4HWIB

Crystal structure of atbag1 in complex with hsp70
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
177
structure length
177
Chain Sequence
MIRVRIKYGAVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock cognate 71 kDa protein
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
total genus 66
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwiB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hwiB01
4IWOA 2KOXA 3A9JA 4FHJA 4AWJA 3L0WB 5AQSB 1WYWB 3DOWA 4MM3A 4FJVB 1A5RA 1Y8RC 2MBOA 2FCNA 4NY0A 1XT9B 4P7IA 3ZNZB 3H7PA 4BKTA 1WXMA 2KVRA 3ZO5B 1E7VA 1E90A 2EKEC 2JT4B 1V81A 2K25A 4A3PA 2KMAA 3PTFC 4IUMB 3W1SA 3ZDTA 4BKSD 1P3QU 2CHZA 4RM8A 2LJ5A 2VRRB 4CHKA 1H8CA 3ZNGC 3VXWA 2C7NB 2KC1A 3AI5A 2NPTB 2RPQA 3W1YA 3N30A 1E8YA 2C9WB 2K8CA 5AQHB 1WFYA 4W9EA 4GIVA 3QAQA 1FXTB 1WGRA 2L05A 3TL5A 3PZDA 2XK5B 3QJZA 1WGDA 1YIWA 5HKHA 1RLFA 4LDTD 3Q3JA 2KX3A 2AWTA 2KDEB 4W9CA 1H4RA 2O6VD 5GMVA 3N32A 3ZTCA 4FJYA 4BBNC 1I6ZA 1OGWA 3S2AA 2NS5A 1OEYA 2LGDA 2PE9A 2NPTA 1TTNA 2NBUA 1J8CA 2C7MB 2FIFA 2PJHA 3UQBA 4ZYNA 3ZVVA 2L0TA 3QHTA 2IY1B 1I35A 1IPGA 4EZLA 2JUOA 2REXA 1F9JA 2HJ8A 5KHQA 2N1VA 3CSFA 5J2RA 2GBRA 4B6WA 1EF1A 1WGYA 4JGHB 4MSQB 3QX1A 2N1WA 3TCAA 4GN1A 1WJ4A 1J19A 2KWCA 5AQVB 2BYEA 4IWQA 4HWCA 4MGKE 4PS8A 4E3CA 2KO3A 1KOTA 3A1QB 2M17A 1LQBA 3ZIMA 2HTHA 4LDTB 3OJ4B 4G3XB 2WDTB 3R7RA 4BKSA 4FBJB 2KTFA 3UIPB 3WA0A 2O6VB 2DYMA 4DDGD 2N9EB 4B9KA 1J0GA 1WGGA 5D7GA 3NZUA 3FZFB 4ANUA 2KWUB 5DPWA 3QC8B 4G0NB 3X0WA 3DVNV 4LCDE 3ZTDA 3PSEB 4ICUA 4DXAB 2KC2A 1E8XA 2ZPYA 3AU5A 4AOFA 5AQRB 3A1QA 3UQAA 4KDIC 2KQSA 4IG7B 5D2MB 4EZJA 2N7EA 1WJUA 3RD2A 3PS6A 5E6OA 2O6VA 5AQKB 2FIDA 3RZWC 3RUIB 4EZKA 3H1UA 2MBQA 5L83A 1S1QB 3L16A 1E8WA 4W9JA 1KM7A 4WWOA 1WH3A 3L17A 2LRUA 2MP2B 4BFRA 2KJRA 2LVOA 3M63B 4HPMB 2LWPA 2WYQA 4J6IA 3IBEA 4II2B 1WR1A 2A5UA 3DVGY 