4HWIB

Crystal structure of atbag1 in complex with hsp70
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
177
structure length
177
Chain Sequence
b'MIRVRIKYGAVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock cognate 71 kDa protein
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
total genus 66
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwiB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hwiB01
4AJWA 1SIFA 1P0RA 1SGHA 2QHOA 4DHZE 2GBMA 3NY5A 1IP9A 4IW0A 1WJUA 2J0JA 4W9GA 3JVZX 3ZUNA 3DBRI 3A33B 2N4FA 3TMPB 1LM8B 4FHJA 1TBEA 2ZPYA 2DX5B 3SD5A 2LGYA 1P1AA 4EZKA 4GDLB 1WI0A 5HKHA 1L2NA 2PPHA 2KVRA 3UINB 4B6WA 3X0WA 1KOTA 3IHPC 2N1WA 4DHJB 5AQLB 1M7KA 1X1MA 3L16A 4WJQA 3PHWB 2GOWA 4KSKC 1OEYA 4PYUA 2MX2A 2KFKB 2G4SA 4ANUA 1WRDB 2WX1A 2C7NB 4FLHA 5AEKB 2JPHA 1WXAA 5D6JB 1WGDA 4HVBA 3ZNHB 2GBJA 4ICUA 2JZZA 4K7SA 3V60A 1R4NI 1S3SG 1E90A 1EF1A 3N32A 3ZDMC 2DAFA 2BKFA 5D94A 2L8JA 3KH0A 3SHQA 2KDFB 2MWSB 2DZMA 2KQ7A 1WMHA 2JRHA 2NPTB 4FBJB 3OJ4B 4MSMB 4KIKB 2K1FA 1RLFA 2RR9A 1GUAB 1E5WA 1RAXA 3RULA 2GBNA 1WJ4A 1AARA 2DENB 1WXVA 3M62B 1V5OA 3UIPB 1IPGA 1KM7A 4BBNC 1V2YA 1SE9A 2A5UA 2KWCA 2RD0A 3H7PB 4M8MA 2JXXA 4ZRIA 1HE8A 1H4RA 1UGMA 3KYDD 3R7RA 4JQWC 3PGEA 3WA0A 2KX0A 3ZIMA 4W9FA 2IYDB 2KMCA 3L13A 2XK5B 4K7WA 2AEHA 4TKNA 3QA8A 4M8NA 2UWQA 3W1YA 2REXA 1TGZB 2D07B 4IWPA 4W9EA 2HD5B 2JWZA 2FNJB 4NNJB 1Q0WB 2D10A 4GDLA 3FZMB 5AQFB 4N9F4 1QZEA 4HPMB 1P3QU 3H6NA 4E3CA 3HIZA 1T7SA 2O2VB 4J6IA 3DVNU 4XX5A 2R2QA 4AP4C 3R7QA 1ZGUB 4NQLB 3UQBA 1J8CA 2KWUB 2JUOA 4BKSD 1G6JA 2BPSA 2KANA 2KFKA 4G0NB 4HK2A 4IM0A 5AQKB 2K39A 1RRBA 5AQSB 3DDCB 2L05A 2KC2A 2L3ZA 1WX9A 2ZCBA 3VUWA 4W9DA 4GGQA 3PS6A 3C0RB 1WGYA 2YVCA 4ZRJA 2JZ3B 3HM3A 3IG3A 2GMIC 3UF8A 2ZVOA 2ZNVB 3R3MA 4GDKA 3UGBB 2K6QA 5AQGB 4GSWA 2MBHA 3N3KB 1WZ3A 2G3QB 4IM3A 3ZTCA 2NPTA 3OAWA 3APDA 4KIKA 3CMMB 3VH4B 2BYEA 3R66C 3VVWB 2NBUA 2N7DA 2LJ5A 1V5TA 3OLMD 3V6EB 4NPNA 4AUQC 2AYOB 2D9DA 2LD9A 3H7PA 4JIOU 1WM3A 1E8ZA 2FAZA 3JSVB 1UELA 4JL9A 4HWIB 2CU1A 4HXDA 4CO7A 5G55A 4XZ4A 2XK5A 2LXCA 4MGIE 4WWOA 2K25A 4FHKA 5JHBA 2KZRA 3ML8A 3FZKB 3LJ3A 2WDTB 3PLVA 3ZW3A 2K6DB 4DDID 2K8BA 3KUZA 4I6PA 5CHFA 2XEWA 3DVGY 3QX1A 3DQVA 4EZJA 4KZCA 4BOZB 1WYWB 4M0WB 2O2VA 1Q5WB 2NVUI 1WXMA 2KDIA 5AQJB 3PV1A 1UBQA 2G45B 1WR6E 3TL5A 1LQBA 3U30A 2Y5BB 4PS8A 3A4SC 4AOFA 4E74A 4AWJA 3D32A 1FXTB 2R2OA 2KJRA 2MBEA 4W9LA 2C60A 2DZJA 2NBWB 3AULA 4URKA 2KO3A 4GN1A 3VUYA 3PRMB 5C1ZA 3APFA 2D2QA 3DBSA 4PYZA 5D7GA 2HTHA 5FR6A 3KVFB 4LDTD 4MGZE 2FIFA 4KZ0A 2MBOA 4G3XB 2FCQA 2W9NA 3K9OB 3DPDA 2YLMA 4IWOA 4K1RB 4MH0E 4TQ1A 1TTNA 2JT4B 2LI5A 2LGDA 1Z5SB 3KYCD 2Z59B 4GXBA 2N9XA 3RZWC 2G4DB 2MA9B 4EEWA 2HJ8A 2RPQA 4FJYA 4HDOA 4PS7A 4NJ6A 5L95C 3A1QB 3U7DA 3FZLB 4NAWB 2KDBA 2DZKA 2KTFA 4GDKB 3ZTDA 5LXIB 5JHAA 3GOEA 3Q3JA 3JSVA 3W1SC 1WX7A 2FCNA 3CSFA 5AQRB 4EKUA 3IFWB 2MQJA 3T9LA 3PVLA 1R4MI 5J2RA 5AQOB 3EFUA 1TZ1A 2GBRA 2IO2B 2V4LA 4GOCA 3WAMA 2CHWA 2V3SA 3V6CB 5J17A 2BGFA 3FZFB 1I42A 2J7QB 2I1JA 2PE9A 3M3JA 4KDLB 1NBFC 5CX3A 3GZNI 5AQTB 5BO4B 1LXDA 4FADA 2J0MA 4FULA 1KJTA 4MDKE 5CTRC 4P7IA 1Y8RC 1NI2A 1UBIA 4HCNB 4IM2A 4KV2A 4ZYNA 3VXWA 1C1YB 4W9CA 3WAOA 4ASWC 4ANXA 5KHQA 3OJ3A 4ICVA 1E8WA 4WJPA 4BOSC 1P98A 3AXCA 3UQAA 2KMAA 4MSQB 4RMAA 1CMXB 1XT9B 5AQVB 3A9KB 1H8CA 4WQOB 2LASA 3B08A 3U8ZA 1JRUA 2JRIB 3DBLI 3QAQA 2IY1B 2UYZB 5IA7A 2N9PC 2LVOA 2WWZA 3VTVA 2MP2B 2L00B 4MEMA 2KX3A 3IVFA 2D3GA 4WWPA 3WALA 2OJRA 3L08A 2K8CA 3WANA 3PREA 3VUXA 1WX8A 2EKEC 3SDLC 5L83A 3VHTC 4HDQA 2MLBA 2L76A 4K7UA 4CYEA 2OOBB 2BF8B 1YJ1A 2O6VD 1V80A 2KK8A 3QK0A 2DYOA 3B0AA 2PEAA 1YD8U 4LDTB 3DVGX 5KHOA 3A1QA 2KD0A 3A4RA 4NAWA 5E6NA 3DVNV 1WFYA 5AQUB 3B1LX 2I1KA 3EHVA 5CHWA 1RFAA 2KWVB 3NZSA 2LGXA 2IO0B 2ZCCA 4OVVA 4DHJD 3A9JB 4BKGA 5DPRA 2L0FA 5E6OA 4OVUA 4MM3A 4HWCA 4MGKE 2MW5A 1XD3B 1K8RB 2KTRB 1YIWA 2BWFA 3V61A 3ML9A 3L0WB 3P2BA 1XQQA 2CR5A 2RSUA 1KLVA 1GC7A 4FN2A 3UIOB 3JW0X 5AQNB 3ENEA 1YQBA 4DHZB 3M3ZB 2KOXA 3TIXA 3N30A 3A8YC 1Q1OA 3A9KA 4DXAB 3RZFA 3WIMA 3BINA 3PRZA 4W9IA 4IG7B 4NY0A 4A20A 1V86A 3QCAA 4TQ0A 2KFJA 2MP2A 2C5LC 1VD2A 4WAAA 2MRPA 1WJ6A 2LWPA 4KSLC 3MHSD 2MBBB 3X23A 1L7YA 2V1YA 1OQYA 3NOBA 1OEYJ 2KLGA 3QJZA 4G50A 3SU8X 5AQHB 2ZPNA 1UGOA 2LVQA 4EFOA 1U4AA 4XC2A 1WJNA 2JY6A 2VRRB 4A3OA 3ZNGC 2FCMA 2FIDA 2AL3A 1E8YA 2ZZPB 2GBKA 3APCA 3H1UA 4HPLB 3L10B 5LLIA 4BKTA 3ZDTA 5AZHA 3QHTA 1J19A 2KC1A 2RGFA 3HM6X 2DHZA 4HWDA 4WJOA 3ZRCA 2DYMA 2O6VB 2B3AA 4HCPB 1HX1B 1J0GA 3L54A 3A9JA 3LDQB 1ISNA 2CHXA 1GG3A 2LVPA 1ZKHA 3DOWA 5C23A 1YX6B 2BYVE 1WH3A 3KW5B 2M1MA 2ZVNA 4GIVA 3HHMA 4FJZA 2KJ6A 3NS8A 2KTRA 4MGYE 4RM8A 2L7RA 1WE7A 1UH6A 1WGHA 4FA6A 5JZEB 4DWFA 3IBEA 1MG8A 4GB9A 3AU4A 3AI5A 3VAWA 4ANVA 3MJWA 3PZDA 4TV3A 2Z0DB 4IC7B 2D11A 4IUMB 4NQKE 1Z2MA 3RD2A 4AJYB 3ZNZB 1UZXB 3NHEB 2FUHB 4TUUA 4MJSB 3RYTA 4W9KA 3ZVVA 1F9JA 1GNUA 2IZVB 3ZLZA 5EDSA 2K8HA 3M63B 1WM2A 2PJHA 3TCAA 5DPSA 1V6EA 5AQPB 1WZ0A 3ZNID 3PTFC 4LJPB 2M17A 3RT3B 1UD7A 3W1SA 2AWTA 1D3ZA 3QQ8B 1V81A 2MBQA 4PS3A 3S2AA 3V62A 4DK5A 4HWFA 4HJKA 4I6NB 4HLEA 1WGGA 2N7EA 2J0KA 1M62A 2LXAA 2M0XA 4WWNA 4KDIC 4F7ZA 1WE6A 3AU5A 4II3B 1ZW7A 4W9JA 3K9PB 3QWZB 4KVGB 4LCDE 3VH3B 5E6PA 2A4ZA 5JH5C 4MELA 4BKSA 3Q3FA 3H9DA 5DCNA 5DPTA 2KLCA 4EUTA 4RM9A 2O6VA 3H7SA 3QIJA 1NDDA 4G11A 4B95A 4K81A 5AZGA 2NBVB 2CHZA 2ZJDA 3LDZE 2XBBC 1E8XA 3RUIB 4FJVB 2LRUA 2MSED 2IY0B 3QARA 4ANWA 3BY4B 3PSEB 3ZRFA 3VFKA 4BFRA 4ZDVA 1M94A 2NR2A 5TR5A 1WF9A 4WJNA 4DBGA 5J18A 4B9KA 2KN5A 1E7UA 3VTUA 1EUVB 4BVUC 4DDGD 2ASQA 1YX5B 4A3PA 4JLCA 1UK5A 3T8MA 3KUDB 4HWHA 2EMTA 2CKHB 2MCNB 1VCBA 3HK0A 4NJ7A 2C9WB 4BBNF 3CSTA 4ZRKA 2KHWB 2ZEQA 1E7VA 2WYQA 3TJPA 3PHXB 4CHKA 2BWES 2IBIB 2KQSA 3EECA 1EO6A 2C7HA 2L0TA 4MJSA 1EF5A 1LFDA 2IO3B 2KJHB 4LJOB 3VDZA 2Z0EB 3WAPA 2KDEB 2C7MB 2CS4A 3PRPB 2BKRB 2DAJA 2LRWA 2LZ6A 4F8CB 2BYFA 3ONSA 3M95A 3O65B 3VQIA 5IAAC 2KNBA 1WIAA 3EC8A 3PPAA 5DPWA 1IYFA 1I35A 3JYUA 4EOYA 1P9DU 2KXJA 4JGHB 3ZKJC 4E71A 1PQSA 3DBHI 2WX0A 1C3TA 3TBLD 3ZO5B 1WGRA 4X57B 2LUEA 5GMVA 2NCNA 3FZHB 1OGWA 1T0YA 2M8SA 3RCZA 2N9EB 4F1SA 2FCSA 4W9HA 4EZLA 5LXHA 3L17A 3I3TB 1OTRB 2JF5A 3ECIA 4I6LB 3MTNB 5CHVC 1WMHB 5G2NA 2DZIA 1GJZA 3CF6E 2IO1B 2JVCA 4GMVA 1S1QB 5AQIB 2PE6B 5AQMB 1WR1A 4GU2A 5AZFA 3NZUA 3ALBA 5AQQB 2DYBA 1WXSA 2KKCA 3QC8B 4IWQA 2N1VA 4YL8A 3KUCB 1BT0A 2HE7A 1V49A 3DCGA 2NS5A 5D2MB 1I6ZA 2EMSA 3PLUA 2ZNVC 1WY8A 3PT2B 4II2B 1A5RA 2M4NA 1GC6A 2AL6A 1V9JA 3VTWA
chains in the Genus database with same CATH superfamily
3GMIA 1V8CA 5LJMA 3GB1A 3LXFA 1IP9A 4H9SE 4X1IE 2J0JA 2K48A 4W9GA 3ZUNA 1F52A 1K53A 3A33B 1JRPA 2CXFA 3P7IA 4FHJA 4S17A 4JI3T 2LGYA 2RA1A 2FJEA 5ETWA 2WP9A 1HEZE 4GDLB 1WI0A 5HKHA 1L2NA 5LG3A 2JSVX 3UINB 4WH4A 1VLBA 2LEKA 3X0WA 4B6WA 1LO5D 4JI6T 2N1WA 4OYKA 4DHJB 3RYHE 1LKXA 1FRRA 3OBVE 1SXTA 3DHIC 3UU5A 3GE3C 4TV8E 1TYGB 4PYUA 1OEYA 5EK4A 2J4GA 4Q2JA 1SA0E 1WRDB 2WX1A 4FLHA 2JPHA 4O4JE 3AAEB 2IC9A 2CJNA 3LK3B 1KF6A 1YQ4B 2IGHA 3AE5B 1VOMA 5H8YE 4HVBA 3ZNHB 4IREA 5D3DA 2PBIA 4K7SA 3PUWF 1R4NI 4ZRPA 1ZV4X 3Q8BA 4EZ4A 4XDDA 3ZDMC 2L8JA 3KH0A 3NJTA 5HWXA 1AYFA 3SHQA 4A97A 2QVAA 2JRHA 4AKLA 2W63A 3MA9A 4OZAA 3HVDA 4LLGM 2RR9A 1GUAB 3C4ZA 4LNFA 3RIUC 2INPE 1YD8G 3U4EG 2YK0A 3KLSX 2LT3A 3RULA 5FXXA 1WJ4A 3M62B 1V5OA 3HRDD 3I9YA 4DV6T 3UIPB 2UUAT 2A5UA 1JALA 2KWCA 3LYYA 1NENA 3ZMSB 4ZRIA 1H4RA 4QXCB 4H63H 3KYDD 3WA0A 3DJBA 2KMCA 2XM2A 5IKCM 4TKNA 4M8NA 3W1YA 4LNKA 5BMHA 3CPZA 4N59A 3UI3A 2JWZA 1W9RA 4X20E 2BS4B 2MOZA 1B1ZA 2PFVA 3FZMB 1FIOA 1KLGD 4HPMB 3FXDB 3R7QA 3AE9B 1VR9A 4I0UA 2L8KA 2JUOA 2KWUB 2BPSA 2KANA 3U78A 2KFKA 4G0NB 2K39A 1AWDA 5AQSB 1WXQA 2BT6A 1NAFA 3RC8A 2PLPA 1IZNB 3RHWA 2FJBA 3AE6A 5MPOA 2XQYA 3CWZB 2JZ3B 3HM3A 3IG3A 3H3MA 3UF8A 2ZVOA 2DCFA 4B0EA 4DV2T 4XE0A 4UELA 1WZ3A 1GB1A 4C80A 2NPTA 3K3QC 4IHJE 2V5DA 4NJCA 2BYEA 3RYCE 4CXWA 3R66C 2INNE 2NBUA 3Q14C 1CZPA 2WU2B 2LJ5A 2JRKA 4H9PC 2AYOB 2LRLA 3AA1B 4ILCA 4X65T 2LD9A 3H7PA 4JIOU 1WM3A 3RKOA 3DBLB 2KNDA 4AI6A 4HE8A 2W61A 1IJ5A 3ESLA 3IA3A 3I0OA 4HWIB 3RKGA 4YTNA 4HXDA 2PVGC 3Q8AA 5H6RB 1D0XA 3RQUA 2IAKA 4MGIE 5JHBA 2KZRA 3ML8A 4JWSC 3BQIA 2WDTB 1GB4A 5G5GA 2K8BA 2BW2A 4I6PA 3QX1A 1S94A 4KZCA 1TS5A 1YJIA 3UUXB 2HN1A 3LK2B 3AECA 1ZOYB 3RFZB 1DGJA 1FFVA 1WR6E 4JWUC 3TL5A 1LQBA 3BWUD 3OJAA 3PU8A 4U7IA 4AOFA 4EOZB 3O9XA 2E9XB 3IF8B 1ZDVA 3ZMUB 2MBEA 3Q5XA 2IJ0A 3CQXC 2BB5A 3AULA 1KLUD 5KXJA 5KDMC 4GLSC 2KO3A 4GN1A 3PRMB 5C1ZA 5GONE 1XCTL 2V7JA 5D7GA 1KK7A 5D3IB 4L2YA 4EAHA 2KT7A 3AE7B 4G3XB 2WXKA 2FCQA 4MH0E 1XDOA 1TTNA 4IDZA 4ERRA 2XQ3A 2LGDA 4Z8XA 1Z5SB 2AXDS 4UR9A 1X79A 4MFRA 5HEOA 1XXGA 3LSVA 2MA9B 4XYCA 4AQYT 2RPQA 2EHOA 4FJYA 4HDOA 4PS7A 3OYZA 5L95C 4NAWB 1I4HA 4HKZE 3ZTDA 3GOEA 1G73A 4EKUA 5LHIB 1TZ1A 1HZ5A 3TEYA 3RMKC 4JI1T 4YXDA 2L83A 4CN6A 5LB7B 1NBFC 3IBPA 4EIWA 5AQTB 3P42A 1XWMA 4FULA 1KJTA 5CTRC 3AE3A 3ZXVA 4EE2A 1UBIA 5KHQA 3VXWA 1C1YB 4ANXA 3OJ3A 4C56C 4PNIA 4BOSC 2BG9E 3AXCA 2CWOA 2HPJA 5LHGB 3OTOT 2BS3A 4MSQB 3VRBB 2XNAC 1SJED 1H8CA 5AQVB 2XM1A 3SFDB 4N78D 3N1YC 4E7SA 2JRIB 3ZQ4A 4DQOC 1MNEA 2XZEA 3VHLA 2WXIA 2N9PC 3Q5DA 2ZMAA 3OG5A 4MEMA 4JBWF 2IDOB 4CI2B 1MHXA 3WALA 3UFGA 2K8CA 1F1HA 2LE8A 2KWIB 2WXLA 3Q8EA 3SDLC 3ANWA 3K8PC 3VHTC 5L83A 1E7PA 2CBJA 3P4PB 3Q3NC 1V80A 3QK0A 3B0AA 1YD8U 2LGSA 5CGMA 3DVGX 3FAHA 5KHOA 5IN7A 1HG5A 3UFEA 1L6VA 3A4RA 4JYAT 4QAYA 1FEHA 2KWVB 2WNMA 3RNFC 1WFDA 3NZSA 5LGUB 2Y3AA 2ZM2A 2IO0B 4DHJD 1FPYA 1JNZA 2I38A 2B1EA 5J1GA 1SE3A 3AA6B 3UQ7A 4JX1C 3ZKRA 4MGKE 3B5MA 2OLTA 3TLWA 2KTRB 3HI2A 4G63A 1FM0D 2Q9QC 3ML9A 3L0WB 3P2BA 2CR5A 2RSUA 1KLVA 4ZHPA 3UIOB 1LVFA 3ENEA 4B3TT 1SHZC 1P7FA 2G9HD 1YQBA 4YWGG 3LFMA 5ADXL 1WLXA 4H2AA 2FUPA 3HKCE 5C2TA 1KTKA 4KX6A 3RZFA 2XHEB 4IG7B 2WXPA 2V6YB 4EYYR 3QCAA 4YFSA 2KFJA 1IBMT 5FMNA 2MRPA 2WXJA 1JWBD 4US8A 3TEZA 2OHFA 1WJ6A 3B2FA 3AAIA 2Q9QD 3P4QA 1N5WA 2MEKA 1UUPA 4DV5T 2V1YA 3N2KE 1HCIA 3QJZA 3AEGA 1ZPSA 1UGOA 2LVQA 4MHCA 