4HWIB

Crystal structure of atbag1 in complex with hsp70
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
177
structure length
177
Chain Sequence
MIRVRIKYGAVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock cognate 71 kDa protein
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
total genus 66
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwiB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hwiB01
4KSLC 4IM0A 2DAJA 2Y5BB 4PYUA 3S2AA 4FJYA 1WJUA 1WGDA 1V6EA 2FNJB 1E7VA 2FAZA 3V6CB 4WAAA 2WDTB 2AL3A 1YX6B 4AWJA 2BGFA 4GSWA 2KWVB 2WYQA 4KV2A 2NPTB 5AQRB 1WF9A 4E74A 2KLCA 2KQ7A 4ZRKA 5AQLB 4RM8A 3EC8A 1NDDA 2IBIB 1WM3A 1IYFA 2KDEB 2AYOB 4IW0A 4KDLB 2DAFA 3V60A 2DZJA 1A5RA 3X0WA 1UH6A 1U4AA 4M0WB 3NOBA 2REXA 4GMVA 1YX5B 4MGKE 2DYOA 3L16A 3IBEA 1E8YA 2CU1A 1L7YA 4GXBA 2KNBA 4BKGA 3LDZE 5IAAC 2KD0A 1E8WA 4AJWA 1TZ1A 3EECA 3FZMB 2MSED 3UIOB 3ZDMC 2ASQA 4FJVB 3L54A 3ZKJC 5EDSA 4WJNA 2MBEA 2JUOA 2FCQA 2I1KA 4DHJD 1E90A 2RGFA 2AEHA 2VRRB 3QJZA 4WWPA 5J17A 3AI5A 3PGEA 3PRZA 1AARA 2RR9A 1P98A 2ZZPB 4W9DA 3B0AA 4ZRJA 1OGWA 3NZSA 5E6OA 3VUYA 5AQQB 5JHBA 1RRBA 2ZCCA 2JVCA 3NS8A 3H7PB 3PRPB 4PS7A 4WJOA 3DCGA 4IWOA 2BWFA 4NAWB 3ZO5B 1YQBA 2GBKA 2MRPA 4I6LB 1WFYA 4URKA 1RAXA 3QWZB 4M8NA 3ZNGC 3KUZA 2KC1A 3HHMA 2L05A 3GOEA 3ZTCA 1FXTB 2KJHB 2A4ZA 3O65B 3N3KB 3C0RB 3I3TB 3PS6A 4BKSA 1WMHB 3JSVB 2D9DA 4BOZB 2N7DA 3KW5B 4XZ4A 5J18A 3H9DA 2MA9B 1WJ4A 1XQQA 2OJRA 2KWUB 3A9KB 3M62B 4IM2A 4OVUA 4EOYA 5DPRA 1Z2MA 3L10B 4B95A 1WX7A 3JW0X 2LUEA 4GU2A 3ZDTA 2KMAA 3H6NA 2C7HA 4WWNA 3WAMA 2FCNA 2M1MA 1MG8A 3UQBA 2V4LA 4NY0A 1GC6A 3LJ3A 2NVUI 4W9GA 2K39A 3BINA 2CHZA 3W1SA 3SU8X 2JY6A 4FBJB 5L83A 5AQHB 3QHTA 1KOTA 2HJ8A 5D6JB 1WYWB 1Q1OA 1V86A 5AQJB 2BF8B 2IO2B 4KIKA 2ZPYA 4GIVA 2LVOA 1E7UA 4DHJB 4W9JA 1WXAA 3QARA 2ZVOA 1M7KA 2JRHA 2CHWA 1EF5A 3EHVA 4HCNB 2C7MB 4JL9A 2BWES 2G4SA 4NJ7A 1X1MA 2KFKA 1H8CA 3JVZX 4JGHB 4MELA 1PQSA 1V80A 4HXDA 4X57B 3PREA 3OAWA 3HK0A 5AQIB 2O2VA 3DPDA 2N1WA 4HWDA 2KZRA 1ZGUB 4I6NB 3PLVA 3WANA 3TIXA 4ICUA 5D94A 3PLUA 2K6QA 4BKSD 3N30A 3RUIB 1C1YB 1V49A 1Z5SB 4LJPB 2GBJA 2KLGA 4YL8A 1T7SA 4MGYE 3LDQB 2WWZA 4IUMB 2IO3B 1P1AA 1WY8A 3SDLC 1TBEA 3NY5A 2C5LC 4GDLB 3DBHI 3PSEB 2K8BA 4K1RB 4CHKA 4HWIB 4ANUA 4LJOB 2PJHA 1WRDB 4HLEA 4JLCA 4CYEA 1OEYA 4AP4C 1H4RA 2DENB 5AZHA 3PTFC 2MX2A 2M4NA 4EFOA 3VAWA 3L17A 1ZW7A 2KXJA 1M94A 3PZDA 3R7QA 4JQWC 1RLFA 3V6EB 1XD3B 2K25A 4OVVA 1Q0WB 1WXVA 3QIJA 1WX8A 2MBBB 2IZVB 1R4MI 2LWPA 5AQGB 4KSKC 5DPSA 4HWFA 3L0WB 5BO4B 2DZKA 3AU5A 5TR5A 2M8SA 3QAQA 4AOFA 2D07B 2D11A 3B1LX 3M3ZB 1L2NA 3MJWA 4HPMB 4ZRIA 1KJTA 2GOWA 4TQ0A 5C1ZA 4XX5A 1WI0A 2C60A 4I6PA 2KOXA 4GDKA 4G11A 1WR6E 3U7DA 3L13A 4GOCA 1V2YA 3VDZA 2ZEQA 3WAPA 3OJ4B 4DDGD 3KH0A 4HJKA 4K7SA 3RD2A 4TKNA 1UGMA 1E5WA 2FCMA 2K1FA 5CHWA 5DCNA 2KTRA 1WGGA 2V3SA 5LLIA 3ZRCA 4HVBA 1E8ZA 2B3AA 4PYZA 3VTUA 4DXAB 4HK2A 4TUUA 2LGYA 3ZNZB 4MSQB 3IHPC 2JRIB 4XC2A 1IP9A 3OJ3A 2GBRA 5AZGA 5CHVC 1WE7A 1NBFC 2K6DB 2KVRA 3MHSD 3A4RA 4RMAA 3WAOA 2G3QB 1IPGA 1V5OA 4HDOA 4MJSA 3KVFB 3UGBB 4NQLB 4AJYB 3ENEA 4W9EA 3K9OB 1S3SG 5L95C 3DBRI 4ZYNA 5G55A 5DPWA 2O6VA 3VHTC 4ZDVA 1EF1A 4BKTA 1E8XA 4HCPB 4A3PA 5CTRC 2G45B 4A20A 4GN1A 3UIPB 2JXXA 1XT9B 2KFKB 2W9NA 4K81A 4DDID 1WJNA 2JF5A 2K8HA 3M63B 4GB9A 4WWOA 3PHWB 5JZEB 4M8MA 1ISNA 3T9LA 1UBQA 3ML8A 4ANVA 2O2VB 2KANA 3X23A 2N9PC 2NS5A 1F9JA 3ZRFA 5AQUB 2KC2A 2DZMA 3AULA 2DX5B 2L7RA 2KMCA 2YLMA 2ZCBA 3A4SC 1SE9A 1TGZB 1LFDA 2IY1B 2L0FA 3VUWA 2IO1B 2ZVNA 3RT3B 2C7NB 4II3B 2LXCA 5AQSB 2OOBB 2LGXA 4EEWA 1V81A 4G50A 4FJZA 1GJZA 2DYBA 2KDBA 3RULA 2LI5A 1NI2A 3PT2B 2RSUA 1I42A 1K8RB 2N9XA 3APDA 5CHFA 2KTFA 4DHZE 5AQFB 2LD9A 3UINB 4DHZB 4ANXA 1G6JA 1I35A 4MGIE 2LASA 2V1YA 3PV1A 1WZ3A 3H1UA 1YIWA 2MW5A 1WGYA 1UZXB 2JZ3B 1WM2A 4W9KA 3IVFA 3DVGY 2Z0EB 2ZNVB 2BKFA 3APCA 3FZKB 3R66C 2MBQA 2JZZA 2O6VD 2LVPA 4E3CA 5JHAA 5LXIB 3CF6E 3A1QA 4KVGB 4HWHA 3VQIA 2J7QB 2L8JA 3PVLA 3V62A 1Q5WB 2YVCA 1R4NI 4ASWC 3VH3B 3VFKA 1OTRB 3ML9A 3FZFB 2XEWA 1V5TA 2KDIA 3W1YA 3RZWC 4GGQA 4EZLA 1M62A 1WIAA 4W9HA 2KDFB 5AQKB 3ZLZA 1WXMA 2EKEC 1S1QB 1GC7A 4KDIC 3TL5A 1VCBA 2PPHA 2MQJA 3A9JA 5FR6A 3HM3A 4GDKB 3VUXA 4ANWA 4F8CB 2J0JA 3B08A 4EZKA 3L08A 3TJPA 3ZW3A 2MBOA 4BOSC 4E71A 1CMXB 4IM3A 1UD7A 3DBLI 3VH4B 1QZEA 2R2QA 4WQOB 1WGHA 2EMTA 3H7SA 4IC7B 4HPLB 4IG7B 4TV3A 5C23A 4BVUC 3D32A 1ZKHA 2EMSA 2KTRB 1J0GA 5DPTA 3RCZA 2KJ6A 3GZNI 1WX9A 2AWTA 4RM9A 3QX1A 3DOWA 3ZVVA 4IWQA 1Y8RC 2WX1A 1J19A 4BFRA 2KX0A 4NNJB 5D7GA 4W9FA 3WA0A 3ZIMA 5KHQA 2Z59B 4MJSB 2G4DB 1JRUA 4NPNA 2KN5A 4DBGA 3ECIA 2LVQA 3T8MA 2NR2A 4P7IA 2MP2A 2O6VB 4B6WA 1HX1B 2GBNA 3QCAA 2C9WB 4AUQC 4W9LA 4HDQA 2LJ5A 2J0KA 4K7UA 4MM3A 3HM6X 2XK5A 3QQ8B 4J6IA 3AU4A 3AXCA 3DQVA 3DBSA 3DVGX 4GDLA 1WZ0A 3KUDB 2FIDA 5JH5C 3EFUA 3V61A 3WALA 2N7EA 4W9IA 2PE6B 2Z0DB 1WE6A 3BY4B 3K9PB 3KYCD 4IWPA 2D2QA 1P3QU 2IY0B 2L3ZA 2GMIC 2MBHA 3VTWA 4NQKE 3FZLB 1C3TA 1EO6A 2N9EB 5KHOA 3OLMD 4A3OA 2FCSA 5E6NA 3SHQA 2MCNB 4ICVA 4WJPA 3ZTDA 1VD2A 1SIFA 2K8CA 3IG3A 4FN2A 3SD5A 1WR1A 3MTNB 4KIKB 2D10A 4MH0E 4WJQA 3TBLD 1GG3A 1UBIA 1GNUA 4PS3A 2ZJDA 1P0RA 3A33B 2PEAA 1V9JA 3WIMA 2NPTA 4MDKE 4BBNF 2KQSA 2JWZA 3PRMB 5AQTB 3QK0A 4F7ZA 2N1VA 3NZUA 3IFWB 5AQMB 2NBWB 4K7WA 5IA7A 5AZFA 2FUHB 2UWQA 3CSTA 1KLVA 4HWCA 2KJRA 2CS4A 3W1SC 1OQYA 4FULA 4DWFA 4FA6A 4KZCA 1SGHA 3TMPB 1WGRA 1LM8B 2GBMA 2NBUA 5AQNB 5GMVA 2KX3A 3A1QB 2IYDB 3JYUA 4W9CA 3R7RA 3M95A 5HKHA 4II2B 2CR5A 2IO0B 2NCNA 3KUCB 5G2NA 1UK5A 2R2OA 3Q3FA 5J2RA 5LXHA 1GUAB 2WX0A 1WJ6A 1KM7A 4MSMB 2KWCA 4LDTD 2LRUA 1BT0A 2DYMA 2KKCA 3CMMB 4DK5A 1LXDA 2LGDA 2J0MA 2PE9A 4FHKA 2DZIA 3CSFA 2HE7A 4CO7A 4EKUA 3H7PA 4MGZE 1HE8A 2BYVE 4NAWA 1EUVB 3ZUNA 3A9JB 3Q3JA 2M17A 3VXWA 3A8YC 2BPSA 2XBBC 3KYDD 2L0TA 4NJ6A 3VTVA 1YD8U 3RZFA 3TCAA 2HTHA 2RD0A 2N4FA 2L00B 1WMHA 3JSVA 1OEYJ 4FLHA 2AL6A 2KFJA 2MWSB 2BYFA 2ZPNA 3R3MA 1J8CA 2BYEA 3A9KA 4LCDE 3UQAA 1I6ZA 2CKHB 3ALBA 4G0NB 4B9KA 3ZNHB 3QA8A 2QHOA 3N32A 3QC8B 4KZ0A 3P2BA 3UF8A 3VVWB 4FADA 5D2MB 5AQPB 2D3GA 2UYZB 5E6PA 2MLBA 1UGOA 4N9F4 1WH3A 4JIOU 4G3XB 5AEKB 5AQVB 2BKRB 2KK8A 2LRWA 5CX3A 3APFA 2I1JA 3FZHB 2LZ6A 2JT4B 3ONSA 2ZNVC 3HIZA 2MP2B 2RPQA 1TTNA 4EUTA 3NHEB 1YJ1A 3RYTA 1D3ZA 1UELA 4PS8A 2HD5B 2XK5B 2DHZA 2FIFA 3PHXB 3DVNU 1RFAA 4MEMA 2JPHA 2LXAA 3U8ZA 1T0YA 4BBNC 2KHWB 4LDTB 2NBVB 3DDCB 2A5UA 3ZNID 4EZJA 2KO3A 1LQBA 1WXSA 2L76A 3DVNV 4TQ1A 4FHJA 2M0XA 5AQOB 3U30A 4F1SA 3M3JA 3PPAA 2CHXA 1P9DU
chains in the Genus database with same CATH superfamily
3VRAB 4DXFA 4PYUA 3S2AA 1F1HA 4FJYA 2LM9A 4P0AA 2WDRB 1ZHCA 2XQ3A 1G8XA 1SE4A 3T1HT 1B9RA 1J5WA 5FVLA 3VR8B 4AWJA 4A97A 1D0XA 2BGFA 4CN4A 2RPAA 2KWVB 2WYQA 4KV2A 2M0AA 5AQRB 2KQ7A 4ZRKA 5AQLB 1E1HB 1WM3A 4EEDA 1QLBA 2J52A 4IW0A 2C5JA 3V60A 4LFCT 2DZJA 4YT0B 4MALA 3H8HA 4MGKE 2DYOA 3IBEA 3QUJA 1NEKB 3LK3B 1MIWA 2KD0A 4PAGA 1E8WA 1TZ1A 3EECA 2V4IB 2WXLA 3JC6D 3P4RB 4B3MT 1YQ4B 2MBEA 5EE9A 5EDSA 2I1KA 4DHJD 4KHZF 2RGFA 1UF0A 4WWPA 5J17A 2RR9A 3B0AA 5EZYE 4ZRJA 2J47A 1RRBA 3BQLA 1N33T 4WJOA 1ZEEA 3ZPOA 4NAWB 5JR9C 3ZO5B 2GBKA 4I6LB 1WFYA 1W0BA 3ZXRA 3ZNGC 4KMCA 4AQGA 4M8NA 1FO4A 2GI9A 2KC1A 2W61A 1E2AA 3RIFA 1MHHE 3EABA 5JREA 1TS4A 5J0ZA 3P4SA 3PS6A 1PFDA 2PVOD 2WXIA 2XTLA 2I6HA 1WR6A 5L3DB 2WDVA 2NW8A 3ZSSA 4WW0A 1DU2A 1XLOA 3LB8C 2V26A 4GYRA 1Z2MA 5I4DA 2V0GA 1BMLC 4B95A 4JPSA 3AE7A 1WX7A 5EE0A 4BZAA 3H6NA 3RNAC 4WWNA 2RDBC 2FCNA 2M6BA 4W9GA 2CHZA 3SU8X 4PJMA 2B76A 1KOTA 2CHNA 5JDFA 5M4YA 2IO2B 3UUNA 4LMLA 4ZYSA 1WXAA 3RI7C 4HCNB 2LUMA 4JI4T 2BWES 1H8CA 4LK0M 4A56A 1F52A 2LGIA 2ZW1A 2QA7A 4EZHA 3BYYB 2IAKA 5HCJA 1YOVB 3BVMA 2Y3AA 3GS2A 3CX7B 2MBGA 2Y6XA 2K9AA 4HWDA 4RFBA 4EAHA 4EGWA 4I6NB 3PLVA 3SFEB 4CXXA 4JI1T 4N59A 2BKNA 3I57A 3WANA 4PJJA 2K6QA 3UT5E 3N2KE 5HEOA 5C2TB 4YFSA 3E22E 3IHRA 3RRCA 4LJPB 4HKQA 3P7IA 2GBJA 4UEMA 3SEBA 3NZPA 4LFAT 4MGYE 3LDQB 4YL8A 4C00A 5BMIA 5HCMA 2SAKA 4YXDA 2C5LC 4K1RB 2ZMAA 3N9MA 3AXJB 3PTRB 1WRDB 4WURA 3I5JC 1ZUD2 4AP4C 3BIID 1W0AA 1H4RA 4TNVA 4H9OC 4QXHB 2FBWA 5AZHA 3PTFC 1ET9A 5FK9C 2M4NA 3L39A 5HHDG 2ZM6T 1ZW7A 2J4GA 2X9HA 5LA6E 3ZSTA 3LBXB 1RLFA 2INCC 4JQWC 2K48A 3CX6B 5KDMC 4OVVA 4DBRA 4CI1B 1R4MI 2LWPA 1KFYA 2JRKA 1STEA 2MHJA 1FXIA 4HWFA 4JE3B 3PE0A 2UXDT 3AU5A 1OXZA 2RDGA 2D07B 2WU2B 3N9NA 1L2NA 3MJWA 3KV5A 4HPMB 4NJCA 1US7B 1KLGD 4TQ0A 5FY7A 1V9DA 4XX5A 3EDVA 4R3DA 2KOXA 2V3NA 3NUHB 5JRCA 3C51A 4GOCA 4L0RA 1V2YA 2CRBA 4DDGD 3KH0A 1L6UA 4O2BE 3HVDA 2WSSV 2IDOB 2X8XX 4H9QC 1EU4A 4TKNA 1WYBA 2WS3B 4HVBA 2OV9A 2XAJB 4X1KE 1WWTA 2V3PA 1BUIC 2B3AA 4EV6A 1LO5D 1MMAA 5FXZA 2LGYA 3ZNZB 1WYGA 4AQYT 5FXWA 4XC2A 2WY2A 5BMVE 1PGAA 4LMKA 1V5OA 2X9YA 3VRAA 4HDOA 2CU3A 4EYYR 3NBXX 4BJMA 1K50A 4QH5A 4ZZCA 4AJYB 3UU8A 3AA0B 4IDZA 5JDGA 1I4XA 2VB6A 4ZI3D 5LXTE 2O6VA 2ES0A 1VCSA 3VR8A 4BKTA 1N60A 5CTRC 2JXXA 4KP3C 4K81A 4DDID 1FNWA 1TYGB 1OWAA 1WJNA 4ASKA 2QC8A 2X38A 4ZI7E 3V5UA 4GB9A 3PHWB 3PUZF 4M8MA 1ISNA 4O4IE 3T9LA 2ACZA 3ML8A 4ANVA 2KANA 3C4WA 3ZC1A 2WQYB 5JR9A 2XHEB 1VLBA 1NWMX 3P4WA 2DZMA 2DX5B 4BAYB 2XAHB 2WHIA 2YLMA 2EHOB 2YK0A 1IBXB 4C90A 3KWLA 2ZVNA 3RT3B 4II3B 2LXCA 2LGXA 2E2AA 3AA1B 2E6XA 1GJZA 4FJZA 2DYBA 2CBJA 2KDBA 2MJ3A 3PZ7A 2ZLYA 3AVSA 3Q8BA 1K8RB 4RCOA 2NTSA 3NVVA 1HCIA 3CQGB 3ZMUB 2LD9A 4DHZB 1T3QA 3Q5XA 3ZMZB 2LASA 4LF5T 2V1YA 3PV1A 1YIWA 3PU3A 3HR0A 2MW5A 4KKJA 1NENB 4PW8A 3APCA 3R66C 3RYCE 2MBQA 2O6VD 3AE1A 4XDCA 4ZS3A 1G73A 1TKGA 2KNDA 3PVLA 5LB7B 4GYSA 1R4NI 4YSYB 4YTPA 3IAS1 3VFKA 2UUBT 1OTRB 4ILAA 2ACXA 4B0EA 4QHOA 3HVZA 3K3QC 2E5LT 4PK4A 2JQ9A 2KWIB 2LRKA 1KNRA 1SJED 3HKDE 1GC7A 4WZXA 4KDIC 3LFMA 2BTEA 1K52A 3HM3A 4HFDA 5JH7E 3ANWA 3TJPA 2H89B 3ZJTA 4BOSC 1CMXB 5L4HA 1C4CA 5FXXA 3P4QB 4JV5T 1WGHA 4QH4A 2CPTA 2KTRB 3IAM1 2MYSA 1QOBA 1UX5A 2E9XB 2V6YA 2XAGB 3ZMSB 2AWTA 3GZNI 3DOWA 3ZVVA 2MJDA 2WX1A 1J19A 4UVBB 5IHYA 2KX0A 2LE8A 3AE9A 3ZIMA 3E9SA 1EZ3A 1FNVA 2KT9A 2WXFA 1CUNA 3ECIA 5HEGA 2XM2A 3T8MA 1SE2A 2D3AA 3EVYA 