2K6QA 2LRWA 3H6NA 3H9DA 1V6EA 5AQFB 4PS7A 1UGMA 3M3JA 4GMVA 2CHXA 3B1LX 4GB9A 4KVGB 4A20A 3NY5A 4F8CB 3NHEB 3LJ3A 2MRPA 2NR2A 1AARA 3C0RB 3NS8A 3ECIA 2D10A 3PGEA 4OVVA 2DENB 3DBSA 5CHWA 4WAAA 2MP2A 4AUQC 5AQQB 4NNJB 3R66C 1WM2A 2KXJA 2CS4A 3KYCD 3UGBB 1M7KA 4DDID 4ICVA 4W9GA 3LDZE 1WXVA 2C7HA 1V86A 2JY6A 1WE6A 1WY8A 3ML9A 4CYEA 4F1SA 4FADA 2J0MA 4XX5A 2UYZB 2ZNVC 4PS3A 4K81A 2NBVB 4HK2A 2LXCA 4HVBA 2JF5A 5AQOB 2K39A 2KDIA 3NOBA 1UBQA 3U30A 4GU2A 1WX8A 1WM3A 3RCZA 1P0RA 4IWPA 3PRPB 4NAWB 3BY4B 4BBNF 2CU1A 3A4RA 1RAXA 1GG3A 3U7DA 5JH5C 2J0JA 2ZEQA 2FAZA 2G4SA 2DX5B 2KZRA 4IC7B 2IBIB 2M4NA 3VDZA 5AQGB 4HJKA 2MQJA 4WJOA 1X1MA 3SDLC 4EUTA 5E6PA 3ZLZA 3L54A 2GOWA 4I6LB 1WF9A 4HDQA 3PVLA 1UBIA 4NAWA 3JW0X 5IA7A 1V5TA 2IYDB 2KFJA 4N9F4 1GJZA 3K9OB 5DPTA 3ZUNA 2G4DB 3A9KB 1OQYA 1HE8A 2I1JA 2OJRA 2EMTA 4EKUA 4KSLC 2PPHA 3PLUA 3Q3FA 2OOBB 1WE7A 2DZMA 2AEHA 2M0XA 4ZRIA 5G55A 4FJZA 2PEAA 3DDCB 2K1FA 2M8SA 4HPLB 4KZCA 3V60A 2D11A 2IO0B 2MSED 1EO6A 3VH4B 2IO3B 2DYOA 4WWNA 4GDLB 4FHKA 3X23A 5AQUB 2R2QA 3UF8A 4HWFA 3A9KA 3KVFB 2FCSA 3PRZA 5CHVC 1P1AA 3ZRFA 1KLVA 2V1YA 4XZ4A 2K8BA 2DAJA 2RSUA 4BKGA 1WXAA 1YJ1A 2BKRB 1UD7A 1Z5SB 2NVUI 5DCNA 3O65B 2BWFA 3UINB 4JL9A 1WRDB 3HK0A 1NDDA 3KH0A 1WXSA 1ZGUB 2V3SA 3EC8A 3HM3A 4W9FA 5LXHA 3MJWA 3VH3B 1RFAA 4GDLA 4BOSC 2KANA 4WJQA 3VQIA 2BWES 4WWPA 4IM3A 4KIKB 1WX9A 3APCA 2DZKA 2KX0A 2NBWB 3V6CB 4G50A 4GGQA 3SHQA 1UGOA 2V4LA 4TKNA 4NQLB 3UIOB 4II3B 2WWZA 3WAMA 4PYZA 3VTWA 5DPRA 3OJ3A 1V9JA 2G45B 3ZRCA 2A4ZA 1WI0A 2JPHA 4DHZE 1M94A 4KIKA 3QARA 5AZGA 2QHOA 3JYUA 3ZNID 5AQLB 4AJYB 2JWZA 1NI2A 1JRUA 1SIFA 5JZEB 4ANXA 1WJNA 4WJNA 2KDFB 2KFKB 3L08A 4E71A 5AEKB 2JVCA 1YD8U 3AU4A 4ZRJA 1CMXB 2JZZA 1WJ6A 4FULA 4W9DA 2C5LC 1T0YA 5D6JB 4E74A 4OVUA 1GUAB 1RRBA 4RM9A 4YL8A 3KW5B 4GDKB 4LJPB 4EFOA 3RZFA 3DBHI 5E6NA 3VVWB 1EF5A 2BKFA 3OLMD 3DVGX 