1WJNA 1BXTA 3AE8A 3ZNGC 3APCA 3H1UA 3UUMA 1BMLC 2LSIA 4ZEYA 3IXSA 5AZHA 2IHR1 2Z6EA 3HM6X 3P4SB 3EA6A 5IOIA 4B3RT 1ET9A 2W4XA 1HX1B 1GAQB 1KRHA 2B3AA 2YEPF 1J7AA 3A9JA 1E7PB 1FMAD 1FXAA 1IAPA 2BYVE 3KW5B 5FKAC 3GN5A 2ZVNA 2CCQA 4MGYE 4RM8A 2W55A 5LGTB 1UH6A 3PUYF 4HFCA 5GXGB 3UU3A 4DWFA 3N9MA 1MPEA 4Z90A 3AU4A 3PZDA 5IWAT 3QB5K 4MT5A 3RD2A 1Y01A 1OQRA 3F57A 1T72A 2WXGA 2K24A 3ZNZB 4BZAA 3C19A 3NHEB 2YDSA 3W5UB 4DV1T 4C00A 4W9KA 3GWHA 2VK9A 2IZVB 1TY2A 3ZMVB 2V9HA 1ZEEA 1MIYA 1X9BA 4OX9T 2D5UA 1YKEB 2XQ4A 1DYQA 1JCKB 4ASKA 1KNZA 2CJOA 3FKYA 4LJPB 4YTPB 3RT3B 2IGGA 3QQ8B 2MBQA 4DK5A 2XAJB 3UT5E 4NXMT 4HLEA 2J0KA 1M62A 3PUGA 1VZ7A 3AU5A 3HL6A 4F8HA 3VRAA 4ZI2D 3K9PB 3NVOA 4KVGB 2K9XA 5JH5C 1J1JA 2WQYA 2UU9T 3UQ4A 2O6VA 4QWNB 2NOXA 1U5PA 1FMWA 3RI7C 2RP4A 1E8XA 2MSED 2PMVA 4K0UA 3QARA 3ZRFA 4ZDVA 1TKEA 5TR5A 5F5WA 2DHRA 2CXLA 5J18A 2KN5A 1E7UA 3PUVF 4DDGD 1D4BA 3N9QA 2K3WA 4YLHA 3TLSA 1YX5B 2ASQA 3EDUA 1ZXIA 4JLCA 4ISTA 4A3PA 2CKHB 1HA5A 3C98B 3NZPA 2ODVA 4UEMA 3R6NA 5HHDG 2WY2A 4WW0A 2WYQA 3PHXB 4IDNA 3RNGC 4MJSA 3ZGZA 2N1GA 4GOUA 1EF5A 2IO3B 4A6QA 3HUIA 1OEDE 1LVKA 2BKRB 2LZ6A 2V3NA 3ONSA 2WS3A 3M95A 3VQIA 1EWCA 3LG7A 2KNBA 1WIAA 3EC8A 1ZUD2 1J5ET 3P4RA 1IYFA 3AEDB 4EV6A 3L39A 1P9DU 1IGCA 1TKYA 4JGHB 4PFPA 4E71A 3W2DA 1OFFA 3AEAB 1EZ3A 2BS2A 4X62T 2KXPB 4L5GA 1WGRA 4X57B 2LUEA 3FZHB 3MJXA 1OGWA 2M8SA 4EZLA 2FCSA 4W9HA 4JI2T 3L17A 1MMGA 2JF5A 3C8YA 3ECIA 4I6LB 5CHVC 1WMHB 3CF6E 2WZHA 5FL1A 2JVCA 2LUMA 2E5LT 1UX5A 3I1AA 2BVLA 4JI7T 2PE6B 3EAMA 5JDMA 1XLQA 4HFDA 3QC8B 3P1MA 4YL8A 2IMLA 3KUCB 2HE7A 1ZXHA 2JXTA 1SSNA 2G1EA 2EMSA 3EHZA 3BVZA 3PV0F 5HXEA 1WY8A 4C7ZA 1A5RA 1GC6A 2AL6A 3ZYMA 2SEBD 5BYQA 5LGNB 1SGHA 2QHOA 5I4DA 4NUVA 4O8SA 3PUZF 5LG4A 3UUNA 3JVZX 5ABEA 2QRXA 2KSRA 4YY3T 2VZKD 3TMPB 3EVYA 2ZPYA 1NEKA 2EHOC 2DX5B 2V7LA 3NRYA 5L2LA 3LK42 4R3DA 4EZKA 5F8PA 4OFZA 2VB6A 4DO0A 2XAHB 4LTUA 1G8XA 2HN2A 4U33A 2Y6XA 2D3CA 2GLSA 3L16A 1HFAA 3ZJTA 2GOWA 4KSKC 2QDFA 4PK6A 2G4SA 1J5WA 3JAEA 3AXJB 2C7NB 5FVLA 5D6JB 1WGDA 3KVAA 1CUNA 2LHNA 4TUYE 2EHOD 3Q8FA 4RNAA 4DV7T 3W5VB 4WNKA 4HFHA 2DZMA 1E9MA 2XAFB 2H89B 3OJ4B 1W0BA 4MSMB 2IC6A 4P09A 4AKIA 2UUCT 3V05A 3ZXRA 1E5WA 2DENB 3NVWA 2MTQA 5EE9A 1V2YA 1TS3A 4M8MA 3P50A 5J2TE 2JXXA 2WXRA 4YSZB 2N2NA 3R7RA 2DWQA 4JQWC 2K5BB 3CX7B 3Q5EA 4NUUA 3ZIMA 2IYDB 1FD6A 2N9LA 2XK5B 2AEHA 2I59A 2ES0A 1FEWA 2WHIA 2CBIA 2UWQA 3FILA 1GOZA 4W9EA 5L4HA 1N32T 2FNJB 1Q0WB 4KKIA 4ANJA 4GDLA 3AE4B 3I57A 4U3CA 1RWSA 4OW0A 3KWLA 1JROA 3H6NA 1I94T 2AQ1B 4AKGA 2VH1A 4AP4C 5JDHA 4PK1A 4LMJA 4DMVA 4WURA 1R4MB 2X51A 1MI0A 4ILBA 1WRDA 3AAAB 3AE5A 1YQ4A 2YVCA 1QLBB 2E3TA 4TV9E 2ZNVB 3R3MA 3ETVA 4IE4A 4RGMA 1HXYD 3SFEB 5LBQB 3MC8A 3N3KB 4GK5E 5JVDE 2G3QB 2K0PA 4O4HE 4A9AA 5BMGA 3CMMB 2KINB 1NVID 3VH4B 4AKRB 2WXNA 1SIJA 2OV9A 2LSJA 1XZYA 3KQ4A 3OLMD 4JI0T 2K5PA 4HROA 4KGSA 3V6EB 4AUQC 2BBCA 4LF5T 5LNK1 2QYWA 2GI9A 2Q5WD 3JSVB 4B0MA 4OVZA 1DU2A 2MJDA 4JL9A 3F2EA 2LM2A 4CO7A 4H63V 1LGRA 2CLYB 4UV8B 2WBLA 3K1SA 3E9SA 2X0LB 3FZKB 4KI0F 1XO3A 1H7CA 2BS4A 2WDQB 5FXZA 2QSDA 5CHFA 2Y5PA 2YU1A 1S35A 3TKLB 2MJEA 4HN9A 4M0WB 5L3DB 4UV9B 1WXMA 2KDIA 5AQJB 1PGXA 3AE9A 4HFBA 4O1NA 4PS8A 2CM0A 2W2UA 4AWJA 3FILB 1BUIC 4W9LA 2C60A 1MMAA 2NBWB 3BVGA 4URKA 2M19A 5HI1A 3N9LA 4CN1A 3I9V1 4L9IA 2D2QA 5M4YA 2HTHA 3NWIA 2D0UA 2LOSA 2BVCA 2LSYA 3KVFB 2CHOA 4KZ0A 2VVSA 2J1DG 2H88B 4K1RB 3DPDA 4DR4T 4LNNA 2LI5A 4HFEA 1ENFA 4OZBA 3MKDA 3AM9A 4IKGA 3KYCD 4C4VB 4P1NA 4QH4A 4A98A 2WU2A 2Z59B 3UU8A 2N9XA 3GS2A 4GXBA 3ZYYX 4EEWA 4ZYSA 2IGDA 3FZLB 4ISSA 2DZKA 2KTFA 2LKHA 5JHAA 3Q3JA 3PUAA 2KMMA 3T9LA 3UULA 2B76B 4AQ7A 3B9JA 4J3OD 3WAMA 2IO2B 1NYRA 2V4LA 4GOCA 5CJ5A 5J17A 4HPPA 3FZFB 4MLKA 2J7QB 1KFYB 3VKGA 3M3JA 1D1AA 4KDLB 5L3BB 2LJIA 2BYTA 1P7EA 4FADA 3CQGB 2C5IT 4E7ZA 2J0MA 2JMKA 3RYIE 5HCMA 1Y8RC 1NI2A 1ZOYA 1ACCA 2M0AA 4KV2A 4ZYNA 4E74A 5ABHA 4KHZF 3RH3A 4UVAB 4W9CA 4US9A 4ICVA 1E8WA 2L3LA 3C4WA 3T1YT 2KDMA 3UQAA 1W09A 2E9XA 4H9RC 4UF0B 4QX8B 1CMXB 1XT9B 2NTSA 1NWMX 4OZCA 1KEYA 1HZ6A 3GP7A 2WSSV 2JU6X 1JRUA 2RPVA 3DBLI 1QSDA 3QAQA 2CU3A 3PUXF 2LVOA 3AE7A 2K22A 3OKQA 2J53A 4MALA 2D3GA 3IVFA 4YTMB 4WWPA 1T0QC 3K3OA 2D2SA 3F31A 2UU7A 4XGAB 4HDQA 5LXTE 2X0YA 2WU5B 1YJ1A 2O6VD 3LBXB 2KK8A 3PDYA 1HNXT 4LDTB 5LMUT 4RGNA 4NAWA 4ZHOA 3S4UA 5BMVE 4CQIA 1BR4A 2LGXA 3EUHA 4LFAT 2ZCCA 4OVVA 3LB8C 4EXTA 1CQVA 1TT5B 5DPRA 1QOGA 2CPTA 4OVUA 4NPPA 3VKHA 3KBTA 1STEA 2QILA 4HWCA 3VR9B 3NVVA 3ZSSA 3EUB2 1GC7A 3QUJA 4HRSA 3UU6A 4EZHA 4BJNA 4F6RC 5LP6E 2KOXA 3TIXA 1D1CA 5J0ZA 3VRBA 2LMCA 1VCSA 2XSBA 1XCQL 1Q1OA 1YN3A 3SFDA 1YQ3B 3NRZA 3WIMA 3BINA 4D2KA 1ET6A 5FP3A 3PRZA 3U7ZA 3CIRB 4NY0A 3SOLA 1V86A 3I5JC 4LFCT 3J9CA 3SS1A 4ZZBA 4TQ0A 2XAQB 2X9XA 4GKKT 4MBQA 5FK9C 1SBBB 2QEJC 1B9RA 1ZKEA 3NKZA 2HTME 5E0OA 2MBBB 1XLNA 1YW0A 3X23A 1L7YA 3P4PA 2WAUA 2PW9A 3RN9C 2KLGA 5HEJA 2A72A 5AQHB 2ZPNA 1U4AA 2QIEB 4A3OA 2JQKA 1E8YA 2ZZPB 3ZDTA 1J19A 4MH8A 3WCQA 3P4WA 4HWDA 2DYMA 3LDQB 1GG3A 1VCTA 5C23A 2CXDA 2BKOA 4EEBA 3HKDE 2M1MA 3HHMA 2TSSA 3NS8A 2KTRA 2L7RA 4FA6A 2NW7A 4M1PA 5JZEB 3NZQA 4I4TE 4P0BA 3I9WA 4ANVA 4YSXB 2D11A 1XNRT 1Z2MA 2LSKA 5HYAA 2INDC 4FJOA 2CEAA 2WWUA 5EK3A 2FUHB 2W66A 1PFDA 2INCC 3ZVVA 2V6YA 5KMGP 1V97A 4IGUA 5JR9B 1F2RI 4NXNT 3M63B 1WM2A 3TCAA 1MMNA 1V6EA 5F3JA 1WZ0A 4XWTA 3ZNID 3W1SA 1UD7A 2AWTA 4PS3A 2XPKA 1ZP0B 4U2ZA 4I6NB 3RF1A 2N7EA 2ZM6T 4G2AA 3RNCC 2LXAA 1HNZT 1PUTA 1WSPA 3DBRB 4KDIC 2UXDT 2A3DA 4II3B 1ZW7A 1MMDA 3TEXA 4LCDE 4IDIA 2XQ9A 2A4ZA 1SF0A 3Q3FA 1DOYA 1JW9D 3P4SA 5HCJA 4EUTA 4EGWA 4RM9A 3H7SA 1NDDA 4K81A 4OHFA 4CXYA 2CHZA 2ZJDA 2BKNA 3LDZE 5AUKA 1PGBA 4ARIA 3IHRA 4FJVB 2BVMA 2LRUA 4ANWA 3PSEB 1FNVA 5L3FB 2JX5A 4DBGA 1L4DB 3I63C 1D5MC 3H8HA 1UK5A 1DOIA 3T8MA 3L09A 4PK4A 1VCBA 4NJ7A 2JQHA 4HFVA 4ZI3D 3CSTA 2G0UA 3TJPA 4DVDA 4CHKA 4X1YE 4ILAA 2BWES 3EECA 2C7HA 3J7Yq 2L0TA 1LFDA 3VDZA 4JI5T 5BR8T 2Z0EB 4X66T 2CS4A 2WXHA 2BZBA 3NBXX 4UDUC 2AQ2B 3N9NA 4YTPA 3FHNA 2KWDA 3PPAA 1XDPA 3V3XA 4DR2T 1I35A 4TSSA 3Q2MA 1FNWA 3AB5A 2DI4A 4CN4A 3QNUA 2NR4A 4A8XC 4C91A 2XASB 4GKJT 3AE2B 2NCNA 4L23A 2WMOA 4F1SA 2N9EB 4LF4T 4TNVA 3I3TB 1OTRB 3HKEE 5CFBA 4BA9A 3Q8CA 3MTNB 5LJNA 1UWXA 1C4PA 1I4XA 1EWYC 5AQIB 4RF1A 4NZLB 3NZ3A 3NZUA 3VR8B 5AQQB 5IP4D 1WXSA 2FJDA 1K52A 2AQ3B 2VWAA 1V49A 3DCGA 5FL0A 3PLUA 5FXVA 3H3AA 5EE1A 4DV3T 3LJCA 5LA6E 1SIFA 3RC3A 4KP3C 1FJGT 4DHZE 2GBMA 5HEHA 3NY5A 4IW0A 1WJUA 1U4QA 1ROEA 2CMRA 2W54A 3N9YC 2N4FA 4IDPA 1LM8B 3ZCIA 1TBEA 3AEFB 3O1JA 3SD5A 2ODUA 3Q9DA 2PG8A 4JV5T 2HDEA 2KVRA 3I0QA 2C0SA 3ZJVA 1KOTA 4U2YA 3IHPC 2RPAA 5L3CB 1D0ZA 1D1BA 5AQLB 3N2OA 1M7KA 2XQAA 4KBMB 2V8SV 1LRZA 2X0HA 3KINB 1HF8A 3AEDA 3P8CD 2DWKA 2ON8A 1OQQA 1TIFA 4DNDA 4ZI2C 2D0TA 4ZOHC 3AEAA 4AQGA 1WXAA 3RLFF 1VRBA 4ICUA 1EM7A 1QT9A 3ZLIA 4CQNA 3V60A 4LF9T 1E90A 3O4XE 1AJ3A 2BKFA 5HXHA 5D94A 2KDFB 2MWSB 4MACA 1WMHA 4WBNE 2KACA 2E9XC 4FBJB 2WXOA 1BR2A 5FR3A 2LKGA 2K1FA 4KIKB 1D5XC 2YU2A 3HKBE 4IE5A 2E2AA 1WXVA 2LOPA 2XSAA 1QOBA 1KM7A 4BBNC 2KT9A 3SWHA 2K3UA 2RD0A 3FXEB 1NI3A 3R84B 1UGMA 2XTLA 1C78A 3RRCA 3PGEA 2V7IA 1IUEA 2KX0A 1RM6C 3NVZA 2H3RA 4DV4T 4LFBT 2D07B 3RPFC 3ONXA 2KWHA 2E9XD 2HD5B 3ETUA 4NNJB 1TZOA 3JC6C 3PUQA 2IUBA 4N9F4 3MK7C 1T7SA 5FY7A 4EB6E 2O2VB 3DVNU 3AB3B 2NTXA 2R2QA 3DWMA 5JRCB 4NQLB 1J8CA 4BKSD 2CE7A 4DV0T 1E1HB 3E56A 5AQKB 5LNKA 1RRBA 3AVRA 4O2AE 3AXJA 2KC2A 1WX9A 2MYSA 4W9DA 4GGQA 3DHHC 1HX8A 1L6UA 3C0RB 3RGLA 4AS1A 4I43B 1K51A 2GMIC 3C51A 2VURA 4TMAB 3H37A 1WWTA 3GZNB 3UGBB 3JC6D 4PJLA 4GSWA 1UURA 4TWHA 2MBHA 2HHHT 1ZDXA 2H89A 2WDRB 1YN5A 3B2GA 5LCYA 4GYSA 2M67A 5KX5E 2JQQA 2VQET 2N7DA 1V5TA 3SEBA 2WWVA 4NPNA 4DR6T 2E5VA 4HFIA 2D9DA 4EEDA 4YSZA 5L4EA 2LHRA 1E8ZA 1OWAA 3CQCB 2M6IA 2WLBA 2CU1A 2YINA 3U2SC 5G55A 2XK5A 4S0RA 1C76A 5IO9A 2LXCA 4WWOA 4FHKA 4I55E 5LBMA 2E6XA 4AISA 3PLVA 2NTYA 4WZXA 4DDID 3KUZA 1C77A 4JUYA 4DXFA 3AE4A 5JDGA 2XEWA 3DVGY 3DQVA 1F0ZA 4EZJA 4WYVA 4B3MT 1F2RC 2J47A 4O4IE 3G06A 1WYWB 4TN7B 1Q5WB 3N2GE 3OYXA 1UBQA 4IL9A 3QOFA 4DR5T 1MG4A 3A4SC 2ZW0A 3D32A 5JTGA 2KJRA 3AEEB 2DZJA 1CJEA 1UUSA 3CWIA 4IE6A 2EKIA 4KHPT 1QLBA 4PYZA 4MGZE 2WM9A 2FIFA 1QILA 3SFEA 2MBOA 2YDQA 3K9OB 4IWOA 4U7YA 2DNFA 2JT4B 3BQKA 3HVZA 2BG9B 2SAKA 1KNRA 4ILUA 4P1BC 3L4PA 1DOXA 2G4DB 3KV9A 5ABFB 2J42A 2ACZB 3RPUA 2X8XX 3A1QB 2I2YA 1Z0PA 2KDBA 1I4PA 5LXIB 4YT0B 3JSVA 3W1SC 1WX7A 2FCNA 5EE3A 1T5XD 3IFWB 2MQJA 2YKSA 1R4MI 5AQOB 3EFUA 2JMHA 3AA0B 4IDQA 4DBRA 2CHWA 3VU7H 1I4RA 3V6CB 4FXCA 2BGFA 2YDRA 2VQFT 1I42A 1A70A 5H92C 2PE9A 2WDQA 4HEA1 5CX3A 1XLPA 4MDKE 3Q6BA 2A2FX 4M0WA 4IM2A 2BQQA 2XN9C 1MVKA 4ADZA 1P98A 2KMAA 1VRAB 2DLRA 2V1DB 3A9KB 2LASA 3HA4A 2YEPB 4YSYB 3CX6B 4DMWA 3JADA 5IA7A 1HTJF 1N6ZA 2JIWA 3VTVA 2MP2B 4IOIE 2H88A 1WYCA 4OHJA 2Z8LA 2H7VC 4U74A 4RF0A 3CVRA 4N58A 3L08A 3WANA 2KMFA 3VUXA 1MNDA 1UNSA 3R8BA 2L76A 2WCAA 4K7UA 2OOBB 4C4VA 2BF8B 4AKHA 1F77A 1VZ6A 2DYOA 2XAGB 5FKYA 3DHGC 2W67A 1WRIA 2X9HA 1AN8A 1WFYA 1EU4A 2CWYA 1BR0A 2B76A 2N7JA 2KYWA 4ZI7E 2KQ4X 3TSSA 1N33T 3DWGC 4ZXLA 1YMHE 1T98A 1SE2A 2L0FA 5E6OA 3QB5A 4ZHQE 4MM3A 1KFYA 1QOFA 3MJ5A 4CI1B 4BAYB 3JAFA 4YJ2E 3WI3A 2RDHA 1D6EC 3M65A 2DL1A 4FN2A 4JPSA 1N62A 4DHZB 1EU3A 3M3ZB 2LRKA 4UF0A 3A8YC 4DXAB 2W62A 4W9IA 3RNBC 1K50A 1QF6A 4H9OC 4IDOA 2W82A 4ZZCA 4DR1T 5JDLA 2X9YA 4WAAA 2JJ9A 5DABA 4YTMA 5C3JB 3CMLA 4B6XA 2J4XA 2JYEA 3B13A 2WU5A 3FB2A 3LBXA 1OQYA 2R6GF 3SU8X 3PO0A 3EI0A 4XZCA 5BYSA 3RNEC 1V1OA 1WGKA 4XWWA 2JY6A 2VRRB 5G5HA 2FCMA 1IBXA 3GE8C 3AEBB 2FIDA 2RDGA 4HPLB 4PAGA 3L10B 5LLIA 3BVMA 3QHTA 2KC1A 2DHZA 3C64A 3ZMTB 4HCPB 2MJ3A 2A9UA 1E0ZA 4LF7T 1WYBA 1ISNA 2CHXA 2JYTA 2LVPA 1ZKHA 3SRZA 3DOWA 3MP9A 3IT4B 2QJLA 1UCUA 1WH3A 5HXSA 5EK2A 3BYYB 3DBHB 2KJ6A 4O4LE 3VR9A 4U72A 1JWMD 3BK2A 1I4GA 4X5TA 4Z91A 3FBLA 3ETRA 1IBKT 4GB9A 3AI5A 3AE1B 2OA5A 1YN4A 4O2BE 4IUMB 5ABGA 3KWVA 4NQKE 3AH7A 2LEHA 1UZXB 1YQ3A 1N61A 4H9NC 4MM3B 5FYMA 4AXPA 3CIRA 2VKJA 1FFUA 1F9JA 4L0RA 1GNUA 