4HFCA 1HX1B 5KXJA 2C9WB 4W9LA 2HJ1A 2W67A 1S35A 4QX8B 2J0KA 2IHR1 4DR5T 4J6IA 3AU4A 4OZBA 3GB1A 2XQ7A 1SA0E 4RGTA 3DBSA 4YSZB 3AE6B 4RF1A 1ZV4X 3EFUA 2PG8A 4W9IA 3B13A 3K9PB 2KWHA 3CWIA 4AKRB 3HKBE 2W63A 2GMIC 1ZOYA 5BR8T 4NQKE 5LG4A 4QXBB 5FKYA 3AN1A 5KHOA 1N62A 2WXQA 3ABVB 4ICVA 3SHQA 1VD2A 2K8CA 3BK2A 4OZCA 2HH7A 1WR1A 3MTNB 5FVKA 1IJ5A 1KK7A 1L4DB 4LLGM 3TBLD 5FY1A 2ZM8A 2PEAA 4US8A 3BYTB 5HFYA 3WIMA 2NPTA 2VKJA 3MK7C 4GIWA 3NRYA 5IA7A 5AZFA 3TLUA 4XYCA 1QOGA 3ZN0B 3HL6A 1JALA 2UXNB 2W4XA 1KLVA 4M0WA 2JJ9A 3ZYYX 1OQYA 4FULA 4FA6A 3T3NA 3TMPB 2DI4A 2NBUA 5EK4A 3A1QB 5GMVA 2N7JA 4H2AA 3UUMA 4W9CA 3JADA 3PUAA 3EUB2 4TWDA 2WXNA 4U7YA 3L09A 2IO0B 3CQCB 4DUYT 4PNIA 3IEEA 5G2NA 4HFVA 5FY0A 1UK5A 3Q3FA 5J2RA 1JNRA 1GUAB 2N9KA 3PO0A 3BZDB 2XQ8A 1VZ8A 2LRUA 3R2TA 3CMMB 2LGDA 5ABFA 2YN6A 2HE7A 3MACA 4CO7A 2SEBD 1D6EC 2W54A 3A8YC 2WP9B 3X1DA 1AWDA 2XBBC 2V7JA 1PGBA 5EE1A 3ZJUA 4NUUA 3VTVA 1YD8U 1V1PB 3EHZA 3J9X1 1WMHA 4PK1A 1OEYJ 2AL6A 4JI5T 2BYFA 3R3MA 1C4PA 4DR7T 2BYEA 3A9KA 1VR9A 4LCDE 1J8CA 4EOZB 1KNZA 1Y56A 1XLQA 3QC8B 4DBQA 1T0SC 4N9F4 4I43B 4Q2JA 4G3XB 5AEKB 5AQVB 5LMUT 3WAKA 3APFA 4H9RC 2UUCT 2LZ6A 3F57A 3RPFC 3W5VB 3ONSA 1WR0A 2RPQA 4JI7T 3AEDB 1IBXA 3KV9A 1D3ZA 1MNDA 5HXSA 2HD5B 4P1NA 3PHXB 3WI3A 4TWFA 3E0ZA 3VKGA 1HZ6A 3CMLA 4MEMA 1HF8A 2LXAA 4IKGA 3PURA 4BBNC 2KHWB 3IF8B 1FNUA 3DWGC 4JI6T 3ZNID 4EZJA 2KO3A 3AH7A 1LQBA 1VOMA 2SPCA 4ICUA 3M3JA 1C76A 1WSPA 1KF6B 2AE9A 3AEGA 5HXRA 2Y5BB 3OYZA 4IM0A 5JDQA 4NXMT 1XNQT 1WGDA 1V6EA 1E7PA 3PUGA 1V97A 2WDTB 1LVFA 2IUBA 2PKOA 1YX6B 1N63A 4HGAA 3ZXVA 3D0TA 4E74A 5FP3A 2BW2A 4RM8A 2JQQA 3NRZA 1NDDA 2IBIB 4MLKA 2BBCA 2KDEB 2AYOB 3DBRB 2DAFA 4KX6A 1OEDE 4IDPA 1UH6A 2M56B 3NOBA 1VDVA 4GMVA 4X1YE 2H7OA 1F2RC 2KNBA 2I38A 3AE2B 1ZP0A 2MSED 3ZKJC 5LNKA 4IT4A 2VZKB 1MIVA 2FCQA 4U2ZA 5ADXL 1VZ7A 2JX5A 1ROEA 4TZ4C 2L32A 3PRZA 4QX7B 4U7IA 1OGWA 2BS4A 4HEA1 5E6OA 3VUYA 5AQQB 4DXGA 3I9V1 3H7PB 4PS7A 3OPCA 4NPPA 1IZNB 4UV9B 3DCGA 3MJ5A 3RPUA 3B2GA 1YQBA 2MRPA 1RAXA 3HHMA 3GOEA 2DLBA 5LBQB 1FXTB 4WBNE 1WXQA 3Q8AA 4BA9A 2A4ZA 3O65B 3U52E 3HKEE 1TS5A 5KMGP 4C4VB 4BKSA 5JDHA 1IBMT 3JAFA 3RQUA 1N6ZA 3JSVB 4PK6A 3AE5B 5J18A 1FIOA 2OJRA 1HNWT 2KWUB 3M62B 4EOYA 4OVUA 3AEAB 3ZJ1A 3QOFA 4WWMA 5LJNA 2XQ6A 3TEYA 5EK2A 4K3BA 2VKOA 1JRPA 3ZDTA 4XWWA 3GN5B 4M1PA 2V4LA 4NY0A 4DUZT 3LJ3A 3BINA 3ZYLA 1BR0A 1ZE3D 4CXWA 2D3BA 2JY6A 3ABVA 5L83A 3NJTA 5D6JB 1Q1OA 4FI5A 2ZPYA 4RGNA 2K5PA 4AIUA 4W9JA 2JRHA 1EF5A 2WXRA 2C7MB 4JL9A 4ZI2C 1TS2A 2D2SA 2KDMA 2KFKA 3J9CA 2BQQA 3JVZX 2B1EA 4MELA 4UVCB 3DBLB 4XZCA 4HXDA 1XEEA 3OAWA 4B3RT 4IL9A 2O2VA 3DPDA 2PFVA 3GWHA 2KAJA 1Q10A 5H6QB 1XCTL 2E8IA 2J53A 4DR3T 4BKSD 4X20E 4EIWA 3OBVE 2LOSA 1Z5SB 2KLGA 2NWBA 3AECA 4IUMB 2QYWA 1IAPA 4O1NA 3SDLC 3ZYMA 2H88A 2VQFT 1NAFA 4JEHB 4K0KT 4LJOB 2PJHA 1Z0PA 2JWUA 4CYEA 1OEYA 3CIRB 4ITKA 1VRAB 2XQ9A 3Q9DA 1RYJA 2CHOA 3RNCC 3AEEB 4EFOA 1LVKA 3ZT6A 2KXJA 3PZDA 3IT4B 4B0MA 2HN1A 4ZRQA 2WXPA 1XD3B 2K25A 2N9DA 2IPKD 3ESLA 3IBPA 5MPOA 1Q0WB 1WXVA 3ONXA 2MBBB 1IBKT 3U3IA 2MPKA 4OFZA 1KLUD 1MPEA 1X79A 3L0WB 2YEPF 4I0UA 5BO4B 4M00A 1WYCA 1QKZA 2L83A 3RNGC 4IE5A 4P0BA 1ZXIA 3KBUA 4HROA 4AQFC 3Q2AC 5FXVA 4L1BA 1DOXA 1KJTA 5H6RB 1QQRA 2NR4A 3CX8B 3AVRA 2WMNA 3A7MA 4GDKA 4JI8T 3T8OA 2GK9A 4GK5E 1WR6E 3AEDA 2VKHA 4C7ZA 2JQRB 3GA8A 3OJ4B 3WAPA 1I4QA 3CVRA 1UGMA 1E5WA 2FCMA 5CHWA 5DCNA 3RYHE 3ZRCA 1WGGA 5LLIA 1QOAA 2VVNA 5JVDE 3VTUA 4PYZA 4DXAB 4HK2A 2LSYA 5ETWA 3ZCJA 4UIGA 3IHPC 2CMRA 5CHVC 3WAOA 2K6DB 1KF6A 2IW5B 3UGBB 4O8SA 1YMHE 4CN1A 3K9OB 5L95C 1HQRD 4L2YA 1YQ3B 4ZEYA 1CZPA 5LGUB 4HCPB 4A3PA 3Q14C 3AE8B 2C5IT 2INPE 3KQ4A 2W3RA 3UIPB 3C64A 4ARIA 4A9AA 4QXCB 3ZN1B 2LJIA 4WWOA 3UI3A 3Q5WA 4LF4T 1QF6A 2JMKA 1MIYA 3X23A 2DL1A 1LGRA 1MI0A 2L7RA 3UUXB 3A4SC 2KZ7B 4REZA 1WFDA 1SE9A 2IY1B 1SF0A 2IO1B 2C7NB 4KUMB 2GLSA 2QEJC 4EEWA 2V7IA 1AJ3A 5L47A 3RFZB 4UF0A 2LI5A 3ZLIA 1XWMA 3CK6A 2K9XA 3APDA 5CHFA 3AA7B 2WMOA 5JTGA 1CQVA 3UINB 2WBLA 3MC8A 4MGIE 2XN9C 1Y01A 2DHRA 4F8HA 3H1UA 1WGYA 2JZ3B 4W9KA 3IVFA 3DVGY 3H3AA 2ZNVB 3Q8EA 2BKFA 3AEFA 5ABHA 3KWVA 5HI1A 1L5PA 2LT3A 1N5XA 3PZ8A 4TSSA 4DV4T 2KT7A 2L8JA 1SHZC 4C80A 3V62A 2XQ5A 2BVMA 2YVCA 3ZJVA 5LBMA 3T1YT 2WLBA 4A55A 3ML9A 3FZFB 3O1JA 4EZLA 3P63A 3Q69A 4JX1C 5FNVE 4W9HA 2ZM2A 4EB6E 1KTKA 5AQKB 4YSXA 1WXMA 1R4MB 2EKEC 3IXSA 1H7CA 4LF7T 1VCBA 2PPHA 2WZHA 3VHLA 2MQJA 4ANWA 4F8CB 1JNZA 2J0JA 4EZKA 5C3JA 3AE4B 3ZW3A 1D5ZC 1FRDA 4G63A 4OK0A 4N6EB 1DGJA 2LFIA 2EMTA 2BS2B 4TV3A 4HPLB 4PJLA 4H63V 4A5XA 4N58A 4BVUC 1GQEA 2EMSA 1LKXA 5DPTA 3RCZA 3RX6A 4KGSA 4I4TE 2KJ6A 5F3JA 4TMAB 5FKAC 4AKIA 3QX1A 4HEAA 4IWQA 3C50A 1M4VA 2LGSA 1HA5A 3FILA 4AXPA 3WA0A 5KHQA 4MJSB 2A3DA 3K1SA 5AUIA 4DBGA 4IOIE 4DIDB 2LVQA 1XO3A 4U31A 4BAXA 1JQ4A 4KI0F 2HPJA 2XZEA 4GK0E 3SFDA 5L4EA 2HTME 4AUQC 5JDLA 3J7Yq 4OHFA 1RFKA 2XK5A 4ZI2D 4LF6T 4UVAB 3AXCA 2LHDA 4HJGE 5JH5C 2OHFA 3SOLA 2Z0DB 4IWPA 3KYCD 2BS3A 1P3QU 4QAYA 3VTWA 3QC9A 4X66T 2MBHA 3FZLB 1C3TA 4AQFA 5J1GA 4A3OA 3OLMD 1B7TA 1P7EA 3AV8A 2MCNB 2LOPA 3PUSA 1D5XC 1SIFA 3IG3A 4NXNT 4AQ7A 3LXFA 2WDRA 4IREA 5FMNA 4KIKB 3BQKA 2D10A 4MH0E 4RF0A 4YTMB 1KNPA 1GG3A 1D0YA 1GNUA 1UBIA 3N5LA 2ZJDA 3TLWA 1T8BA 1P0RA 1NYRA 1L4ZB 1FEWA 1L0VB 4HKAA 4DV3T 3PRMB 5AQTB 4B6XA 1QT9A 2JYTA 4NIQA 5AQMB 2NBWB 2YINA 2Y8DA 2UWQA 3OYXA 4D2KA 4JWSC 3O9XA 4YT0A 2KJRA 4A8XC 5F5WA 2Q9QB 4DWFA 2K3WA 2XY8B 4RH6A 4ILCA 4EYUA 2UU9T 1NEKA 1EM7A 2GBMA 3B5MA 5AQNB 1TS3A 4AI6A 3LK42 2V6XA 3M95A 3P4RA 4II2B 1YQ4A 1JW9D 1N36T 2AQ1B 2R2OA 5LXHA 2WX0A 2HHHT 4MSMB 4KHPT 4LDTD 3O13A 2I2YA 2DYMA 3KV4A 5HXCA 1LXDA 1YJIA 2LKGA 1UGJA 2PE9A 3CSFA 1ET6A 4EKUA 3KBTA 1VZ6A 4NAWA 3A9JB 2N2NA 4QH1A 3RIAA 3Q3JA 4O2AE 3VXWA 2Y48B 3R6NA 2VVSA 4YLHA 2L0TA 5IKCM 2EHOC 3VR9B 1N5WA 2XPKA 2HTHA 2NP9A 4DQOC 1QOFA 2QRXA 2L00B 4FLHA 4CI3B 3AE8A 3KLSX 2NW9A 2A72A 2KFJA 2PBIA 3P4PB 2ZPNA 5CA1E 2CKHB 4XAXB 4G0NB 2BBJA 3P8CD 3ZNHB 3B57A 3QNUA 3UF8A 3MJXA 5AQPB 2D3GA 3MC9A 1MMDA 2MLBA 4HFHA 5C8YE 4JIOU 2BYTA 1T98A 3GZNB 2KK8A 3BQIA 3UU5A 2KYWA 2LRWA 5CX3A 3FZHB 3ONLC 2MP2B 1I4PA 3CPZA 1TTNA 5HYAA 3NHEB 1YJ1A 3RYTA 1DOIA 3Q5EA 4PS8A 4MM3B 1IGDA 2DBYA 3U8ZA 2WGSA 3UQ7A 1TZOA 3KINB 3JAEA 2BVLA 3Q5DA 1WXSA 1YN5A 2BG9B 4IDOA 2M0XA 3OWEB 1IYFA 2CHXA 3R2IA 2DAJA 4H9PC 2KQ4X 2FNJB 4G2AA 3SFEA 1FMAD 2FAZA 1MFWA 4WAAA 2AL3A 5C2TA 2WXOA 1XCQL 2PVGC 3KV6A 2X51A 1WF9A 4NZLB 2IGHA 2KLCA 1MJDA 3GE8C 4CQNA 3UQ4A 2E9XC 4KDLB 5JQGE 1SEBD 4CN6A 3ZGZA 2WDQB 2BG9C 3AXJA 4PFPA 3X0WA 1U4AA 1WRDA 2V7MA 3FKYA 2CXFA 1HEZE 3RH3A 4IIJE 1L7YA 4GXBA 3RC8A 4BKGA 2IC6A 3LDZE 4AJWA 3UIOB 3ZDMC 2ASQA 1PDXA 3L54A 2N0SB 4WJNA 2AQ3B 2W2UA 4XBFB 3LBXA 2QJLA 3PGEA 1AARA 2ZZPB 2CWOA 3SWHA 5JHBA 4P09A 3NS8A 3PRPB 3P1MA 1D1AA 3DTOA 4IWOA 3N9LA 2X67A 4ZZBA 2BWFA 4URKA 2WU2A 1FD6A 2XAQB 1J7CA 2XSBA 3QWZB 5LOVE 2L05A 2L1AA 3ZTCA 4YTNB 5F8PA 1E10A 2KJHB 3CWZB 5HXHA 1J7AA 3F2EA 3E56A 4BOZB 2AXDS 2D9DA 3ZEFB 3KW5B 1QILA 3EUHA 1XQQA 3NVZA 2CCQA 2AQ2B 3U78A 4IM2A 4OVZA 1A70A 1SB3C 3IT6B 3L10B 1T72A 3LYYA 2YEPB 2WS3A 2QILA 3B2FA 4DR1T 4HE8A 4US9A 2RP4A 2XQAA 2LUEA 1HG5A 1J7BA 4MT5A 4Z90A 3PUQA 1MG8A 3UQBA 3I0OA 2K39A 4GKJT 5BYSA 5ABGA 1HS7A 3ONJA 3KDSE 5AQHB 3VRBB 3AE3B 4P1BC 2E3TA 2VK9A 1WYWB 3RYIE 5AQJB 2BF8B 4KIKA 4DV2T 5AFUL 3RN9C 2W66A 4E7ZA 1MG4A 1PYWD 4DHJB 3QK6A 3N1YC 2OA5A 3N9OA 2CHWA 1XNRT 2XM1A 1JWUD 4P6VF 1C9FA 3GMIA 2G4SA 4DNDA 2X0HA 4L9IA 4ANJA 1FCLA 4TV9E 1PQSA 1V80A 4X57B 3PREA 2MH7A 5AQIB 2VWAA 2WQYA 2INNE 2KZRA 2CXLA 1HTJF 2V9HA 3RRWA 5L3CB 4ZHPA 1GOZA 4S0RA 3N30A 4ILUA 2X0LB 2H3RA 2EHOA 1C1YB 4MACA 1V49A 1D1BA 3DP7A 4U74A 4WAFA 4ZOHC 4KGRA 3RKOA 1T7SA 2VQET 4Q25A 1FJGT 2WWZA 5LHIB 1UWMA 1P1AA 3L8RA 1WY8A 1QLBB 1TBEA 3K8PC 4GDLB 4UDUC 3HA4A 3DBHI 3PSEB 3W5UB 2L9QA 2YDSA 4TNWA 3W9CB 4ANUA 3EGRA 4HLEA 2V5DA 1Y64B 1UCUA 3PUYF 2CJNA 3DHIC 2DENB 1NENA 3Q8FA 1I7HA 3FAHA 1I4GA 3DHGC 1RWSA 3VAWA 2CE7A 4DMWA 1M94A 5LCYA 1UWXA 2IMLA 3N2GE 1T0RC 1XF5L 3AMZA 2P9BA 4EZ4A 1YD8G 3QIJA 2VKDA 1WX8A 4C7YA 3V05A 1W9RA 4YSYA 3RC3A 4DV1T 3HRDD 3N9QA 1C79A 2DZKA 2CJOA 5TR5A 4AOFA 3B1LX 1FIQA 2YEVC 4RGOS 4ACFA 1ZPSA 4ZRIA 2GOWA 5LG3A 1WI0A 2C60A 2EHOD 1SE3A 3P4SB 1YKEB 1QUUA 4A90A 2WNMA 3L13A 2H89A 2WDVB 2X68A 3W2DA 2LHEA 3RD2A 3NVWA 3P4QA 4F6RC 4ARCA 2K1FA 4IDNA 2KTRA 3AE7B 1F2RI 1YXRA 1E8ZA 2E9XA 2CLYB 4MSQB 3FBZA 3AAIA 2BG9A 3MXZA 2JRIB 2OLTA 1IP9A 5AZGA 2OJWA 3NRXA 5LP6E 1NBFC 3A4RA 5DABA 2G3QB 1IPGA 4DR6T 2B76B 4NQLB 3RKGA 5JDMA 3ENEA 3NWIA 4W9EA 1I4RA 1S3SG 4ISTA 4P16A 3DBRI 2HPLA 4U72A 3QB5K 5G55A 2V1DB 4ZDVA 3URYA 1E8XA 2G45B 4A20A 1XT9B 2W9NA 1S94A 1GAQB 3WCQA 3M63B 4YSZA 1KRHA 4YWGG 5JZEB 3AE6A 4O4JE 3MA9A 2WXGA 1UBQA 4UXNB 2XASB 3I1AA 4IHJE 4N78D 4S17A 5LHGB 3BK1A 3EDUA 3AULA 3AAAB 3RYFE 2KMCA 5BMGA 1TGZB 2L0FA 1D1CA 1LFDA 3VU7H 4MH8A 2Z8LA 4HPPA 1JMLA 3ETVA 4G50A 1TT5B 2WXJA 2JMHA 4UV8B 3RULA 4YXDB 2RSUA 2L3LA 2N9XA 4HFBA 2N1GA 2E9XD 3RLFF 3Q3NC 4DR2T 1G6JA 3FHNA 4K0UA 4ANXA 1I35A 5HEJA 4HTEA 2X9WA 3V5SA 4H63H 2BKOA 2FBWB 1UZXB 3ZCIA 2LRLA 2PIAA 2D3CA 2LLYA 1SIJA 4PK5A 2Z0EB 2ODUA 3O1HA 5EK3A 3ZC0A 1W09A 5LXIB 2JZZA 4WBOA 4E3CA 2V7LA 3LSVA 2LJLA 3A1QA 3FB2A 4KVGB 4HWHA 1IUEA 3VQIA 1BR4A 4NUVA 1E0ZA 2J7QB 3G06A 1KFYB 3TSSA 1FEHA 4TV8E 1V5TA 1PUTA 2NOXA 4YJ2E 5E0OA 4LF8T 2RA1A 4GGQA 3OTOT 1UUSA 5HEUA 3RZWC 3JCFA 3EI0A 2D0TA 1WIAA 2E5VA 2KDFB 4YJ3E 2IGDA 2L52A 4FXCA 2VH2A 1S1QB 4TX5A 1UURA 2WM9A 4TWHA 3K3OA 5FR6A 3VUXA 2K5BB 2WP9A 3EFCA 2LKHA 4E71A 3KFWX 3VRBA 3IA3A 1TKYA 4LNIA 5EE3A 3AB3B 1VCTA 3DBLI 4IE0A 3VH4B 2INDC 1V1PA 2R2QA 4TN7B 3H7SA 1ZKEA 3BVZA 4WQOB 3D32A 4QKNA 4BJNA 4TUYE 1TY2A 3Q3MC 3CQXC 2J1DG 1WX9A 2R6GF 2ICIA 5J2TE 4LNKA 5ABEA 3BK9A 2M67A 4BFRA 4ZS2A 4NNJB 2I0MA 4W9FA 1OFFA 2C5KT 4OYJA 2KN5A 4NPNA 3SR6A 1V1OA 3ZKRA 1D5MC 2J42A 2NR2A 4P7IA 2O6VB 1HFAA 1MMGA 2W3SA 2GBNA 3QCAA 1UNSA 5L3BB 2Q5WD 5HWYA 4HDQA 3OJAA 3RNFC 2RDHA 1HTOA 4Z91A 3DQVA 4GDLA 3O1IA 2I59A 3SRZA 2BKPA 5LJMA 