3FZKB 2KWVB 1WIAA 2KFKA 3BINA 2WX1A 1WR6E 5JHBA 3L10B 3HM6X 3EECA 4K7SA 4WQOB 4ANVA 2LUEA 2MCNB 1I42A 2MLBA 3FZMB 2LGXA 2AL6A 4GDKA 4ZDVA 5C1ZA 2GBNA 1Q0WB 3VAWA 2LASA 3GZNI 3JVZX 2N4FA 4KSKC 3DQVA 2BF8B 3TBLD 2R2OA 1E7UA 4ASWC 3PV1A 2MBHA 1Z2MA 3L13A 3QCAA 2BGFA 2J7QB 2D2QA 4LJOB 5C23A 1V2YA 4XC2A 5TR5A 1P98A 3PHXB 4M8NA 1YX6B 2ZCCA 3U8ZA 1IYFA 2LZ6A 2BYFA 1GNUA 2BPSA 1WMHA 3QK0A 3RT3B 3B0AA 3CF6E 5IAAC 3APFA 1Q5WB 4DWFA 2N9PC 2WX0A 3M3ZB 2KDBA 5AQMB 2GBMA 2KTRB 2ZJDA 3QIJA 4TQ0A 2DZIA 1R4MI 4HWDA 1XD3B 3WALA 3FZHB 2M1MA 4IM0A 1C1YB 4RMAA 4GXBA 1OTRB 2LGYA 2CR5A 3EFUA 2JRHA 3ZW3A 1TGZB 5JHAA 2NCNA 1OEYJ 2GBKA 1E8ZA 1VD2A 4K1RB 1U4AA 3PPAA 4ZRKA 4BOZB 2D07B 2LVPA 3V62A 4M0WB 4MGIE 2FCMA 2KTRA 4NPNA 3TMPB 5LXIB 2L00B 2ZPNA 1WX7A 5AZHA 4M8MA 4TUUA 2CHWA 5FR6A 3V6EB 2LVQA 3CMMB 3A4SC 2LD9A 2RR9A 2ASQA 3QWZB 2L3ZA 5AZFA 2EMSA 3VUYA 4K7WA 3DVNU 4I6PA 3M62B 3PHWB 3PRMB 3P2BA 1YX5B 2ZZPB 4G11A 3IFWB 4HDOA 1ISNA 3M95A 3GOEA 4GOCA 4X57B 4FA6A 2DAFA 1EUVB 3VUXA 4EEWA 1HX1B 4AJWA 2IY0B 3HIZA 3DBLI 2KLGA 3B08A 1VCBA 3IHPC 4W9IA 2XBBC 5LLIA 2L8JA 4MJSB 1G6JA 3PT2B 2KK8A 2N9XA 3DCGA 3W1SC 3AULA 4DHZB 3KYDD 3A8YC 1YQBA 2XEWA 2IO1B 1SE9A 2Y5BB 3VTVA 5L95C 3N3KB 2DHZA 1NBFC 4KZ0A 3NZSA 1LM8B 2LXAA 2O2VB 4FLHA 2DZJA 3D32A 3CSTA 3VTUA 3ZDMC 2MX2A 4WJPA 4W9HA 4JQWC 4K7UA 1V49A 2AL3A 2Z0DB 4DBGA 2MWSB 1V80A 5AQJB 2KKCA 4MJSA 2XK5A 4MELA 1ZKHA 4PYUA 1TBEA 2CKHB 2KNBA 4NJ7A 2G3QB 2KJ6A 2DYBA 3T9LA 4KV2A 2LI5A 4HCPB 4JLCA 4HXDA 2O2VA 5J17A 4FN2A 2KJHB 3ONSA 4W9LA 5J18A 4MSMB 2ZVOA 1Q1OA 5EDSA 2K6DB 3I3TB 4IM2A 3IVFA 2YLMA 3SU8X 1PQSA 2ZNVB 1UK5A 3MHSD 5AQTB 3PLVA 2I1KA 3VHTC 1P9DU 3R7QA 4BVUC 2FUHB 5G2NA 3AXCA 4NJ6A 1BT0A 1LFDA 4KDLB 2KD0A 4MDKE 2IO2B 3WAPA 2PE6B 3R3MA 2YVCA 2KN5A 2Z59B 2L7RA 5CX3A 2GMIC 1E5WA 2MA9B 1MG8A 2BYVE 4DHJD 3FZLB 1XQQA 4GSWA 4JIOU 3OAWA 1D3ZA 