4RFBA 3ZLZA 5AFUL 5FXWA 4JEHB 5DQWA 2WDVB 3K3NA 4M02A 2BB6A 3B57A 3N1XC 3AA7B 5DPSA 5AQPB 4WIPA 1WCRA 3PTFC 1D3ZA 5CA1E 2M17A 5CB4E 1V81A 2NTTA 3V62A 2Y8DA 3ZC1A 3P63A 2HH7A 5L3EB 4QH5A 1WGGA 5HEGA 3BK1A 1R7SA 2DWGA 4WWNA 1JQ4A 1WE6A 4W9JA 4IL4A 3QWZB 3VH3B 5T8IA 4MELA 1OEDB 5JXVA 4BKSA 2VKOA 4H9QC 2WXFA 1V1PB 3N20C 4ITKA 2Q9QB 3MC0B 2MPKA 2L9QA 4G11A 5LOVE 2BG9C 1C79A 1L5PA 2XBBC 4ARCA 3RUIB 2UXXB 4LF8T 1E2AA 2FBWB 4KGTA 1FO4A 5J2UE 4C7YA 4BFRA 2CHNA 2KVZA 2JZPA 4LNOA 2UXCT 1IBXB 1EUVB 2QCZA 1RFKA 3KUDB 1R4NB 3RI5A 3DTOA 1C9FA 4YSXA 3TEWA 2C9WB 2OEDA 1OXZA 2ZEQA 1E7VA 2IBIB 2KQSA 1ZHCA 3E08A 3MACA 4UXNB 2WP9B 1I4QA 3WAPA 5JR9A 2KDEB 2C7MB 3PRPB 1C4AA 2LRWA 1JWAD 5D2MB 1MHHE 3EABA 4IIJE 1HNWT 2W3SA 2V26A 3JYUA 4HKQA 2D3AA 2KXJA 2VVNA 4GK0E 3C50A 4V1Av 1ZP0A 1YNTE 1SE4A 1Z8UA 3QK6A 2XJ7A 1KF6B 3ZO5B 3HR0A 5HEUA 4FI5A 4QHOA 4A5XA 4DR3T 2AX5A 1UX4A 2DZIA 4ACFA 1GJZA 4PJJA 1D5ZC 2IO1B 4GMVA 4P6VF 5AQMB 4GU2A 2DYBA 2KKCA 4IWQA 2N1VA 2MBGA 2BTEA 1BT0A 3ZYLA 3AMZA 2QGSA 1XMQT 4AIUA 5FNVE 1JWUD 1IJ6A 2IDYA 2L52A 2ZNVC 1NENB 5IHYA 3UU4A 4II2B 2CRBA 4TWDA 2XY8B 1MIVA 4AJWA 2BBHA 5HAXA 1P0RA 2LHDA 4AQFA 3O1HA 1D0YA 2V0GA 2VKDA 3TLTA 5AUIA 2YN6A 2IPKD 2AE9A 1ESFA 3DBRI 2QC8A 1M4VA 4J2CA 3ZN0B 4UIGA 1P1AA 1CHUA 2BBJA 3IAS1 2PPHA 3Q69A 1HQRD 5H6QB 3MHZA 4OK0A 3WAJA 5L47A 1T0SC 3KDSE 1X1MA 3FBZA 4WJQA 1W0AA 3MFGA 3PHWB 3PZ7A 2NW8A 2CLYC 5DQVA 5TAOA 4YHHT 2LGIA 2MX2A 2KFKB 4ANUA 1YKHB 3ZSTA 5AEKB 3AE6B 3AE2A 2GBJA 2N0SB 5A1LA 2VH2A 2JZZA 2X68A 1QOAA 4KUMB 2PTFA 1S3SG 2DLBA 1EF1A 3NUHB 3SR6A 4COFA 3N32A 3QC9A 2DAFA 4REZA 2KQ7A 2NPTB 4JI8T 1RLFA 4A55A 4X1KE 2ICIA 3VR8A 1RAXA 2PIAA 3ABVA 3RYFE 3WAKA 4DR7T 1AARA 1L4ZB 2GBNA 3R2IA 3TUOA 1IPGA 3ZYKA 2ZW1A 4KGRA 1HTQA 1SE9A 3N9PA 3H7PB 2I0MA 2M6BA 4ZI3C 1HE8A 1E6EB 4RGTA 1V9DA 3NG0A 3ONJA 5EE0A 4W9FA 2OJWA 4DBQA 1VJKA 3L13A 4YTNB 4HKAA 4XBFB 1N34T 2V7MA 1XLOA 4K7WA 1L0XB 3QA8A 2REXA 1TGZB 3KV4A 4IWPA 3AEFA 4CI3B 5IUXA 3NS1A 2FUG1 2D10A 3E22E 5HG2A 5AQFB 2LJLA 2LM9A 4ZOLE 1QZEA 3X1DA 1P3QU 4E3CA 3HIZA 4J6IA 4XX5A 3AECB 1YJJA 3CX8B 1ZGUB 3UQBA 2VZKB 1G6JA 1PDXA 4WQMA 1UGJA 4HK2A 2E8IA 4IM0A 3ZJ2A 4CZZB 3T1HT 4XDCA 3DDCB 2L05A 2XUEA 4WAFA 4P0AA 3FC4A 2L3ZA 4KKJA 4IT4A 2ZCBA 3O1IA 2CA5A 2JQRB 2RDBC 2JQ9A 3VUWA 3PS6A 3BZDB 1WGYA 3RQWA 4ZRJA 5E6JA 4YJ3E 3BYTB 4GDKA 5JDQA 2BDEA 3EDVA 1UWMA 2K6QA 5AQGB 3UTKA 2D3BA 3ZCJA 2LLYA 4M01A 4IM3A 3ZTCA 2N9KA 1HS7A 3OAWA 3PURA 4TNWA 4X64T 1PGAA 2QMTA 3APDA 4KIKA 3VVWB 2KLQA 2HPLA 2V4IB 4TZ4C 5HWYA 2EHOB 1L0VA 3KFWX 5BYRA 2BKPA 1OEDC 1FCLA 2V7KA 1MIWA 2FAZA 3D0TA 5FY1A 1UELA 4XZ4A 2YEVC 4USAA 2K25A 4YXDB 3JCFA 3LJ3A 3ABVB 3ZW3A 2XQ7A 2K6DB 4HGAA 2D5GA 4ZS2A 2FJAA 4BOZB 1Y64B 3BIID 2H7OA 1UF0A 3AE3B 2O2VA 2NVUI 1T8BA 5JRCA 2Y5CA 2G45B 3PV1A 1RYJA 4U31A 2L32A 3U30A 2Y5BB 3BK9A 2BS3B 1FXTB 4A56A 2R2OA 5LMNT 5HXRA 3VUYA 3APFA 2F4VT 2X38A 3DBSA 4P1CC 3IEEA 5FR6A 5C8YE 4LDTD 5L3GB 2RMMA 1VZ8A 2R61A 3ZJ1A 2W9NA 2YLMA 4TQ1A 2NMQA 4TWFA 4HEAA 1SUMB 2WDRA 1VDVA 1WR6A 5JQGE 3ZJUA 3ANWB 1N63A 4DUYT 4WWMA 3RZWC 5BMIA 2SPCA 1PYWD 1XEEA 4LMKA 2HJ8A 4NJ6A 3U7DA 2IW5B 2YOEA 1WR0A 4UVCB 5HXCA 4GDKB 1MJDA 3ZN1B 1T3QA 4PJMA 3CSFA 5AQRB 2VASA 4LF6T 3U3IA 3PVLA 5J2RA 3PJAJ 2GBRA 2FE8A 2V3SA 2MAWA 3A5XA 3N5LA 3L3PA 1BR1A 1AW7A 3KBUA 2I1JA 4LNIA 1L0VB 1TJEA 1T0RC 3T3NA 1CK1A 3URYA 3CKDA 3GZNI 1QUUA 3ONLC 5BO4B 3A7MA 1LXDA 4LK0M 3N9OA 3ZC0A 4P7IA 2C5KT 1Q10A 4HCNB 3WAOA 4JE3B 4ASWC 3OPCA 3RIAA 4K3CA 4WJPA 4PK5A 4RMAA 1N36T 1R8IA 3AEEA 5C2TB 4KX6B 4LMLA 3RIUA 1KH0A 4WQOB 4QKNA 3B08A 1FRDA 3U8ZA 3OWEB 3AN1A 2IY1B 2UYZB 4HJGE 1XF5L 1Y56A 3DP7A 2WWZA 5JREA 2L00B 5FVKA 2KX3A 4P16A 3EGRA 2LSGA 4XAXB 2OJRA 2KN4A 2WXMA 1WX8A 3L8RA 2EKEC 3P4QB 3KV6A 2BG9A 3PREA 3ZT6A 2MLBA 4CYEA 2XQ8A 3PU3A 4GYRA 4L1BA 1IGDA 5JDFA 2PEAA 2MHJA 3AEGB 3Q3MC 5ABFA 5IYZE 4EYUA 5JR9C 2ACZA 1L0YB 3A1QA 2KD0A 5CA0E 5E6NA 3DVNV 2M56B 3AE8B 5AQUB 2LHEA 4YT0A 3ZT7A 3B1LX 2I1KA 3EHVA 5CHWA 2I6HA 1RFAA 2ONQA 4RGOS 3ZEFB 2J52A 4C90A 4A90A 5LYJE 1JNRA 3AVSA 3A9JB 3AV8A 4PFOA 3N1ZC 4BKGA 3KVBA 3GN5B 1TY0A 1N5XA 1J7CA 2MW5A 1XD3B 4QXBB 1K8RB 3W9CB 1YIWA 2BWFA 3V61A 3PZ8A 1XQQA 2V6XA 2NWBA 4PT5A 3JW0X 2QA7A 5AQNB 4BJMA 1QQRA 3N30A 2GK9A 2EELA 4JI4T 3A9KA 3NVYA 3BQLA 1FXIA 4IE0A 1HG2A 4YSYA 1T6BX 4A20A 3MZKB 4NAMA 2VKHA 4CXXA 1VD2A 2C5LC 2MP2A 3V5SA 4AQFC 2X9WA 1TKGA 2LFIA 2LWPA 4KSLC 3MHSD 2N9DA 2PJQA 3Q3OC 3GA8A 1KNPA 3NOBA 1OEYJ 4G50A 3T3OA 2W00A 4EFOA 4XC2A 3VRAB 3KV5A 1NYQA 2K9AA 2ACXA 1TS4A 2NW9A 2AL3A 2GBKA 3ZMZB 4BKTA 4DIDB 2PTLA 2WQYB 3O13A 2RGFA 2X66A 4WJOA 1J7BA 3ZRCA 4PW8A 2O6VB 1XMOT 1J0GA 3L54A 3RX6A 3Q5WA 2UXNB 2NP9A 4HTEA 3OVUA 1YX6B 4IE7A 2XQ5A 4GIVA 1O3XA 3RRWA 1IBLT 5DJQC 2ZM0A 4FJZA 1WE7A 1WGHA 3PE0A 2UUBT 3IBEA 1GQEA 1SB3C 1MG8A 2J62A 3VAWA 3MJWA 2ZM8A 4TV3A 1N60A 2Z0DB 4IC7B 3ZPOA 3U52E 2WZIA 3Q2AC 1YOVB 4AJYB 1HR0T 2XQ6A 4GIWA 4TUUA 1MFWA 1JWSD 4MJSB 3RYTA 1QKZA 5EDSA 3TLUA 2K8HA 2JPFA 3C4XA 2PJHA 5HFYA 4JLEA 2WS3B 4QH1A 3EFCA 5C3JA 3E0ZA 3MXZA 3P4RB 3S2AA 4HWFA 4HJKA 1SEBD 2Y48B 2M0XA 4ZS3A 2PKOA 2P9BA 2BS2B 4F7ZA 1FIQA 5LHHB 4DXGA 2W3RA 4RCOA 2DBYA 1SE7A 5E6PA 3PJAA 3AEBA 3H9DA 5DCNA 5DPTA 4M00A 2KLCA 4WBOA 3IT6B 3QIJA 1E10A 4B95A 5AZGA 2DNXA 2NBVB 3IAM1 2GB1A 2V5CA 2W0GA 2WXQA 3NRXA 4DUZT 2IY0B 3BY4B 4ZRQA 3VFKA 1M94A 2NR2A 5EZYE 4TX5A 3RIFA 1WF9A 1WYGA 4WJNA 4OYJA 4B9KA 3VTUA 4BVUC 4YHJA 3J9X1 2PVOD 4HWHA 4B3ST 2EMTA 4Q25A 3AE1A 4K3BA 2MCNB 1SJHD 3HK0A 1XNQT 3V5UA 2IIUA 3T8OA 3RNAC 4BBNF 4ZRKA 4BAXA 1FCCC 2KHWB 1TS2A 2L1AA 2V3PA 4QX7B 3PTRB 1NEKB 4RH6A 1EO6A 4QXHB 5FY0A 3R2TA 5JDNA 2KJHB 4LJOB 2WDVA 4N6EB 2DAJA 4F8CB 2VL0A 2BYFA 3O65B 5IAAC 2JWUA 5DPWA 5TSSA 2C5JA 5JH7E 1GPXA 1I7HA 4EOYA 3ZKJC 3CK6A 3PUSA 4NIQA 2WMNA 4JEUB 1PQSA 2MH7A 2KZ7B 1FNUA 1HTOA 3DBHI 2WX0A 1US7B 3UUBA 1C3TA 3TBLD 3W15B 5GMVA 1JMLA 1C4CA 1T0YA 3TLVA 3RCZA 5LXHA 1OEDA 2VL8A 4I50E 2ZLYA 1V1PA 3MC9A 2Q9QA 2KAJA 4K0KT 1FMVA 5G2NA 1YXRA 4KMCA 1ZE3D 1S1QB 2HJ1A 1WR1A 2GRIA 5AZFA 2X67A 3ALBA 2FBWA 3ZT5A 1B7TA 2WGSA 2NS5A 1I6ZA 2WB5A 3PT2B 4PJNA 2M4NA 1V9JA 3VTWA 2UXBT 4UVBB
chains in the Genus database with same CATH topology
4AJWA 1SIFA 1P0RA 1SGHA 2QHOA 4DHZE 2GBMA 3NY5A 1IP9A 4IW0A 1WJUA 2J0JA 4W9GA 3JVZX 3ZUNA 3DBRI 3A33B 2N4FA 3TMPB 1LM8B 4FHJA 1TBEA 2ZPYA 2DX5B 3SD5A 2LGYA 1P1AA 4EZKA 4GDLB 1WI0A 5HKHA 1L2NA 2PPHA 2KVRA 3UINB 4B6WA 3X0WA 1KOTA 3IHPC 2N1WA 4DHJB 5AQLB 1M7KA 1X1MA 3L16A 4WJQA 3PHWB 2GOWA 4KSKC 1OEYA 4PYUA 2MX2A 2KFKB 2G4SA 4ANUA 1WRDB 2WX1A 2C7NB 4FLHA 5AEKB 2JPHA 1WXAA 5D6JB 1WGDA 4HVBA 3ZNHB 2GBJA 4ICUA 2JZZA 4K7SA 3V60A 1R4NI 1S3SG 1E90A 1EF1A 3N32A 3ZDMC 2DAFA 2BKFA 5D94A 2L8JA 3KH0A 3SHQA 2KDFB 2MWSB 2DZMA 2KQ7A 1WMHA 2JRHA 2NPTB 4FBJB 3OJ4B 4MSMB 4KIKB 2K1FA 1RLFA 2RR9A 1GUAB 1E5WA 1RAXA 3RULA 2GBNA 1WJ4A 1AARA 2DENB 1WXVA 3M62B 1V5OA 3UIPB 1IPGA 1KM7A 4BBNC 1V2YA 1SE9A 2A5UA 2KWCA 2RD0A 3H7PB 4M8MA 2JXXA 4ZRIA 1HE8A 1H4RA 1UGMA 3KYDD 3R7RA 4JQWC 3PGEA 3WA0A 2KX0A 3ZIMA 4W9FA 2IYDB 2KMCA 3L13A 2XK5B 4K7WA 2AEHA 4TKNA 3QA8A 4M8NA 2UWQA 3W1YA 2REXA 1TGZB 2D07B 4IWPA 4W9EA 2HD5B 2JWZA 2FNJB 4NNJB 1Q0WB 2D10A 4GDLA 3FZMB 5AQFB 4N9F4 1QZEA 4HPMB 1P3QU 3H6NA 4E3CA 3HIZA 1T7SA 2O2VB 4J6IA 3DVNU 4XX5A 2R2QA 4AP4C 3R7QA 1ZGUB 4NQLB 3UQBA 1J8CA 2KWUB 2JUOA 4BKSD 1G6JA 2BPSA 2KANA 2KFKA 4G0NB 4HK2A 4IM0A 5AQKB 2K39A 1RRBA 5AQSB 3DDCB 2L05A 2KC2A 2L3ZA 1WX9A 2ZCBA 3VUWA 4W9DA 4GGQA 3PS6A 3C0RB 1WGYA 2YVCA 4ZRJA 2JZ3B 3HM3A 3IG3A 2GMIC 3UF8A 2ZVOA 2ZNVB 3R3MA 4GDKA 3UGBB 2K6QA 5AQGB 4GSWA 2MBHA 3N3KB 1WZ3A 2G3QB 4IM3A 3ZTCA 2NPTA 3OAWA 3APDA 4KIKA 3CMMB 3VH4B 2BYEA 3R66C 3VVWB 2NBUA 2N7DA 2LJ5A 1V5TA 3OLMD 3V6EB 4NPNA 4AUQC 2AYOB 2D9DA 2LD9A 3H7PA 4JIOU 1WM3A 1E8ZA 2FAZA 3JSVB 1UELA 4JL9A 4HWIB 2CU1A 4HXDA 4CO7A 5G55A 4XZ4A 2XK5A 2LXCA 4MGIE 4WWOA 2K25A 4FHKA 5JHBA 2KZRA 3ML8A 3FZKB 3LJ3A 2WDTB 3PLVA 3ZW3A 2K6DB 4DDID 2K8BA 3KUZA 4I6PA 5CHFA 2XEWA 3DVGY 3QX1A 3DQVA 4EZJA 4KZCA 4BOZB 1WYWB 4M0WB 2O2VA 1Q5WB 2NVUI 1WXMA 2KDIA 5AQJB 3PV1A 1UBQA 2G45B 1WR6E 3TL5A 1LQBA 3U30A 2Y5BB 4PS8A 3A4SC 4AOFA 4E74A 4AWJA 3D32A 1FXTB 2R2OA 2KJRA 2MBEA 4W9LA 2C60A 2DZJA 2NBWB 3AULA 4URKA 2KO3A 4GN1A 3VUYA 3PRMB 5C1ZA 3APFA 2D2QA 3DBSA 4PYZA 5D7GA 2HTHA 5FR6A 3KVFB 4LDTD 4MGZE 2FIFA 4KZ0A 2MBOA 4G3XB 2FCQA 2W9NA 3K9OB 3DPDA 2YLMA 4IWOA 4K1RB 4MH0E 4TQ1A 1TTNA 2JT4B 2LI5A 2LGDA 1Z5SB 3KYCD 2Z59B 4GXBA 2N9XA 3RZWC 2G4DB 2MA9B 4EEWA 2HJ8A 2RPQA 4FJYA 4HDOA 4PS7A 4NJ6A 5L95C 3A1QB 3U7DA 3FZLB 4NAWB 2KDBA 2DZKA 2KTFA 4GDKB 3ZTDA 5LXIB 5JHAA 3GOEA 3Q3JA 3JSVA 3W1SC 1WX7A 2FCNA 3CSFA 5AQRB 4EKUA 3IFWB 2MQJA 3T9LA 3PVLA 1R4MI 5J2RA 5AQOB 3EFUA 1TZ1A 2GBRA 2IO2B 2V4LA 4GOCA 3WAMA 2CHWA 2V3SA 3V6CB 5J17A 2BGFA 3FZFB 1I42A 2J7QB 2I1JA 2PE9A 3M3JA 4KDLB 1NBFC 5CX3A 3GZNI 5AQTB 5BO4B 1LXDA 4FADA 2J0MA 4FULA 1KJTA 4MDKE 5CTRC 4P7IA 1Y8RC 1NI2A 1UBIA 4HCNB 4IM2A 4KV2A 4ZYNA 3VXWA 1C1YB 4W9CA 3WAOA 4ASWC 4ANXA 5KHQA 3OJ3A 4ICVA 1E8WA 4WJPA 4BOSC 1P98A 3AXCA 3UQAA 2KMAA 4MSQB 4RMAA 1CMXB 1XT9B 5AQVB 3A9KB 1H8CA 4WQOB 2LASA 3B08A 3U8ZA 1JRUA 2JRIB 3DBLI 3QAQA 2IY1B 2UYZB 5IA7A 2N9PC 2LVOA 2WWZA 3VTVA 2MP2B 2L00B 4MEMA 2KX3A 3IVFA 2D3GA 4WWPA 3WALA 2OJRA 3L08A 2K8CA 3WANA 3PREA 3VUXA 1WX8A 2EKEC 3SDLC 5L83A 3VHTC 4HDQA 2MLBA 2L76A 4K7UA 4CYEA 2OOBB 2BF8B 1YJ1A 2O6VD 1V80A 2KK8A 3QK0A 2DYOA 3B0AA 2PEAA 1YD8U 4LDTB 3DVGX 5KHOA 3A1QA 2KD0A 3A4RA 4NAWA 5E6NA 3DVNV 1WFYA 5AQUB 3B1LX 2I1KA 3EHVA 5CHWA 1RFAA 2KWVB 3NZSA 2LGXA 2IO0B 2ZCCA 4OVVA 4DHJD 3A9JB 4BKGA 5DPRA 2L0FA 5E6OA 4OVUA 4MM3A 4HWCA 4MGKE 2MW5A 1XD3B 1K8RB 2KTRB 1YIWA 2BWFA 3V61A 3ML9A 3L0WB 3P2BA 1XQQA 2CR5A 2RSUA 1KLVA 1GC7A 4FN2A 3UIOB 3JW0X 5AQNB 3ENEA 1YQBA 4DHZB 3M3ZB 2KOXA 3TIXA 3N30A 3A8YC 1Q1OA 3A9KA 4DXAB 3RZFA 3WIMA 3BINA 3PRZA 4W9IA 4IG7B 4NY0A 4A20A 1V86A 3QCAA 4TQ0A 2KFJA 2MP2A 2C5LC 1VD2A 4WAAA 2MRPA 1WJ6A 2LWPA 4KSLC 3MHSD 2MBBB 3X23A 1L7YA 2V1YA 1OQYA 3NOBA 1OEYJ 2KLGA 