  3I1A A;  2LOS A;  2WB5 A;  3OTO T;  4X1K E;  1OWA A;  2MBG A;  3WAJ A;  4MAL A;  2V7J A;  3FZL B;  4E7S A;  1XDO A;  4XBF B;  1YXR A;  1W0B A;  3CPZ A;  1KNP A;  4QX8 B;  3I0O A;  3LSV A;  4U74 A;  5HWY A;  3P7I A;  5LMU T;  4IE6 A;  2CBJ A;  4JI3 T;  1I6Z A;  4QKN A;  2DCF A;  3JC6 C;  3C50 A;  4P09 A;  1OED E;  4HWF A;  5FL1 A;  4K0K T;  4KMC A;  4ILC A;  2W62 A;  2NW8 A;  2AXD S;  4UEM A;  1XZY A;  2V26 A;  3KVA A;  4YXD A;  4QH4 A;  2XAF B;  1XWM A;  2K48 A;  3FXE B;  4DUY T;  1W0A A;  2BVL A;  2CLY B;  5E0O A;  4JI8 T;  2D9D A;  1J1J A;  2JPF A;  5JDQ A;  2CPT A;  4O4I E;  3FXD B;  5HAX A;  4GYS A;  1KFY A;  3UFE A;  4IHJ E;  3FBL A;  4LF5 T;  5FXW A;  2BS2 A;  3PUR A;  2PTF A;  1X79 A;  3LBX A;  4BA9 A;  3PJA A;  3ZC1 A;  3ZYL A;  4AQG A;  2JIW A;  5L2L A;  3A7M A;  4P0A A;  1VRB A;  1JNR A;  1J5E T;  3HR0 A;  1IBM T;  2LKH A;  2BZB A;  2G0U A;  1WLX A;  3UQ4 A;  2LM9 A;  2Y48 B;  5LMN T;  4TV8 E;  1QSD A;  2XAS B;  2WQY A;  4IIJ E;  2PFV A;  3VRB A;  1HS7 A;  2CHN A;  3SRZ A;  2FBW A;  4KP3 C;  2DL1 A;  3RH3 A;  3ZN0 B;  3AA6 B;  2H7V C;  3AA7 B;  4ASK A;  2LM2 A;  5JRE A;  3AE8 A;  3CIR A;  1W9R A;  4LF4 T;  3UFG A;  4N78 D;  5J2U E;  2JMK A;  4L0R A;  3GMI A;  1MND A;  3A8Y C;  5HEO A;  2UXB T;  2YU2 A;  2WU2 A;  2XY8 B;  3MA9 A;  4YFS A;  2XQ8 A;  5CA1 E;  1NEK A;  3ABV A;  3RQU A;  2VKH A;  3MZK B;  3AEE A;  5JTG A;  2X9H A;  5LYJ E;  2IC6 A;  2CLY C;  4IE4 A;  3RYF E;  3MK7 C;  5JQG E;  3QC9 A;  4NXM T;  1OXZ A;  5J1G A;  2JQK A;  4U72 A;  2QVA A;  1D0X A;  2E8I A;  3E22 E;  4TX5 A;  2HN1 A;  4M1P A;  3IBP A;  2WDR A;  2ZM0 A;  2L3L A;  4CI1 B;  2VB6 A;  2XAG B;  4B6X A;  3K3N A;  4PJM A;  2KMF A;  1WR6 A;  2LSJ A;  1T72 A;  2YK0 A;  4GIW A;  2LSG A;  4OYK A;  1FEW A;  3AE7 A;  3A5X A;  3N2O A;  4HWC A;  4MLK A;  4HWH A;  3CX8 B;  5FXZ A;  3PE0 A;  4EAH A;  1MMG A;  5HXS A;  5GON E;  2LSY A;  4CXX A;  1LVK A;  2E5L T;  4ZEY A;  2CWO A;  1EZ3 A;  2PG8 A;  5H6R B;  3ZCJ A;  3ZMT B;  3RKO A;  4CQI A;  2BG9 A;  2BS4 A;  3B13 A;  1KF6 A;  4LF7 T;  4P0B A;  2JJ9 A;  4JBW F;  4JYA T;  3L3P A;  