4TQ1A 3ALBA 1GC6A 2J0KA 3VUWA 1GC7A 3HHMA 3ZNHB 1WMHB 3TIXA 4DK5A 1M62A 4URKA 5AQPB 2B3AA 3WIMA 3IG3A 2HE7A 2W9NA 3QA8A 2N7DA 2FNJB 3A33B 4HWIB 2FCQA 3JSVB 4NQKE 3APDA 1C3TA 2RGFA 4MH0E 1K8RB 1L2NA 3TJPA 1T7SA 1R4NI 1UH6A 2AYOB 3VFKA 3WANA 3ZKJC 3RULA 4HWHA 4MGYE 1SGHA 3V61A 1LXDA 1WGHA 2MBBB 1V5OA 3K9PB 4MGZE 5DPSA 2KQ7A 3T8MA 4DHJB 2Z0EB 3DBRI 3PREA 1WZ3A 1UELA 4B95A 2D9DA 3SD5A 2L76A 1S3SG 3WAOA 2C60A 5D94A 2JRIB 3JSVA 1IP9A 4HLEA 2HD5B 4IW0A 4I6NB 2UWQA 4MEMA 4HCNB 3LDQB 3QQ8B 4A3OA 3A9JB 3ENEA 1KJTA 4TV3A 2D3GA 2MBEA 2JXXA 2K8HA 3H7SA 1QZEA 1L7YA 2IZVB 3KUZA 1UZXB 1ZW7A 3KUDB 1WZ0A 5BO4B 2GBJA 4AP4C 3H7PB 3EHVA 5AQNB 4ANWA 1TZ1A 2JZ3B 3MTNB 5KHOA 2KHWB 2MW5A 3DPDA 2KMCA 3RYTA 4W9KA 5AQIB 2ZCBA 5CHFA 4EOYA 4CO7A 2KLCA 5CTRC 3KUCB 3ML8A 2L0FA 2ZVNA 4F7ZA 2RD0A
chains in the Genus database with same CATH superfamily
5AUKA 1J5ET 4J2CA 2KVZA 3ANWA 3RYFE 2N7JA 3B9JA 4PT5A 2EKIA 4MM3A 2LSJA 2X67A 4DMVA 1Y8RC 3MC8A 2FCNA 1XT9B 5BR8T 2H7VC 4BKTA 2J62A 2V8SV 1E7VA 1R4NB 1WWTA 2JT4B 3ZO5B 1V81A 1MMDA 2K25A 1FPYA 4A3PA 1EZ3A 1P3QU 1EU4A 2LJ5A 2XUEA 4RM8A 3NVOA 1H8CA 3VXWA 2KC1A 4WW0A 5ABHA 3DBRB 4DR5T 1L4ZB 4U74A 2VH2A 3N30A 3ZJTA 1XLPA 4PJJA 3TEZA 2PVOD 2OLTA 2XK5B 1XLOA 4AQGA 3KDSE 1YW0A 3TUOA 3Q5XA 5L3EB 1WGDA 1YIWA 1FMAD 4LDTD 1EWCA 1KF6A 1WXQA 4RGTA 5FVLA 3AE1B 4W9CA 5F3JA 5BMVE 4P1CC 1B9RA 4FJYA 1E2AA 4X64T 1I6ZA 2K9XA 2X66A 2NPTA 1TTNA 1R7SA 4TV9E 4A56A 2BS2B 2LT3A 2WP9A 5ETWA 4F8HA 3UQ7A 1T0QC 2KMMA 2LGIA 3I9WA 4EZLA 1I35A 2VKJA 2N1VA 2C5IT 4YHHT 1F52A 1LRZA 1WGYA 3HKCE 4JGHB 4YSYA 3ZMZB 3LK2B 1HTOA 3TCAA 3N20C 5JR9B 5AQVB 2BYEA 2RP4A 1MIVA 4UF0A 2WXIA 1OQQA 2KO3A 3ZJ2A 1ZE3D 5EE1A 2M17A 3PU8A 3VKHA 1LQBA 1I4XA 3AE6B 4RGOS 3R7RA 2X9HA 3AECB 2KTFA 3WA0A 2DYMA 3P4RA 5ABFB 3W5UB 3N2KE 1WGGA 3B57A 1KNPA 3NZUA 2D3CA 3FZFB 4G0NB 2WNMA 4C4VB 2XPKA 3QB5K 