3QJZA 4G50A 3SU8X 5AQHB 2ZPNA 1UGOA 2LVQA 4EFOA 1U4AA 4XC2A 1WJNA 2JY6A 2VRRB 4A3OA 3ZNGC 2FCMA 2FIDA 2AL3A 1E8YA 2ZZPB 2GBKA 3APCA 3H1UA 4HPLB 3L10B 5LLIA 4BKTA 3ZDTA 5AZHA 3QHTA 1J19A 2KC1A 2RGFA 3HM6X 2DHZA 4HWDA 4WJOA 3ZRCA 2DYMA 2O6VB 2B3AA 4HCPB 1HX1B 1J0GA 3L54A 3A9JA 3LDQB 1ISNA 2CHXA 1GG3A 2LVPA 1ZKHA 3DOWA 5C23A 1YX6B 2BYVE 1WH3A 3KW5B 2M1MA 2ZVNA 4GIVA 3HHMA 4FJZA 2KJ6A 3NS8A 2KTRA 4MGYE 4RM8A 2L7RA 1WE7A 1UH6A 1WGHA 4FA6A 5JZEB 4DWFA 3IBEA 1MG8A 4GB9A 3AU4A 3AI5A 3VAWA 4ANVA 3MJWA 3PZDA 4TV3A 2Z0DB 4IC7B 2D11A 4IUMB 4NQKE 1Z2MA 3RD2A 4AJYB 3ZNZB 1UZXB 3NHEB 2FUHB 4TUUA 4MJSB 3RYTA 4W9KA 3ZVVA 1F9JA 1GNUA 2IZVB 3ZLZA 5EDSA 2K8HA 3M63B 1WM2A 2PJHA 3TCAA 5DPSA 1V6EA 5AQPB 1WZ0A 3ZNID 3PTFC 4LJPB 2M17A 3RT3B 1UD7A 3W1SA 2AWTA 1D3ZA 3QQ8B 1V81A 2MBQA 4PS3A 3S2AA 3V62A 4DK5A 4HWFA 4HJKA 4I6NB 4HLEA 1WGGA 2N7EA 2J0KA 1M62A 2LXAA 2M0XA 4WWNA 4KDIC 4F7ZA 1WE6A 3AU5A 4II3B 1ZW7A 4W9JA 3K9PB 3QWZB 4KVGB 4LCDE 3VH3B 5E6PA 2A4ZA 5JH5C 4MELA 4BKSA 3Q3FA 3H9DA 5DCNA 5DPTA 2KLCA 4EUTA 4RM9A 2O6VA 3H7SA 3QIJA 1NDDA 4G11A 4B95A 4K81A 5AZGA 2NBVB 2CHZA 2ZJDA 3LDZE 2XBBC 1E8XA 3RUIB 4FJVB 2LRUA 2MSED 2IY0B 3QARA 4ANWA 3BY4B 3PSEB 3ZRFA 3VFKA 4BFRA 4ZDVA 1M94A 2NR2A 5TR5A 1WF9A 4WJNA 4DBGA 5J18A 4B9KA 2KN5A 1E7UA 3VTUA 1EUVB 4BVUC 4DDGD 2ASQA 1YX5B 4A3PA 4JLCA 1UK5A 3T8MA 3KUDB 4HWHA 2EMTA 2CKHB 2MCNB 1VCBA 3HK0A 4NJ7A 2C9WB 4BBNF 3CSTA 4ZRKA 2KHWB 2ZEQA 1E7VA 2WYQA 3TJPA 3PHXB 4CHKA 2BWES 2IBIB 2KQSA 3EECA 1EO6A 2C7HA 2L0TA 4MJSA 1EF5A 1LFDA 2IO3B 2KJHB 4LJOB 3VDZA 2Z0EB 3WAPA 2KDEB 2C7MB 2CS4A 3PRPB 2BKRB 2DAJA 2LRWA 2LZ6A 4F8CB 2BYFA 3ONSA 3M95A 3O65B 3VQIA 5IAAC 2KNBA 1WIAA 3EC8A 3PPAA 5DPWA 1IYFA 1I35A 3JYUA 4EOYA 1P9DU 2KXJA 4JGHB 3ZKJC 4E71A 1PQSA 3DBHI 2WX0A 1C3TA 3TBLD 3ZO5B 1WGRA 4X57B 2LUEA 5GMVA 2NCNA 3FZHB 1OGWA 1T0YA 2M8SA 3RCZA 2N9EB 4F1SA 2FCSA 4W9HA 4EZLA 5LXHA 3L17A 3I3TB 1OTRB 2JF5A 3ECIA 4I6LB 3MTNB 5CHVC 1WMHB 5G2NA 2DZIA 1GJZA 3CF6E 2IO1B 2JVCA 4GMVA 1S1QB 5AQIB 2PE6B 5AQMB 1WR1A 4GU2A 5AZFA 3NZUA 3ALBA 5AQQB 2DYBA 1WXSA 2KKCA 3QC8B 4IWQA 2N1VA 4YL8A 3KUCB 1BT0A 2HE7A 1V49A 3DCGA 2NS5A 5D2MB 1I6ZA 2EMSA 3PLUA 2ZNVC 1WY8A 3PT2B 4II2B 1A5RA 2M4NA 1GC6A 2AL6A 1V9JA 3VTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AJW A;  1SIF A;  1P0R A;  1SGH A;  2QHO A;  4DHZ E;  2GBM A;  3NY5 A;  1IP9 A;  4IW0 A;  1WJU A;  2J0J A;  4W9G A;  3JVZ X;  3ZUN A;  3DBR I;  3A33 B;  2N4F A;  3TMP B;  1LM8 B;  4FHJ A;  1TBE A;  2ZPY A;  2DX5 B;  3SD5 A;  2LGY A;  1P1A A;  4EZK A;  4GDL B;  1WI0 A;  5HKH A;  1L2N A;  2PPH A;  2KVR A;  3UIN B;  4B6W A;  3X0W A;  1KOT A;  3IHP C;  2N1W A;  4DHJ B;  5AQL B;  1M7K A;  1X1M A;  3L16 A;  4WJQ A;  3PHW B;  2GOW A;  4KSK C;  1OEY A;  4PYU A;  2MX2 A;  2KFK B;  2G4S A;  4ANU A;  1WRD B;  2WX1 A;  2C7N B;  4FLH A;  5AEK B;  2JPH A;  1WXA A;  5D6J B;  1WGD A;  4HVB A;  3ZNH B;  2GBJ A;  4ICU A;  2JZZ A;  4K7S A;  3V60 A;  1R4N I;  1S3S G;  1E90 A;  1EF1 A;  3N32 A;  3ZDM C;  2DAF A;  2BKF A;  5D94 A;  2L8J A;  3KH0 A;  3SHQ A;  2KDF B;  2MWS B;  2DZM A;  2KQ7 A;  1WMH A;  2JRH A;  2NPT B;  4FBJ B;  3OJ4 B;  4MSM B;  4KIK B;  2K1F A;  1RLF A;  2RR9 A;  1GUA B;  1E5W A;  1RAX A;  3RUL A;  2GBN A;  1WJ4 A;  1AAR A;  2DEN B;  1WXV A;  3M62 B;  1V5O A;  3UIP B;  1IPG A;  1KM7 A;  4BBN C;  1V2Y A;  1SE9 A;  2A5U A;  2KWC A;  2RD0 A;  3H7P B;  4M8M A;  2JXX A;  4ZRI A;  1HE8 A;  1H4R A;  1UGM A;  3KYD D;  3R7R A;  4JQW C;  3PGE A;  3WA0 A;  2KX0 A;  3ZIM A;  4W9F A;  2IYD B;  2KMC A;  3L13 A;  2XK5 B;  4K7W A;  2AEH A;  4TKN A;  3QA8 A;  4M8N A;  2UWQ A;  3W1Y A;  2REX A;  1TGZ B;  2D07 B;  4IWP A;  4W9E A;  2HD5 B;  2JWZ A;  2FNJ B;  4NNJ B;  1Q0W B;  2D10 A;  4GDL A;  3FZM B;  5AQF B;  4N9F 4;  1QZE A;  4HPM B;  1P3Q U;  3H6N A;  4E3C A;  3HIZ A;  1T7S A;  2O2V B;  4J6I A;  3DVN U;  4XX5 A;  2R2Q A;  4AP4 C;  3R7Q A;  1ZGU B;  4NQL B;  3UQB A;  1J8C A;  2KWU B;  2JUO A;  4BKS D;  1G6J A;  2BPS A;  2KAN A;  2KFK A;  4G0N B;  4HK2 A;  4IM0 A;  5AQK B;  2K39 A;  1RRB A;  5AQS B;  3DDC B;  2L05 A;  2KC2 A;  2L3Z A;  1WX9 A;  2ZCB A;  3VUW A;  4W9D A;  4GGQ A;  3PS6 A;  3C0R B;  1WGY A;  2YVC A;  4ZRJ A;  2JZ3 B;  3HM3 A;  3IG3 A;  2GMI C;  3UF8 A;  2ZVO A;  2ZNV B;  3R3M A;  4GDK A;  3UGB B;  2K6Q A;  5AQG B;  4GSW A;  2MBH A;  3N3K B;  1WZ3 A;  2G3Q B;  4IM3 A;  3ZTC A;  2NPT A;  3OAW A;  3APD A;  4KIK A;  3CMM B;  3VH4 B;  2BYE A;  3R66 C;  3VVW B;  2NBU A;  2N7D A;  2LJ5 A;  1V5T A;  3OLM D;  3V6E B;  4NPN A;  4AUQ C;  2AYO B;  2D9D A;  2LD9 A;  3H7P A;  4JIO U;  1WM3 A;  1E8Z A;  2FAZ A;  3JSV B;  1UEL A;  4JL9 A;  4HWI B;  2CU1 A;  4HXD A;  4CO7 A;  5G55 A;  4XZ4 A;  2XK5 A;  2LXC A;  4MGI E;  4WWO A;  2K25 A;  4FHK A;  5JHB A;  2KZR A;  3ML8 A;  3FZK B;  3LJ3 A;  2WDT B;  3PLV A;  3ZW3 A;  2K6D B;  4DDI D;  2K8B A;  3KUZ A;  4I6P A;  5CHF A;  2XEW A;  3DVG Y;  3QX1 A;  3DQV A;  4EZJ A;  4KZC A;  4BOZ B;  1WYW B;  4M0W B;  2O2V A;  1Q5W B;  2NVU I;  1WXM A;  2KDI A;  5AQJ B;  3PV1 A;  1UBQ A;  2G45 B;  1WR6 E;  3TL5 A;  1LQB A;  3U30 A;  2Y5B B;  4PS8 A;  3A4S C;  4AOF A;  4E74 A;  4AWJ A;  3D32 A;  1FXT B;  2R2O A;  2KJR A;  2MBE A;  4W9L A;  2C60 A;  2DZJ A;  2NBW B;  3AUL A;  4URK A;  2KO3 A;  4GN1 A;  3VUY A;  3PRM B;  5C1Z A;  3APF A;  2D2Q A;  3DBS A;  4PYZ A;  5D7G A;  2HTH A;  5FR6 A;  3KVF B;  4LDT D;  4MGZ E;  2FIF A;  4KZ0 A;  2MBO A;  4G3X B;  2FCQ A;  2W9N A;  3K9O B;  3DPD A;  2YLM A;  4IWO A;  4K1R B;  4MH0 E;  4TQ1 A;  1TTN A;  2JT4 B;  2LI5 A;  2LGD A;  1Z5S B;  3KYC D;  2Z59 B;  4GXB A;  2N9X A;  3RZW C;  2G4D B;  2MA9 B;  4EEW A;  2HJ8 A;  2RPQ A;  4FJY A;  4HDO A;  4PS7 A;  4NJ6 A;  5L95 C;  3A1Q B;  3U7D A;  3FZL B;  4NAW B;  2KDB A;  2DZK A;  2KTF A;  4GDK B;  3ZTD A;  5LXI B;  5JHA A;  3GOE A;  3Q3J A;  3JSV A;  3W1S C;  1WX7 A;  2FCN A;  3CSF A;  5AQR B;  4EKU A;  3IFW B;  2MQJ A;  3T9L A;  3PVL A;  1R4M I;  5J2R A;  5AQO B;  3EFU A;  1TZ1 A;  2GBR A;  2IO2 B;  2V4L A;  4GOC A;  3WAM A;  2CHW A;  2V3S A;  3V6C B;  5J17 A;  2BGF A;  3FZF B;  1I42 A;  2J7Q B;  2I1J A;  2PE9 A;  3M3J A;  4KDL B;  1NBF C;  5CX3 A;  3GZN I;  5AQT B;  5BO4 B;  1LXD A;  4FAD A;  2J0M A;  4FUL A;  1KJT A;  4MDK E;  5CTR C;  4P7I A;  1Y8R C;  1NI2 A;  1UBI A;  4HCN B;  4IM2 A;  4KV2 A;  4ZYN A;  3VXW A;  1C1Y B;  4W9C A;  3WAO A;  4ASW C;  4ANX A;  5KHQ A;  3OJ3 A;  4ICV A;  1E8W A;  4WJP A;  4BOS C;  1P98 A;  3AXC A;  3UQA A;  2KMA A;  4MSQ B;  4RMA A;  1CMX B;  1XT9 B;  5AQV B;  3A9K B;  1H8C A;  4WQO B;  2LAS A;  3B08 A;  3U8Z A;  1JRU A;  2JRI B;  3DBL I;  3QAQ A;  2IY1 B;  2UYZ B;  5IA7 A;  2N9P C;  2LVO A;  2WWZ A;  3VTV A;  2MP2 B;  2L00 B;  4MEM A;  2KX3 A;  3IVF A;  2D3G A;  4WWP A;  3WAL A;  2OJR A;  3L08 A;  2K8C A;  3WAN A;  3PRE A;  3VUX A;  1WX8 A;  2EKE C;  3SDL C;  5L83 A;  3VHT C;  4HDQ A;  2MLB A;  2L76 A;  4K7U A;  4CYE A;  2OOB B;  2BF8 B;  1YJ1 A;  2O6V D;  1V80 A;  2KK8 A;  3QK0 A;  2DYO A;  3B0A A;  2PEA A;  1YD8 U;  4LDT B;  3DVG X;  5KHO A;  3A1Q A;  2KD0 A;  3A4R A;  4NAW A;  5E6N A;  3DVN V;  1WFY A;  5AQU B;  3B1L X;  2I1K A;  3EHV A;  5CHW A;  1RFA A;  2KWV B;  3NZS A;  2LGX A;  2IO0 B;  2ZCC A;  4OVV A;  4DHJ D;  3A9J B;  4BKG A;  5DPR A;  2L0F A;  5E6O A;  4OVU A;  4MM3 A;  4HWC A;  4MGK E;  2MW5 A;  1XD3 B;  1K8R B;  2KTR B;  1YIW A;  2BWF A;  3V61 A;  3ML9 A;  3L0W B;  3P2B A;  1XQQ A;  2CR5 A;  2RSU A;  1KLV A;  1GC7 A;  4FN2 A;  3UIO B;  3JW0 X;  5AQN B;  3ENE A;  1YQB A;  4DHZ B;  3M3Z B;  2KOX A;  3TIX A;  3N30 A;  3A8Y C;  1Q1O A;  3A9K A;  4DXA B;  3RZF A;  3WIM A;  3BIN A;  3PRZ A;  4W9I A;  4IG7 B;  4NY0 A;  4A20 A;  1V86 A;  3QCA A;  4TQ0 A;  2KFJ A;  2MP2 A;  2C5L C;  1VD2 A;  4WAA A;  2MRP A;  1WJ6 A;  2LWP A;  4KSL C;  3MHS D;  2MBB B;  3X23 A;  1L7Y A;  2V1Y A;  1OQY A;  3NOB A;  1OEY J;  2KLG A;  3QJZ A;  4G50 A;  3SU8 X;  5AQH B;  2ZPN A;  1UGO A;  2LVQ A;  4EFO A;  1U4A A;  4XC2 A;  1WJN A;  2JY6 A;  2VRR B;  4A3O A;  3ZNG C;  2FCM A;  2FID A;  2AL3 A;  1E8Y A;  2ZZP B;  2GBK A;  3APC A;  3H1U A;  4HPL B;  3L10 B;  5LLI A;  4BKT A;  3ZDT A;  5AZH A;  3QHT A;  1J19 A;  2KC1 A;  2RGF A;  3HM6 X;  2DHZ A;  4HWD A;  4WJO A;  3ZRC A;  2DYM A;  2O6V B;  2B3A A;  4HCP B;  1HX1 B;  1J0G A;  3L54 A;  3A9J A;  3LDQ B;  1ISN A;  2CHX A;  1GG3 A;  2LVP A;  1ZKH A;  3DOW A;  5C23 A;  1YX6 B;  2BYV E;  1WH3 A;  3KW5 B;  2M1M A;  2ZVN A;  4GIV A;  3HHM A;  4FJZ A;  2KJ6 A;  3NS8 A;  2KTR A;  4MGY E;  4RM8 A;  2L7R A;  1WE7 A;  1UH6 A;  1WGH A;  4FA6 A;  5JZE B;  4DWF A;  3IBE A;  1MG8 A;  4GB9 A;  3AU4 A;  3AI5 A;  3VAW A;  4ANV A;  3MJW A;  3PZD A;  4TV3 A;  2Z0D B;  4IC7 B;  2D11 A;  4IUM B;  4NQK E;  1Z2M A;  3RD2 A;  4AJY B;  3ZNZ B;  1UZX B;  3NHE B;  2FUH B;  4TUU A;  4MJS B;  3RYT A;  4W9K A;  3ZVV A;  1F9J A;  1GNU A;  2IZV B;  3ZLZ A;  5EDS A;  2K8H A;  3M63 B;  1WM2 A;  2PJH A;  3TCA A;  5DPS A;  1V6E A;  5AQP B;  1WZ0 A;  3ZNI D;  3PTF C;  4LJP B;  2M17 A;  3RT3 B;  1UD7 A;  3W1S A;  2AWT A;  1D3Z A;  3QQ8 B;  1V81 A;  2MBQ A;  4PS3 A;  3S2A A;  3V62 A;  4DK5 A;  4HWF A;  4HJK A;  4I6N B;  4HLE A;  1WGG A;  2N7E A;  2J0K A;  1M62 A;  2LXA A;  2M0X A;  4WWN A;  4KDI C;  4F7Z A;  1WE6 A;  3AU5 A;  4II3 B;  1ZW7 A;  4W9J A;  3K9P B;  3QWZ B;  4KVG B;  4LCD E;  3VH3 B;  5E6P A;  2A4Z A;  5JH5 C;  4MEL A;  4BKS A;  3Q3F A;  3H9D A;  5DCN A;  5DPT A;  2KLC A;  4EUT A;  4RM9 A;  2O6V A;  3H7S A;  3QIJ A;  1NDD A;  4G11 A;  4B95 A;  4K81 A;  5AZG A;  2NBV B;  2CHZ A;  2ZJD A;  3LDZ E;  2XBB C;  1E8X A;  3RUI B;  4FJV B;  2LRU A;  2MSE D;  2IY0 B;  3QAR A;  4ANW A;  3BY4 B;  3PSE B;  3ZRF A;  3VFK A;  4BFR A;  4ZDV A;  1M94 A;  2NR2 A;  5TR5 A;  1WF9 A;  4WJN A;  4DBG A;  5J18 A;  4B9K A;  2KN5 A;  1E7U A;  3VTU A;  1EUV B;  4BVU C;  4DDG D;  2ASQ A;  1YX5 B;  4A3P A;  4JLC A;  1UK5 A;  3T8M A;  3KUD B;  4HWH A;  2EMT A;  2CKH B;  2MCN B;  1VCB A;  3HK0 A;  4NJ7 A;  2C9W B;  4BBN F;  3CST A;  4ZRK A;  2KHW B;  2ZEQ A;  1E7V A;  2WYQ A;  3TJP A;  3PHX B;  4CHK A;  2BWE S;  2IBI B;  2KQS A;  3EEC A;  1EO6 A;  2C7H A;  2L0T A;  4MJS A;  1EF5 A;  1LFD A;  2IO3 B;  2KJH B;  4LJO B;  3VDZ A;  2Z0E B;  3WAP A;  2KDE B;  2C7M B;  2CS4 A;  3PRP B;  2BKR B;  2DAJ A;  2LRW A;  2LZ6 A;  4F8C B;  2BYF A;  3ONS A;  3M95 A;  3O65 B;  3VQI A;  5IAA C;  2KNB A;  1WIA A;  3EC8 A;  3PPA A;  5DPW A;  1IYF A;  1I35 A;  3JYU A;  4EOY A;  1P9D U;  2KXJ A;  4JGH B;  3ZKJ C;  4E71 A;  1PQS A;  3DBH I;  2WX0 A;  1C3T A;  3TBL D;  3ZO5 B;  1WGR A;  4X57 B;  2LUE A;  5GMV A;  2NCN A;  3FZH B;  1OGW A;  1T0Y A;  2M8S A;  3RCZ A;  2N9E B;  4F1S A;  2FCS A;  4W9H A;  4EZL A;  5LXH A;  3L17 A;  3I3T B;  1OTR B;  2JF5 A;  3ECI A;  4I6L B;  3MTN B;  5CHV C;  1WMH B;  5G2N A;  2DZI A;  1GJZ A;  3CF6 E;  2IO1 B;  2JVC A;  4GMV A;  1S1Q B;  5AQI B;  2PE6 B;  5AQM B;  1WR1 A;  4GU2 A;  5AZF A;  3NZU A;  3ALB A;  5AQQ B;  2DYB A;  1WXS A;  2KKC A;  3QC8 B;  4IWQ A;  2N1V A;  4YL8 A;  3KUC B;  1BT0 A;  2HE7 A;  1V49 A;  3DCG A;  2NS5 A;  5D2M B;  1I6Z A;  2EMS A;  3PLU A;  2ZNV C;  1WY8 A;  3PT2 B;  4II2 B;  1A5R A;  2M4N A;  1GC6 A;  2AL6 A;  1V9J A;  3VTW A; 