1FXAA 2ACZB 3V61A 3BY4B 2QDFA 3WALA 3B9JA 2D2QA 5JR9B 1EWYC 4PT5A 4AKLA 2N9EB 3N9PA 3N20C 3MFGA 3PJAJ 3ZTDA 3AEBB 3N2OA 2YOEA 2DLRA 1C77A 4FN2A 3SD5A 1U5PA 2LHNA 2KVZA 4DV6T 4P1CC 2CXDA 1BXTA 4RGMA 4PS3A 3RHWA 1AW7A 5L3EB 2JZPA 4I50E 3EAMA 2JQHA 4JI2T 1V9JA 1XLNA 4BBNF 3SS1A 4ERRA 3Q8CA 2JWZA 3QK0A 4XGAB 2N1VA 2CBIA 4O4LE 2JSVX 2BB6A 3ZYKA 3NZUA 4F7ZA 4HFEA 1SE7A 1LRZA 1DYQA 2LSIA 1EWCA 1HTQA 4HWCA 2CS4A 3W1SC 2XSAA 2KWDA 4IE4A 4OZAA 3AE1B 5D3DA 1WGRA 1LM8B 4HRSA 5AUKA 2FJAA 3RQWA 3TUOA 2JPFA 3JYUA 4X62T 3AE2A 3NS1A 3R7RA 3FXDB 5HKHA 3NVOA 2FJBA 2CR5A 2NCNA 3KUCB 4YTPB 3VKHA 3T3OA 4WYVA 1KM7A 4U2YA 4AS1A 3WAJA 2KKCA 4EE2A 5JDNA 1YKHB 4FHKA 3TLVA 3H7PA 2QGSA 1U4QA 4LF9T 2KMFA 1HE8A 2BYVE 4OX9T 2WXKA 2M17A 5LMNT 2V8SV 3ANWB 1VRBA 3KYDD 3UU3A 2XUEA 4NJ6A 3ETRA 3RZFA 3TCAA 2XAFB 4V1Av 2RD0A 4C4VA 1FRRA 4EXTA 3I0QA 3JSVA 2IGGA 2EKIA 1HNZT 3AE5A 2V6YB 4DV7T 2KMMA 2UXXB 3S4UA 3UQAA 4IDIA 3AEAA 1I6ZA 1WGKA 5BYRA 2QHOA 3N32A 4CXYA 4KZ0A 3VVWB 2GB1A 5D2MB 3TLTA 5L2LA 3AE9B 1NVID 3GN5A 1WH3A 3NVYA 2BKRB 4IL4A 2I1JA 4HFIA 5GXGB 4H9SE 3N1XC 1TY0A 2ZNVC 3RIUC 1PGXA 2WU5B 3U4EG 4JLEA 4EUTA 3DJBA 2W62A 3ZMTB 2KACA 2ON8A 2VZKD 1DOYA 1E6EB 2WCAA 1SBBB 3DVNU 1RFAA 1MHXA 2JPHA 1T0YA 2H7VC 1HXYD 2NBVB 2Z6EA 2ZM0A 1ZOYB 4IE6A 2L76A 1HR0T 4FHJA 3AA6B 2VL8A 2BZBA 3HI2A 1K51A 4KSLC 4Z8XA 4X64T 1XMQT 1AN8A 1WJUA 3MP9A 1E7VA 3QB5A 3ZQ4A 5DQWA 3V6CB 3PUXF 5IO9A 4OYKA 3C4ZA 2W82A 2K22A 2IIUA 4GSWA 2NPTB 3GP7A 5H8YE 3PUWF 1BR2A 3HKCE 3EC8A 1MMNA 2QSDA 2YU1A 1A5RA 4M0WB 2REXA 1YX5B 4XDDA 3CIRA 3L16A 1FFVA 1E8YA 2CU1A 2JXTA 5IAAC 3AEEA 2PLPA 4B3ST 5HXEA 1I4HA 4M01A 3FZMB 4FJVB 1HG2A 2PJQA 4L23A 2JUOA 3Q3OC 1FFUA 1E90A 1N32T 2AEHA 2VRRB 3QJZA 2WB5A 3AI5A 4W9DA 2BDEA 1P98A 2PW9A 1TKEA 2WAUA 4CQIA 3NZSA 1X9BA 3AB5A 5ABFB 4A98A 2LSJA 5CGMA 1EU3A 2JVCA 2ZCCA 3MC0B 3NZQA 2VASA 2L8KA 2F4VT 2FUG1 1Z8UA 3C19A 1F0ZA 3KUZA 2QMTA 5T8IA 4C91A 4J3OD 2LEKA 3N3KB 1MVKA 4DV5T 3C0RB 3I3TB 3E08A 1E9MA 1WMHB 2HDEA 4K3CA 2N7DA 4XZ4A 3TEWA 3H9DA 2MA9B 4KBMB 1WJ4A 3PJAA 3A9KB 4X1IE 4DMVA 1ACCA 5DPRA 4B3TT 3I63C 5DJQC 1FPYA 3HUIA 3JW0X 1JWBD 4PJNA 3C8YA 4GU2A 2KMAA 2KLQA 2C7HA 1R4NB 2XQ4A 3WAMA 2M1MA 2MTQA 4QWNB 3Q6BA 1AYFA 3I9YA 1GC6A 2DNFA 2NVUI 3W1SA 2Q9QC 4FBJB 5LNK1 3R84B 3AEBA 4ZXLA 1N61A 3QHTA 3C4XA 2HJ8A 4DV0T 1ENFA 1V86A 3PU8A 3R8BA 4GIVA 2LVOA 4ZOLE 1E7UA 4YY3T 3KVAA 5IYZE 1YQ3A 1R8IA 5TAOA 3AAEB 3BWUD 2ZVOA 1M7KA 3QARA 3EHVA 1FCCC 1FM0D 4DR4T 1X1MA 4NJ7A 5E6JA 2FUPA 4JGHB 2YDQA 1YJJA 4MHCA 2MOZA 1ZXHA 3HK0A 3C98B 3AEGB 1CHUA 4UELA 2N1WA 1NYQA 1ZGUB 4GOUA 2BT6A 3L4PA 1E7PB 3TIXA 5D94A 2XJ7A 4GKKT 3PLUA 5D3IB 3RUIB 3PV0F 2C0SA 1GPXA 2M6IA 2VURA 1YNTE 2UUAT 2NMQA 1T5XD 2IO3B 3NY5A 5FL0A 4KX6B 2K8BA 4CHKA 3ZJ2A 4HWIB 1QSDA 5LYJE 2G9HD 4JLCA 1HNXT 4XE0A 1XXGA 2BVCA 5JXVA 3BVGA 2LMCA 2VH1A 2MX2A 1ZP0B 5IN7A 4M02A 3ZT7A 2W0GA 3L17A 2K24A 3P50A 3RIUA 3R7QA 4WIPA 1NI3A 1WCRA 4JBWF 3V6EB 2X9XA 5LHHB 2G0UA 4LNFA 1VJKA 2IDYA 2IZVB 2BS4B 5AQGB 1SUMB 4HKZE 4KSKC 4IDQA 5HEHA 4OW0A 5DPSA 5GONE 2WWUA 2M8SA 3QAQA 1FMWA 2D11A 3M3ZB 3MZKB 5DQVA 1OEDB 4JI3T 1YN3A 4E7SA 4ADZA 1J1JA 4HN9A 5C1ZA 1KEYA 3O4XE 4I6PA 3UULA 2K3UA 4G11A 2J62A 3U7DA 3RNBC 3VDZA 2WU5A 4O4HE 2ZEQA 3AE4A 3N1ZC 4HJKA 5IUXA 4PFOA 1B1ZA 2V5CA 4K7SA 3NG0A 2BS2A 1O3XA 2V7KA 1UUPA 2LM2A 1RM6C 2GRIA 2V3SA 3UFGA 3UTKA 1J5ET 3P42A 1TJEA 4AISA 4AKHA 2CWYA 4TUUA 4YHJA 3EA6A 2X66A 2PTLA 2ZW0A 1OEDC 3OJ3A 2GBRA 1WE7A 2KVRA 3MHSD 4RMAA 5L3GB 4MJSA 2YU2A 3KVFB 3W15B 2R61A 1YN4A 2NW7A 1TIFA 4ZYNA 5DPWA 3VHTC 3CKDA 1EF1A 3TKLB 4GN1A 1XDPA 2YDRA 2CEAA 2KFKB 5FYMA 1V8CA 2JF5A 2K8HA 1F77A 2O2VB 3K3NA 2N9PC 2NS5A 2XNAC 2WZIA 3DHHC 1F9JA 4H9NC 3ZRFA 5AQUB 2KC2A 2JIWA 4ZHQE 1OQQA 2AX5A 2ZCBA 2FJEA 5L3FB 5BMHA 2KN4A 3VUWA 4YHHT 4USAA 5AQSB 2OOBB 2QIEB 3AECB 4YTMA 1V81A 3MHZA 4KGTA 2W00A 1XLPA 1NI2A 2WXHA 3PT2B 2VL0A 2H88B 1I42A 1D0ZA 4WQMA 2KTFA 4DHZE 1L0VA 2NTXA 1UX4A 1IJ6A 5AQFB 2ONQA 1YW0A 1P7FA 5CFBA 5A1LA 1C4AA 1WZ3A 4XWTA 3ETUA 3H37A 1WM2A 3DBHB 2PTFA 2D0UA 1ESFA 3DWMA 1BR1A 2Q9QA 1SJHD 4CI2B 3FZKB 1XZYA 5JHAA 4L5GA 2LVPA 4IGUA 4U3CA 2EELA 3CF6E 2ODVA 5TSSA 4LNOA 1N34T 5KX5E 2FJDA 2HN2A 3JC6C 3LG7A 2J4XA 1Q5WB 2A9UA 5IWAT 4ASWC 3VH3B 5CA0E 4JEUB 2XEWA 4WNKA 2DWGA 3RF1A 2KDIA 3W1YA 2MJEA 5G5HA 4JUYA 2D5GA 2LHRA 1M62A 3N9YC 3UU6A 2DCFA 3ZLZA 1D4BA 2LEHA 1GB1A 3TL5A 2K0PA 1JWMD 3A9JA 4GDKB 3RMKC 1T0QC 1KH0A 3B08A 2IJ0A 3L08A 2MBOA 3U7ZA 2Y5PA 3VR9A 4IM3A 1UD7A 4WH4A 2XQYA 1QZEA 4GLSC 4IC7B 4IG7B 5C23A 4A6QA 4I55E 4OHJA 1ZKHA 1J0GA 2MAWA 2CM0A 1FMVA 4IE7A 3P4PA 5CJ5A 4MBQA 4RM9A 4ISSA 2BG9E 4DVDA 4NAMA 3A5XA 4JWUC 1K53A 1JROA 1Y8RC 3TEZA 5D7GA 2Z59B 3UFEA 2Q9QD 2G4DB 1JRUA 2JYEA 2OEDA 3LJCA 5CB4E 2MP2A 4B6WA 2N9LA 2LSGA 4UR9A 1JWAD 3FBLA 4ZRPA 2LJ5A 4AKGA 4K7UA 4MM3A 3HM6X 1JCKB 5HAXA 2JU6X 3QQ8B 2G1EA 3DVGX 2CA5A 1WZ0A 4J2CA 2FIDA 3KUDB 2QCZA 2N7EA 1C78A 1L6VA 1WE6A 2PE6B 3U2SC 2IY0B 2L3ZA 2WXMA 4CZZB 1EO6A 3TEXA 2FCSA 5E6NA 4WJPA 3PUVF 5FR3A 2DNXA 4WJQA 1I94T 4UF0B 2NTYA 2QVAA 3FC4A 3A33B 2NTTA 4ILBA 3OKQA 4MDKE 5IP4D 4JI0T 2KQSA 1WLXA 4EEBA 3UUBA 3IFWB 3RGLA 4K7WA 4LTUA 4DO0A 2CLYC 3Q2MA 2WDQA 2FUHB 5IOIA 1T6BX 1OEDA 3CSTA 4FJOA 1GB4A 2KINB 2TSSA 3M65A 1SGHA 3AEFB 4KZCA 2UXCT 2KX3A 2IYDB 3PDYA 3I9WA 4X5TA 3MKDA 4X65T 5HWXA 3L3PA 1CK1A 3LK2B 1SSNA 1WJ6A 1MNEA 2KWCA 4KKIA 1BT0A 4DK5A 5FL1A 2J0MA 2DZIA 4YSXB 4MGZE 4MFRA 3ZUNA 1EUVB 3RNEC 2JQKA 1XMOT 1CJEA 2MEKA 2BPSA 4LFBT 4JYAT 3OG5A 5G5GA 5C3JB 1HX8A 2RMMA 4YTNA 2Y5CA 1L0XB 2W55A 2IC9A 3UU4A 1ZDVA 2BBHA 2N4FA 3ZT5A 3KVBA 3F31A 2WWVA 3FXEB 2X0YA 2MWSB 1WRIA 3ALBA 4B9KA 2RPVA 3QA8A 5HG2A 4LMJA 3OVUA 3P2BA 4FADA 3FILB 2UYZB 5E6PA 1UGOA 3NKZA 1ZDXA 5J2UE 5BYQA 2LSKA 2UXBT 1R7SA 2JT4B 3HIZA 3NZ3A 5LGNB 5JRCB 2KSRA 2KXPB 2FE8A 2DWQA 3SFDB 1IGCA 3ZMVB 3AE3A 1L0YB 2D5UA 1UELA 4COFA 4ZI3C 4U33A 3RI5A 2PMVA 2A2FX 5H92C 4C56C 2XK5B 2DHZA 1XDOA 1HZ5A 1IBLT 2FIFA 3AM9A 3GE3C 1SXTA 2M19A 2DWKA 4LNNA 2YKSA 5LGTB 4LDTB 3DDCB 2BS3B 2A5UA 2UU7A 4ZHOA 4RNAA 1JWSD 3U30A 3V3XA 3H3MA 3DVNV 2BB5A 4TQ1A 5AQOB 3TLSA 1OQRA 4F1SA 3PPAA 1P9DU
chains in the Genus database with same CATH topology
4KSLC 4IM0A 2DAJA 2Y5BB 4PYUA 3S2AA 4FJYA 1WJUA 1WGDA 1V6EA 2FNJB 1E7VA 2FAZA 3V6CB 4WAAA 2WDTB 2AL3A 1YX6B 4AWJA 2BGFA 4GSWA 2KWVB 2WYQA 4KV2A 2NPTB 5AQRB 1WF9A 4E74A 2KLCA 2KQ7A 4ZRKA 5AQLB 4RM8A 3EC8A 1NDDA 2IBIB 1WM3A 1IYFA 2KDEB 2AYOB 4IW0A 4KDLB 2DAFA 3V60A 2DZJA 1A5RA 3X0WA 1UH6A 1U4AA 4M0WB 3NOBA 2REXA 4GMVA 1YX5B 4MGKE 2DYOA 3L16A 3IBEA 1E8YA 2CU1A 1L7YA 4GXBA 2KNBA 4BKGA 3LDZE 5IAAC 2KD0A 1E8WA 4AJWA 1TZ1A 3EECA 3FZMB 2MSED 3UIOB 3ZDMC 2ASQA 4FJVB 3L54A 3ZKJC 5EDSA 4WJNA 2MBEA 2JUOA 2FCQA 2I1KA 4DHJD 1E90A 2RGFA 2AEHA 2VRRB 3QJZA 4WWPA 5J17A 3AI5A 3PGEA 3PRZA 1AARA 2RR9A 1P98A 2ZZPB 4W9DA 3B0AA 4ZRJA 1OGWA 3NZSA 5E6OA 3VUYA 5AQQB 5JHBA 1RRBA 2ZCCA 2JVCA 3NS8A 3H7PB 3PRPB 4PS7A 4WJOA 3DCGA 4IWOA 2BWFA 4NAWB 3ZO5B 1YQBA 2GBKA 2MRPA 4I6LB 1WFYA 4URKA 1RAXA 3QWZB 4M8NA 3ZNGC 3KUZA 2KC1A 3HHMA 2L05A 3GOEA 3ZTCA 1FXTB 2KJHB 2A4ZA 3O65B 3N3KB 3C0RB 3I3TB 3PS6A 4BKSA 1WMHB 3JSVB 2D9DA 4BOZB 2N7DA 3KW5B 4XZ4A 5J18A 3H9DA 2MA9B 1WJ4A 1XQQA 2OJRA 2KWUB 3A9KB 3M62B 4IM2A 4OVUA 4EOYA 5DPRA 1Z2MA 3L10B 4B95A 1WX7A 3JW0X 2LUEA 4GU2A 3ZDTA 2KMAA 3H6NA 2C7HA 4WWNA 3WAMA 2FCNA 2M1MA 1MG8A 3UQBA 2V4LA 4NY0A 1GC6A 3LJ3A 2NVUI 4W9GA 2K39A 3BINA 2CHZA 3W1SA 3SU8X 2JY6A 4FBJB 5L83A 5AQHB 3QHTA 1KOTA 2HJ8A 5D6JB 1WYWB 1Q1OA 1V86A 5AQJB 2BF8B 2IO2B 4KIKA 2ZPYA 4GIVA 2LVOA 1E7UA 4DHJB 4W9JA 1WXAA 3QARA 2ZVOA 1M7KA 2JRHA 2CHWA 1EF5A 3EHVA 4HCNB 2C7MB 4JL9A 2BWES 2G4SA 4NJ7A 1X1MA 2KFKA 1H8CA 3JVZX 4JGHB 4MELA 1PQSA 1V80A 4HXDA 4X57B 3PREA 3OAWA 3HK0A 5AQIB 2O2VA 3DPDA 2N1WA 4HWDA 2KZRA 1ZGUB 4I6NB 3PLVA 3WANA 3TIXA 4ICUA 5D94A 3PLUA 2K6QA 4BKSD 3N30A 3RUIB 1C1YB 1V49A 1Z5SB 4LJPB 2GBJA 2KLGA 4YL8A 1T7SA 4MGYE 3LDQB 2WWZA 4IUMB 2IO3B 1P1AA 1WY8A 3SDLC 1TBEA 3NY5A 2C5LC 4GDLB 3DBHI 3PSEB 2K8BA 4K1RB 4CHKA 4HWIB 4ANUA 4LJOB 2PJHA 1WRDB 4HLEA 4JLCA 4CYEA 1OEYA 4AP4C 1H4RA 2DENB 5AZHA 3PTFC 2MX2A 2M4NA 4EFOA 3VAWA 3L17A 1ZW7A 2KXJA 1M94A 3PZDA 3R7QA 4JQWC 1RLFA 3V6EB 1XD3B 2K25A 4OVVA 1Q0WB 1WXVA 3QIJA 1WX8A 2MBBB 2IZVB 1R4MI 2LWPA 5AQGB 4KSKC 5DPSA 4HWFA 3L0WB 5BO4B 2DZKA 3AU5A 5TR5A 2M8SA 3QAQA 4AOFA 2D07B 2D11A 3B1LX 3M3ZB 1L2NA 3MJWA 4HPMB 4ZRIA 1KJTA 2GOWA 4TQ0A 5C1ZA 4XX5A 1WI0A 2C60A 4I6PA 2KOXA 4GDKA 4G11A 1WR6E 3U7DA 3L13A 4GOCA 1V2YA 3VDZA 2ZEQA 3WAPA 3OJ4B 4DDGD 3KH0A 4HJKA 4K7SA 3RD2A 4TKNA 1UGMA 1E5WA 2FCMA 2K1FA 5CHWA 5DCNA 2KTRA 1WGGA 2V3SA 5LLIA 3ZRCA 4HVBA 1E8ZA 2B3AA 4PYZA 3VTUA 4DXAB 4HK2A 4TUUA 2LGYA 3ZNZB 4MSQB 3IHPC 2JRIB 4XC2A 1IP9A 3OJ3A 2GBRA 5AZGA 5CHVC 1WE7A 1NBFC 2K6DB 2KVRA 3MHSD 3A4RA 4RMAA 3WAOA 2G3QB 1IPGA 1V5OA 4HDOA 4MJSA 3KVFB 3UGBB 4NQLB 4AJYB 3ENEA 4W9EA 3K9OB 1S3SG 5L95C 3DBRI 4ZYNA 5G55A 5DPWA 2O6VA 3VHTC 4ZDVA 1EF1A 4BKTA 1E8XA 4HCPB 4A3PA 5CTRC 2G45B 4A20A 4GN1A 3UIPB 2JXXA 1XT9B 2KFKB 2W9NA 4K81A 4DDID 1WJNA 2JF5A 2K8HA 3M63B 4GB9A 4WWOA 3PHWB 5JZEB 4M8MA 1ISNA 3T9LA 1UBQA 3ML8A 4ANVA 2O2VB 2KANA 3X23A 2N9PC 2NS5A 1F9JA 3ZRFA 5AQUB 2KC2A 2DZMA 3AULA 2DX5B 2L7RA 2KMCA 2YLMA 2ZCBA 3A4SC 1SE9A 1TGZB 1LFDA 2IY1B 2L0FA 3VUWA 2IO1B 2ZVNA 3RT3B 2C7NB 4II3B 2LXCA 5AQSB 2OOBB 2LGXA 4EEWA 1V81A 4G50A 4FJZA 1GJZA 2DYBA 2KDBA 3RULA 2LI5A 1NI2A 3PT2B 2RSUA 1I42A 1K8RB 2N9XA 3APDA 5CHFA 2KTFA 4DHZE 5AQFB 2LD9A 3UINB 4DHZB 4ANXA 1G6JA 1I35A 4MGIE 2LASA 2V1YA 3PV1A 1WZ3A 3H1UA 1YIWA 2MW5A 1WGYA 1UZXB 2JZ3B 1WM2A 4W9KA 3IVFA 3DVGY 2Z0EB 2ZNVB 2BKFA 3APCA 3FZKB 3R66C 2MBQA 2JZZA 2O6VD 2LVPA 4E3CA 5JHAA 5LXIB 3CF6E 3A1QA 4KVGB 4HWHA 3VQIA 2J7QB 2L8JA 3PVLA 3V62A 1Q5WB 2YVCA 1R4NI 4ASWC 3VH3B 3VFKA 1OTRB 3ML9A 3FZFB 2XEWA 1V5TA 2KDIA 3W1YA 3RZWC 4GGQA 4EZLA 1M62A 1WIAA 4W9HA 2KDFB 5AQKB 3ZLZA 1WXMA 2EKEC 1S1QB 1GC7A 4KDIC 3TL5A 1VCBA 2PPHA 2MQJA 3A9JA 5FR6A 3HM3A 4GDKB 3VUXA 4ANWA 4F8CB 2J0JA 3B08A 4EZKA 