3C4W A;  1R8I A;  4DV0 T;  4IDQ A;  4I50 E;  4PNI A;  2Y8D A;  3WAK A;  3UTK A;  2VWA A;  2WU5 A;  4C91 A;  3N9O A;  4AQF C;  2MPK A;  1NAF A;  4O4J E;  2E2A A;  4UV8 B;  3OYX A;  4IE0 A;  1ZEE A;  2D5U A;  3X1D A;  3LK4 2;  2XQA A;  1UX5 A;  4PK6 A;  3PUG A;  2VAS A;  5FP3 A;  5FY1 A;  4H63 V;  2N9D A;  4JI5 T;  2XJ7 A;  2CA5 A;  4LF6 T;  4JEU B;  4NUV A;  4KUM B;  3UUX B;  3V5S A;  5ETW A;  2E9X D;  2KZ7 B;  3VR8 A;  5JDL A;  4JI2 T;  3RYC E;  2VL8 A;  4EZH A;  2NTX A;  4A98 A;  3KDS E;  3ZYM A;  1UGO A;  3WI3 A;  5EK2 A;  5L4H A;  4NIQ A;  4IRE A;  4YSZ A;  4QXH B;  4AIS A;  4OYJ A;  3AEG A;  1D1A A;  4WBO A;  3JAE A;  4YJ2 E;  2QYW A;  3VKH A;  2K24 A;  2WMO A;  3CWZ B;  3AEF A;  5LBQ B;  2K3W A;  3BQL A;  2LHR A;  2KSR A;  4ILA A;  2WMN A;  4QXB B;  5KMG P;  2IIU A;  3ZC0 A;  2EHO A;  3GN5 A;  5A1L A;  4MBQ A;  4ZI2 D;  3VU7 H;  2B1E A;  5DQV A;  3AA0 B;  5JRC B;  2ZM2 A;  3RIA A;  2NW7 A;  5HEH A;  5AQN B;  4HFH A;  5ABF B;  1HR0 T;  3SFD A;  3RIU C;  2BBH A;  3AEC A;  3F2E A;  1E2A A;  1X9B A;  2IW5 B;  3EDV A;  4X65 T;  5JDN A;  2BKN A;  1IAP A;  2L9Q A;  4IE7 A;  1LRZ A;  2FJD A;  4E7Z A;  5FVK A;  1ZOY A;  3KIN B;  4AQY T;  3N5L A;  3KV4 A;  4WZX A;  2C5I T;  4DMW A;  3C4X A;  3CQG B;  3DTO A;  3T1H T;  4V1A v;  5HCM A;  3AE1 A;  5AQR B;  3RF1 A;  4B3T T;  2BVM A;  2YKS A;  4B3R T;  4AIU A;  3B57 A;  4HFV A;  4EV6 A;  5AQM B;  4UVA B;  3M3Z B;  4AI6 A;  2V6Y A;  3ZYK A;  3JAD A;  2J1D G;  4G2A A;  3CKD A;  4UVC B;  4ILU A;  1Y64 B;  5C2T A;  4AKI A;  2H89 A;  2LHN A;  1UX4 A;  3HKB E;  4BJM A;  3LFM A;  3ZMS B;  1XNR T;  2R6G F;  2PJQ A;  4OHF A;  1ZKE A;  3E08 A;  4HFB A;  2UUB T;  5L4E A;  4LML A;  5L3B B;  2MAW A;  5JR9 A;  3I0Q A;  3AE9 A;  2UUA T;  2NOX A;  2I0M A;  4BAY B;  4XAX B;  3B5M A;  4OK0 A;  2RP4 A;  2W0G A;  2J47 A;  3SFE A;  5C3J A;  2ES0 A;  4AKR B;  2UXD T;  4LF9 T;  4LFC T;  4PK4 A;  4ZI2 C;  3IHR A;  2V6X A;  1HX8 A;  2Q9Q B;  2Z6E A;  1D1C A;  2WS3 A;  2DNX A;  5LXT E;  3K3Q C;  5H6Q B;  3FZF B;  2NW9 A;  4IGU A;  3KV6 A;  2X67 A;  1DU2 A;  2VQE T;  4GKJ T;  5JDH A;  3Q9D