#chains in the Genus database with same CATH topology
 3GMI A;  1V8C A;  5LJM A;  3GB1 A;  3LXF A;  1IP9 A;  4H9S E;  4X1I E;  2J0J A;  2K48 A;  4W9G A;  3ZUN A;  1F52 A;  1K53 A;  3A33 B;  1JRP A;  2CXF A;  3P7I A;  4FHJ A;  4S17 A;  4JI3 T;  2LGY A;  2RA1 A;  2FJE A;  5ETW A;  2WP9 A;  1HEZ E;  4GDL B;  1WI0 A;  5HKH A;  1L2N A;  5LG3 A;  2JSV X;  3UIN B;  4WH4 A;  1VLB A;  2LEK A;  3X0W A;  4B6W A;  1LO5 D;  4JI6 T;  2N1W A;  4OYK A;  4DHJ B;  3RYH E;  1LKX A;  1FRR A;  3OBV E;  1SXT A;  3DHI C;  3UU5 A;  3GE3 C;  4TV8 E;  1TYG B;  4PYU A;  1OEY A;  5EK4 A;  2J4G A;  4Q2J A;  1SA0 E;  1WRD B;  2WX1 A;  4FLH A;  2JPH A;  4O4J E;  3AAE B;  2IC9 A;  2CJN A;  3LK3 B;  1KF6 A;  1YQ4 B;  2IGH A;  3AE5 B;  1VOM A;  5H8Y E;  4HVB A;  3ZNH B;  4IRE A;  5D3D A;  2PBI A;  4K7S A;  3PUW F;  1R4N I;  4ZRP A;  1ZV4 X;  3Q8B A;  4EZ4 A;  4XDD A;  3ZDM C;  2L8J A;  3KH0 A;  3NJT A;  5HWX A;  1AYF A;  3SHQ A;  4A97 A;  2QVA A;  2JRH A;  4AKL A;  2W63 A;  3MA9 A;  4OZA A;  3HVD A;  4LLG M;  2RR9 A;  1GUA B;  3C4Z A;  4LNF A;  3RIU C;  2INP E;  1YD8 G;  3U4E G;  2YK0 A;  3KLS X;  2LT3 A;  3RUL A;  5FXX A;  1WJ4 A;  3M62 B;  1V5O A;  3HRD D;  3I9Y A;  4DV6 T;  3UIP B;  2UUA T;  2A5U A;  1JAL A;  2KWC A;  3LYY A;  1NEN A;  3ZMS B;  4ZRI A;  1H4R A;  4QXC B;  4H63 H;  3KYD D;  3WA0 A;  3DJB A;  2KMC A;  2XM2 A;  5IKC M;  4TKN A;  4M8N A;  3W1Y A;  4LNK A;  5BMH A;  3CPZ A;  4N59 A;  3UI3 A;  2JWZ A;  1W9R A;  4X20 E;  2BS4 B;  2MOZ A;  1B1Z A;  2PFV A;  3FZM B;  1FIO A;  1KLG D;  4HPM B;  3FXD B;  3R7Q A;  3AE9 B;  1VR9 A;  4I0U A;  2L8K A;  2JUO A;  2KWU B;  2BPS A;  2KAN A;  3U78 A;  2KFK A;  4G0N B;  2K39 A;  1AWD A;  5AQS B;  1WXQ A;  2BT6 A;  1NAF A;  3RC8 A;  2PLP A;  1IZN B;  3RHW A;  2FJB A;  3AE6 A;  5MPO A;  2XQY A;  3CWZ B;  2JZ3 B;  3HM3 A;  3IG3 A;  3H3M A;  3UF8 A;  2ZVO A;  2DCF A;  4B0E A;  4DV2 T;  4XE0 A;  4UEL A;  1WZ3 A;  1GB1 A;  4C80 A;  2NPT A;  3K3Q C;  4IHJ E;  2V5D A;  4NJC A;  2BYE A;  3RYC E;  4CXW A;  3R66 C;  2INN E;  2NBU A;  3Q14 C;  1CZP A;  2WU2 B;  2LJ5 A;  2JRK A;  4H9P C;  2AYO B;  2LRL A;  3AA1 B;  4ILC A;  4X65 T;  2LD9 A;  3H7P A;  4JIO U;  1WM3 A;  3RKO A;  3DBL B;  2KND A;  4AI6 A;  4HE8 A;  2W61 A;  1IJ5 A;  3ESL A;  3IA3 A;  3I0O A;  4HWI B;  3RKG A;  4YTN A;  4HXD A;  2PVG C;  3Q8A A;  5H6R B;  1D0X A;  3RQU A;  2IAK A;  4MGI E;  5JHB A;  2KZR A;  3ML8 A;  4JWS C;  3BQI A;  2WDT B;  1GB4 A;  5G5G A;  2K8B A;  2BW2 A;  4I6P A;  3QX1 A;  1S94 A;  4KZC A;  1TS5 A;  1YJI A;  3UUX B;  2HN1 A;  3LK2 B;  3AEC A;  1ZOY B;  3RFZ B;  1DGJ A;  1FFV A;  1WR6 E;  4JWU C;  3TL5 A;  1LQB A;  3BWU D;  3OJA A;  3PU8 A;  4U7I A;  4AOF A;  4EOZ B;  3O9X A;  2E9X B;  3IF8 B;  1ZDV A;  3ZMU B;  2MBE A;  3Q5X A;  2IJ0 A;  3CQX C;  2BB5 A;  3AUL A;  1KLU D;  5KXJ A;  5KDM C;  4GLS C;  2KO3 A;  4GN1 A;  3PRM B;  5C1Z A;  5GON E;  1XCT L;  2V7J A;  5D7G A;  1KK7 A;  5D3I B;  4L2Y A;  4EAH A;  2KT7 A;  3AE7 B;  4G3X B;  2WXK A;  2FCQ A;  4MH0 E;  1XDO A;  1TTN A;  4IDZ A;  4ERR A;  2XQ3 A;  2LGD A;  4Z8X A;  1Z5S B;  2AXD S;  4UR9 A;  1X79 A;  4MFR A;  5HEO A;  1XXG A;  3LSV A;  2MA9 B;  4XYC A;  4AQY T;  2RPQ A;  2EHO A;  4FJY A;  4HDO A;  4PS7 A;  3OYZ A;  5L95 C;  4NAW B;  1I4H A;  4HKZ E;  3ZTD A;  3GOE A;  1G73 A;  4EKU A;  5LHI B;  1TZ1 A;  1HZ5 A;  3TEY A;  3RMK C;  4JI1 T;  4YXD A;  2L83 A;  4CN6 A;  5LB7 B;  1NBF C;  3IBP A;  4EIW A;  5AQT B;  3P42 A;  1XWM A;  4FUL A;  1KJT A;  5CTR C;  3AE3 A;  3ZXV A;  4EE2 A;  1UBI A;  5KHQ A;  3VXW A;  1C1Y B;  4ANX A;  3OJ3 A;  4C56 C;  4PNI A;  4BOS C;  2BG9 E;  3AXC A;  2CWO A;  2HPJ A;  5LHG B;  3OTO T;  2BS3 A;  4MSQ B;  3VRB B;  2XNA C;  1SJE D;  1H8C A;  5AQV B;  2XM1 A;  3SFD B;  4N78 D;  3N1Y C;  4E7S A;  2JRI B;  3ZQ4 A;  4DQO C;  1MNE A;  2XZE A;  3VHL A;  2WXI A;  2N9P C;  3Q5D A;  2ZMA A;  3OG5 A;  4MEM A;  4JBW F;  2IDO B;  4CI2 B;  1MHX A;  3WAL A;  3UFG A;  2K8C A;  1F1H A;  2LE8 A;  2KWI B;  2WXL A;  3Q8E A;  3SDL C;  3ANW A;  3K8P C;  3VHT C;  5L83 A;  1E7P A;  2CBJ A;  3P4P B;  3Q3N C;  1V80 A;  3QK0 A;  3B0A A;  1YD8 U;  2LGS A;  5CGM A;  3DVG X;  3FAH A;  5KHO A;  5IN7 A;  1HG5 A;  3UFE A;  1L6V A;  3A4R A;  4JYA T;  4QAY A;  1FEH A;  2KWV B;  2WNM A;  3RNF C;  1WFD A;  3NZS A;  5LGU B;  2Y3A A;  2ZM2 A;  2IO0 B;  4DHJ D;  1FPY A;  1JNZ A;  2I38 A;  2B1E A;  5J1G A;  1SE3 A;  3AA6 B;  3UQ7 A;  4JX1 C;  3ZKR A;  4MGK E;  3B5M A;  2OLT A;  3TLW A;  2KTR B;  3HI2 A;  4G63 A;  1FM0 D;  2Q9Q C;  3ML9 A;  3L0W B;  3P2B A;  2CR5 A;  2RSU A;  1KLV A;  4ZHP A;  3UIO B;  1LVF A;  3ENE A;  4B3T T;  1SHZ C;  1P7F A;  2G9H D;  1YQB A;  4YWG G;  3LFM A;  5ADX L;  1WLX A;  4H2A A;  2FUP A;  3HKC E;  5C2T A;  1KTK A;  4KX6 A;  3RZF A;  2XHE B;  4IG7 B;  2WXP A;  2V6Y B;  4EYY R;  3QCA A;  4YFS A;  2KFJ A;  1IBM T;  5FMN A;  2MRP A;  2WXJ A;  1JWB D;  4US8 A;  3TEZ A;  2OHF A;  1WJ6 A;  3B2F A;  3AAI A;  2Q9Q D;  3P4Q A;  1N5W A;  2MEK A;  1UUP A;  4DV5 T;  2V1Y A;  3N2K E;  1HCI A;  3QJZ A;  3AEG A;  1ZPS A;  1UGO A;  2LVQ A;  4MHC A;  1WJN A;  1BXT A;  3AE8 A;  3ZNG C;  3APC A;  3H1U A;  3UUM A;  1BML C;  2LSI A;  4ZEY A;  3IXS A;  5AZH A;  2IHR 1;  2Z6E A;  3HM6 X;  3P4S B;  3EA6 A;  5IOI A;  4B3R T;  1ET9 A;  2W4X A;  1HX1 B;  1GAQ B;  1KRH A;  2B3A A;  2YEP F;  1J7A A;  3A9J A;  1E7P B;  1FMA D;  1FXA A;  1IAP A;  2BYV E;  3KW5 B;  5FKA C;  3GN5 A;  2ZVN A;  2CCQ A;  4MGY E;  4RM8 A;  2W55 A;  5LGT B;  1UH6 A;  3PUY F;  4HFC A;  5GXG B;  3UU3 A;  4DWF A;  3N9M A;  1MPE A;  4Z90 A;  3AU4 A;  3PZD A;  5IWA T;  3QB5 K;  4MT5 A;  3RD2 A;  1Y01 A;  1OQR A;  3F57 A;  1T72 A;  2WXG A;  2K24 A;  3ZNZ B;  4BZA A;  3C19 A;  3NHE B;  2YDS A;  3W5U B;  4DV1 T;  4C00 A;  4W9K A;  3GWH A;  2VK9 A;  2IZV B;  1TY2 A;  3ZMV B;  2V9H A;  1ZEE A;  1MIY A;  1X9B A;  4OX9 T;  2D5U A;  1YKE B;  2XQ4 A;  1DYQ A;  1JCK B;  4ASK A;  1KNZ A;  2CJO A;  3FKY A;  4LJP B;  4YTP B;  3RT3 B;  2IGG A;  3QQ8 B;  2MBQ A;  4DK5 A;  2XAJ B;  3UT5 E;  4NXM T;  4HLE A;  2J0K A;  1M62 A;  3PUG A;  1VZ7 A;  3AU5 A;  3HL6 A;  4F8H A;  3VRA A;  4ZI2 D;  3K9P B;  3NVO A;  4KVG B;  2K9X A;  5JH5 C;  1J1J A;  2WQY A;  2UU9 T;  3UQ4 A;  2O6V A;  4QWN B;  2NOX A;  1U5P A;  1FMW A;  3RI7 C;  2RP4 A;  1E8X A;  2MSE D;  2PMV A;  4K0U A;  3QAR A;  3ZRF A;  4ZDV A;  1TKE A;  5TR5 A;  5F5W A;  2DHR A;  2CXL A;  5J18 A;  2KN5 A;  1E7U A;  3PUV F;  4DDG D;  1D4B A;  3N9Q A;  2K3W A;  4YLH A;  3TLS A;  1YX5 B;  2ASQ A;  3EDU A;  1ZXI A;  4JLC A;  4IST A;  4A3P A;  2CKH B;  1HA5 A;  3C98 B;  3NZP A;  2ODV A;  4UEM A;  3R6N A;  5HHD G;  2WY2 A;  4WW0 A;  2WYQ A;  3PHX B;  4IDN A;  3RNG C;  4MJS A;  3ZGZ A;  2N1G A;  4GOU A;  1EF5 A;  2IO3 B;  4A6Q A;  3HUI A;  1OED E;  1LVK A;  2BKR B;  2LZ6 A;  2V3N A;  3ONS A;  2WS3 A;  3M95 A;  3VQI A;  1EWC A;  3LG7 A;  2KNB A;  1WIA A;  3EC8 A;  1ZUD 2;  1J5E T;  3P4R A;  1IYF A;  3AED B;  4EV6 A;  3L39 A;  1P9D U;  1IGC A;  1TKY A;  4JGH B;  4PFP A;  4E71 A;  3W2D A;  1OFF A;  3AEA B;  1EZ3 A;  2BS2 A;  4X62 T;  2KXP B;  4L5G A;  1WGR A;  4X57 B;  2LUE A;  3FZH B;  3MJX A;  1OGW A;  2M8S A;  4EZL A;  2FCS A;  4W9H A;  4JI2 T;  3L17 A;  1MMG A;  2JF5 A;  3C8Y A;  3ECI A;  4I6L B;  5CHV C;  1WMH B;  3CF6 E;  2WZH A;  5FL1 A;  2JVC A;  2LUM A;  2E5L T;  1UX5 A;  3I1A A;  2BVL A;  4JI7 T;  2PE6 B;  3EAM A;  5JDM A;  1XLQ A;  4HFD A;  3QC8 B;  3P1M A;  4YL8 A;  2IML A;  3KUC B;  2HE7 A;  1ZXH A;  2JXT A;  1SSN A;  2G1E A;  2EMS A;  3EHZ A;  3BVZ A;  3PV0 F;  5HXE A;  1WY8 A;  4C7Z A;  1A5R A;  1GC6 A;  2AL6 A;  3ZYM A;  2SEB D;  5BYQ A;  5LGN B;  1SGH A;  2QHO A;  5I4D A;  4NUV A;  4O8S A;  3PUZ F;  5LG4 A;  3UUN A;  3JVZ X;  5ABE A;  2QRX A;  2KSR A;  4YY3 T;  2VZK D;  3TMP B;  3EVY A;  2ZPY A;  1NEK A;  2EHO C;  2DX5 B;  2V7L A;  3NRY A;  5L2L A;  3LK4 2;  4R3D A;  4EZK A;  5F8P A;  4OFZ A;  2VB6 A;  4DO0 A;  2XAH B;  4LTU A;  1G8X A;  2HN2 A;  4U33 A;  2Y6X A;  2D3C A;  2GLS A;  3L16 A;  1HFA A;  3ZJT A;  2GOW A;  4KSK C;  2QDF A;  4PK6 A;  2G4S A;  1J5W A;  3JAE A;  3AXJ B;  2C7N B;  5FVL A;  5D6J B;  1WGD A;  3KVA A;  1CUN A;  2LHN A;  4TUY E;  2EHO D;  3Q8F A;  4RNA A;  4DV7 T;  3W5V B;  4WNK A;  4HFH A;  2DZM A;  1E9M A;  2XAF B;  2H89 B;  3OJ4 B;  1W0B A;  4MSM B;  2IC6 A;  4P09 A;  4AKI A;  2UUC T;  3V05 A;  3ZXR A;  1E5W A;  2DEN B;  3NVW A;  2MTQ A;  5EE9 A;  1V2Y A;  1TS3 A;  4M8M