3L08A 3TJPA 3ZW3A 2MBOA 4BOSC 4E71A 1CMXB 4IM3A 1UD7A 3DBLI 3VH4B 1QZEA 2R2QA 4WQOB 1WGHA 2EMTA 3H7SA 4IC7B 4HPLB 4IG7B 4TV3A 5C23A 4BVUC 3D32A 1ZKHA 2EMSA 2KTRB 1J0GA 5DPTA 3RCZA 2KJ6A 3GZNI 1WX9A 2AWTA 4RM9A 3QX1A 3DOWA 3ZVVA 4IWQA 1Y8RC 2WX1A 1J19A 4BFRA 2KX0A 4NNJB 5D7GA 4W9FA 3WA0A 3ZIMA 5KHQA 2Z59B 4MJSB 2G4DB 1JRUA 4NPNA 2KN5A 4DBGA 3ECIA 2LVQA 3T8MA 2NR2A 4P7IA 2MP2A 2O6VB 4B6WA 1HX1B 2GBNA 3QCAA 2C9WB 4AUQC 4W9LA 4HDQA 2LJ5A 2J0KA 4K7UA 4MM3A 3HM6X 2XK5A 3QQ8B 4J6IA 3AU4A 3AXCA 3DQVA 3DBSA 3DVGX 4GDLA 1WZ0A 3KUDB 2FIDA 5JH5C 3EFUA 3V61A 3WALA 2N7EA 4W9IA 2PE6B 2Z0DB 1WE6A 3BY4B 3K9PB 3KYCD 4IWPA 2D2QA 1P3QU 2IY0B 2L3ZA 2GMIC 2MBHA 3VTWA 4NQKE 3FZLB 1C3TA 1EO6A 2N9EB 5KHOA 3OLMD 4A3OA 2FCSA 5E6NA 3SHQA 2MCNB 4ICVA 4WJPA 3ZTDA 1VD2A 1SIFA 2K8CA 3IG3A 4FN2A 3SD5A 1WR1A 3MTNB 4KIKB 2D10A 4MH0E 4WJQA 3TBLD 1GG3A 1UBIA 1GNUA 4PS3A 2ZJDA 1P0RA 3A33B 2PEAA 1V9JA 3WIMA 2NPTA 4MDKE 4BBNF 2KQSA 2JWZA 3PRMB 5AQTB 3QK0A 4F7ZA 2N1VA 3NZUA 3IFWB 5AQMB 2NBWB 4K7WA 5IA7A 5AZFA 2FUHB 2UWQA 3CSTA 1KLVA 4HWCA 2KJRA 2CS4A 3W1SC 1OQYA 4FULA 4DWFA 4FA6A 4KZCA 1SGHA 3TMPB 1WGRA 1LM8B 2GBMA 2NBUA 5AQNB 5GMVA 2KX3A 3A1QB 2IYDB 3JYUA 4W9CA 3R7RA 3M95A 5HKHA 4II2B 2CR5A 2IO0B 2NCNA 3KUCB 5G2NA 1UK5A 2R2OA 3Q3FA 5J2RA 5LXHA 1GUAB 2WX0A 1WJ6A 1KM7A 4MSMB 2KWCA 4LDTD 2LRUA 1BT0A 2DYMA 2KKCA 3CMMB 4DK5A 1LXDA 2LGDA 2J0MA 2PE9A 4FHKA 2DZIA 3CSFA 2HE7A 4CO7A 4EKUA 3H7PA 4MGZE 1HE8A 2BYVE 4NAWA 1EUVB 3ZUNA 3A9JB 3Q3JA 2M17A 3VXWA 3A8YC 2BPSA 2XBBC 3KYDD 2L0TA 4NJ6A 3VTVA 1YD8U 3RZFA 3TCAA 2HTHA 2RD0A 2N4FA 2L00B 1WMHA 3JSVA 1OEYJ 4FLHA 2AL6A 2KFJA 2MWSB 2BYFA 2ZPNA 3R3MA 1J8CA 2BYEA 3A9KA 4LCDE 3UQAA 1I6ZA 2CKHB 3ALBA 4G0NB 4B9KA 3ZNHB 3QA8A 2QHOA 3N32A 3QC8B 4KZ0A 3P2BA 3UF8A 3VVWB 4FADA 5D2MB 5AQPB 2D3GA 2UYZB 5E6PA 2MLBA 1UGOA 4N9F4 1WH3A 4JIOU 4G3XB 5AEKB 5AQVB 2BKRB 2KK8A 2LRWA 5CX3A 3APFA 2I1JA 3FZHB 2LZ6A 2JT4B 3ONSA 2ZNVC 3HIZA 2MP2B 2RPQA 1TTNA 4EUTA 3NHEB 1YJ1A 3RYTA 1D3ZA 1UELA 4PS8A 2HD5B 2XK5B 2DHZA 2FIFA 3PHXB 3DVNU 1RFAA 4MEMA 2JPHA 2LXAA 3U8ZA 1T0YA 4BBNC 2KHWB 4LDTB 2NBVB 3DDCB 2A5UA 3ZNID 4EZJA 2KO3A 1LQBA 1WXSA 2L76A 3DVNV 4TQ1A 4FHJA 2M0XA 5AQOB 3U30A 4F1SA 3M3JA 3PPAA 2CHXA 1P9DU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSL C;  4IM0 A;  2DAJ A;  2Y5B B;  4PYU A;  3S2A A;  4FJY A;  1WJU A;  1WGD A;  1V6E A;  2FNJ B;  1E7V A;  2FAZ A;  3V6C B;  4WAA A;  2WDT B;  2AL3 A;  1YX6 B;  4AWJ A;  2BGF A;  4GSW A;  2KWV B;  2WYQ A;  4KV2 A;  2NPT B;  5AQR B;  1WF9 A;  4E74 A;  2KLC A;  2KQ7 A;  4ZRK A;  5AQL B;  4RM8 A;  3EC8 A;  1NDD A;  2IBI B;  1WM3 A;  1IYF A;  2KDE B;  2AYO B;  4IW0 A;  4KDL B;  2DAF A;  3V60 A;  2DZJ A;  1A5R A;  3X0W A;  1UH6 A;  1U4A A;  4M0W B;  3NOB A;  2REX A;  4GMV A;  1YX5 B;  4MGK E;  2DYO A;  3L16 A;  3IBE A;  1E8Y A;  2CU1 A;  1L7Y A;  4GXB A;  2KNB A;  4BKG A;  3LDZ E;  5IAA C;  2KD0 A;  1E8W A;  4AJW A;  1TZ1 A;  3EEC A;  3FZM B;  2MSE D;  3UIO B;  3ZDM C;  2ASQ A;  4FJV B;  3L54 A;  3ZKJ C;  5EDS A;  4WJN A;  2MBE A;  2JUO A;  2FCQ A;  2I1K A;  4DHJ D;  1E90 A;  2RGF A;  2AEH A;  2VRR B;  3QJZ A;  4WWP A;  5J17 A;  3AI5 A;  3PGE A;  3PRZ A;  1AAR A;  2RR9 A;  1P98 A;  2ZZP B;  4W9D A;  3B0A A;  4ZRJ A;  1OGW A;  3NZS A;  5E6O A;  3VUY A;  5AQQ B;  5JHB A;  1RRB A;  2ZCC A;  2JVC A;  3NS8 A;  3H7P B;  3PRP B;  4PS7 A;  4WJO A;  3DCG A;  4IWO A;  2BWF A;  4NAW B;  3ZO5 B;  1YQB A;  2GBK A;  2MRP A;  4I6L B;  1WFY A;  4URK A;  1RAX A;  3QWZ B;  4M8N A;  3ZNG C;  3KUZ A;  2KC1 A;  3HHM A;  2L05 A;  3GOE A;  3ZTC A;  1FXT B;  2KJH B;  2A4Z A;  3O65 B;  3N3K B;  3C0R B;  3I3T B;  3PS6 A;  4BKS A;  1WMH B;  3JSV B;  2D9D A;  4BOZ B;  2N7D A;  3KW5 B;  4XZ4 A;  5J18 A;  3H9D A;  2MA9 B;  1WJ4 A;  1XQQ A;  2OJR A;  2KWU B;  3A9K B;  3M62 B;  4IM2 A;  4OVU A;  4EOY A;  5DPR A;  1Z2M A;  3L10 B;  4B95 A;  1WX7 A;  3JW0 X;  2LUE A;  4GU2 A;  3ZDT A;  2KMA A;  3H6N A;  2C7H A;  4WWN A;  3WAM A;  2FCN A;  2M1M A;  1MG8 A;  3UQB A;  2V4L A;  4NY0 A;  1GC6 A;  3LJ3 A;  2NVU I;  4W9G A;  2K39 A;  3BIN A;  2CHZ A;  3W1S A;  3SU8 X;  2JY6 A;  4FBJ B;  5L83 A;  5AQH B;  3QHT A;  1KOT A;  2HJ8 A;  5D6J B;  1WYW B;  1Q1O A;  1V86 A;  5AQJ B;  2BF8 B;  2IO2 B;  4KIK A;  2ZPY A;  4GIV A;  2LVO A;  1E7U A;  4DHJ B;  4W9J A;  1WXA A;  3QAR A;  2ZVO A;  1M7K A;  2JRH A;  2CHW A;  1EF5 A;  3EHV A;  4HCN B;  2C7M B;  4JL9 A;  2BWE S;  2G4S A;  4NJ7 A;  1X1M A;  2KFK A;  1H8C A;  3JVZ X;  4JGH B;  4MEL A;  1PQS A;  1V80 A;  4HXD A;  4X57 B;  3PRE A;  3OAW A;  3HK0 A;  5AQI B;  2O2V A;  3DPD A;  2N1W A;  4HWD A;  2KZR A;  1ZGU B;  4I6N B;  3PLV A;  3WAN A;  3TIX A;  4ICU A;  5D94 A;  3PLU A;  2K6Q A;  4BKS D;  3N30 A;  3RUI B;  1C1Y B;  1V49 A;  1Z5S B;  4LJP B;  2GBJ A;  2KLG A;  4YL8 A;  1T7S A;  4MGY E;  3LDQ B;  2WWZ A;  4IUM B;  2IO3 B;  1P1A A;  1WY8 A;  3SDL C;  1TBE A;  3NY5 A;  2C5L C;  4GDL B;  3DBH I;  3PSE B;  2K8B A;  4K1R B;  4CHK A;  4HWI B;  4ANU A;  4LJO B;  2PJH A;  1WRD B;  4HLE A;  4JLC A;  4CYE A;  1OEY A;  4AP4 C;  1H4R A;  2DEN B;  5AZH A;  3PTF C;  2MX2 A;  2M4N A;  4EFO A;  3VAW A;  3L17 A;  1ZW7 A;  2KXJ A;  1M94 A;  3PZD A;  3R7Q A;  4JQW C;  1RLF A;  3V6E B;  1XD3 B;  2K25 A;  4OVV A;  1Q0W B;  1WXV A;  3QIJ A;  1WX8 A;  2MBB B;  2IZV B;  1R4M I;  2LWP A;  5AQG B;  4KSK C;  5DPS A;  4HWF A;  3L0W B;  5BO4 B;  2DZK A;  3AU5 A;  5TR5 A;  2M8S A;  3QAQ A;  4AOF A;  2D07 B;  2D11 A;  3B1L X;  3M3Z B;  1L2N A;  3MJW A;  4HPM B;  4ZRI A;  1KJT A;  2GOW A;  4TQ0 A;  5C1Z A;  4XX5 A;  1WI0 A;  2C60 A;  4I6P A;  2KOX A;  4GDK A;  4G11 A;  1WR6 E;  3U7D A;  3L13 A;  4GOC A;  1V2Y A;  3VDZ A;  2ZEQ A;  3WAP A;  3OJ4 B;  4DDG D;  3KH0 A;  4HJK A;  4K7S A;  3RD2 A;  4TKN A;  1UGM A;  1E5W A;  2FCM A;  2K1F A;  5CHW A;  5DCN A;  2KTR A;  1WGG A;  2V3S A;  5LLI A;  3ZRC A;  4HVB A;  1E8Z A;  2B3A A;  4PYZ A;  3VTU A;  4DXA B;  4HK2 A;  4TUU A;  2LGY A;  3ZNZ B;  4MSQ B;  3IHP C;  2JRI B;  4XC2 A;  1IP9 A;  3OJ3 A;  2GBR A;  5AZG A;  5CHV C;  1WE7 A;  1NBF C;  2K6D B;  2KVR A;  3MHS D;  3A4R A;  4RMA A;  3WAO A;  2G3Q B;  1IPG A;  1V5O A;  4HDO A;  4MJS A;  3KVF B;  3UGB B;  4NQL B;  4AJY B;  3ENE A;  4W9E A;  3K9O B;  1S3S G;  5L95 C;  3DBR I;  4ZYN A;  5G55 A;  5DPW A;  2O6V A;  3VHT C;  4ZDV A;  1EF1 A;  4BKT A;  1E8X A;  4HCP B;  4A3P A;  5CTR C;  2G45 B;  4A20 A;  4GN1 A;  3UIP B;  2JXX A;  1XT9 B;  2KFK B;  2W9N A;  4K81 A;  4DDI D;  1WJN A;  2JF5 A;  2K8H A;  3M63 B;  4GB9 A;  4WWO A;  3PHW B;  5JZE B;  4M8M A;  1ISN A;  3T9L A;  1UBQ A;  3ML8 A;  4ANV A;  2O2V B;  2KAN A;  3X23 A;  2N9P C;  2NS5 A;  1F9J A;  3ZRF A;  5AQU B;  2KC2 A;  2DZM A;  3AUL A;  2DX5 B;  2L7R A;  2KMC A;  2YLM A;  2ZCB A;  3A4S C;  1SE9 A;  1TGZ B;  1LFD A;  2IY1 B;  2L0F A;  3VUW A;  2IO1 B;  2ZVN A;  3RT3 B;  2C7N B;  4II3 B;  2LXC A;  5AQS B;  2OOB B;  2LGX A;  4EEW A;  1V81 A;  4G50 A;  4FJZ A;  1GJZ A;  2DYB A;  2KDB A;  3RUL A;  2LI5 A;  1NI2 A;  3PT2 B;  2RSU A;  1I42 A;  1K8R B;  2N9X A;  3APD A;  5CHF A;  2KTF A;  4DHZ E;  5AQF B;  2LD9 A;  3UIN B;  4DHZ B;  4ANX A;  1G6J A;  1I35 A;  4MGI E;  2LAS A;  2V1Y A;  3PV1 A;  1WZ3 A;  3H1U A;  1YIW A;  2MW5 A;  1WGY A;  1UZX B;  2JZ3 B;  1WM2 A;  4W9K A;  3IVF A;  3DVG Y;  2Z0E B;  2ZNV B;  2BKF A;  3APC A;  3FZK B;  3R66 C;  2MBQ A;  2JZZ A;  2O6V D;  2LVP A;  4E3C A;  5JHA A;  5LXI B;  3CF6 E;  3A1Q A;  4KVG B;  4HWH A;  3VQI A;  2J7Q B;  2L8J A;  3PVL A;  3V62 A;  1Q5W B;  2YVC A;  1R4N I;  4ASW C;  3VH3 B;  3VFK A;  1OTR B;  3ML9 A;  3FZF B;  2XEW A;  1V5T A;  2KDI A;  3W1Y A;  3RZW C;  4GGQ A;  4EZL A;  1M62 A;  1WIA A;  4W9H A;  2KDF B;  5AQK B;  3ZLZ A;  1WXM A;  2EKE C;  1S1Q B;  1GC7 A;  4KDI C;  3TL5 A;  1VCB A;  2PPH A;  2MQJ A;  3A9J A;  5FR6 A;  3HM3 A;  4GDK B;  3VUX A;  4ANW A;  4F8C B;  2J0J A;  3B08 A;  4EZK A;  3L08 A;  3TJP A;  3ZW3 A;  2MBO A;  4BOS C;  4E71 A;  1CMX B;  4IM3 A;  1UD7 A;  3DBL I;  3VH4 B;  1QZE A;  2R2Q A;  4WQO B;  1WGH A;  2EMT A;  3H7S A;  4IC7 B;  4HPL B;  4IG7 B;  4TV3 A;  5C23 A;  4BVU C;  3D32 A;  1ZKH A;  2EMS A;  2KTR B;  1J0G A;  5DPT A;  3RCZ A;  2KJ6 A;  3GZN I;  1WX9 A;  2AWT A;  4RM9 A;  3QX1 A;  3DOW A;  3ZVV A;  4IWQ A;  1Y8R C;  2WX1 A;  1J19 A;  4BFR A;  2KX0 A;  4NNJ B;  5D7G A;  4W9F A;  3WA0 A;  3ZIM A;  5KHQ A;  2Z59 B;  4MJS B;  2G4D B;  1JRU A;  4NPN A;  2KN5 A;  4DBG A;  3ECI A;  2LVQ A;  3T8M A;  2NR2 A;  4P7I A;  2MP2 A;  2O6V B;  4B6W A;  1HX1 B;  2GBN A;  3QCA A;  2C9W B;  4AUQ C;  4W9L A;  4HDQ A;  2LJ5 A;  2J0K A;  4K7U A;  4MM3 A;  3HM6 X;  2XK5 A;  3QQ8 B;  4J6I A;  3AU4 A;  3AXC A;  3DQV A;  3DBS A;  3DVG X;  4GDL A;  1WZ0 A;  3KUD B;  2FID A;  5JH5 C;  3EFU A;  3V61 A;  3WAL A;  2N7E A;  4W9I A;  2PE6 B;  2Z0D B;  1WE6 A;  3BY4 B;  3K9P B;  3KYC D;  4IWP A;  2D2Q A;  1P3Q U;  2IY0 B;  2L3Z A;  2GMI C;  2MBH A;  3VTW A;  4NQK E;  3FZL B;  1C3T A;  1EO6 A;  2N9E B;  5KHO A;  3OLM D;  4A3O A;  2FCS A;  5E6N A;  3SHQ A;  2MCN B;  4ICV A;  4WJP A;  3ZTD A;  1VD2 A;  1SIF A;  2K8C A;  3IG3 A;  4FN2 A;  3SD5 A;  1WR1 A;  3MTN B;  4KIK B;  2D10 A;  4MH0 E;  4WJQ A;  3TBL D;  1GG3 A;  1UBI A;  1GNU A;  4PS3 A;  2ZJD A;  1P0R A;  3A33 B;  2PEA A;  1V9J A;  3WIM A;  2NPT A;  4MDK E;  4BBN F;  2KQS A;  2JWZ A;  3PRM B;  5AQT B;  3QK0 A;  4F7Z A;  2N1V A;  3NZU A;  3IFW B;  5AQM B;  2NBW B;  4K7W A;  5IA7 A;  5AZF A;  2FUH B;  2UWQ A;  3CST A;  1KLV A;  4HWC A;  2KJR A;  2CS4 A;  3W1S C;  1OQY A;  4FUL A;  4DWF A;  4FA6 A;  4KZC A;  1SGH A;  3TMP B;  1WGR A;  1LM8 B;  2GBM A;  2NBU A;  5AQN B;  5GMV A;  2KX3 A;  3A1Q B;  2IYD B;  3JYU A;  4W9C A;  3R7R A;  3M95 A;  5HKH A;  4II2 B;  2CR5 A;  2IO0 B;  2NCN A;  3KUC B;  5G2N A;  1UK5 A;  2R2O A;  3Q3F A;  5J2R A;  5LXH A;  1GUA B;  2WX0 A;  1WJ6 A;  1KM7 A;  4MSM B;  2KWC A;  4LDT D;  2LRU A;  1BT0 A;  2DYM A;  2KKC A;  3CMM B;  4DK5 A;  1LXD A;  2LGD A;  2J0M A;  2PE9 A;  4FHK A;  2DZI A;  3CSF A;  2HE7 A;  4CO7 A;  4EKU A;  3H7P A;  4MGZ E;  1HE8 A;  2BYV E;  4NAW A;  1EUV B;  3ZUN A;  3A9J B;  3Q3J A;  2M17 A;  3VXW A;  3A8Y C;  2BPS A;  2XBB C;  3KYD D;  2L0T A;  4NJ6 A;  3VTV A;  1YD8 U;  3RZF A;  3TCA A;  2HTH A;  2RD0 A;  2N4F A;  2L00 B;  1WMH A;  3JSV A;  1OEY J;  4FLH A;  2AL6 A;  2KFJ A;  2MWS B;  2BYF A;  2ZPN A;  3R3M A;  1J8C A;  2BYE A;  3A9K A;  4LCD E;  3UQA A;  1I6Z A;  2CKH B;  3ALB A;  4G0N B;  4B9K A;  3ZNH B;  3QA8 A;  2QHO A;  3N32 A;  3QC8 B;  4KZ0 A;  3P2B A;  3UF8 A;  3VVW B;  4FAD A;  5D2M B;  5AQP B;  2D3G A;  2UYZ B;  5E6P A;  2MLB A;  1UGO A;  4N9F 4;  1WH3 A;  4JIO U;  4G3X B;  5AEK B;  5AQV B;  2BKR B;  2KK8 A;  2LRW A;  5CX3 A;  3APF A;  2I1J A;  3FZH B;  2LZ6 A;  2JT4 B;  3ONS A;  2ZNV C;  3HIZ A;  2MP2 B;  2RPQ A;  1TTN A;  4EUT A;  3NHE B;  1YJ1 A;  3RYT A;  1D3Z A;  1UEL A;  4PS8 A;  2HD5 B;  2XK5 B;  2DHZ A;  2FIF A;  3PHX B;  3DVN U;  1RFA A;  4MEM A;  2JPH A;  2LXA A;  3U8Z A;  1T0Y A;  4BBN C;  2KHW B;  4LDT B;  2NBV B;  3DDC B;  2A5U A;  3ZNI D;  4EZJ A;  2KO3 A;  1LQB A;  1WXS A;  2L76 A;  3DVN V;  4TQ1 A;  4FHJ A;  2M0X A;  5AQO B;  3U30 A;  4F1S A;  3M3J A;  3PPA A;  2CHX A;  1P9D U; 