A;  4PJN A;  2ZM8 A;  3Q5W A;  3N9L A;  1FMV A;  4IT4 A;  2LJL A;  2UXX B;  3LJC A;  5M4Y A;  4UIG A;  2XQ6 A;  5LB7 B;  3JAF A;  4HN9 A;  4ZXL A;  3HI2 A;  5FXX A;  1HX1 B;  4L5G A;  2BBJ A;  3CQC B;  4H9Q C;  2XZE A;  3PUY F;  3PUS A;  3ZMZ B;  5L3C B;  2RA1 A;  4CXY A;  2FJA A;  4EGW A;  3D0T A;  4UEL A;  2AE9 A;  2CWY A;  1VCT A;  4GK5 E;  4DV1 T;  3NBX X;  4TUY E;  5HYA A;  2X9Y A;  3N9N A;  4ZI3 D;  1CHU A;  5IYZ E;  3L8R A;  2WAU A;  2QGS A;  4IDN A;  3ZJ2 A;  2M6B A;  2XM1 A;  4PW8 A;  1MIV A;  2DI4 A;  3BQK A;  1MIY A;  2ZLY A;  5AQL B;  3AEB A;  4HGA A;  1IBL T;  2QRX A;  1BR4 A;  2YIN A;  4KHZ F;  3J7Y q;  1ZHC A;  4UF0 B;  2Q9Q C;  4H9P C;  4TWF A;  5IHY A;  3W15 B;  3Q5X A;  1VCS A;  4YTP A;  5LGT B;  1WYB A;  3EAB A;  1D0Z A;  4DV5 T;  4YT0 A;  1XDP A;  4U2Y A;  4X62 T;  2IDO B;  3ANW A;  5L3E B;  3KFW X;  1HNW T;  3SWH A;  3KV5 A;  4TWD A;  3AXJ B;  1HG2 A;  2M67 A;  4X20 E;  2UU9 T;  3UU6 A;  3RYI E;  2OA5 A;  5AQV B;  1YD8 G;  4IDZ A;  1HF8 A;  2J62 A;  3AE4 A;  2V7I A;  4HEA A;  2H88 A;  2HPL A;  1SA0 E;  3H37 A;  1FMW A;  4LMJ A;  2D0T A;  2MOZ A;  5HEJ A;  1QLB A;  2LSK A;  1J5W A;  1BR2 A;  1CUN A;  4MFR A;  4PFO A;  1SUM B;  4GKK T;  4Z91 A;  4KI0 F;  3ZMV B;  5EK4 A;  2X68 A;  2CBI A;  3N2G E;  3OKQ A;  3P50 A;  2XQY A;  2KWH A;  2X66 A;  2D2S A;  1T98 A;  4DBR A;  1T7S A;  2IAK A;  4ILB A;  2XQ4 A;  2A3D A;  3MKD A;  4ZI3 C;  4CI3 B;  5ABG A;  3C51 A;  3LG7 A;  3VRA A;  4TZ4 C;  5CGM A;  2HPJ A;  3ETV A;  2BDE A;  2XQ7 A;  1IZN B;  2XQ5 A;  4QHO A;  2XM2 A;  3LDQ B;  3N9M A;  3NZP A;  3TLU A;  2EHO D;  4ERR A;  3AVS A;  2X0Y A;  2YDS A;  1S35 A;  2W00 A;  4EED A;  2VQF T;  1E7P A;  4DR3 T;  5DJQ C;  5DQW A;  2ACX A;  2A72 A;  1YKH B;  3N9P A;  4FJO A;  2VVN A;  3PUZ F;  4GK0 E;  4YHJ A;  5KDM C;  3VKG A;  2WZH A;  3GN5 B;  2V5C A;  5ABH A;  4U31 A;  3QOF A;  2YDR A;  3I9Y A;  2K5B B;  1T8B A;  1HNZ T;  2LLY A;  3O1J A;  4ANJ A;  2W4X A;  2M6I A;  3OPC A;  3UT5 E;  3IF8 B;  2CXF A;  4DV3 T;  3RRC A;  2HH7 A;  4JLE A;  4EXT A;  2LOP A;  4JI7 T;  3SOL A;  2XAJ B;  3KBT A;  4P1N A;  