A;  3P50 A;  5J2T E;  2JXX A;  2WXR A;  4YSZ B;  2N2N A;  3R7R A;  2DWQ A;  4JQW C;  2K5B B;  3CX7 B;  3Q5E A;  4NUU A;  3ZIM A;  2IYD B;  1FD6 A;  2N9L A;  2XK5 B;  2AEH A;  2I59 A;  2ES0 A;  1FEW A;  2WHI A;  2CBI A;  2UWQ A;  3FIL A;  1GOZ A;  4W9E A;  5L4H A;  1N32 T;  2FNJ B;  1Q0W B;  4KKI A;  4ANJ A;  4GDL A;  3AE4 B;  3I57 A;  4U3C A;  1RWS A;  4OW0 A;  3KWL A;  1JRO A;  3H6N A;  1I94 T;  2AQ1 B;  4AKG A;  2VH1 A;  4AP4 C;  5JDH A;  4PK1 A;  4LMJ A;  4DMV A;  4WUR A;  1R4M B;  2X51 A;  1MI0 A;  4ILB A;  1WRD A;  3AAA B;  3AE5 A;  1YQ4 A;  2YVC A;  1QLB B;  2E3T A;  4TV9 E;  2ZNV B;  3R3M A;  3ETV A;  4IE4 A;  4RGM A;  1HXY D;  3SFE B;  5LBQ B;  3MC8 A;  3N3K B;  4GK5 E;  5JVD E;  2G3Q B;  2K0P A;  4O4H E;  4A9A A;  5BMG A;  3CMM B;  2KIN B;  1NVI D;  3VH4 B;  4AKR B;  2WXN A;  1SIJ A;  2OV9 A;  2LSJ A;  1XZY A;  3KQ4 A;  3OLM D;  4JI0 T;  2K5P A;  4HRO A;  4KGS A;  3V6E B;  4AUQ C;  2BBC A;  4LF5 T;  5LNK 1;  2QYW A;  2GI9 A;  2Q5W D;  3JSV B;  4B0M A;  4OVZ A;  1DU2 A;  2MJD A;  4JL9 A;  3F2E A;  2LM2 A;  4CO7 A;  4H63 V;  1LGR A;  2CLY B;  4UV8 B;  2WBL A;  3K1S A;  3E9S A;  2X0L B;  3FZK B;  4KI0 F;  1XO3 A;  1H7C A;  2BS4 A;  2WDQ B;  5FXZ A;  2QSD A;  5CHF A;  2Y5P A;  2YU1 A;  1S35 A;  3TKL B;  2MJE A;  4HN9 A;  4M0W B;  5L3D B;  4UV9 B;  1WXM A;  2KDI A;  5AQJ B;  1PGX A;  3AE9 A;  4HFB A;  4O1N A;  4PS8 A;  2CM0 A;  2W2U A;  4AWJ A;  3FIL B;  1BUI C;  4W9L A;  2C60 A;  1MMA A;  2NBW B;  3BVG A;  4URK A;  2M19 A;  5HI1 A;  3N9L A;  4CN1 A;  3I9V 1;  4L9I A;  2D2Q A;  5M4Y A;  2HTH A;  3NWI A;  2D0U A;  2LOS A;  2BVC A;  2LSY A;  3KVF B;  2CHO A;  4KZ0 A;  2VVS A;  2J1D G;  2H88 B;  4K1R B;  3DPD A;  4DR4 T;  4LNN A;  2LI5 A;  4HFE A;  1ENF A;  4OZB A;  3MKD A;  3AM9 A;  4IKG A;  3KYC D;  4C4V B;  4P1N A;  4QH4 A;  4A98 A;  2WU2 A;  2Z59 B;  3UU8 A;  2N9X A;  3GS2 A;  4GXB A;  3ZYY X;  4EEW A;  4ZYS A;  2IGD A;  3FZL B;  4ISS A;  2DZK A;  2KTF A;  2LKH A;  5JHA A;  3Q3J A;  3PUA A;  2KMM A;  3T9L A;  3UUL A;  2B76 B;  4AQ7 A;  3B9J A;  4J3O D;  3WAM A;  2IO2 B;  1NYR A;  2V4L A;  4GOC A;  5CJ5 A;  5J17 A;  4HPP A;  3FZF B;  4MLK A;  2J7Q B;  1KFY B;  3VKG A;  3M3J A;  1D1A A;  4KDL B;  5L3B B;  2LJI A;  2BYT A;  1P7E A;  4FAD A;  3CQG B;  2C5I T;  4E7Z A;  2J0M A;  2JMK A;  3RYI E;  5HCM A;  1Y8R C;  1NI2 A;  1ZOY A;  1ACC A;  2M0A A;  4KV2 A;  4ZYN A;  4E74 A;  5ABH A;  4KHZ F;  3RH3 A;  4UVA B;  4W9C A;  4US9 A;  4ICV A;  1E8W A;  2L3L A;  3C4W A;  3T1Y T;  2KDM A;  3UQA A;  1W09 A;  2E9X A;  4H9R C;  4UF0 B;  4QX8 B;  1CMX B;  1XT9 B;  2NTS A;  1NWM X;  4OZC A;  1KEY A;  1HZ6 A;  3GP7 A;  2WSS V;  2JU6 X;  1JRU A;  2RPV A;  3DBL I;  1QSD A;  3QAQ A;  2CU3 A;  3PUX F;  2LVO A;  3AE7 A;  2K22 A;  3OKQ A;  2J53 A;  4MAL A;  2D3G A;  3IVF A;  4YTM B;  4WWP A;  1T0Q C;  3K3O A;  2D2S A;  3F31 A;  2UU7 A;  4XGA B;  4HDQ A;  5LXT E;  2X0Y A;  2WU5 B;  1YJ1 A;  2O6V D;  3LBX B;  2KK8 A;  3PDY A;  1HNX T;  4LDT B;  5LMU T;  4RGN A;  4NAW A;  4ZHO A;  3S4U A;  5BMV E;  4CQI A;  1BR4 A;  2LGX A;  3EUH A;  4LFA T;  2ZCC A;  4OVV A;  3LB8 C;  4EXT A;  1CQV A;  1TT5 B;  5DPR A;  1QOG A;  2CPT A;  4OVU A;  4NPP A;  3VKH A;  3KBT A;  1STE A;  2QIL A;  4HWC A;  3VR9 B;  3NVV A;  3ZSS A;  3EUB 2;  1GC7 A;  3QUJ A;  4HRS A;  3UU6 A;  4EZH A;  4BJN A;  4F6R C;  5LP6 E;  2KOX A;  3TIX A;  1D1C A;  5J0Z A;  3VRB A;  2LMC A;  1VCS A;  2XSB A;  1XCQ L;  1Q1O A;  1YN3 A;  3SFD A;  1YQ3 B;  3NRZ A;  3WIM A;  3BIN A;  4D2K A;  1ET6 A;  5FP3 A;  3PRZ A;  3U7Z A;  3CIR B;  4NY0 A;  3SOL A;  1V86 A;  3I5J C;  4LFC T;  3J9C A;  3SS1 A;  4ZZB A;  4TQ0 A;  2XAQ B;  2X9X A;  4GKK T;  4MBQ A;  5FK9 C;  1SBB B;  2QEJ C;  1B9R A;  1ZKE A;  3NKZ A;  2HTM E;  5E0O A;  2MBB B;  1XLN A;  1YW0 A;  3X23 A;  1L7Y A;  3P4P A;  2WAU A;  2PW9 A;  3RN9 C;  2KLG A;  5HEJ A;  2A72 A;  5AQH B;  2ZPN A;  1U4A A;  2QIE B;  4A3O A;  2JQK A;  1E8Y A;  2ZZP B;  3ZDT A;  1J19 A;  4MH8 A;  3WCQ A;  3P4W A;  4HWD A;  2DYM A;  3LDQ B;  1GG3 A;  1VCT A;  5C23 A;  2CXD A;  2BKO A;  4EEB A;  3HKD E;  2M1M A;  3HHM A;  2TSS A;  3NS8 A;  2KTR A;  2L7R A;  4FA6 A;  2NW7 A;  4M1P A;  5JZE B;  3NZQ A;  4I4T E;  4P0B A;  3I9W A;  4ANV A;  4YSX B;  2D11 A;  1XNR T;  1Z2M A;  2LSK A;  5HYA A;  2IND C;  4FJO A;  2CEA A;  2WWU A;  5EK3 A;  2FUH B;  2W66 A;  1PFD A;  2INC C;  3ZVV A;  2V6Y A;  5KMG P;  1V97 A;  4IGU A;  5JR9 B;  1F2R I;  4NXN T;  3M63 B;  1WM2 A;  3TCA A;  1MMN A;  1V6E A;  5F3J A;  1WZ0 A;  4XWT A;  3ZNI D;  3W1S A;  1UD7 A;  2AWT A;  4PS3 A;  2XPK A;  1ZP0 B;  4U2Z A;  4I6N B;  3RF1 A;  2N7E A;  2ZM6 T;  4G2A A;  3RNC C;  2LXA A;  1HNZ T;  1PUT A;  1WSP A;  3DBR B;  4KDI C;  2UXD T;  2A3D A;  4II3 B;  1ZW7 A;  1MMD A;  3TEX A;  4LCD E;  4IDI A;  2XQ9 A;  2A4Z A;  1SF0 A;  3Q3F A;  1DOY A;  1JW9 D;  3P4S A;  5HCJ A;  4EUT A;  4EGW A;  4RM9 A;  3H7S A;  1NDD A;  4K81 A;  4OHF A;  4CXY A;  2CHZ A;  2ZJD A;  2BKN A;  3LDZ E;  5AUK A;  1PGB A;  4ARI A;  3IHR A;  4FJV B;  2BVM A;  2LRU A;  4ANW A;  3PSE B;  1FNV A;  5L3F B;  2JX5 A;  4DBG A;  1L4D B;  3I63 C;  1D5M C;  3H8H A;  1UK5 A;  1DOI A;  3T8M A;  3L09 A;  4PK4 A;  1VCB A;  4NJ7 A;  2JQH A;  4HFV A;  4ZI3 D;  3CST A;  2G0U A;  3TJP A;  4DVD A;  4CHK A;  4X1Y E;  4ILA A;  2BWE S;  3EEC A;  2C7H A;  3J7Y q;  2L0T A;  1LFD A;  3VDZ A;  4JI5 T;  5BR8 T;  2Z0E B;  4X66 T;  2CS4 A;  2WXH A;  2BZB A;  3NBX X;  4UDU C;  2AQ2 B;  3N9N A;  4YTP A;  3FHN A;  2KWD A;  3PPA A;  1XDP A;  3V3X A;  4DR2 T;  1I35 A;  4TSS A;  3Q2M A;  1FNW A;  3AB5 A;  2DI4 A;  4CN4 A;  3QNU A;  2NR4 A;  4A8X C;  4C91 A;  2XAS B;  4GKJ T;  3AE2 B;  2NCN A;  4L23 A;  2WMO A;  4F1S A;  2N9E B;  4LF4 T;  4TNV A;  3I3T B;  1OTR B;  3HKE E;  5CFB A;  4BA9 A;  3Q8C A;  3MTN B;  5LJN A;  1UWX A;  1C4P A;  1I4X A;  1EWY C;  5AQI B;  4RF1 A;  4NZL B;  3NZ3 A;  3NZU A;  3VR8 B;  5AQQ B;  5IP4 D;  1WXS A;  2FJD A;  1K52 A;  2AQ3 B;  2VWA A;  1V49 A;  3DCG A;  5FL0 A;  3PLU A;  5FXV A;  3H3A A;  5EE1 A;  4DV3 T;  3LJC A;  5LA6 E;  1SIF A;  3RC3 A;  4KP3 C;  1FJG T;  4DHZ E;  2GBM A;  5HEH A;  3NY5 A;  4IW0 A;  1WJU A;  1U4Q A;  1ROE A;  2CMR A;  2W54 A;  3N9Y C;  2N4F A;  4IDP A;  1LM8 B;  3ZCI A;  1TBE A;  3AEF B;  3O1J A;  3SD5 A;  2ODU A;  3Q9D A;  2PG8 A;  4JV5 T;  2HDE A;  2KVR A;  3I0Q A;  2C0S A;  3ZJV A;  1KOT A;  4U2Y A;  3IHP C;  2RPA A;  5L3C B;  1D0Z A;  1D1B A;  5AQL B;  3N2O A;  1M7K A;  2XQA A;  4KBM B;  2V8S V;  1LRZ A;  2X0H A;  3KIN B;  1HF8 A;  3AED A;  3P8C D;  2DWK A;  2ON8 A;  1OQQ A;  1TIF A;  4DND A;  4ZI2 C;  2D0T A;  4ZOH C;  3AEA A;  4AQG A;  1WXA A;  3RLF F;  1VRB A;  4ICU A;  1EM7 A;  1QT9 A;  3ZLI A;  4CQN A;  3V60 A;  4LF9 T;  1E90 A;  3O4X E;  1AJ3 A;  2BKF A;  5HXH A;  5D94 A;  2KDF B;  2MWS B;  4MAC A;  1WMH A;  4WBN E;  2KAC A;  2E9X C;  4FBJ B;  2WXO A;  1BR2 A;  5FR3 A;  2LKG A;  2K1F A;  4KIK B;  1D5X C;  2YU2 A;  3HKB E;  4IE5 A;  2E2A A;  1WXV A;  2LOP A;  2XSA A;  1QOB A;  1KM7 A;  4BBN C;  2KT9 A;  3SWH A;  2K3U A;  2RD0 A;  3FXE B;  1NI3 A;  3R84 B;  1UGM A;  2XTL A;  1C78 A;  3RRC A;  3PGE A;  2V7I A;  1IUE A;  2KX0 A;  1RM6 C;  3NVZ A;  2H3R A;  4DV4 T;  4LFB T;  2D07 B;  3RPF C;  3ONX A;  2KWH A;  2E9X D;  2HD5 B;  3ETU A;  4NNJ B;  1TZO A;  3JC6 C;  3PUQ A;  2IUB A;  4N9F 4;  3MK7 C;  1T7S A;  5FY7 A;  4EB6 E;  2O2V B;  3DVN U;  3AB3 B;  2NTX A;  2R2Q A;  3DWM A;  5JRC B;  4NQL B;  1J8C A;  4BKS D;  2CE7 A;  4DV0 T;  1E1H B;  3E56 A;  5AQK B;  5LNK A;  1RRB A;  3AVR A;  4O2A E;  3AXJ A;  2KC2 A;  1WX9 A;  2MYS A;  4W9D A;  4GGQ A;  3DHH C;  1HX8 A;  1L6U A;  3C0R B;  3RGL A;  4AS1 A;  4I43 B;  1K51 A;  2GMI C;  3C51 A;  2VUR A;  4TMA B;  3H37 A;  1WWT A;  3GZN B;  3UGB B;  3JC6 D;  4PJL A;  4GSW A;  1UUR A;  4TWH A;  2MBH A;  2HHH T;  1ZDX A;  2H89 A;  2WDR B;  1YN5 A;  3B2G A;  5LCY A;  4GYS A;  2M67 A;  5KX5 E;  2JQQ A;  2VQE T;  2N7D A;  1V5T A;  3SEB A;  2WWV A;  4NPN A;  4DR6 T;  2E5V A;  4HFI A;  2D9D A;  4EED A;  4YSZ A;  5L4E A;  2LHR A;  1E8Z A;  1OWA A;  3CQC B;  2M6I A;  2WLB A;  2CU1 A;  2YIN A;  3U2S C;  5G55 A;  2XK5 A;  4S0R A;  1C76 A;  5IO9 A;  2LXC A;  4WWO A;  4FHK A;  4I55 E;  5LBM A;  2E6X A;  4AIS A;  3PLV A;  2NTY A;  4WZX A;  4DDI D;  3KUZ A;  1C77 A;  4JUY A;  4DXF A;  3AE4 A;  5JDG A;  2XEW A;  3DVG Y;  3DQV A;  1F0Z A;  4EZJ A;  4WYV A;  4B3M T;  1F2R C;  2J47 A;  4O4I E;  3G06 A;  1WYW B;  4TN7 B;  1Q5W B;  3N2G E;  3OYX A;  1UBQ A;  4IL9 A;  3QOF A;  4DR5 T;  1MG4 A;  3A4S C;  2ZW0 A;  3D32 A;  5JTG A;  2KJR A;  3AEE B;  2DZJ A;  1CJE A;  1UUS A;  3CWI A;  4IE6 A;  2EKI A;  4KHP T;  1QLB A;  4PYZ A;  4MGZ E;  2WM9 A;  2FIF A;  1QIL A;  3SFE A;  2MBO A;  2YDQ A;  3K9O B;  4IWO A;  4U7Y A;  2DNF A;  2JT4 B;  3BQK A;  3HVZ A;  2BG9 B;  2SAK A;  1KNR A;  4ILU A;  4P1B C;  3L4P A;  1DOX A;  2G4D B;  3KV9 A;  5ABF B;  2J42 A;  2ACZ B;  3RPU A;  2X8X X;  3A1Q B;  2I2Y A;  1Z0P A;  2KDB A;  1I4P A;  5LXI B;  4YT0 B;  3JSV A;  3W1S C;  1WX7 A;  2FCN A;  5EE3 A;  1T5X D;  3IFW B;  2MQJ A;  2YKS A;  1R4M I;  5AQO B;  3EFU A;  2JMH A;  3AA0 B;  4IDQ A;  4DBR A;  2CHW A;  3VU7 H;  1I4R A;  3V6C B;  4FXC A;  2BGF A;  2YDR A;  2VQF T;  1I42 A;  1A70 A;  5H92 C;  2PE9 A;  2WDQ A;  4HEA 1;  5CX3 A;  1XLP A;  4MDK E;  3Q6B A;  2A2F X;  4M0W A;  4IM2 A;  2BQQ A;  2XN9 C;  1MVK A;  4ADZ A;  1P98 A;  2KMA A;  1VRA B;  2DLR A;  2V1D B;  3A9K B;  2LAS A;  3HA4 A;  2YEP B;  4YSY B;  3CX6 B;  4DMW A;  3JAD A;  5IA7 A;  1HTJ F;  1N6Z A;  2JIW A;  3VTV A;  2MP2 B;  4IOI E;  2H88 A;  1WYC A;  4OHJ A;  2Z8L A;  2H7V C;  4U74 A;  4RF0 A;  3CVR A;  4N58 A;  3L08 A;  3WAN A;  2KMF A;  3VUX A;  1MND A;  1UNS A;  3R8B A;  2L76 A;  2WCA A;  4K7U A;  2OOB B;  4C4V A;  2BF8 B;  4AKH A;  1F77 A;  1VZ6 