#chains in the Genus database with same CATH topology
 3VRA B;  4DXF A;  4PYU A;  3S2A A;  1F1H A;  4FJY A;  2LM9 A;  4P0A A;  2WDR B;  1ZHC A;  2XQ3 A;  1G8X A;  1SE4 A;  3T1H T;  1B9R A;  1J5W A;  5FVL A;  3VR8 B;  4AWJ A;  4A97 A;  1D0X A;  2BGF A;  4CN4 A;  2RPA A;  2KWV B;  2WYQ A;  4KV2 A;  2M0A A;  5AQR B;  2KQ7 A;  4ZRK A;  5AQL B;  1E1H B;  1WM3 A;  4EED A;  1QLB A;  2J52 A;  4IW0 A;  2C5J A;  3V60 A;  4LFC T;  2DZJ A;  4YT0 B;  4MAL A;  3H8H A;  4MGK E;  2DYO A;  3IBE A;  3QUJ A;  1NEK B;  3LK3 B;  1MIW A;  2KD0 A;  4PAG A;  1E8W A;  1TZ1 A;  3EEC A;  2V4I B;  2WXL A;  3JC6 D;  3P4R B;  4B3M T;  1YQ4 B;  2MBE A;  5EE9 A;  5EDS A;  2I1K A;  4DHJ D;  4KHZ F;  2RGF A;  1UF0 A;  4WWP A;  5J17 A;  2RR9 A;  3B0A A;  5EZY E;  4ZRJ A;  2J47 A;  1RRB A;  3BQL A;  1N33 T;  4WJO A;  1ZEE A;  3ZPO A;  4NAW B;  5JR9 C;  3ZO5 B;  2GBK A;  4I6L B;  1WFY A;  1W0B A;  3ZXR A;  3ZNG C;  4KMC A;  4AQG A;  4M8N A;  1FO4 A;  2GI9 A;  2KC1 A;  2W61 A;  1E2A A;  3RIF A;  1MHH E;  3EAB A;  5JRE A;  1TS4 A;  5J0Z A;  3P4S A;  3PS6 A;  1PFD A;  2PVO D;  2WXI A;  2XTL A;  2I6H A;  1WR6 A;  5L3D B;  2WDV A;  2NW8 A;  3ZSS A;  4WW0 A;  1DU2 A;  1XLO A;  3LB8 C;  2V26 A;  4GYR A;  1Z2M A;  5I4D A;  2V0G A;  1BML C;  4B95 A;  4JPS A;  3AE7 A;  1WX7 A;  5EE0 A;  4BZA A;  3H6N A;  3RNA C;  4WWN A;  2RDB C;  2FCN A;  2M6B A;  4W9G A;  2CHZ A;  3SU8 X;  4PJM A;  2B76 A;  1KOT A;  2CHN A;  5JDF A;  5M4Y A;  2IO2 B;  3UUN A;  4LML A;  4ZYS A;  1WXA A;  3RI7 C;  4HCN B;  2LUM A;  4JI4 T;  2BWE S;  1H8C A;  4LK0 M;  4A56 A;  1F52 A;  2LGI A;  2ZW1 A;  2QA7 A;  4EZH A;  3BYY B;  2IAK A;  5HCJ A;  1YOV B;  3BVM A;  2Y3A A;  3GS2 A;  3CX7 B;  2MBG A;  2Y6X A;  2K9A A;  4HWD A;  4RFB A;  4EAH A;  4EGW A;  4I6N B;  3PLV A;  3SFE B;  4CXX A;  4JI1 T;  4N59 A;  2BKN A;  3I57 A;  3WAN A;  4PJJ A;  2K6Q A;  3UT5 E;  3N2K E;  5HEO A;  5C2T B;  4YFS A;  3E22 E;  3IHR A;  3RRC A;  4LJP B;  4HKQ A;  3P7I A;  2GBJ A;  4UEM A;  3SEB A;  3NZP A;  4LFA T;  4MGY E;  3LDQ B;  4YL8 A;  4C00 A;  5BMI A;  5HCM A;  2SAK A;  4YXD A;  2C5L C;  4K1R B;  2ZMA A;  3N9M A;  3AXJ B;  3PTR B;  1WRD B;  4WUR A;  3I5J C;  1ZUD 2;  4AP4 C;  3BII D;  1W0A A;  1H4R A;  4TNV A;  4H9O C;  4QXH B;  2FBW A;  5AZH A;  3PTF C;  1ET9 A;  5FK9 C;  2M4N A;  3L39 A;  5HHD G;  2ZM6 T;  1ZW7 A;  2J4G A;  2X9H A;  5LA6 E;  3ZST A;  3LBX B;  1RLF A;  2INC C;  4JQW C;  2K48 A;  3CX6 B;  5KDM C;  4OVV A;  4DBR A;  4CI1 B;  1R4M I;  2LWP A;  1KFY A;  2JRK A;  1STE A;  2MHJ A;  1FXI A;  4HWF A;  4JE3 B;  3PE0 A;  2UXD T;  3AU5 A;  1OXZ A;  2RDG A;  2D07 B;  2WU2 B;  3N9N A;  1L2N A;  3MJW A;  3KV5 A;  4HPM B;  4NJC A;  1US7 B;  1KLG D;  4TQ0 A;  5FY7 A;  1V9D A;  4XX5 A;  3EDV A;  4R3D A;  2KOX A;  2V3N A;  3NUH B;  5JRC A;  3C51 A;  4GOC A;  4L0R A;  1V2Y A;  2CRB A;  4DDG D;  3KH0 A;  1L6U A;  4O2B E;  3HVD A;  2WSS V;  2IDO B;  2X8X X;  4H9Q C;  1EU4 A;  4TKN A;  1WYB A;  2WS3 B;  4HVB A;  2OV9 A;  2XAJ B;  4X1K E;  1WWT A;  2V3P A;  1BUI C;  2B3A A;  4EV6 A;  1LO5 D;  1MMA A;  5FXZ A;  2LGY A;  3ZNZ B;  1WYG A;  4AQY T;  5FXW A;  4XC2 A;  2WY2 A;  5BMV E;  1PGA A;  4LMK A;  1V5O A;  2X9Y A;  3VRA A;  4HDO A;  2CU3 A;  4EYY R;  3NBX X;  4BJM A;  1K50 A;  4QH5 A;  4ZZC A;  4AJY B;  3UU8 A;  3AA0 B;  4IDZ A;  5JDG A;  1I4X A;  2VB6 A;  4ZI3 D;  5LXT E;  2O6V A;  2ES0 A;  1VCS A;  3VR8 A;  4BKT A;  1N60 A;  5CTR C;  2JXX A;  4KP3 C;  4K81 A;  4DDI D;  1FNW A;  1TYG B;  1OWA A;  1WJN A;  4ASK A;  2QC8 A;  2X38 A;  4ZI7 E;  3V5U A;  4GB9 A;  3PHW B;  3PUZ F;  4M8M A;  1ISN A;  4O4I E;  3T9L A;  2ACZ A;  3ML8 A;  4ANV A;  2KAN A;  3C4W A;  3ZC1 A;  2WQY B;  5JR9 A;  2XHE B;  1VLB A;  1NWM X;  3P4W A;  2DZM A;  2DX5 B;  4BAY B;  2XAH B;  2WHI A;  2YLM A;  2EHO B;  2YK0 A;  1IBX B;  4C90 A;  3KWL A;  2ZVN A;  3RT3 B;  4II3 B;  2LXC A;  2LGX A;  2E2A A;  3AA1 B;  2E6X A;  1GJZ A;  4FJZ A;  2DYB A;  2CBJ A;  2KDB A;  2MJ3 A;  3PZ7 A;  2ZLY A;  3AVS A;  3Q8B A;  1K8R B;  4RCO A;  2NTS A;  3NVV A;  1HCI A;  3CQG B;  3ZMU B;  2LD9 A;  4DHZ B;  1T3Q A;  3Q5X A;  3ZMZ B;  2LAS A;  4LF5 T;  2V1Y A;  3PV1 A;  1YIW A;  3PU3 A;  3HR0 A;  2MW5 A;  4KKJ A;  1NEN B;  4PW8 A;  3APC A;  3R66 C;  3RYC E;  2MBQ A;  2O6V D;  3AE1 A;  4XDC A;  4ZS3 A;  1G73 A;  1TKG A;  2KND A;  3PVL A;  5LB7 B;  4GYS A;  1R4N I;  4YSY B;  4YTP A;  3IAS 1;  3VFK A;  2UUB T;  1OTR B;  4ILA A;  2ACX A;  4B0E A;  4QHO A;  3HVZ A;  3K3Q C;  2E5L T;  4PK4 A;  2JQ9 A;  2KWI B;  2LRK A;  1KNR A;  1SJE D;  3HKD E;  1GC7 A;  4WZX A;  4KDI C;  3LFM A;  2BTE A;  1K52 A;  3HM3 A;  4HFD A;  5JH7 E;  3ANW A;  3TJP A;  2H89 B;  3ZJT A;  4BOS C;  1CMX B;  5L4H A;  1C4C A;  5FXX A;  3P4Q B;  4JV5 T;  1WGH A;  4QH4 A;  2CPT A;  2KTR B;  3IAM 1;  2MYS A;  1QOB A;  1UX5 A;  2E9X B;  2V6Y A;  2XAG B;  3ZMS B;  2AWT A;  3GZN I;  3DOW A;  3ZVV A;  2MJD A;  2WX1 A;  1J19 A;  4UVB B;  5IHY A;  2KX0 A;  2LE8 A;  3AE9 A;  3ZIM A;  3E9S A;  1EZ3 A;  1FNV A;  2KT9 A;  2WXF A;  1CUN A;  3ECI A;  5HEG A;  2XM2 A;  3T8M A;  1SE2 A;  2D3A A;  3EVY A;  4HFC A;  1HX1 B;  5KXJ A;  2C9W B;  4W9L A;  2HJ1 A;  2W67 A;  1S35 A;  4QX8 B;  2J0K A;  2IHR 1;  4DR5 T;  4J6I A;  3AU4 A;  4OZB A;  3GB1 A;  2XQ7 A;  1SA0 E;  4RGT A;  3DBS A;  4YSZ B;  3AE6 B;  4RF1 A;  1ZV4 X;  3EFU A;  2PG8 A;  4W9I A;  3B13 A;  3K9P B;  2KWH A;  3CWI A;  4AKR B;  3HKB E;  2W63 A;  2GMI C;  1ZOY A;  5BR8 T;  4NQK E;  5LG4 A;  4QXB B;  5FKY A;  3AN1 A;  5KHO A;  1N62 A;  2WXQ A;  3ABV B;  4ICV A;  3SHQ A;  1VD2 A;  2K8C A;  3BK2 A;  4OZC A;  2HH7 A;  1WR1 A;  3MTN B;  5FVK A;  1IJ5 A;  1KK7 A;  1L4D B;  4LLG M;  3TBL D;  5FY1 A;  2ZM8 A;  2PEA A;  4US8 A;  3BYT B;  5HFY A;  3WIM A;  2NPT A;  2VKJ A;  3MK7 C;  4GIW A;  3NRY A;  5IA7 A;  5AZF A;  3TLU A;  4XYC A;  1QOG A;  3ZN0 B;  3HL6 A;  1JAL A;  2UXN B;  2W4X A;  1KLV A;  4M0W A;  2JJ9 A;  3ZYY X;  1OQY A;  4FUL A;  4FA6 A;  3T3N A;  3TMP B;  2DI4 A;  2NBU A;  5EK4 A;  3A1Q B;  5GMV A;  2N7J A;  4H2A A;  3UUM A;  4W9C A;  3JAD A;  3PUA A;  3EUB 2;  4TWD A;  2WXN A;  4U7Y A;  3L09 A;  2IO0 B;  3CQC B;  4DUY T;  4PNI A;  3IEE A;  5G2N A;  4HFV A;  5FY0 A;  1UK5 A;  3Q3F A;  5J2R A;  1JNR A;  1GUA B;  2N9K A;  3PO0 A;  3BZD B;  2XQ8 A;  1VZ8 A;  2LRU A;  3R2T A;  3CMM B;  2LGD A;  5ABF A;  2YN6 A;  2HE7 A;  3MAC A;  4CO7 A;  2SEB D;  1D6E C;  2W54 A;  3A8Y C;  2WP9 B;  3X1D A;  1AWD A;  2XBB C;  2V7J A;  1PGB A;  5EE1 A;  3ZJU A;  4NUU A;  3VTV A;  1YD8 U;  1V1P B;  3EHZ A;  3J9X 1;  1WMH A;  4PK1 A;  1OEY J;  2AL6 A;  4JI5 T;  2BYF A;  3R3M A;  1C4P A;  4DR7 T;  2BYE A;  3A9K A;  1VR9 A;  4LCD E;  1J8C A;  4EOZ B;  1KNZ A;  1Y56 A;  1XLQ A;  3QC8 B;  4DBQ A;  1T0S C;  4N9F 4;  4I43 B;  4Q2J A;  4G3X B;  5AEK B;  5AQV B;  5LMU T;  3WAK A;  3APF A;  4H9R C;  2UUC T;  2LZ6 A;  3F57 A;  3RPF C;  3W5V B;  3ONS A;  1WR0 A;  2RPQ A;  4JI7 T;  3AED B;  1IBX A;  3KV9 A;  1D3Z A;  1MND A;  5HXS A;  2HD5 B;  4P1N A;  3PHX B;  3WI3 A;  4TWF A;  3E0Z A;  3VKG A;  1HZ6 A;  3CML A;  4MEM A;  1HF8 A;  2LXA A;  4IKG A;  3PUR A;  4BBN C;  2KHW B;  3IF8 B;  1FNU A;  3DWG C;  4JI6 T;  3ZNI D;  4EZJ A;  2KO3 A;  3AH7 A;  1LQB A;  1VOM A;  2SPC A;  4ICU A;  3M3J A;  1C76 A;  1WSP A;  1KF6 B;  2AE9 A;  3AEG A;  5HXR A;  2Y5B B;  3OYZ A;  4IM0 A;  5JDQ A;  4NXM T;  1XNQ T;  1WGD A;  1V6E A;  1E7P A;  3PUG A;  1V97 A;  2WDT B;  1LVF A;  2IUB A;  2PKO A;  1YX6 B;  1N63 A;  4HGA A;  3ZXV A;  3D0T A;  4E74 A;  5FP3 A;  2BW2 A;  4RM8 A;  2JQQ A;  3NRZ A;  1NDD A;  2IBI B;  4MLK A;  2BBC A;  2KDE B;  2AYO B;  3DBR B;  2DAF A;  4KX6 A;  1OED E;  4IDP A;  1UH6 A;  2M56 B;  3NOB A;  1VDV A;  4GMV A;  4X1Y E;  2H7O A;  1F2R C;  2KNB A;  2I38 A;  3AE2 B;  1ZP0 A;  2MSE D;  3ZKJ C;  5LNK A;  4IT4 A;  2VZK B;  1MIV A;  2FCQ A;  4U2Z A;  5ADX L;  1VZ7 A;  2JX5 A;  1ROE A;  4TZ4 C;  2L32 A;  3PRZ A;  4QX7 B;  4U7I A;  1OGW A;  2BS4 A;  4HEA 1;  5E6O A;  3VUY A;  5AQQ B;  4DXG A;  3I9V 1;  3H7P B;  4PS7 A;  3OPC A;  4NPP A;  1IZN B;  4UV9 B;  3DCG A;  3MJ5 A;  3RPU A;  3B2G A;  1YQB A;  2MRP A;  1RAX A;  3HHM A;  3GOE A;  2DLB A;  5LBQ B;  1FXT B;  4WBN E;  1WXQ A;  3Q8A A;  4BA9 A;  2A4Z A;  3O65 B;  3U52 E;  3HKE E;  1TS5 A;  5KMG P;  4C4V B;  4BKS A;  5JDH A;  1IBM T;  3JAF A;  3RQU A;  1N6Z A;  3JSV B;  4PK6 A;  3AE5 B;  5J18 A;  1FIO A;  2OJR A;  1HNW T;  2KWU B;  3M62 B;  4EOY A;  4OVU A;  3AEA B;  