5LCY A;  4LF8 T;  2WWV A;  2CRB A;  4AKH A;  2ODU A;  3U3I A;  2ODV A;  3CVR A;  3HKD E;  4X5T A;  3FZH B;  4A97 A;  2E5V A;  4LFB T;  4IST A;  3AE5 A;  4DR1 T;  3PUV F;  2N2N A;  1L0V A;  5AQF B;  3BK9 A;  5AFU L;  4YSX A;  4PJL A;  1QUU A;  5LJM A;  1OED A;  5DAB A;  3ZEF B;  4OFZ A;  2C5J A;  5JDM A;  2E9X B;  1V9D A;  3PTR B;  5LJN A;  2H3R A;  3ONL C;  4EEB A;  2OV9 A;  4IDP A;  1G8X A;  2V6Y B;  4IE5 A;  4BJN A;  3SS1 A;  3PUA A;  4ZS3 A;  4DV2 T;  2SPC A;  3UUB A;  1MMN A;  5AQJ B;  3RC8 A;  3HKE E;  1HG5 A;  2B76 A;  4WYV A;  5AQK B;  1KNZ A;  4U7I A;  5JR9 B;  3NZQ A;  5JVD E;  4WW0 A;  1US7 B;  4O2A E;  3UQ7 A;  4ZOL E;  3AVR A;  3EHZ A;  3ZJ1 A;  3NKZ A;  5L47 A;  1JNZ A;  3FZM B;  3UUL A;  3RHW A;  2ACZ A;  5IUX A;  2FJB A;  3E0Z A;  1MIW A;  3AE2 A;  2ZMA A;  5AQQ B;  4K0U A;  4QX7 B;  3RKG A;  4WNK A;  2LKG A;  4DVD A;  3RIU A;  3PU8 A;  1W09 A;  3MXZ A;  4JEH B;  4J2C A;  2KIN B;  3OYZ A;  2DWG A;  4CXW A;  1XMQ T;  2V8S V;  4H9N C;  4KBM B;  4COF A;  4O8S A;  2CM0 A;  5LG3 A;  3CX6 B;  1Z0P A;  3PJA J;  3QUJ A;  2NTY A;  1I94 T;  3QB5 K;  4CI2 B;  2WZI A;  4DBQ A;  5AQO B;  3P8C D;  1HTJ F;  1LKX A;  2W63 A;  3UUN A;  2KND A;  3PUX F;  1YQ4 A;  3ONJ A;  5AQH B;  2VVS A;  3CML A;  2XSA A;  4I55 E;  2IML A;  2E9X C;  2DLR A;  5AQS B;  4DR4 T;  3R6N A;  5L3F B;  1GQE A;  1KK7 A;  3AA1 B;  5F5W A;  5AQI B;  5JDF A;  2UUC T;  5FMN A;  4CZZ B;  1MNE A;  3T8O A;  2HHH T;  2XQ3 A;  3TLS A;  1SE7 A;  3L09 A;  4ZHQ E;  2L8K A;  4AKG A;  4UR9 A;  2W67 A;  3PUQ A;  3LBX B;  5JR9 C;  4PFP A;  2H7O A;  3FB2 A;  3ONX A;  4PJJ A;  5HXR A;  3AAI A;  2DHR A;  3C98 B;  4F8H A;  2XAH B;  3UU4 A;  3FBZ A;  5LP6 E;  2JQQ A;  4IL9 A;  4U3C A;  3S4U A;  3RC3 A;  3PUW F;  2XUE A;  4ZZC A;  4LMK A;  4KHP T;  4HWI B;  2BKO A;  2N1G A;  3AE6 A;  4PAG A;  1N36 T;  5JDG A;  4U7Y A;  1LVF A;  4ADZ A;  2X0H A;  2WP9 A;  4PK5 A;  4Z8X A;  2LRK A;  4OX9 T;  2CMR A;  3AB3 B;  4U2Z A;  4FI5 A;  3ANW B;  3DP7 A;  1AJ3 A;  4DND A;  1SHZ C;  2BKP A;  1KEY A;  2WBL A;  1IJ5 A;  3AE3 A;  4JI4 T;  1UK5 A;  4TV9 E;  3EAM A;  4HFE