1LKXA 2JQRB 4LCDE 1D5MC 3PSEB 3ZTDA 3AE2B 4ICUA 1E8XA 2KLQA 3AU5A 2X38A 3ZT7A 5LYJE 3ESLA 4EZJA 2PG8A 2N7EA 3RD2A 5EE9A 3NRXA 1PUTA 4EZKA 3RUIB 2W62A 4P0BA 1DOXA 2YOEA 4UIGA 2LLYA 4AKHA 4PJNA 1KM7A 2CHOA 3L17A 3MXZA 2LRUA 3RNFC 2LVOA 2LWPA 3RIAA 2ZM6T 4J6IA 3IBEA 5BYQA 3N1YC 1YXRA 2A5UA 3F57A 2K6QA 2LRWA 2JYEA 4WNKA 3H9DA 2YKSA 1UGMA 3M3JA 4F8CB 3QB5A 3LJ3A 3RPUA 2NR2A 2J53A 2KYWA 2RDHA 3Q3MC 3RI5A 5L3BB 4XDDA 3PGEA 2DENB 2KT9A 3KFWX 2MP2A 4NNJB 2DNXA 4JI8T 4X66T 1KNRA 5F8PA 4CI3B 4DDID 4LNKA 2ZM8A 1MMAA 3I5JC 3LDZE 3Q5WA 1WXVA 2PJQA 4YT0B 3ML9A 2XAQB 2XM2A 4CYEA 1GB1A 3SWHA 5FL1A 4PJLA 2YN6A 2N2NA 2CM0A 3GA8A 4GLSC 2XSAA 3V5UA 2J0MA 2LM9A 4XX5A 4IL9A 4NPPA 3RQWA 1D6EC 1VZ6A 4PS3A 1XMOT 4YJ2E 4HVBA 2JF5A 2KDIA 3RN9C 4X1YE 2WXJA 3NOBA 3U7ZA 4AQ7A 4GKKT 4H9OC 2A9UA 4IDOA 2WXOA 2YU1A 4BBNF 4RNAA 2W61A 3KVAA 2K22A 1RAXA 3LXFA 3UU5A 1SA0E 2ODUA 2WU2B 1FIOA 4DV6T 2IBIB 4IC7B 4YXDA 4LF5T 1B1ZA 2IIUA 2MQJA 4WJOA 5HXSA 3KV4A 3SR6A 1OEDC 4CZZB 5E6PA 4EUTA 4HDQA 3C4ZA 2V6XA 1V5TA 1GJZA 4N9F4 3K9OB 2FJEA 3UFGA 3A9KB 2I1JA 4HKAA 5LG3A 4DV1T 1I4HA 4DV2T 3PLUA 3Q3FA 5CA0E 1WE7A 3ZYKA 3BVMA 2AEHA 2M0XA 4ZRIA 1AYFA 2JMKA 3DDCB 3V60A 1YQ4A 2D11A 1SE3A 2W3RA 5LGTB 3VH4B 2IO3B 4U2ZA 3RH3A 4ADZA 2DYOA 1WLXA 3PZ7A 1WYBA 4WWNA 1PDXA 4FHKA 3GN5A 5IO9A 2MAWA 2J1DG 5M4YA 3PRZA 5CHVC 1P1AA 1D1BA 3ZC0A 2V1DB 2WXLA 4QXBB 1DOIA 1NENB 3BZDB 4NZLB 3KBUA 2IPKD 3ZSTA 3FKYA 2FJAA 2N9KA 4JL9A 3UINB 2CPTA 2LOSA 5I4DA 1ZGUB 3T1YT 4AKIA 5LXHA 3WAJA 1QOFA 3K3QC 2IHR1 2DWKA 3HKBE 4ZI2C 4LF9T 3BVZA 2DZKA 2NBWB 2I0MA 3GS2A 3KBTA 2HHHT 1LVKA 4US9A 1UGOA 3AEAA 2L3LA 1FFUA 2B1EA 2CXDA 3ETRA 1PGXA 2NTTA 3CQCB 3SFDA 3E08A 4X1KE 4KX6B 4TKNA 4OHFA 4II3B 2WWZA 3O9XA 4PYZA 3OJ3A 4YHJA 1TIFA 2FUG1 1JRPA 2V5DA 2XQ4A 3JYUA 5AQLB 4JI0T 1WJNA 2MBGA 2XAHB 4HFDA 3L08A 4JYAT 1CUNA 4ACFA 4C80A 4O4HE 3PJAA 