3ZJ1 A;  3QOF A;  4WWM A;  5LJN A;  2XQ6 A;  3TEY A;  5EK2 A;  4K3B A;  2VKO A;  1JRP A;  3ZDT A;  4XWW A;  3GN5 B;  4M1P A;  2V4L A;  4NY0 A;  4DUZ T;  3LJ3 A;  3BIN A;  3ZYL A;  1BR0 A;  1ZE3 D;  4CXW A;  2D3B A;  2JY6 A;  3ABV A;  5L83 A;  3NJT A;  5D6J B;  1Q1O A;  4FI5 A;  2ZPY A;  4RGN A;  2K5P A;  4AIU A;  4W9J A;  2JRH A;  1EF5 A;  2WXR A;  2C7M B;  4JL9 A;  4ZI2 C;  1TS2 A;  2D2S A;  2KDM A;  2KFK A;  3J9C A;  2BQQ A;  3JVZ X;  2B1E A;  4MEL A;  4UVC B;  3DBL B;  4XZC A;  4HXD A;  1XEE A;  3OAW A;  4B3R T;  4IL9 A;  2O2V A;  3DPD A;  2PFV A;  3GWH A;  2KAJ A;  1Q10 A;  5H6Q B;  1XCT L;  2E8I A;  2J53 A;  4DR3 T;  4BKS D;  4X20 E;  4EIW A;  3OBV E;  2LOS A;  1Z5S B;  2KLG A;  2NWB A;  3AEC A;  4IUM B;  2QYW A;  1IAP A;  4O1N A;  3SDL C;  3ZYM A;  2H88 A;  2VQF T;  1NAF A;  4JEH B;  4K0K T;  4LJO B;  2PJH A;  1Z0P A;  2JWU A;  4CYE A;  1OEY A;  3CIR B;  4ITK A;  1VRA B;  2XQ9 A;  3Q9D A;  1RYJ A;  2CHO A;  3RNC C;  3AEE B;  4EFO A;  1LVK A;  3ZT6 A;  2KXJ A;  3PZD A;  3IT4 B;  4B0M A;  2HN1 A;  4ZRQ A;  2WXP A;  1XD3 B;  2K25 A;  2N9D A;  2IPK D;  3ESL A;  3IBP A;  5MPO A;  1Q0W B;  1WXV A;  3ONX A;  2MBB B;  1IBK T;  3U3I A;  2MPK A;  4OFZ A;  1KLU D;  1MPE A;  1X79 A;  3L0W B;  2YEP F;  4I0U A;  5BO4 B;  4M00 A;  1WYC A;  1QKZ A;  2L83 A;  3RNG C;  4IE5 A;  4P0B A;  1ZXI A;  3KBU A;  4HRO A;  4AQF C;  3Q2A C;  5FXV A;  4L1B A;  1DOX A;  1KJT A;  5H6R B;  1QQR A;  2NR4 A;  3CX8 B;  3AVR A;  2WMN A;  3A7M A;  4GDK A;  4JI8 T;  3T8O A;  2GK9 A;  4GK5 E;  1WR6 E;  3AED A;  2VKH A;  4C7Z A;  2JQR B;  3GA8 A;  3OJ4 B;  3WAP A;  1I4Q A;  3CVR A;  1UGM A;  1E5W A;  2FCM A;  5CHW A;  5DCN A;  3RYH E;  3ZRC A;  1WGG A;  5LLI A;  1QOA A;  2VVN A;  5JVD E;  3VTU A;  4PYZ A;  4DXA B;  4HK2 A;  2LSY A;  5ETW A;  3ZCJ A;  4UIG A;  3IHP C;  2CMR A;  5CHV C;  3WAO A;  2K6D B;  1KF6 A;  2IW5 B;  3UGB B;  4O8S A;  1YMH E;  4CN1 A;  3K9O B;  5L95 C;  1HQR D;  4L2Y A;  1YQ3 B;  4ZEY A;  1CZP A;  5LGU B;  4HCP B;  4A3P A;  3Q14 C;  3AE8 B;  2C5I T;  2INP E;  3KQ4 A;  2W3R A;  3UIP B;  3C64 A;  4ARI A;  4A9A A;  4QXC B;  3ZN1 B;  2LJI A;  4WWO A;  3UI3 A;  3Q5W A;  4LF4 T;  1QF6 A;  2JMK A;  1MIY A;  3X23 A;  2DL1 A;  1LGR A;  1MI0 A;  2L7R A;  3UUX B;  3A4S C;  2KZ7 B;  4REZ A;  1WFD A;  1SE9 A;  2IY1 B;  1SF0 A;  2IO1 B;  2C7N B;  4KUM B;  2GLS A;  2QEJ C;  4EEW A;  2V7I A;  1AJ3 A;  5L47 A;  3RFZ B;  4UF0 A;  2LI5 A;  3ZLI A;  1XWM A;  3CK6 A;  2K9X A;  3APD A;  5CHF A;  3AA7 B;  2WMO A;  5JTG A;  1CQV A;  3UIN B;  2WBL A;  3MC8 A;  4MGI E;  2XN9 C;  1Y01 A;  2DHR A;  4F8H A;  3H1U A;  1WGY A;  2JZ3 B;  4W9K A;  3IVF A;  3DVG Y;  3H3A A;  2ZNV B;  3Q8E A;  2BKF A;  3AEF A;  5ABH A;  3KWV A;  5HI1 A;  1L5P A;  2LT3 A;  1N5X A;  3PZ8 A;  4TSS A;  4DV4 T;  2KT7 A;  2L8J A;  1SHZ C;  4C80 A;  3V62 A;  2XQ5 A;  2BVM A;  2YVC A;  3ZJV A;  5LBM A;  3T1Y T;  2WLB A;  4A55 A;  3ML9 A;  3FZF B;  3O1J A;  4EZL A;  3P63 A;  3Q69 A;  4JX1 C;  5FNV E;  4W9H A;  2ZM2 A;  4EB6 E;  1KTK A;  5AQK B;  4YSX A;  1WXM A;  1R4M B;  2EKE C;  3IXS A;  1H7C A;  4LF7 T;  1VCB A;  2PPH A;  2WZH A;  3VHL A;  2MQJ A;  4ANW A;  4F8C B;  1JNZ A;  2J0J A;  4EZK A;  5C3J A;  3AE4 B;  3ZW3 A;  1D5Z C;  1FRD A;  4G63 A;  4OK0 A;  4N6E B;  1DGJ A;  2LFI A;  2EMT A;  2BS2 B;  4TV3 A;  4HPL B;  4PJL A;  4H63 V;  4A5X A;  4N58 A;  4BVU C;  1GQE A;  2EMS A;  1LKX A;  5DPT A;  3RCZ A;  3RX6 A;  4KGS A;  4I4T E;  2KJ6 A;  5F3J A;  4TMA B;  5FKA C;  4AKI A;  3QX1 A;  4HEA A;  4IWQ A;  3C50 A;  1M4V A;  2LGS A;  1HA5 A;  3FIL A;  4AXP A;  3WA0 A;  5KHQ A;  4MJS B;  2A3D A;  3K1S A;  5AUI A;  4DBG A;  4IOI E;  4DID B;  2LVQ A;  1XO3 A;  4U31 A;  4BAX A;  1JQ4 A;  4KI0 F;  2HPJ A;  2XZE A;  4GK0 E;  3SFD A;  5L4E A;  2HTM E;  4AUQ C;  5JDL A;  3J7Y q;  4OHF A;  1RFK A;  2XK5 A;  4ZI2 D;  4LF6 T;  4UVA B;  3AXC A;  2LHD A;  4HJG E;  5JH5 C;  2OHF A;  3SOL A;  2Z0D B;  4IWP A;  3KYC D;  2BS3 A;  1P3Q U;  4QAY A;  3VTW A;  3QC9 A;  4X66 T;  2MBH A;  3FZL B;  1C3T A;  4AQF A;  5J1G A;  4A3O A;  3OLM D;  1B7T A;  1P7E A;  3AV8 A;  2MCN B;  2LOP A;  3PUS A;  1D5X C;  1SIF A;  3IG3 A;  4NXN T;  4AQ7 A;  3LXF A;  2WDR A;  4IRE A;  5FMN A;  4KIK B;  3BQK A;  2D10 A;  4MH0 E;  4RF0 A;  4YTM B;  1KNP A;  1GG3 A;  1D0Y A;  1GNU A;  1UBI A;  3N5L A;  2ZJD A;  3TLW A;  1T8B A;  1P0R A;  1NYR A;  1L4Z B;  1FEW A;  1L0V B;  4HKA A;  4DV3 T;  3PRM B;  5AQT B;  4B6X A;  1QT9 A;  2JYT A;  4NIQ A;  5AQM B;  2NBW B;  2YIN A;  2Y8D A;  2UWQ A;  3OYX A;  4D2K A;  4JWS C;  3O9X A;  4YT0 A;  2KJR A;  4A8X C;  5F5W A;  2Q9Q B;  4DWF A;  2K3W A;  2XY8 B;  4RH6 A;  4ILC A;  4EYU A;  2UU9 T;  1NEK A;  1EM7 A;  2GBM A;  3B5M A;  5AQN B;  1TS3 A;  4AI6 A;  3LK4 2;  2V6X A;  3M95 A;  3P4R A;  4II2 B;  1YQ4 A;  1JW9 D;  1N36 T;  2AQ1 B;  2R2O A;  5LXH A;  2WX0 A;  2HHH T;  4MSM B;  4KHP T;  4LDT D;  3O13 A;  2I2Y A;  2DYM A;  3KV4 A;  5HXC A;  1LXD A;  1YJI A;  2LKG A;  1UGJ A;  2PE9 A;  3CSF A;  1ET6 A;  4EKU A;  3KBT A;  1VZ6 A;  4NAW A;  3A9J B;  2N2N A;  4QH1 A;  3RIA A;  3Q3J A;  4O2A E;  3VXW A;  2Y48 B;  3R6N A;  2VVS A;  4YLH A;  2L0T A;  5IKC M;  2EHO C;  3VR9 B;  1N5W A;  2XPK A;  2HTH A;  2NP9 A;  4DQO C;  1QOF A;  2QRX A;  2L00 B;  4FLH A;  4CI3 B;  3AE8 A;  3KLS X;  2NW9 A;  2A72 A;  2KFJ A;  2PBI A;  3P4P B;  2ZPN A;  5CA1 E;  2CKH B;  4XAX B;  4G0N B;  2BBJ A;  3P8C D;  3ZNH B;  3B57 A;  3QNU A;  3UF8 A;  3MJX A;  5AQP B;  2D3G A;  3MC9 A;  1MMD A;  2MLB A;  4HFH A;  5C8Y E;  4JIO U;  2BYT A;  1T98 A;  3GZN B;  2KK8 A;  3BQI A;  3UU5 A;  2KYW A;  2LRW A;  5CX3 A;  3FZH B;  3ONL C;  2MP2 B;  1I4P A;  3CPZ A;  1TTN A;  5HYA A;  3NHE B;  1YJ1 A;  3RYT A;  1DOI A;  3Q5E A;  4PS8 A;  4MM3 B;  1IGD A;  2DBY A;  3U8Z A;  2WGS A;  3UQ7 A;  1TZO A;  3KIN B;  3JAE A;  2BVL A;  3Q5D A;  1WXS A;  1YN5 A;  2BG9 B;  4IDO A;  2M0X A;  3OWE B;  1IYF A;  2CHX A;  3R2I A;  2DAJ A;  4H9P C;  2KQ4 X;  2FNJ B;  4G2A A;  3SFE A;  1FMA D;  2FAZ A;  1MFW A;  4WAA A;  2AL3 A;  5C2T A;  2WXO A;  1XCQ L;  2PVG C;  3KV6 A;  2X51 A;  1WF9 A;  4NZL B;  2IGH A;  2KLC A;  1MJD A;  3GE8 C;  4CQN A;  3UQ4 A;  2E9X C;  4KDL B;  5JQG E;  1SEB D;  4CN6 A;  3ZGZ A;  2WDQ B;  2BG9 C;  3AXJ A;  4PFP A;  3X0W A;  1U4A A;  1WRD A;  2V7M A;  3FKY A;  2CXF A;  1HEZ E;  3RH3 A;  4IIJ E;  1L7Y A;  4GXB A;  3RC8 A;  4BKG A;  2IC6 A;  3LDZ E;  4AJW A;  3UIO B;  3ZDM C;  2ASQ A;  1PDX A;  3L54 A;  2N0S B;  4WJN A;  2AQ3 B;  2W2U A;  4XBF B;  3LBX A;  2QJL A;  3PGE A;  1AAR A;  2ZZP B;  2CWO A;  3SWH A;  5JHB A;  4P09 A;  3NS8 A;  3PRP B;  3P1M A;  1D1A A;  3DTO A;  4IWO A;  3N9L A;  2X67 A;  4ZZB A;  2BWF A;  4URK A;  2WU2 A;  1FD6 A;  2XAQ B;  1J7C A;  2XSB A;  3QWZ B;  5LOV E;  2L05 A;  2L1A A;  3ZTC A;  4YTN B;  5F8P A;  1E10 A;  2KJH B;  3CWZ B;  5HXH A;  1J7A A;  3F2E A;  3E56 A;  4BOZ B;  2AXD S;  2D9D A;  3ZEF B;  3KW5 B;  1QIL A;  3EUH A;  1XQQ A;  3NVZ A;  2CCQ A;  2AQ2 B;  3U78 A;  4IM2 A;  4OVZ A;  1A70 A;  1SB3 C;  3IT6 B;  3L10 B;  1T72 A;  3LYY A;  2YEP B;  2WS3 A;  2QIL A;  3B2F A;  4DR1 T;  4HE8 A;  4US9 A;  2RP4 A;  2XQA A;  2LUE A;  1HG5 A;  1J7B A;  4MT5 A;  4Z90 A;  3PUQ A;  1MG8 A;  3UQB A;  3I0O A;  2K39 A;  4GKJ T;  5BYS A;  5ABG A;  1HS7 A;  3ONJ A;  3KDS E;  5AQH B;  3VRB B;  3AE3 B;  4P1B C;  2E3T A;  2VK9 A;  1WYW B;  3RYI E;  5AQJ B;  2BF8 B;  4KIK A;  4DV2 T;  5AFU L;  3RN9 C;  2W66 A;  4E7Z A;  1MG4 A;  1PYW D;  4DHJ B;  3QK6 A;  3N1Y C;  2OA5 A;  3N9O A;  2CHW A;  1XNR T;  2XM1 A;  1JWU D;  4P6V F;  1C9F A;  3GMI A;  2G4S A;  4DND A;  2X0H A;  4L9I A;  4ANJ A;  1FCL A;  4TV9 E;  1PQS A;  1V80 A;  4X57 B;  3PRE A;  2MH7 A;  5AQI B;  2VWA A;  2WQY A;  2INN E;  2KZR A;  2CXL A;  1HTJ F;  2V9H A;  3RRW A;  5L3C B;  4ZHP A;  1GOZ A;  4S0R A;  3N30 A;  4ILU A;  2X0L B;  2H3R A;  2EHO A;  1C1Y B;  4MAC A;  1V49 A;  1D1B A;  3DP7 A;  4U74 A;  4WAF A;  4ZOH C;  4KGR A;  3RKO A;  1T7S A;  2VQE T;  4Q25 A;  1FJG T;  2WWZ A;  5LHI B;  1UWM A;  1P1A A;  3L8R A;  1WY8 A;  1QLB B;  1TBE A;  3K8P C;  4GDL B;  4UDU C;  3HA4 A;  3DBH I;  3PSE B;  3W5U B;  2L9Q A;  2YDS A;  4TNW A;  3W9C B;  4ANU A;  3EGR A;  4HLE A;  2V5D A;  1Y64 B;  1UCU A;  3PUY F;  2CJN A;  3DHI C;  2DEN B;  1NEN A;  3Q8F A;  1I7H A;  3FAH A;  1I4G A;  3DHG C;  1RWS A;  3VAW A;  2CE7 A;  4DMW A;  1M94 A;  5LCY A;  1UWX A;  2IML A;  3N2G E;  1T0R C;  1XF5 L;  3AMZ A;  2P9B A;  4EZ4 A;  1YD8 G;  3QIJ A;  2VKD A;  1WX8 A;  4C7Y A;  3V05 A;  1W9R A;  4YSY A;  3RC3 A;  4DV1 T;  3HRD D;  3N9Q A;  1C79 A;  2DZK A;  2CJO A;  5TR5 A;  4AOF A;  3B1L X;  1FIQ A;  2YEV C;  4RGO S;  4ACF A;  1ZPS A;  4ZRI A;  2GOW A;  5LG3 A;  1WI0 A;  2C60 A;  2EHO D;  1SE3 A;  3P4S B;  1YKE B;  1QUU A;  4A90 A;  2WNM A;  3L13 A;  2H89 A;  2WDV B;  2X68 A;  3W2D A;  2LHE A;  3RD2 A;  3NVW A;  3P4Q A;  4F6R C;  4ARC A;  2K1F A;  4IDN A;  2KTR A;  3AE7 B;  1F2R I;  1YXR A;  1E8Z A;  2E9X A;  2CLY B;  4MSQ B;  3FBZ A;  3AAI A;  2BG9 A;  3MXZ A;  2JRI B;  2OLT A;  1IP9 A;  5AZG A;  2OJW A;  3NRX A;  5LP6 E;  1NBF C;  3A4R A;  5DAB A;  2G3Q B;  1IPG A;  4DR6 T;  2B76 B;  4NQL B;  3RKG A;  5JDM A;  3ENE A;  3NWI A;  4W9E A;  1I4R A;  1S3S G;  4IST A;  4P16 A;  3DBR I;  2HPL A;  4U72 A;  3QB5 K;  5G55 A;  2V1D B;  4ZDV A;  3URY A;  1E8X A;  2G45 B;  4A20 A;  1XT9 B;  2W9N A;  1S94 A;  1GAQ B;  3WCQ A;  3M63 B;  4YSZ A;  1KRH A;  4YWG G;  5JZE B;  3AE6 A;  4O4J E;  3MA9 A;  2WXG A;  1UBQ A;  4UXN B;  2XAS B;  3I1A A;  4IHJ E;  4N78 D;  4S17 A;  5LHG B;  3BK1 A;  3EDU A;  3AUL A;  3AAA B;  3RYF E;  2KMC A;  5BMG A;  1TGZ B;  2L0F A;  1D1C A;  1LFD A;  3VU7 H;  4MH8 A;  2Z8L A;  4HPP A;  1JML A;  3ETV A;  4G50 A;  1TT5 B;  2WXJ A;  2JMH A;  4UV8 B;  3RUL A;  4YXD B;  2RSU A;  2L3L