A;  2DYO A;  2XAG B;  5FKY A;  3DHG C;  2W67 A;  1WRI A;  2X9H A;  1AN8 A;  1WFY A;  1EU4 A;  2CWY A;  1BR0 A;  2B76 A;  2N7J A;  2KYW A;  4ZI7 E;  2KQ4 X;  3TSS A;  1N33 T;  3DWG C;  4ZXL A;  1YMH E;  1T98 A;  1SE2 A;  2L0F A;  5E6O A;  3QB5 A;  4ZHQ E;  4MM3 A;  1KFY A;  1QOF A;  3MJ5 A;  4CI1 B;  4BAY B;  3JAF A;  4YJ2 E;  3WI3 A;  2RDH A;  1D6E C;  3M65 A;  2DL1 A;  4FN2 A;  4JPS A;  1N62 A;  4DHZ B;  1EU3 A;  3M3Z B;  2LRK A;  4UF0 A;  3A8Y C;  4DXA B;  2W62 A;  4W9I A;  3RNB C;  1K50 A;  1QF6 A;  4H9O C;  4IDO A;  2W82 A;  4ZZC A;  4DR1 T;  5JDL A;  2X9Y A;  4WAA A;  2JJ9 A;  5DAB A;  4YTM A;  5C3J B;  3CML A;  4B6X A;  2J4X A;  2JYE A;  3B13 A;  2WU5 A;  3FB2 A;  3LBX A;  1OQY A;  2R6G F;  3SU8 X;  3PO0 A;  3EI0 A;  4XZC A;  5BYS A;  3RNE C;  1V1O A;  1WGK A;  4XWW A;  2JY6 A;  2VRR B;  5G5H A;  2FCM A;  1IBX A;  3GE8 C;  3AEB B;  2FID A;  2RDG A;  4HPL B;  4PAG A;  3L10 B;  5LLI A;  3BVM A;  3QHT A;  2KC1 A;  2DHZ A;  3C64 A;  3ZMT B;  4HCP B;  2MJ3 A;  2A9U A;  1E0Z A;  4LF7 T;  1WYB A;  1ISN A;  2CHX A;  2JYT A;  2LVP A;  1ZKH A;  3SRZ A;  3DOW A;  3MP9 A;  3IT4 B;  2QJL A;  1UCU A;  1WH3 A;  5HXS A;  5EK2 A;  3BYY B;  3DBH B;  2KJ6 A;  4O4L E;  3VR9 A;  4U72 A;  1JWM D;  3BK2 A;  1I4G A;  4X5T A;  4Z91 A;  3FBL A;  3ETR A;  1IBK T;  4GB9 A;  3AI5 A;  3AE1 B;  2OA5 A;  1YN4 A;  4O2B E;  4IUM B;  5ABG A;  3KWV A;  4NQK E;  3AH7 A;  2LEH A;  1UZX B;  1YQ3 A;  1N61 A;  4H9N C;  4MM3 B;  5FYM A;  4AXP A;  3CIR A;  2VKJ A;  1FFU A;  1F9J A;  4L0R A;  1GNU A;  4RFB A;  3ZLZ A;  5AFU L;  5FXW A;  4JEH B;  5DQW A;  2WDV B;  3K3N A;  4M02 A;  2BB6 A;  3B57 A;  3N1X C;  3AA7 B;  5DPS A;  5AQP B;  4WIP A;  1WCR A;  3PTF C;  1D3Z A;  5CA1 E;  2M17 A;  5CB4 E;  1V81 A;  2NTT A;  3V62 A;  2Y8D A;  3ZC1 A;  3P63 A;  2HH7 A;  5L3E B;  4QH5 A;  1WGG A;  5HEG A;  3BK1 A;  1R7S A;  2DWG A;  4WWN A;  1JQ4 A;  1WE6 A;  4W9J A;  4IL4 A;  3QWZ B;  3VH3 B;  5T8I A;  4MEL A;  1OED B;  5JXV A;  4BKS A;  2VKO A;  4H9Q C;  2WXF A;  1V1P B;  3N20 C;  4ITK A;  2Q9Q B;  3MC0 B;  2MPK A;  2L9Q A;  4G11 A;  5LOV E;  2BG9 C;  1C79 A;  1L5P A;  2XBB C;  4ARC A;  3RUI B;  2UXX B;  4LF8 T;  1E2A A;  2FBW B;  4KGT A;  1FO4 A;  5J2U E;  4C7Y A;  4BFR A;  2CHN A;  2KVZ A;  2JZP A;  4LNO A;  2UXC T;  1IBX B;  1EUV B;  2QCZ A;  1RFK A;  3KUD B;  1R4N B;  3RI5 A;  3DTO A;  1C9F A;  4YSX A;  3TEW A;  2C9W B;  2OED A;  1OXZ A;  2ZEQ A;  1E7V A;  2IBI B;  2KQS A;  1ZHC A;  3E08 A;  3MAC A;  4UXN B;  2WP9 B;  1I4Q A;  3WAP A;  5JR9 A;  2KDE B;  2C7M B;  3PRP B;  1C4A A;  2LRW A;  1JWA D;  5D2M B;  1MHH E;  3EAB A;  4IIJ E;  1HNW T;  2W3S A;  2V26 A;  3JYU A;  4HKQ A;  2D3A A;  2KXJ A;  2VVN A;  4GK0 E;  3C50 A;  4V1A v;  1ZP0 A;  1YNT E;  1SE4 A;  1Z8U A;  3QK6 A;  2XJ7 A;  1KF6 B;  3ZO5 B;  3HR0 A;  5HEU A;  4FI5 A;  4QHO A;  4A5X A;  4DR3 T;  2AX5 A;  1UX4 A;  2DZI A;  4ACF A;  1GJZ A;  4PJJ A;  1D5Z C;  2IO1 B;  4GMV A;  4P6V F;  5AQM B;  4GU2 A;  2DYB A;  2KKC A;  4IWQ A;  2N1V A;  2MBG A;  2BTE A;  1BT0 A;  3ZYL A;  3AMZ A;  2QGS A;  1XMQ T;  4AIU A;  5FNV E;  1JWU D;  1IJ6 A;  2IDY A;  2L52 A;  2ZNV C;  1NEN B;  5IHY A;  3UU4 A;  4II2 B;  2CRB A;  4TWD A;  2XY8 B;  1MIV A;  4AJW A;  2BBH A;  5HAX A;  1P0R A;  2LHD A;  4AQF A;  3O1H A;  1D0Y A;  2V0G A;  2VKD A;  3TLT A;  5AUI A;  2YN6 A;  2IPK D;  2AE9 A;  1ESF A;  3DBR I;  2QC8 A;  1M4V A;  4J2C A;  3ZN0 B;  4UIG A;  1P1A A;  1CHU A;  2BBJ A;  3IAS 1;  2PPH A;  3Q69 A;  1HQR D;  5H6Q B;  3MHZ A;  4OK0 A;  3WAJ A;  5L47 A;  1T0S C;  3KDS E;  1X1M A;  3FBZ A;  4WJQ A;  1W0A A;  3MFG A;  3PHW B;  3PZ7 A;  2NW8 A;  2CLY C;  5DQV A;  5TAO A;  4YHH T;  2LGI A;  2MX2 A;  2KFK B;  4ANU A;  1YKH B;  3ZST A;  5AEK B;  3AE6 B;  3AE2 A;  2GBJ A;  2N0S B;  5A1L A;  2VH2 A;  2JZZ A;  2X68 A;  1QOA A;  4KUM B;  2PTF A;  1S3S G;  2DLB A;  1EF1 A;  3NUH B;  3SR6 A;  4COF A;  3N32 A;  3QC9 A;  2DAF A;  4REZ A;  2KQ7 A;  2NPT B;  4JI8 T;  1RLF A;  4A55 A;  4X1K E;  2ICI A;  3VR8 A;  1RAX A;  2PIA A;  3ABV A;  3RYF E;  3WAK A;  4DR7 T;  1AAR A;  1L4Z B;  2GBN A;  3R2I A;  3TUO A;  1IPG A;  3ZYK A;  2ZW1 A;  4KGR A;  1HTQ A;  1SE9 A;  3N9P A;  3H7P B;  2I0M A;  2M6B A;  4ZI3 C;  1HE8 A;  1E6E B;  4RGT A;  1V9D A;  3NG0 A;  3ONJ A;  5EE0 A;  4W9F A;  2OJW A;  4DBQ A;  1VJK A;  3L13 A;  4YTN B;  4HKA A;  4XBF B;  1N34 T;  2V7M A;  1XLO A;  4K7W A;  1L0X B;  3QA8 A;  2REX A;  1TGZ B;  3KV4 A;  4IWP A;  3AEF A;  4CI3 B;  5IUX A;  3NS1 A;  2FUG 1;  2D10 A;  3E22 E;  5HG2 A;  5AQF B;  2LJL A;  2LM9 A;  4ZOL E;  1QZE A;  3X1D A;  1P3Q U;  4E3C A;  3HIZ A;  4J6I A;  4XX5 A;  3AEC B;  1YJJ A;  3CX8 B;  1ZGU B;  3UQB A;  2VZK B;  1G6J A;  1PDX A;  4WQM A;  1UGJ A;  4HK2 A;  2E8I A;  4IM0 A;  3ZJ2 A;  4CZZ B;  3T1H T;  4XDC A;  3DDC B;  2L05 A;  2XUE A;  4WAF A;  4P0A A;  3FC4 A;  2L3Z A;  4KKJ A;  4IT4 A;  2ZCB A;  3O1I A;  2CA5 A;  2JQR B;  2RDB C;  2JQ9 A;  3VUW A;  3PS6 A;  3BZD B;  1WGY A;  3RQW A;  4ZRJ A;  5E6J A;  4YJ3 E;  3BYT B;  4GDK A;  5JDQ A;  2BDE A;  3EDV A;  1UWM A;  2K6Q A;  5AQG B;  3UTK A;  2D3B A;  3ZCJ A;  2LLY A;  4M01 A;  4IM3 A;  3ZTC A;  2N9K A;  1HS7 A;  3OAW A;  3PUR A;  4TNW A;  4X64 T;  1PGA A;  2QMT A;  3APD A;  4KIK A;  3VVW B;  2KLQ A;  2HPL A;  2V4I B;  4TZ4 C;  5HWY A;  2EHO B;  1L0V A;  3KFW X;  5BYR A;  2BKP A;  1OED C;  1FCL A;  2V7K A;  1MIW A;  2FAZ A;  3D0T A;  5FY1 A;  1UEL A;  4XZ4 A;  2YEV C;  4USA A;  2K25 A;  4YXD B;  3JCF A;  3LJ3 A;  3ABV B;  3ZW3 A;  2XQ7 A;  2K6D B;  4HGA A;  2D5G A;  4ZS2 A;  2FJA A;  4BOZ B;  1Y64 B;  3BII D;  2H7O A;  1UF0 A;  3AE3 B;  2O2V A;  2NVU I;  1T8B A;  5JRC A;  2Y5C A;  2G45 B;  3PV1 A;  1RYJ A;  4U31 A;  2L32 A;  3U30 A;  2Y5B B;  3BK9 A;  2BS3 B;  1FXT B;  4A56 A;  2R2O A;  5LMN T;  5HXR A;  3VUY A;  3APF A;  2F4V T;  2X38 A;  3DBS A;  4P1C C;  3IEE A;  5FR6 A;  5C8Y E;  4LDT D;  5L3G B;  2RMM A;  1VZ8 A;  2R61 A;  3ZJ1 A;  2W9N A;  2YLM A;  4TQ1 A;  2NMQ A;  4TWF A;  4HEA A;  1SUM B;  2WDR A;  1VDV A;  1WR6 A;  5JQG E;  3ZJU A;  3ANW B;  1N63 A;  4DUY T;  4WWM A;  3RZW C;  5BMI A;  2SPC A;  1PYW D;  1XEE A;  4LMK A;  2HJ8 A;  4NJ6 A;  3U7D A;  2IW5 B;  2YOE A;  1WR0 A;  4UVC B;  5HXC A;  4GDK B;  1MJD A;  3ZN1 B;  1T3Q A;  4PJM A;  3CSF A;  5AQR B;  2VAS A;  4LF6 T;  3U3I A;  3PVL A;  5J2R A;  3PJA J;  2GBR A;  2FE8 A;  2V3S A;  2MAW A;  3A5X A;  3N5L A;  3L3P A;  1BR1 A;  1AW7 A;  3KBU A;  2I1J A;  4LNI A;  1L0V B;  1TJE A;  1T0R C;  3T3N A;  1CK1 A;  3URY A;  3CKD A;  3GZN I;  1QUU A;  3ONL C;  5BO4 B;  3A7M A;  1LXD A;  4LK0 M;  3N9O A;  3ZC0 A;  4P7I A;  2C5K T;  1Q10 A;  4HCN B;  3WAO A;  4JE3 B;  4ASW C;  3OPC A;  3RIA A;  4K3C A;  4WJP A;  4PK5 A;  4RMA A;  1N36 T;  1R8I A;  3AEE A;  5C2T B;  4KX6 B;  4LML A;  3RIU A;  1KH0 A;  4WQO B;  4QKN A;  3B08 A;  1FRD A;  3U8Z A;  3OWE B;  3AN1 A;  2IY1 B;  2UYZ B;  4HJG E;  1XF5 L;  1Y56 A;  3DP7 A;  2WWZ A;  5JRE A;  2L00 B;  5FVK A;  2KX3 A;  4P16 A;  3EGR A;  2LSG A;  4XAX B;  2OJR A;  2KN4 A;  2WXM A;  1WX8 A;  3L8R A;  2EKE C;  3P4Q B;  3KV6 A;  2BG9 A;  3PRE A;  3ZT6 A;  2MLB A;  4CYE A;  2XQ8 A;  3PU3 A;  4GYR A;  4L1B A;  1IGD A;  5JDF A;  2PEA A;  2MHJ A;  3AEG B;  3Q3M C;  5ABF A;  5IYZ E;  4EYU A;  5JR9 C;  2ACZ A;  1L0Y B;  3A1Q A;  2KD0 A;  5CA0 E;  5E6N A;  3DVN V;  2M56 B;  3AE8 B;  5AQU B;  2LHE A;  4YT0 A;  3ZT7 A;  3B1L X;  2I1K A;  3EHV A;  5CHW A;  2I6H A;  1RFA A;  2ONQ A;  4RGO S;  3ZEF B;  2J52 A;  4C90 A;  4A90 A;  5LYJ E;  1JNR A;  3AVS A;  3A9J B;  3AV8 A;  4PFO A;  3N1Z C;  4BKG A;  3KVB A;  3GN5 B;  1TY0 A;  1N5X A;  1J7C A;  2MW5 A;  1XD3 B;  4QXB B;  1K8R B;  3W9C B;  1YIW A;  2BWF A;  3V61 A;  3PZ8 A;  1XQQ A;  2V6X A;  2NWB A;  4PT5 A;  3JW0 X;  2QA7 A;  5AQN B;  4BJM A;  1QQR A;  3N30 A;  2GK9 A;  2EEL A;  4JI4 T;  3A9K A;  3NVY A;  3BQL A;  1FXI A;  4IE0 A;  1HG2 A;  4YSY A;  1T6B X;  4A20 A;  3MZK B;  4NAM A;  2VKH A;  4CXX A;  1VD2 A;  2C5L C;  2MP2 A;  3V5S A;  4AQF C;  2X9W A;  1TKG A;  2LFI A;  2LWP A;  4KSL C;  3MHS D;  2N9D A;  2PJQ A;  3Q3O C;  3GA8 A;  1KNP A;  3NOB A;  1OEY J;  4G50 A;  3T3O A;  2W00 A;  4EFO A;  4XC2 A;  3VRA B;  3KV5 A;  1NYQ A;  2K9A A;  2ACX A;  1TS4 A;  2NW9 A;  2AL3 A;  2GBK A;  3ZMZ B;  4BKT A;  4DID B;  2PTL A;  2WQY B;  3O13 A;  2RGF A;  2X66 A;  4WJO A;  1J7B A;  3ZRC A;  4PW8 A;  2O6V B;  1XMO T;  1J0G A;  3L54 A;  3RX6 A;  3Q5W A;  2UXN B;  2NP9 A;  4HTE A;  3OVU A;  1YX6 B;  4IE7 A;  2XQ5 A;  4GIV A;  1O3X A;  3RRW A;  1IBL T;  5DJQ C;  2ZM0 A;  4FJZ A;  1WE7 A;  1WGH A;  3PE0 A;  2UUB T;  3IBE A;  1GQE A;  1SB3 C;  1MG8 A;  2J62 A;  3VAW A;  3MJW A;  2ZM8 A;  4TV3 A;  1N60 A;  2Z0D B;  4IC7 B;  3ZPO A;  3U52 E;  2WZI A;  3Q2A C;  1YOV B;  4AJY B;  1HR0 T;  2XQ6 A;  4GIW A;  4TUU A;  1MFW A;  1JWS D;  4MJS B;  3RYT A;  1QKZ A;  5EDS A;  3TLU A;  2K8H A;  2JPF A;  3C4X A;  2PJH A;  5HFY A;  4JLE A;  2WS3 B;  4QH1 A;  3EFC A;  5C3J A;  3E0Z A;  3MXZ A;  3P4R B;  3S2A A;  4HWF A;  4HJK A;  1SEB D;  2Y48 B;  2M0X A;  4ZS3 A;  2PKO A;  2P9B A;  2BS2 B;  4F7Z A;  1FIQ A;  5LHH B;  4DXG A;  2W3R A;  4RCO A;  2DBY A;  1SE7 A;  5E6P A;  3PJA A;  3AEB A;  3H9D A;  5DCN A;  5DPT A;  4M00 A;  2KLC A;  4WBO A;  3IT6 B;  3QIJ A;  1E10 A;  4B95 A;  5AZG A;  2DNX A;  2NBV B;  3IAM 1;  2GB1 A;  2V5C A;  2W0G A;  2WXQ A;  3NRX A;  4DUZ T;  2IY0 B;  3BY4 B;  4ZRQ A;  3VFK A;  1M94 A;  2NR2 A;  5EZY E;  4TX5 A;  3RIF A;  1WF9 A;  1WYG A;  4WJN A;  4OYJ A;  4B9K A;  3VTU A;  4BVU C;  4YHJ A;  3J9X 1;  2PVO D;  4HWH A;  4B3S T;  2EMT A;  4Q25 A;  3AE1 A;  4K3B A;  2MCN B;  1SJH D;  3HK0 A;  1XNQ T;  3V5U A;  2IIU A;  3T8O A;  3RNA C;  4BBN F;  4ZRK A;  4BAX A;  1FCC C;  2KHW B;  1TS2 A;  2L1A A;  2V3P A;  4QX7 B;  3PTR B;  1NEK B;  4RH6 A;  1EO6 A;  4QXH B;  5FY0 A;  3R2T A;  5JDN A;  2KJH B;  4LJO B;  2WDV A;  4N6E B;  2DAJ A;  4F8C B;  2VL0 A;  2BYF A;  3O65 B;  5IAA C;  2JWU A;  5DPW A;  5TSS A;  2C5J A;  5JH7 E;  1GPX A;  1I7H A;  4EOY A;  3ZKJ C;  3CK6 A;  3PUS A;  4NIQ A;  2WMN A;  4JEU B;  1PQS A;  2MH7 A;  2KZ7 B;  1FNU A;  1HTO A;  3DBH I;  2WX0 A;  1US7 B;  3UUB A;  1C3T A;  3TBL D;  3W15 B;  5GMV A;  1JML A;  1C4C A;  1T0Y A;  3TLV A;  3RCZ A;  5LXH A;  1OED A;  2VL8 A;  4I50 E;  2ZLY A;  1V1P A;  3MC9 A;  2Q9Q A;  2KAJ A;  4K0K T;  1FMV A;  5G2N A;  1YXR A;  4KMC A;  1ZE3 D;  1S1Q B;  2HJ1 A;  1WR1 A;  2GRI A;  5AZF A;  2X67 A;  3ALB A;  2FBW A;  3ZT5 A;  1B7T A;  2WGS A;  2NS5 A;  1I6Z A;  2WB5 A;  3PT2 B;  4PJN A;  2M4N A;  1V9J A;  3VTW A;  2UXB T;  4UVB B; 