2JZZA 2JSVX 5CGMA 1WJ6A 1YJIA 2MTQA 3ETUA 4RM9A 3KW5B 1D5XC 2QRXA 1WYCA 5E6NA 3B5MA 3URYA 4I50E 2KMFA 4J3OD 1N60A 2INCC 2XN9C 1F2RC 4C7ZA 1XNRT 2KFKA 4O2AE 5JHBA 3P50A 2MCNB 1N36T 2PLPA 3FZMB 2K0PA 2MH7A 3IAM1 3LG7A 1Q0WB 2KN4A 3AE5B 3GZNI 1L0XB 3RKOA 3TLVA 2V0GA 2BF8B 3ZYLA 5FR3A 2IC6A 3ABVB 2AE9A 2WU5A 3AEGB 5BYRA 3L13A 2J7QB 4U33A 4HROA 2J47A 4YXDB 1ET6A 2AQ3B 2K5PA 5TR5A 1P98A 4UEMA 2JMHA 4YSZA 2VZKD 1BR1A 1YD8G 3ONLC 3AEFB 3B0AA 3CF6E 2NWBA 2RPAA 3WI3A 2QC8A 2N9PC 2NTXA 1OQRA 3PURA 5JRCA 4AI6A 4ZI2D 3CIRB 2HN2A 3FXDB 3ZCIA 1QILA 4Z91A 4L1BA 2DZIA 3FZHB 3PZ8A 1JW9D 5HFYA 3AB5A 1N63A 5JHAA 1T0RC 2NCNA 2N9DA 1O3XA 1SXTA 3CX6B 4GKJT 3V62A 1U5PA 3LJCA 4MGIE 3L8RA 2L00B 2PW9A 4I43B 5E6JA 1HF8A 1UUSA 2YU2A 4O4JE 4ZZBA 1E7PB 1QQRA 1SIJA 3BYTB 5FR6A 3V6EB 3C98B 2ASQA 3DWGC 5AZFA 1BR4A 1JALA 2QJLA 3P2BA 4G11A 3IFWB 4ZZCA 1P7FA 4HDOA 3M95A 3VRBA 3OKQA 1DU2A 4X57B 2X0LB 4OZAA 3VR9A 3AE3A 4EEWA 4HPPA 1HX1B 2YK0A 1JWSD 4ARIA 3DBLI 2KLGA 3B08A 4DR4T 1VCBA 3RNAC 3DP7A 2XBBC 5LLIA 2BBCA 5LG4A 1MG4A 2KK8A 2N9XA 3LYYA 4NJCA 4DHZB 2RDGA 4GK5E 1UGJA 1YQBA 2WXPA 4TWHA 3UUXB 4A6QA 3N3KB 4YTMB 1LM8B 2LXAA 2O2VB 4FLHA 3AVRA 3MACA 3D32A 3VTUA 1HTQA 4W9HA 3NVZA 4JQWC 4K7UA 5HEJA 1NYRA 2MWSB 1MNDA 3AA6B 4EZHA 1V80A 2W63A 1W0BA 4MELA 3W2DA 1C4CA 1RFKA 1JROA 2CKHB 3M65A 4NJ7A 3KINB 4S17A 3CVRA 1TYGB 2LI5A 1YN3A 4HTEA 2JPFA 1C77A 2G0UA 4OFZA 1PGBA 2KJHB 1LVFA 2WAUA 5J18A 2H3RA 2XQAA 4AQFA 1QUUA 3N9QA 1ZPSA 1ZOYB 4IM2A 1DOYA 5JDFA 1IBKT 5HWYA 3IVFA 3SU8X 2UUBT 5LP6E 1UK5A 1UF0A 3ZQ4A 3VHTC 3RMKC 1C79A 4MBQA 4ZEYA 1SSNA 5G2NA 1K50A 1D0YA 4MDKE 1Q10A 2IO2B 3WAPA 3TEWA 3IAS1 1CZPA 2KN5A 1IJ5A 2L7RA 3J9CA 1E5WA 4UV8B 1R8IA 3AE9B 5JR9C 4JIOU 4C91A 1VRAB 3ALBA 2J0KA 3E0ZA 2X9WA 3I9YA 2WHIA 1OEDB 3TLTA 2IJ0A 1FXIA 2J4XA 3IG3A 2N7DA 5HCJA 2RGFA 2I2YA 1K8RB 3IT6B 2UXBT 1UH6A 3ZKJC 2E8IA 