A;  2N9X A;  4HFB A;  2N1G A;  2E9X D;  3RLF F;  3Q3N C;  4DR2 T;  1G6J A;  3FHN A;  4K0U A;  4ANX A;  1I35 A;  5HEJ A;  4HTE A;  2X9W A;  3V5S A;  4H63 H;  2BKO A;  2FBW B;  1UZX B;  3ZCI A;  2LRL A;  2PIA A;  2D3C A;  2LLY A;  1SIJ A;  4PK5 A;  2Z0E B;  2ODU A;  3O1H A;  5EK3 A;  3ZC0 A;  1W09 A;  5LXI B;  2JZZ A;  4WBO A;  4E3C A;  2V7L A;  3LSV A;  2LJL A;  3A1Q A;  3FB2 A;  4KVG B;  4HWH A;  1IUE A;  3VQI A;  1BR4 A;  4NUV A;  1E0Z A;  2J7Q B;  3G06 A;  1KFY B;  3TSS A;  1FEH A;  4TV8 E;  1V5T A;  1PUT A;  2NOX A;  4YJ2 E;  5E0O A;  4LF8 T;  2RA1 A;  4GGQ A;  3OTO T;  1UUS A;  5HEU A;  3RZW C;  3JCF A;  3EI0 A;  2D0T A;  1WIA A;  2E5V A;  2KDF B;  4YJ3 E;  2IGD A;  2L52 A;  4FXC A;  2VH2 A;  1S1Q B;  4TX5 A;  1UUR A;  2WM9 A;  4TWH A;  3K3O A;  5FR6 A;  3VUX A;  2K5B B;  2WP9 A;  3EFC A;  2LKH A;  4E71 A;  3KFW X;  3VRB A;  3IA3 A;  1TKY A;  4LNI A;  5EE3 A;  3AB3 B;  1VCT A;  3DBL I;  4IE0 A;  3VH4 B;  2IND C;  1V1P A;  2R2Q A;  4TN7 B;  3H7S A;  1ZKE A;  3BVZ A;  4WQO B;  3D32 A;  4QKN A;  4BJN A;  4TUY E;  1TY2 A;  3Q3M C;  3CQX C;  2J1D G;  1WX9 A;  2R6G F;  2ICI A;  5J2T E;  4LNK A;  5ABE A;  3BK9 A;  2M67 A;  4BFR A;  4ZS2 A;  4NNJ B;  2I0M A;  4W9F A;  1OFF A;  2C5K T;  4OYJ A;  2KN5 A;  4NPN A;  3SR6 A;  1V1O A;  3ZKR A;  1D5M C;  2J42 A;  2NR2 A;  4P7I A;  2O6V B;  1HFA A;  1MMG A;  2W3S A;  2GBN A;  3QCA A;  1UNS A;  5L3B B;  2Q5W D;  5HWY A;  4HDQ A;  3OJA A;  3RNF C;  2RDH A;  1HTO A;  4Z91 A;  3DQV A;  4GDL A;  3O1I A;  2I59 A;  3SRZ A;  2BKP A;  5LJM A;  1FXA A;  2ACZ B;  3V61 A;  3BY4 B;  2QDF A;  3WAL A;  3B9J A;  2D2Q A;  5JR9 B;  1EWY C;  4PT5 A;  4AKL A;  2N9E B;  3N9P A;  3N20 C;  3MFG A;  3PJA J;  3ZTD A;  3AEB B;  3N2O A;  2YOE A;  2DLR A;  1C77 A;  4FN2 A;  3SD5 A;  1U5P A;  2LHN A;  2KVZ A;  4DV6 T;  4P1C C;  2CXD A;  1BXT A;  4RGM A;  4PS3 A;  3RHW A;  1AW7 A;  5L3E B;  2JZP A;  4I50 E;  3EAM A;  2JQH A;  4JI2 T;  1V9J A;  1XLN A;  4BBN F;  3SS1 A;  4ERR A;  3Q8C A;  2JWZ A;  3QK0 A;  4XGA B;  2N1V A;  2CBI A;  4O4L E;  2JSV X;  2BB6 A;  3ZYK A;  3NZU A;  4F7Z A;  4HFE A;  1SE7 A;  1LRZ A;  1DYQ A;  2LSI A;  1EWC A;  1HTQ A;  4HWC A;  2CS4 A;  3W1S C;  2XSA A;  2KWD A;  4IE4 A;  4OZA A;  3AE1 B;  5D3D A;  1WGR A;  1LM8 B;  4HRS A;  5AUK A;  2FJA A;  3RQW A;  3TUO A;  2JPF A;  3JYU A;  4X62 T;  3AE2 A;  3NS1 A;  3R7R A;  3FXD B;  5HKH A;  3NVO A;  2FJB A;  2CR5 A;  2NCN A;  3KUC B;  4YTP B;  3VKH A;  3T3O A;  4WYV A;  1KM7 A;  4U2Y A;  4AS1 A;  3WAJ A;  2KKC A;  4EE2 A;  5JDN A;  1YKH B;  4FHK A;  3TLV A;  3H7P A;  2QGS A;  1U4Q A;  4LF9 T;  2KMF A;  1HE8 A;  2BYV E;  4OX9 T;  2WXK A;  2M17 A;  5LMN T;  2V8S V;  3ANW B;  1VRB A;  3KYD D;  3UU3 A;  2XUE A;  4NJ6 A;  3ETR A;  3RZF A;  3TCA A;  2XAF B;  4V1A v;  2RD0 A;  4C4V A;  1FRR A;  4EXT A;  3I0Q A;  3JSV A;  2IGG A;  2EKI A;  1HNZ T;  3AE5 A;  2V6Y B;  4DV7 T;  2KMM A;  2UXX B;  3S4U A;  3UQA A;  4IDI A;  3AEA A;  1I6Z A;  1WGK A;  5BYR A;  2QHO A;  3N32 A;  4CXY A;  4KZ0 A;  3VVW B;  2GB1 A;  5D2M B;  3TLT A;  5L2L A;  3AE9 B;  1NVI D;  3GN5 A;  1WH3 A;  3NVY A;  2BKR B;  4IL4 A;  2I1J A;  4HFI A;  5GXG B;  4H9S E;  3N1X C;  1TY0 A;  2ZNV C;  3RIU C;  1PGX A;  2WU5 B;  3U4E G;  4JLE A;  4EUT A;  3DJB A;  2W62 A;  3ZMT B;  2KAC A;  2ON8 A;  2VZK D;  1DOY A;  1E6E B;  2WCA A;  1SBB B;  3DVN U;  1RFA A;  1MHX A;  2JPH A;  1T0Y A;  2H7V C;  1HXY D;  2NBV B;  2Z6E A;  2ZM0 A;  1ZOY B;  4IE6 A;  2L76 A;  1HR0 T;  4FHJ A;  3AA6 B;  2VL8 A;  2BZB A;  3HI2 A;  1K51 A;  4KSL C;  4Z8X A;  4X64 T;  1XMQ T;  1AN8 A;  1WJU A;  3MP9 A;  1E7V A;  3QB5 A;  3ZQ4 A;  5DQW A;  3V6C B;  3PUX F;  5IO9 A;  4OYK A;  3C4Z A;  2W82 A;  2K22 A;  2IIU A;  4GSW A;  2NPT B;  3GP7 A;  5H8Y E;  3PUW F;  1BR2 A;  3HKC E;  3EC8 A;  1MMN A;  2QSD A;  2YU1 A;  1A5R A;  4M0W B;  2REX A;  1YX5 B;  4XDD A;  3CIR A;  3L16 A;  1FFV A;  1E8Y A;  2CU1 A;  2JXT A;  5IAA C;  3AEE A;  2PLP A;  4B3S T;  5HXE A;  1I4H A;  4M01 A;  3FZM B;  4FJV B;  1HG2 A;  2PJQ A;  4L23 A;  2JUO A;  3Q3O C;  1FFU A;  1E90 A;  1N32 T;  2AEH A;  2VRR B;  3QJZ A;  2WB5 A;  3AI5 A;  4W9D A;  2BDE A;  1P98 A;  2PW9 A;  1TKE A;  2WAU A;  4CQI A;  3NZS A;  1X9B A;  3AB5 A;  5ABF B;  4A98 A;  2LSJ A;  5CGM A;  1EU3 A;  2JVC A;  2ZCC A;  3MC0 B;  3NZQ A;  2VAS A;  2L8K A;  2F4V T;  2FUG 1;  1Z8U A;  3C19 A;  1F0Z A;  3KUZ A;  2QMT A;  5T8I A;  4C91 A;  4J3O D;  2LEK A;  3N3K B;  1MVK A;  4DV5 T;  3C0R B;  3I3T B;  3E08 A;  1E9M A;  1WMH B;  2HDE A;  4K3C A;  2N7D A;  4XZ4 A;  3TEW A;  3H9D A;  2MA9 B;  4KBM B;  1WJ4 A;  3PJA A;  3A9K B;  4X1I E;  4DMV A;  1ACC A;  5DPR A;  4B3T T;  3I63 C;  5DJQ C;  1FPY A;  3HUI A;  3JW0 X;  1JWB D;  4PJN A;  3C8Y A;  4GU2 A;  2KMA A;  2KLQ A;  2C7H A;  1R4N B;  2XQ4 A;  3WAM A;  2M1M A;  2MTQ A;  4QWN B;  3Q6B A;  1AYF A;  3I9Y A;  1GC6 A;  2DNF A;  2NVU I;  3W1S A;  2Q9Q C;  4FBJ B;  5LNK 1;  3R84 B;  3AEB A;  4ZXL A;  1N61 A;  3QHT A;  3C4X A;  2HJ8 A;  4DV0 T;  1ENF A;  1V86 A;  3PU8 A;  3R8B A;  4GIV A;  2LVO A;  4ZOL E;  1E7U A;  4YY3 T;  3KVA A;  5IYZ E;  1YQ3 A;  1R8I A;  5TAO A;  3AAE B;  3BWU D;  2ZVO A;  1M7K A;  3QAR A;  3EHV A;  1FCC C;  1FM0 D;  4DR4 T;  1X1M A;  4NJ7 A;  5E6J A;  2FUP A;  4JGH B;  2YDQ A;  1YJJ A;  4MHC A;  2MOZ A;  1ZXH A;  3HK0 A;  3C98 B;  3AEG B;  1CHU A;  4UEL A;  2N1W A;  1NYQ A;  1ZGU B;  4GOU A;  2BT6 A;  3L4P A;  1E7P B;  3TIX A;  5D94 A;  2XJ7 A;  4GKK T;  3PLU A;  5D3I B;  3RUI B;  3PV0 F;  2C0S A;  1GPX A;  2M6I A;  2VUR A;  1YNT E;  2UUA T;  2NMQ A;  1T5X D;  2IO3 B;  3NY5 A;  5FL0 A;  4KX6 B;  2K8B A;  4CHK A;  3ZJ2 A;  4HWI B;  1QSD A;  5LYJ E;  2G9H D;  4JLC A;  1HNX T;  4XE0 A;  1XXG A;  2BVC A;  5JXV A;  3BVG A;  2LMC A;  2VH1 A;  2MX2 A;  1ZP0 B;  5IN7 A;  4M02 A;  3ZT7 A;  2W0G A;  3L17 A;  2K24 A;  3P50 A;  3RIU A;  3R7Q A;  4WIP A;  1NI3 A;  1WCR A;  4JBW F;  3V6E B;  2X9X A;  5LHH B;  2G0U A;  4LNF A;  1VJK A;  2IDY A;  2IZV B;  2BS4 B;  5AQG B;  1SUM B;  4HKZ E;  4KSK C;  4IDQ A;  5HEH A;  4OW0 A;  5DPS A;  5GON E;  2WWU A;  2M8S A;  3QAQ A;  1FMW A;  2D11 A;  3M3Z B;  3MZK B;  5DQV A;  1OED B;  4JI3 T;  1YN3 A;  4E7S A;  4ADZ A;  1J1J A;  4HN9 A;  5C1Z A;  1KEY A;  3O4X E;  4I6P A;  3UUL A;  2K3U A;  4G11 A;  2J62 A;  3U7D A;  3RNB C;  3VDZ A;  2WU5 A;  4O4H E;  2ZEQ A;  3AE4 A;  3N1Z C;  4HJK A;  5IUX A;  4PFO A;  1B1Z A;  2V5C A;  4K7S A;  3NG0 A;  2BS2 A;  1O3X A;  2V7K A;  1UUP A;  2LM2 A;  1RM6 C;  2GRI A;  2V3S A;  3UFG A;  3UTK A;  1J5E T;  3P42 A;  1TJE A;  4AIS A;  4AKH A;  2CWY A;  4TUU A;  4YHJ A;  3EA6 A;  2X66 A;  2PTL A;  2ZW0 A;  1OED C;  3OJ3 A;  2GBR A;  1WE7 A;  2KVR A;  3MHS D;  4RMA A;  5L3G B;  4MJS A;  2YU2 A;  3KVF B;  3W15 B;  2R61 A;  1YN4 A;  2NW7 A;  1TIF A;  4ZYN A;  5DPW A;  3VHT C;  3CKD A;  1EF1 A;  3TKL B;  4GN1 A;  1XDP A;  2YDR A;  2CEA A;  2KFK B;  5FYM A;  1V8C A;  2JF5 A;  2K8H A;  1F77 A;  2O2V B;  3K3N A;  2N9P C;  2NS5 A;  2XNA C;  2WZI A;  3DHH C;  1F9J A;  4H9N C;  3ZRF A;  5AQU B;  2KC2 A;  2JIW A;  4ZHQ E;  1OQQ A;  2AX5 A;  2ZCB A;  2FJE A;  5L3F B;  5BMH A;  2KN4 A;  3VUW A;  4YHH T;  4USA A;  5AQS B;  2OOB B;  2QIE B;  3AEC B;  4YTM A;  1V81 A;  3MHZ A;  4KGT A;  2W00 A;  1XLP A;  1NI2 A;  2WXH A;  3PT2 B;  2VL0 A;  2H88 B;  1I42 A;  1D0Z A;  4WQM A;  2KTF A;  4DHZ E;  1L0V A;  2NTX A;  1UX4 A;  1IJ6 A;  5AQF B;  2ONQ A;  1YW0 A;  1P7F A;  5CFB A;  5A1L A;  1C4A A;  1WZ3 A;  4XWT A;  3ETU A;  3H37 A;  1WM2 A;  3DBH B;  2PTF A;  2D0U A;  1ESF A;  3DWM A;  1BR1 A;  2Q9Q A;  1SJH D;  4CI2 B;  3FZK B;  1XZY A;  5JHA A;  4L5G A;  2LVP A;  4IGU A;  4U3C A;  2EEL A;  3CF6 E;  2ODV A;  5TSS A;  4LNO A;  1N34 T;  5KX5 E;  2FJD A;  2HN2 A;  3JC6 C;  3LG7 A;  2J4X A;  1Q5W B;  2A9U A;  5IWA T;  4ASW C;  3VH3 B;  5CA0 E;  4JEU B;  2XEW A;  4WNK A;  2DWG A;  3RF1 A;  2KDI A;  3W1Y A;  2MJE A;  5G5H A;  4JUY A;  2D5G A;  2LHR A;  1M62 A;  3N9Y C;  3UU6 A;  2DCF A;  3ZLZ A;  1D4B A;  2LEH A;  1GB1 A;  3TL5 A;  2K0P A;  1JWM D;  3A9J A;  4GDK B;  3RMK C;  1T0Q C;  1KH0 A;  3B08 A;  2IJ0 A;  3L08 A;  2MBO A;  3U7Z A;  2Y5P A;  3VR9 A;  4IM3 A;  1UD7 A;  4WH4 A;  2XQY A;  1QZE A;  4GLS C;  4IC7 B;  4IG7 B;  5C23 A;  4A6Q A;  4I55 E;  4OHJ A;  1ZKH A;  1J0G A;  2MAW A;  2CM0 A;  1FMV A;  4IE7 A;  3P4P A;  5CJ5 A;  4MBQ A;  4RM9 A;  4ISS A;  2BG9 E;  4DVD A;  4NAM A;  3A5X A;  4JWU C;  1K53 A;  1JRO A;  1Y8R C;  3TEZ A;  5D7G A;  2Z59 B;  3UFE A;  2Q9Q D;  2G4D B;  1JRU A;  2JYE A;  2OED A;  3LJC A;  5CB4 E;  2MP2 A;  4B6W A;  2N9L A;  2LSG A;  4UR9 A;  1JWA D;  3FBL A;  4ZRP A;  2LJ5 A;  4AKG A;  4K7U A;  4MM3 A;  3HM6 X;  1JCK B;  5HAX A;  2JU6 X;  3QQ8 B;  2G1E A;  3DVG X;  2CA5 A;  1WZ0 A;  4J2C A;  2FID A;  3KUD B;  2QCZ A;  2N7E A;  1C78 A;  1L6V A;  1WE6 A;  2PE6 B;  3U2S C;  2IY0 B;  2L3Z A;  2WXM A;  4CZZ B;  1EO6 A;  3TEX A;  2FCS A;  5E6N A;  4WJP A;  3PUV F;  5FR3 A;  2DNX A;  4WJQ A;  1I94 T;  4UF0 B;  2NTY A;  2QVA A;  3FC4 A;  3A33 B;  2NTT A;  4ILB A;  3OKQ A;  4MDK E;  5IP4 D;  4JI0 T;  2KQS A;  1WLX A;  4EEB A;  3UUB A;  3IFW B;  3RGL A;  4K7W A;  4LTU A;  4DO0 A;  2CLY C;  3Q2M A;  2WDQ A;  2FUH B;  5IOI A;  1T6B X;  1OED A;  3CST A;  4FJO A;  1GB4 A;  2KIN B;  2TSS A;  3M65 A;  1SGH A;  3AEF B;  4KZC A;  2UXC T;  2KX3 A;  2IYD B;  3PDY A;  3I9W A;  4X5T A;  3MKD A;  4X65 T;  5HWX A;  3L3P A;  1CK1 A;  3LK2 B;  1SSN A;  1WJ6 A;  1MNE A;  2KWC A;  4KKI A;  1BT0 A;  4DK5 A;  5FL1 A;  2J0M A;  2DZI A;  4YSX B;  4MGZ E;  4MFR A;  3ZUN A;  1EUV B;  3RNE C;  2JQK A;  1XMO T;  1CJE A;  2MEK A;  2BPS A;  4LFB T;  4JYA T;  3OG5 A;  5G5G A;  5C3J B;  1HX8 A;  2RMM A;  4YTN A;  2Y5C A;  1L0X B;  2W55 A;  2IC9 A;  3UU4 A;  1ZDV A;  2BBH A;  2N4F A;  3ZT5 A;  3KVB A;  3F31 A;  2WWV A;  3FXE B;  2X0Y A;  2MWS B;  1WRI A;  3ALB A;  4B9K A;  2RPV A;  3QA8 A;  5HG2 A;  4LMJ A;  3OVU A;  3P2B A;  4FAD A;  3FIL B;  2UYZ B;  5E6P A;  1UGO A;  3NKZ A;  1ZDX A;  5J2U E;  5BYQ A;  2LSK A;  2UXB T;  1R7S A;  2JT4 B;  3HIZ A;  3NZ3 A;  5LGN B;  5JRC B;  2KSR A;  2KXP B;  2FE8 A;  2DWQ A;  3SFD B;  1IGC A;  3ZMV B;  3AE3 A;  1L0Y B;  2D5U A;  1UEL A;  4COF A;  4ZI3 C;  4U33 A;  3RI5 A;  2PMV A;  2A2F X;  5H92 C;  4C56 C;  2XK5 B;  2DHZ A;  1XDO A;  1HZ5 A;  1IBL T;  2FIF A;  3AM9 A;  3GE3 C;  1SXT A;  2M19 A;  2DWK A;  4LNN A;  2YKS A;  5LGT B;  4LDT B;  3DDC B;  2BS3 B;  2A5U A;  2UU7 A;  4ZHO A;  4RNA A;  1JWS D;  3U30 A;  3V3X A;  3H3M A;  3DVN V;  2BB5 A;  4TQ1 A;  5AQO B;  3TLS A;  1OQR A;  4F1S A;  3PPA A;  1P9D U; 