#chains in the Genus database with same CATH homology
 4AJW A;  1SIF A;  1P0R A;  1SGH A;  2QHO A;  4DHZ E;  2GBM A;  3NY5 A;  1IP9 A;  4IW0 A;  1WJU A;  2J0J A;  4W9G A;  3JVZ X;  3ZUN A;  3DBR I;  3A33 B;  2N4F A;  3TMP B;  1LM8 B;  4FHJ A;  1TBE A;  2ZPY A;  2DX5 B;  3SD5 A;  2LGY A;  1P1A A;  4EZK A;  4GDL B;  1WI0 A;  5HKH A;  1L2N A;  2PPH A;  2KVR A;  3UIN B;  4B6W A;  3X0W A;  1KOT A;  3IHP C;  2N1W A;  4DHJ B;  5AQL B;  1M7K A;  1X1M A;  3L16 A;  4WJQ A;  3PHW B;  2GOW A;  4KSK C;  1OEY A;  4PYU A;  2MX2 A;  2KFK B;  2G4S A;  4ANU A;  1WRD B;  2WX1 A;  2C7N B;  4FLH A;  5AEK B;  2JPH A;  1WXA A;  5D6J B;  1WGD A;  4HVB A;  3ZNH B;  2GBJ A;  4ICU A;  2JZZ A;  4K7S A;  3V60 A;  1R4N I;  1S3S G;  1E90 A;  1EF1 A;  3N32 A;  3ZDM C;  2DAF A;  2BKF A;  5D94 A;  2L8J A;  3KH0 A;  3SHQ A;  2KDF B;  2MWS B;  2DZM A;  2KQ7 A;  1WMH A;  2JRH A;  2NPT B;  4FBJ B;  3OJ4 B;  4MSM B;  4KIK B;  2K1F A;  1RLF A;  2RR9 A;  1GUA B;  1E5W A;  1RAX A;  3RUL A;  2GBN A;  1WJ4 A;  1AAR A;  2DEN B;  1WXV A;  3M62 B;  1V5O A;  3UIP B;  1IPG A;  1KM7 A;  4BBN C;  1V2Y A;  1SE9 A;  2A5U A;  2KWC A;  2RD0 A;  3H7P B;  4M8M A;  2JXX A;  4ZRI A;  1HE8 A;  1H4R A;  1UGM A;  3KYD D;  3R7R A;  4JQW C;  3PGE A;  3WA0 A;  2KX0 A;  3ZIM A;  4W9F A;  2IYD B;  2KMC A;  3L13 A;  2XK5 B;  4K7W A;  2AEH A;  4TKN A;  3QA8 A;  4M8N A;  2UWQ A;  3W1Y A;  2REX A;  1TGZ B;  2D07 B;  4IWP A;  4W9E A;  2HD5 B;  2JWZ A;  2FNJ B;  4NNJ B;  1Q0W B;  2D10 A;  4GDL A;  3FZM B;  5AQF B;  4N9F 4;  1QZE A;  4HPM B;  1P3Q U;  3H6N A;  4E3C A;  3HIZ A;  1T7S A;  2O2V B;  4J6I A;  3DVN U;  4XX5 A;  2R2Q A;  4AP4 C;  3R7Q A;  1ZGU B;  4NQL B;  3UQB A;  1J8C A;  2KWU B;  2JUO A;  4BKS D;  1G6J A;  2BPS A;  2KAN A;  2KFK A;  4G0N B;  4HK2 A;  4IM0 A;  5AQK B;  2K39 A;  1RRB A;  5AQS B;  3DDC B;  2L05 A;  2KC2 A;  2L3Z A;  1WX9 A;  2ZCB A;  3VUW A;  4W9D A;  4GGQ A;  3PS6 A;  3C0R B;  1WGY A;  2YVC A;  4ZRJ A;  2JZ3 B;  3HM3 A;  3IG3 A;  2GMI C;  3UF8 A;  2ZVO A;  2ZNV B;  3R3M A;  4GDK A;  3UGB B;  2K6Q A;  5AQG B;  4GSW A;  2MBH A;  3N3K B;  1WZ3 A;  2G3Q B;  4IM3 A;  3ZTC A;  2NPT A;  3OAW A;  3APD A;  4KIK A;  3CMM B;  3VH4 B;  2BYE A;  3R66 C;  3VVW B;  2NBU A;  2N7D A;  2LJ5 A;  1V5T A;  3OLM D;  3V6E B;  4NPN A;  4AUQ C;  2AYO B;  2D9D A;  2LD9 A;  3H7P A;  4JIO U;  1WM3 A;  1E8Z A;  2FAZ A;  3JSV B;  1UEL A;  4JL9 A;  4HWI B;  2CU1 A;  4HXD A;  4CO7 A;  5G55 A;  4XZ4 A;  2XK5 A;  2LXC A;  4MGI E;  4WWO A;  2K25 A;  4FHK A;  5JHB A;  2KZR A;  3ML8 A;  3FZK B;  3LJ3 A;  2WDT B;  3PLV A;  3ZW3 A;  2K6D B;  4DDI D;  2K8B A;  3KUZ A;  4I6P A;  5CHF A;  2XEW A;  3DVG Y;  3QX1 A;  3DQV A;  4EZJ A;  4KZC A;  4BOZ B;  1WYW B;  4M0W B;  2O2V A;  1Q5W B;  2NVU I;  1WXM A;  2KDI A;  5AQJ B;  3PV1 A;  1UBQ A;  2G45 B;  1WR6 E;  3TL5 A;  1LQB A;  3U30 A;  2Y5B B;  4PS8 A;  3A4S C;  4AOF A;  4E74 A;  4AWJ A;  3D32 A;  1FXT B;  2R2O A;  2KJR A;  2MBE A;  4W9L A;  2C60 A;  2DZJ A;  2NBW B;  3AUL A;  4URK A;  2KO3 A;  4GN1 A;  3VUY A;  3PRM B;  5C1Z A;  3APF A;  2D2Q A;  3DBS A;  4PYZ A;  5D7G A;  2HTH A;  5FR6 A;  3KVF B;  4LDT D;  4MGZ E;  2FIF A;  4KZ0 A;  2MBO A;  4G3X B;  2FCQ A;  2W9N A;  3K9O B;  3DPD A;  2YLM A;  4IWO A;  4K1R B;  4MH0 E;  4TQ1 A;  1TTN A;  2JT4 B;  2LI5 A;  2LGD A;  1Z5S B;  3KYC D;  2Z59 B;  4GXB A;  2N9X A;  3RZW C;  2G4D B;  2MA9 B;  4EEW A;  2HJ8 A;  2RPQ A;  4FJY A;  4HDO A;  4PS7 A;  4NJ6 A;  5L95 C;  3A1Q B;  3U7D A;  3FZL B;  4NAW B;  2KDB A;  2DZK A;  2KTF A;  4GDK B;  3ZTD A;  5LXI B;  5JHA A;  3GOE A;  3Q3J A;  3JSV A;  3W1S C;  1WX7 A;  2FCN A;  3CSF A;  5AQR B;  4EKU A;  3IFW B;  2MQJ A;  3T9L A;  3PVL A;  1R4M I;  5J2R A;  5AQO B;  3EFU A;  1TZ1 A;  2GBR A;  2IO2 B;  2V4L A;  4GOC A;  3WAM A;  2CHW A;  2V3S A;  3V6C B;  5J17 A;  2BGF A;  3FZF B;  1I42 A;  2J7Q B;  2I1J A;  2PE9 A;  3M3J A;  4KDL B;  1NBF C;  5CX3 A;  3GZN I;  5AQT B;  5BO4 B;  1LXD A;  4FAD A;  2J0M A;  4FUL A;  1KJT A;  4MDK E;  5CTR C;  4P7I A;  1Y8R C;  1NI2 A;  1UBI A;  4HCN B;  4IM2 A;  4KV2 A;  4ZYN A;  3VXW A;  1C1Y B;  4W9C A;  3WAO A;  4ASW C;  4ANX A;  5KHQ A;  3OJ3 A;  4ICV A;  1E8W A;  4WJP A;  4BOS C;  1P98 A;  3AXC A;  3UQA A;  2KMA A;  4MSQ B;  4RMA A;  1CMX B;  1XT9 B;  5AQV B;  3A9K B;  1H8C A;  4WQO B;  2LAS A;  3B08 A;  3U8Z A;  1JRU A;  2JRI B;  3DBL I;  3QAQ A;  2IY1 B;  2UYZ B;  5IA7 A;  2N9P C;  2LVO A;  2WWZ A;  3VTV A;  2MP2 B;  2L00 B;  4MEM A;  2KX3 A;  3IVF A;  2D3G A;  4WWP A;  3WAL A;  2OJR A;  3L08 A;  2K8C A;  3WAN A;  3PRE A;  3VUX A;  1WX8 A;  2EKE C;  3SDL C;  5L83 A;  3VHT C;  4HDQ A;  2MLB A;  2L76 A;  4K7U A;  4CYE A;  2OOB B;  2BF8 B;  1YJ1 A;  2O6V D;  1V80 A;  2KK8 A;  3QK0 A;  2DYO A;  3B0A A;  2PEA A;  1YD8 U;  4LDT B;  3DVG X;  5KHO A;  3A1Q A;  2KD0 A;  3A4R A;  4NAW A;  5E6N A;  3DVN V;  1WFY A;  5AQU B;  3B1L X;  2I1K A;  3EHV A;  5CHW A;  1RFA A;  2KWV B;  3NZS A;  2LGX A;  2IO0 B;  2ZCC A;  4OVV A;  4DHJ D;  3A9J B;  4BKG A;  5DPR A;  2L0F A;  5E6O A;  4OVU A;  4MM3 A;  4HWC A;  4MGK E;  2MW5 A;  1XD3 B;  1K8R B;  2KTR B;  1YIW A;  2BWF A;  3V61 A;  3ML9 A;  3L0W B;  3P2B A;  1XQQ A;  2CR5 A;  2RSU A;  1KLV A;  1GC7 A;  4FN2 A;  3UIO B;  3JW0 X;  5AQN B;  3ENE A;  1YQB A;  4DHZ B;  3M3Z B;  2KOX A;  3TIX A;  3N30 A;  3A8Y C;  1Q1O A;  3A9K A;  4DXA B;  3RZF A;  3WIM A;  3BIN A;  3PRZ A;  4W9I A;  4IG7 B;  4NY0 A;  4A20 A;  1V86 A;  3QCA A;  4TQ0 A;  2KFJ A;  2MP2 A;  2C5L C;  1VD2 A;  4WAA A;  2MRP A;  1WJ6 A;  2LWP A;  4KSL C;  3MHS D;  2MBB B;  3X23 A;  1L7Y A;  2V1Y A;  1OQY A;  3NOB A;  1OEY J;  2KLG A;  3QJZ A;  4G50 A;  3SU8 X;  5AQH B;  2ZPN A;  1UGO A;  2LVQ A;  4EFO A;  1U4A A;  4XC2 A;  1WJN A;  2JY6 A;  2VRR B;  4A3O A;  3ZNG C;  2FCM A;  2FID A;  2AL3 A;  1E8Y A;  2ZZP B;  2GBK A;  3APC A;  3H1U A;  4HPL B;  3L10 B;  5LLI A;  4BKT A;  3ZDT A;  5AZH A;  3QHT A;  1J19 A;  2KC1 A;  2RGF A;  3HM6 X;  2DHZ A;  4HWD A;  4WJO A;  3ZRC A;  2DYM A;  2O6V B;  2B3A A;  4HCP B;  1HX1 B;  1J0G A;  3L54 A;  3A9J A;  3LDQ B;  1ISN A;  2CHX A;  1GG3 A;  2LVP A;  1ZKH A;  3DOW A;  5C23 A;  1YX6 B;  2BYV E;  1WH3 A;  3KW5 B;  2M1M A;  2ZVN A;  4GIV A;  3HHM A;  4FJZ A;  2KJ6 A;  3NS8 A;  2KTR A;  4MGY E;  4RM8 A;  2L7R A;  1WE7 A;  1UH6 A;  1WGH A;  4FA6 A;  5JZE B;  4DWF A;  3IBE A;  1MG8 A;  4GB9 A;  3AU4 A;  3AI5 A;  3VAW A;  4ANV A;  3MJW A;  3PZD A;  4TV3 A;  2Z0D B;  4IC7 B;  2D11 A;  4IUM B;  4NQK E;  1Z2M A;  3RD2 A;  4AJY B;  3ZNZ B;  1UZX B;  3NHE B;  2FUH B;  4TUU A;  4MJS B;  3RYT A;  4W9K A;  3ZVV A;  1F9J A;  1GNU A;  2IZV B;  3ZLZ A;  5EDS A;  2K8H A;  3M63 B;  1WM2 A;  2PJH A;  3TCA A;  5DPS A;  1V6E A;  5AQP B;  1WZ0 A;  3ZNI D;  3PTF C;  4LJP B;  2M17 A;  3RT3 B;  1UD7 A;  3W1S A;  2AWT A;  1D3Z A;  3QQ8 B;  1V81 A;  2MBQ A;  4PS3 A;  3S2A A;  3V62 A;  4DK5 A;  4HWF A;  4HJK A;  4I6N B;  4HLE A;  1WGG A;  2N7E A;  2J0K A;  1M62 A;  2LXA A;  2M0X A;  4WWN A;  4KDI C;  4F7Z A;  1WE6 A;  3AU5 A;  4II3 B;  1ZW7 A;  4W9J A;  3K9P B;  3QWZ B;  4KVG B;  4LCD E;  3VH3 B;  5E6P A;  2A4Z A;  5JH5 C;  4MEL A;  4BKS A;  3Q3F A;  3H9D A;  5DCN A;  5DPT A;  2KLC A;  4EUT A;  4RM9 A;  2O6V A;  3H7S A;  3QIJ A;  1NDD A;  4G11 A;  4B95 A;  4K81 A;  5AZG A;  2NBV B;  2CHZ A;  2ZJD A;  3LDZ E;  2XBB C;  1E8X A;  3RUI B;  4FJV B;  2LRU A;  2MSE D;  2IY0 B;  3QAR A;  4ANW A;  3BY4 B;  3PSE B;  3ZRF A;  3VFK A;  4BFR A;  4ZDV A;  1M94 A;  2NR2 A;  5TR5 A;  1WF9 A;  4WJN A;  4DBG A;  5J18 A;  4B9K A;  2KN5 A;  1E7U A;  3VTU A;  1EUV B;  4BVU C;  4DDG D;  2ASQ A;  1YX5 B;  4A3P A;  4JLC A;  1UK5 A;  3T8M A;  3KUD B;  4HWH A;  2EMT A;  2CKH B;  2MCN B;  1VCB A;  3HK0 A;  4NJ7 A;  2C9W B;  4BBN F;  3CST A;  4ZRK A;  2KHW B;  2ZEQ A;  1E7V A;  2WYQ A;  3TJP A;  3PHX B;  4CHK A;  2BWE S;  2IBI B;  2KQS A;  3EEC A;  1EO6 A;  2C7H A;  2L0T A;  4MJS A;  1EF5 A;  1LFD A;  2IO3 B;  2KJH B;  4LJO B;  3VDZ A;  2Z0E B;  3WAP A;  2KDE B;  2C7M B;  2CS4 A;  3PRP B;  2BKR B;  2DAJ A;  2LRW A;  2LZ6 A;  4F8C B;  2BYF A;  3ONS A;  3M95 A;  3O65 B;  3VQI A;  5IAA C;  2KNB A;  1WIA A;  3EC8 A;  3PPA A;  5DPW A;  1IYF A;  1I35 A;  3JYU A;  4EOY A;  1P9D U;  2KXJ A;  4JGH B;  3ZKJ C;  4E71 A;  1PQS A;  3DBH I;  2WX0 A;  1C3T A;  3TBL D;  3ZO5 B;  1WGR A;  4X57 B;  2LUE A;  5GMV A;  2NCN A;  3FZH B;  1OGW A;  1T0Y A;  2M8S A;  3RCZ A;  2N9E B;  4F1S A;  2FCS A;  4W9H A;  4EZL A;  5LXH A;  3L17 A;  3I3T B;  1OTR B;  2JF5 A;  3ECI A;  4I6L B;  3MTN B;  5CHV C;  1WMH B;  5G2N A;  2DZI A;  1GJZ A;  3CF6 E;  2IO1 B;  2JVC A;  4GMV A;  1S1Q B;  5AQI B;  2PE6 B;  5AQM B;  1WR1 A;  4GU2 A;  5AZF A;  3NZU A;  3ALB A;  5AQQ B;  2DYB A;  1WXS A;  2KKC A;  3QC8 B;  4IWQ A;  2N1V A;  4YL8 A;  3KUC B;  1BT0 A;  2HE7 A;  1V49 A;  3DCG A;  2NS5 A;  5D2M B;  1I6Z A;  2EMS A;  3PLU A;  2ZNV C;  1WY8 A;  3PT2 B;  4II2 B;  1A5R A;  2M4N A;  1GC6 A;  2AL6 A;  1V9J A;  3VTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...