A;  3K3O A;  5CFB A;  5LA6 E;  5HXC A;  3MAC A;  5FXV A;  1MMD A;  2J4G A;  3J9X 1;  5EK3 A;  4DV6 T;  2VKJ A;  2IC9 A;  2VK9 A;  3RX6 A;  3RLF F;  4B3S T;  2WWU A;  3TLT A;  5J0Z A;  3ZCI A;  2V7M A;  2CXD A;  4EIW A;  2YOE A;  3EI0 A;  4IDO A;  2I59 A;  4HE8 A;  1N33 T;  2X9X A;  2V7L A;  4DO0 A;  3KV9 A;  2XHE B;  4EYU A;  2WDV A;  4CN6 A;  4DR6 T;  2QA7 A;  4GOU A;  3EVY A;  2LSI A;  4Z90 A;  2PBI A;  1WRD A;  2A9U A;  5FYM A;  4YLH A;  1YW0 A;  4JI1 T;  3TLV A;  5LNK A;  2YDQ A;  2GK9 A;  2A2F X;  2Q9Q A;  3P4W A;  5HXE A;  5FNV E;  2JMH A;  3BQI A;  3Q5E A;  3LK2 B;  4UV9 B;  3G06 A;  1XMO T;  4I43 B;  4TNW A;  2UXC T;  1BR0 A;  2WDQ A;  3ZKR A;  3K1S A;  1B7T A;  4CN1 A;  3PDY A;  5FY7 A;  2LT3 A;  2BG9 B;  4QWN B;  4JI6 T;  3IEE A;  3UU3 A;  5L3G B;  2KXP B;  1HCI A;  5LBM A;  2YN6 A;  2MYS A;  4YTN A;  5JH7 E;  1N34 T;  2XQ9 A;  4UXN B;  2JQ9 A;  3OJA A;  3QK6 A;  3RIF A;  3KVB A;  2X51 A;  2HN2 A;  3UU8 A;  3FHN A;  5J2T E;  4EZ4 A;  2FUP A;  3ZN1 B;  2LRL A;  4LFA T;  3VHL A;  5L3D B;  2VL0 A;  2W2U A;  4QXC B;  3ZMU B;  4A56 A;  4DUZ T;  3RQW A;  2ZM6 T;  4B3M T;  1M62 A;  4H63 H;  1NEN A;  3RPU A;  4DID B;  3N9Q A;  5CA0 E;  4JUY A;  4L9I A;  4DV4 T;  3NWI A;  2XAQ B;  3HKC E;  5F3J A;  1N32 T;  4G63 A;  2VKO A;  3EUH A;  3H3A A;  4AKL A;  1OED B;  4UF0 A;  4DR5 T;  3K8P C;  4NPP A;  4I0U A;  4X66 T;  2P9B A;  2LE8 A;  1WYC A;  1WR0 A;  3ETU A;  1HFA A;  3P4S A;  3CX7 B;  1Y01 A;  4NUU A;  3AED A;  3P4P A;  2V5D A;  2CCQ A;  2BG9 C;  5LG4 A;  3L39 A;  4Q25 A;  5CJ5 A;  2C0S A;  3AXJ A;  3OBV E;  3QB5 A;  2EHO B;  2I6H A;  2JQH A;  4YSY A;  5AQT B; 
#chains in the Genus database with same CATH homology
 5AQH B;  1UK5 A;  1M7K A;  5AQM B;  3M3Z B;  5AQQ B;  5AQF B;  5AQV B;  4HWF A;  2D9D A;  1M62 A;  5AQK B;  5AQS B;  5AQG B;  5AQO B;  5AQP B;  3LDQ B;  1T7S A;  3A8Y C;  3FZF B;  5AQR B;  5AQN B;  4HWD A;  4HWC A;  5AQU B;  3FZK B;  3FZH B;  5AQI B;  1I6Z A;  5AQL B;  3FZM B;  5AQJ B;  1HX1 B;  4HWH A;  1UGO A;  5AQT B;  3FZL B;  4HWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...