#chains in the Genus database with same CATH homology
 4KSL C;  4IM0 A;  2DAJ A;  2Y5B B;  4PYU A;  3S2A A;  4FJY A;  1WJU A;  1WGD A;  1V6E A;  2FNJ B;  1E7V A;  2FAZ A;  3V6C B;  4WAA A;  2WDT B;  2AL3 A;  1YX6 B;  4AWJ A;  2BGF A;  4GSW A;  2KWV B;  2WYQ A;  4KV2 A;  2NPT B;  5AQR B;  1WF9 A;  4E74 A;  2KLC A;  2KQ7 A;  4ZRK A;  5AQL B;  4RM8 A;  3EC8 A;  1NDD A;  2IBI B;  1WM3 A;  1IYF A;  2KDE B;  2AYO B;  4IW0 A;  4KDL B;  2DAF A;  3V60 A;  2DZJ A;  1A5R A;  3X0W A;  1UH6 A;  1U4A A;  4M0W B;  3NOB A;  2REX A;  4GMV A;  1YX5 B;  4MGK E;  2DYO A;  3L16 A;  3IBE A;  1E8Y A;  2CU1 A;  1L7Y A;  4GXB A;  2KNB A;  4BKG A;  3LDZ E;  5IAA C;  2KD0 A;  1E8W A;  4AJW A;  1TZ1 A;  3EEC A;  3FZM B;  2MSE D;  3UIO B;  3ZDM C;  2ASQ A;  4FJV B;  3L54 A;  3ZKJ C;  5EDS A;  4WJN A;  2MBE A;  2JUO A;  2FCQ A;  2I1K A;  4DHJ D;  1E90 A;  2RGF A;  2AEH A;  2VRR B;  3QJZ A;  4WWP A;  5J17 A;  3AI5 A;  3PGE A;  3PRZ A;  1AAR A;  2RR9 A;  1P98 A;  2ZZP B;  4W9D A;  3B0A A;  4ZRJ A;  1OGW A;  3NZS A;  5E6O A;  3VUY A;  5AQQ B;  5JHB A;  1RRB A;  2ZCC A;  2JVC A;  3NS8 A;  3H7P B;  3PRP B;  4PS7 A;  4WJO A;  3DCG A;  4IWO A;  2BWF A;  4NAW B;  3ZO5 B;  1YQB A;  2GBK A;  2MRP A;  4I6L B;  1WFY A;  4URK A;  1RAX A;  3QWZ B;  4M8N A;  3ZNG C;  3KUZ A;  2KC1 A;  3HHM A;  2L05 A;  3GOE A;  3ZTC A;  1FXT B;  2KJH B;  2A4Z A;  3O65 B;  3N3K B;  3C0R B;  3I3T B;  3PS6 A;  4BKS A;  1WMH B;  3JSV B;  2D9D A;  4BOZ B;  2N7D A;  3KW5 B;  4XZ4 A;  5J18 A;  3H9D A;  2MA9 B;  1WJ4 A;  1XQQ A;  2OJR A;  2KWU B;  3A9K B;  3M62 B;  4IM2 A;  4OVU A;  4EOY A;  5DPR A;  1Z2M A;  3L10 B;  4B95 A;  1WX7 A;  3JW0 X;  2LUE A;  4GU2 A;  3ZDT A;  2KMA A;  3H6N A;  2C7H A;  4WWN A;  3WAM A;  2FCN A;  2M1M A;  1MG8 A;  3UQB A;  2V4L A;  4NY0 A;  1GC6 A;  3LJ3 A;  2NVU I;  4W9G A;  2K39 A;  3BIN A;  2CHZ A;  3W1S A;  3SU8 X;  2JY6 A;  4FBJ B;  5L83 A;  5AQH B;  3QHT A;  1KOT A;  2HJ8 A;  5D6J B;  1WYW B;  1Q1O A;  1V86 A;  5AQJ B;  2BF8 B;  2IO2 B;  4KIK A;  2ZPY A;  4GIV A;  2LVO A;  1E7U A;  4DHJ B;  4W9J A;  1WXA A;  3QAR A;  2ZVO A;  1M7K A;  2JRH A;  2CHW A;  1EF5 A;  3EHV A;  4HCN B;  2C7M B;  4JL9 A;  2BWE S;  2G4S A;  4NJ7 A;  1X1M A;  2KFK A;  1H8C A;  3JVZ X;  4JGH B;  4MEL A;  1PQS A;  1V80 A;  4HXD A;  4X57 B;  3PRE A;  3OAW A;  3HK0 A;  5AQI B;  2O2V A;  3DPD A;  2N1W A;  4HWD A;  2KZR A;  1ZGU B;  4I6N B;  3PLV A;  3WAN A;  3TIX A;  4ICU A;  5D94 A;  3PLU A;  2K6Q A;  4BKS D;  3N30 A;  3RUI B;  1C1Y B;  1V49 A;  1Z5S B;  4LJP B;  2GBJ A;  2KLG A;  4YL8 A;  1T7S A;  4MGY E;  3LDQ B;  2WWZ A;  4IUM B;  2IO3 B;  1P1A A;  1WY8 A;  3SDL C;  1TBE A;  3NY5 A;  2C5L C;  4GDL B;  3DBH I;  3PSE B;  2K8B A;  4K1R B;  4CHK A;  4HWI B;  4ANU A;  4LJO B;  2PJH A;  1WRD B;  4HLE A;  4JLC A;  4CYE A;  1OEY A;  4AP4 C;  1H4R A;  2DEN B;  5AZH A;  3PTF C;  2MX2 A;  2M4N A;  4EFO A;  3VAW A;  3L17 A;  1ZW7 A;  2KXJ A;  1M94 A;  3PZD A;  3R7Q A;  4JQW C;  1RLF A;  3V6E B;  1XD3 B;  2K25 A;  4OVV A;  1Q0W B;  1WXV A;  3QIJ A;  1WX8 A;  2MBB B;  2IZV B;  1R4M I;  2LWP A;  5AQG B;  4KSK C;  5DPS A;  4HWF A;  3L0W B;  5BO4 B;  2DZK A;  3AU5 A;  5TR5 A;  2M8S A;  3QAQ A;  4AOF A;  2D07 B;  2D11 A;  3B1L X;  3M3Z B;  1L2N A;  3MJW A;  4HPM B;  4ZRI A;  1KJT A;  2GOW A;  4TQ0 A;  5C1Z A;  4XX5 A;  1WI0 A;  2C60 A;  4I6P A;  2KOX A;  4GDK A;  4G11 A;  1WR6 E;  3U7D A;  3L13 A;  4GOC A;  1V2Y A;  3VDZ A;  2ZEQ A;  3WAP A;  3OJ4 B;  4DDG D;  3KH0 A;  4HJK A;  4K7S A;  3RD2 A;  4TKN A;  1UGM A;  1E5W A;  2FCM A;  2K1F A;  5CHW A;  5DCN A;  2KTR A;  1WGG A;  2V3S A;  5LLI A;  3ZRC A;  4HVB A;  1E8Z A;  2B3A A;  4PYZ A;  3VTU A;  4DXA B;  4HK2 A;  4TUU A;  2LGY A;  3ZNZ B;  4MSQ B;  3IHP C;  2JRI B;  4XC2 A;  1IP9 A;  3OJ3 A;  2GBR A;  5AZG A;  5CHV C;  1WE7 A;  1NBF C;  2K6D B;  2KVR A;  3MHS D;  3A4R A;  4RMA A;  3WAO A;  2G3Q B;  1IPG A;  1V5O A;  4HDO A;  4MJS A;  3KVF B;  3UGB B;  4NQL B;  4AJY B;  3ENE A;  4W9E A;  3K9O B;  1S3S G;  5L95 C;  3DBR I;  4ZYN A;  5G55 A;  5DPW A;  2O6V A;  3VHT C;  4ZDV A;  1EF1 A;  4BKT A;  1E8X A;  4HCP B;  4A3P A;  5CTR C;  2G45 B;  4A20 A;  4GN1 A;  3UIP B;  2JXX A;  1XT9 B;  2KFK B;  2W9N A;  4K81 A;  4DDI D;  1WJN A;  2JF5 A;  2K8H A;  3M63 B;  4GB9 A;  4WWO A;  3PHW B;  5JZE B;  4M8M A;  1ISN A;  3T9L A;  1UBQ A;  3ML8 A;  4ANV A;  2O2V B;  2KAN A;  3X23 A;  2N9P C;  2NS5 A;  1F9J A;  3ZRF A;  5AQU B;  2KC2 A;  2DZM A;  3AUL A;  2DX5 B;  2L7R A;  2KMC A;  2YLM A;  2ZCB A;  3A4S C;  1SE9 A;  1TGZ B;  1LFD A;  2IY1 B;  2L0F A;  3VUW A;  2IO1 B;  2ZVN A;  3RT3 B;  2C7N B;  4II3 B;  2LXC A;  5AQS B;  2OOB B;  2LGX A;  4EEW A;  1V81 A;  4G50 A;  4FJZ A;  1GJZ A;  2DYB A;  2KDB A;  3RUL A;  2LI5 A;  1NI2 A;  3PT2 B;  2RSU A;  1I42 A;  1K8R B;  2N9X A;  3APD A;  5CHF A;  2KTF A;  4DHZ E;  5AQF B;  2LD9 A;  3UIN B;  4DHZ B;  4ANX A;  1G6J A;  1I35 A;  4MGI E;  2LAS A;  2V1Y A;  3PV1 A;  1WZ3 A;  3H1U A;  1YIW A;  2MW5 A;  1WGY A;  1UZX B;  2JZ3 B;  1WM2 A;  4W9K A;  3IVF A;  3DVG Y;  2Z0E B;  2ZNV B;  2BKF A;  3APC A;  3FZK B;  3R66 C;  2MBQ A;  2JZZ A;  2O6V D;  2LVP A;  4E3C A;  5JHA A;  5LXI B;  3CF6 E;  3A1Q A;  4KVG B;  4HWH A;  3VQI A;  2J7Q B;  2L8J A;  3PVL A;  3V62 A;  1Q5W B;  2YVC A;  1R4N I;  4ASW C;  3VH3 B;  3VFK A;  1OTR B;  3ML9 A;  3FZF B;  2XEW A;  1V5T A;  2KDI A;  3W1Y A;  3RZW C;  4GGQ A;  4EZL A;  1M62 A;  1WIA A;  4W9H A;  2KDF B;  5AQK B;  3ZLZ A;  1WXM A;  2EKE C;  1S1Q B;  1GC7 A;  4KDI C;  3TL5 A;  1VCB A;  2PPH A;  2MQJ A;  3A9J A;  5FR6 A;  3HM3 A;  4GDK B;  3VUX A;  4ANW A;  4F8C B;  2J0J A;  3B08 A;  4EZK A;  3L08 A;  3TJP A;  3ZW3 A;  2MBO A;  4BOS C;  4E71 A;  1CMX B;  4IM3 A;  1UD7 A;  3DBL I;  3VH4 B;  1QZE A;  2R2Q A;  4WQO B;  1WGH A;  2EMT A;  3H7S A;  4IC7 B;  4HPL B;  4IG7 B;  4TV3 A;  5C23 A;  4BVU C;  3D32 A;  1ZKH A;  2EMS A;  2KTR B;  1J0G A;  5DPT A;  3RCZ A;  2KJ6 A;  3GZN I;  1WX9 A;  2AWT A;  4RM9 A;  3QX1 A;  3DOW A;  3ZVV A;  4IWQ A;  1Y8R C;  2WX1 A;  1J19 A;  4BFR A;  2KX0 A;  4NNJ B;  5D7G A;  4W9F A;  3WA0 A;  3ZIM A;  5KHQ A;  2Z59 B;  4MJS B;  2G4D B;  1JRU A;  4NPN A;  2KN5 A;  4DBG A;  3ECI A;  2LVQ A;  3T8M A;  2NR2 A;  4P7I A;  2MP2 A;  2O6V B;  4B6W A;  1HX1 B;  2GBN A;  3QCA A;  2C9W B;  4AUQ C;  4W9L A;  4HDQ A;  2LJ5 A;  2J0K A;  4K7U A;  4MM3 A;  3HM6 X;  2XK5 A;  3QQ8 B;  4J6I A;  3AU4 A;  3AXC A;  3DQV A;  3DBS A;  3DVG X;  4GDL A;  1WZ0 A;  3KUD B;  2FID A;  5JH5 C;  3EFU A;  3V61 A;  3WAL A;  2N7E A;  4W9I A;  2PE6 B;  2Z0D B;  1WE6 A;  3BY4 B;  3K9P B;  3KYC D;  4IWP A;  2D2Q A;  1P3Q U;  2IY0 B;  2L3Z A;  2GMI C;  2MBH A;  3VTW A;  4NQK E;  3FZL B;  1C3T A;  1EO6 A;  2N9E B;  5KHO A;  3OLM D;  4A3O A;  2FCS A;  5E6N A;  3SHQ A;  2MCN B;  4ICV A;  4WJP A;  3ZTD A;  1VD2 A;  1SIF A;  2K8C A;  3IG3 A;  4FN2 A;  3SD5 A;  1WR1 A;  3MTN B;  4KIK B;  2D10 A;  4MH0 E;  4WJQ A;  3TBL D;  1GG3 A;  1UBI A;  1GNU A;  4PS3 A;  2ZJD A;  1P0R A;  3A33 B;  2PEA A;  1V9J A;  3WIM A;  2NPT A;  4MDK E;  4BBN F;  2KQS A;  2JWZ A;  3PRM B;  5AQT B;  3QK0 A;  4F7Z A;  2N1V A;  3NZU A;  3IFW B;  5AQM B;  2NBW B;  4K7W A;  5IA7 A;  5AZF A;  2FUH B;  2UWQ A;  3CST A;  1KLV A;  4HWC A;  2KJR A;  2CS4 A;  3W1S C;  1OQY A;  4FUL A;  4DWF A;  4FA6 A;  4KZC A;  1SGH A;  3TMP B;  1WGR A;  1LM8 B;  2GBM A;  2NBU A;  5AQN B;  5GMV A;  2KX3 A;  3A1Q B;  2IYD B;  3JYU A;  4W9C A;  3R7R A;  3M95 A;  5HKH A;  4II2 B;  2CR5 A;  2IO0 B;  2NCN A;  3KUC B;  5G2N A;  1UK5 A;  2R2O A;  3Q3F A;  5J2R A;  5LXH A;  1GUA B;  2WX0 A;  1WJ6 A;  1KM7 A;  4MSM B;  2KWC A;  4LDT D;  2LRU A;  1BT0 A;  2DYM A;  2KKC A;  3CMM B;  4DK5 A;  1LXD A;  2LGD A;  2J0M A;  2PE9 A;  4FHK A;  2DZI A;  3CSF A;  2HE7 A;  4CO7 A;  4EKU A;  3H7P A;  4MGZ E;  1HE8 A;  2BYV E;  4NAW A;  1EUV B;  3ZUN A;  3A9J B;  3Q3J A;  2M17 A;  3VXW A;  3A8Y C;  2BPS A;  2XBB C;  3KYD D;  2L0T A;  4NJ6 A;  3VTV A;  1YD8 U;  3RZF A;  3TCA A;  2HTH A;  2RD0 A;  2N4F A;  2L00 B;  1WMH A;  3JSV A;  1OEY J;  4FLH A;  2AL6 A;  2KFJ A;  2MWS B;  2BYF A;  2ZPN A;  3R3M A;  1J8C A;  2BYE A;  3A9K A;  4LCD E;  3UQA A;  1I6Z A;  2CKH B;  3ALB A;  4G0N B;  4B9K A;  3ZNH B;  3QA8 A;  2QHO A;  3N32 A;  3QC8 B;  4KZ0 A;  3P2B A;  3UF8 A;  3VVW B;  4FAD A;  5D2M B;  5AQP B;  2D3G A;  2UYZ B;  5E6P A;  2MLB A;  1UGO A;  4N9F 4;  1WH3 A;  4JIO U;  4G3X B;  5AEK B;  5AQV B;  2BKR B;  2KK8 A;  2LRW A;  5CX3 A;  3APF A;  2I1J A;  3FZH B;  2LZ6 A;  2JT4 B;  3ONS A;  2ZNV C;  3HIZ A;  2MP2 B;  2RPQ A;  1TTN A;  4EUT A;  3NHE B;  1YJ1 A;  3RYT A;  1D3Z A;  1UEL A;  4PS8 A;  2HD5 B;  2XK5 B;  2DHZ A;  2FIF A;  3PHX B;  3DVN U;  1RFA A;  4MEM A;  2JPH A;  2LXA A;  3U8Z A;  1T0Y A;  4BBN C;  2KHW B;  4LDT B;  2NBV B;  3DDC B;  2A5U A;  3ZNI D;  4EZJ A;  2KO3 A;  1LQB A;  1WXS A;  2L76 A;  3DVN V;  4TQ1 A;  4FHJ A;  2M0X A;  5AQO B;  3U30 A;  4F1S A;  3M3J A;  3PPA A;  2CHX A;  1P9D U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...