3UULA 1QOBA 4R3DA 3EDUA 3RHWA 1V5OA 3K9PB 2KQ7A 1L0VA 4B95A 3GB1A 2SEBD 4RF1A 3BK2A 3W15B 3ZMVB 2JRIB 4HEA1 4HLEA 4QXHB 2K24A 4IW0A 5IHYA 1I4PA 3IT4B 1JQ4A 3Q5DA 3LDQB 3QQ8B 2LKHA 4A3OA 3ENEA 4ILUA 2JXXA 2K8HA 5FYMA 3ZJ1A 3ZKRA 4X65T 1L7YA 1QZEA 4AP4C 3KUDB 5BO4B 2KXPB 3EHVA 3MTNB 3PO0A 5KHOA 1E1HB 3DPDA 3RYTA 2JQKA 3EUB2 2VVSA 2KLCA 2D3AA 1D0XA 2ZVNA 1QLBA 4F7ZA 2CHNA 1YKEB 1ACCA 2LHDA 3A9JA 3BK1A 3L0WB 5AQSB 1WYWB 4QH5A 2G1EA 3ZNZB 4JBWF 4B0MA 4QX8B 1WXMA 2KVRA 1E90A 1K51A 1IZNB 3RNEC 1SUMB 4RF0A 3N1ZC 4BKSD 1IBXB 5HAXA 3R84B 1UNSA 5CJ5A 1V8CA 3GE8C 4L23A 2IGHA 2KDMA 3AI5A 3EA6A 2A72A 2XQ9A 1E8YA 3P63A 5AQHB 4QWNB 1WFYA 2WZHA 4DV5T 1MMNA 4GIVA 2BG9C 3KV5A 3TL5A 3QJZA 3ZMTB 2FBWA 1R4MB 3I1AA 5HKHA 1RLFA 2YINA 3Q3JA 2L9QA 1MIWA 1H4RA 3N32A 3ZTCA 3U2SC 2NS5A 1FIQA 2FIFA 4LTUA 3UQBA 2IY1B 4U31A 3J9X1 2REXA 5HXCA 1F9JA 4A90A 2LKGA 1I7HA 3QX1A 2N1WA 5HXEA 3AE1A 2WLBA 4IWQA 3O1IA 4P1BC 2HTHA 3GP7A 4BKSA 3AE7B 2BS2A 2NP9A 4HFBA 2O6VB 2C5KT 3ZGZA 1J0GA 4WIPA 4AIUA 1XMQT 3R2TA 3QUJA 3S4UA 5FNVE 5JDHA 2CEAA 5MPOA 5JR9A 2INPE 3NRZA 2KC2A 2ZPYA 3H8HA 1D1CA 1QOGA 2EHOC 4IG7B 3AE6A 3C4XA 3AECA 1WJUA 2UXCT 5LMNT 2Z6EA 2FIDA 5ABFA 3AVSA 2ZW0A 5L3DB 3RZWC 3EABA 3ETVA 4B3ST 4ZHPA 3L16A 3P4QB 3BQIA 1Y01A 5IP4D 1CQVA 4C4VA 3AE8A 4HPMB 1JNZA 1WR1A 3AE2A 4ILAA 4LMKA 1TJEA 4EV6A 2H89B 3H6NA 1V6EA 4PS7A 4GMVA 2CXFA 2CHXA 1F1HA 4C56C 4KVGB 4EZ4A 3IBPA 4HN9A 3PV0F 4PNIA 3ONXA 2CWOA 4H9RC 3NJTA 1VR9A 4IHJE 5CHWA 2A2FX 3BVGA 3N9OA 1WM2A 2KXJA 2CS4A 1XCQL 3UGBB 1M7KA 1IGDA 3RYIE 3FILB 2WXGA 3R2IA 3OG5A 2MYSA 2C7HA 2JY6A 4CXWA 3SEBA 1J5WA 2CWYA 3J7Yq 2BB6A 4IIJE 3AEBB 5BMIA 4DR2T 4H9PC 3OJAA 2NBVB 4HK2A 1U4QA 1D0ZA 2QSDA 5AQOB 2DWQA 5F5WA 3VR8B 3L09A 4IE4A 4NAWB 4YT0A 2CU1A 1GG3A 3U7DA 4US8A 2M67A 3SS1A 4JUYA 2BS4B 3ZMSB 2M4NA 1NEKB 4NXMT 1FM0D 2P9BA 4L0RA 5EK2A 1X1MA 4B0EA 2HN1A 3SDLC 2FBWB 3L54A 3P4PB 4I6LB 4ILBA 4LLGM 3PVLA 1UBIA 1HZ6A 2IYDB 3N9MA 4ZOLE 2EHOD 3QNUA 2IAKA 1XCTL 3ZUNA 3VHLA 2CMRA 1OQYA 4JI3T 2WU2A 2EMTA 3Q8EA 2GI9A 1WSPA 3PUZF 4KHPT 4FJZA 3IHRA 4KZCA 3X1DA 2WBLA 2G9HD 2WGSA 1HS7A 1UUPA 3VRAB 1QF6A 2JIWA 3FHNA 4YTNB 3X23A 3MJ5A 2R2QA 2YDQA 4HWFA 5L47A 3A9KA 3EHZA 2FCSA 2X0HA 1YNTE 3AMZA 2K8BA 2BT6A 1CHUA 2DAJA 3PE0A 1UD7A 2BWFA 1WRDB 3BYYB 3MA9A 1WXSA 4O8SA 2V3SA 3EC8A 4W9FA 3L39A 2WZIA 2KANA 1QSDA 4IM3A 3UUMA 4A98A 2VQFT 2CA5A 1WX9A 2BBHA 4IDIA 1NENA 2EHOA 2LHRA 1WYGA 2V4LA 2I59A 4EYUA 3BWUD 1T8BA 3Q2AC 1OFFA 4AS1A 1UWXA 3AE8B 5FY0A 1UCUA 3NVVA 5DPRA 4ERRA 2G45B 3TSSA 1N62A 1M94A 3UU8A 3HA4A 2QHOA 1NI2A 1JWBD 2QIEB 4WJNA 2LSYA 5AEKB 3N5LA 4KX6A 3AU4A 3AAIA 4FULA 1SHZC 4IKGA 3NKZA 4AQYT 1GUAB 4YY3T 4YL8A 3FBZA 2KWIB 4GDKB 1SJHD 2D3BA 4JLEA 3DBHI 1MNEA 4U72A 1JWUD 3MP9A 3NUHB 1GQEA 5EK4A 3DVGX 1FD6A 5L3GB 2WX1A 1WR6E 2EELA 2JQQA 3HM6X 2PBIA 3Q5EA 4X62T 3PUQA 4OYJA 1KH0A 2QGSA 1L4DB 5C1ZA 2GBNA 2WXRA 2LASA 1XO3A 3IEEA 2K9AA 4NIQA 2V3PA 5DJQC 4HJGE 5LNK1 2MBHA 4C90A 3QCAA 2BGFA 1QKZA 2D2QA 5FXXA 4EXTA 3PUAA 3Q14C 2KINB 3PHXB 2WXKA 2ZCCA 4WWMA 1IYFA 2BYFA 2N9LA 1GNUA 2BG9B 3AE5A 1N61A 3RT3B 2X9YA 3APFA 1Q5WB 3B2FA 4UVAB 1FJGT 3ABVA 3M3ZB 2WX0A 2KDBA 2ZJDA 3AEGA 2WY2A 3QIJA 4TQ0A 4ANJA 2WDQB 1VRBA 4WBOA 4LK0M 5HXHA 2VL8A 3WALA 3DWMA 2V7JA 2CJNA 2M1MA 1YN5A 3HI2A 4GXBA 1OTRB 3EFUA 3AEFA 3UQ4A 1VD2A 4K1RB 3PPAA 1ROEA 3CIRA 4BJMA 2FCMA 4MALA 3TMPB 4IOIE 2BKOA 2NTYA 4XAXB 4KGRA 5EK3A 3GZNB 2KWHA 4HFEA 5IWAT 1WX7A 1W0AA 2X0YA 4M8MA 4TUUA 1FFVA 1J7BA 5JTGA 1HTJF 3A4SC 3AAAB 2XQ7A 5J0ZA 1ZXHA 2W54A 3VUYA 4NUUA 4I6PA 4L9IA 3PHWB 1SJED 2ACZB 3Q3NC 4DV3T 3PRMB 3W9CB 2HH7A 2ZZPB 1Z0PA 4LNOA 1C76A 2WQYB 2WB5A 2XSBA 1ISNA 4E7SA 1MIYA 4A9AA 2OHFA 1UWMA 4FA6A 2DAFA 1E7PA 2FUPA 2EHOB 1EUVB 4FXCA 4AJWA 3HIZA 2D5UA 2V5CA 2ODVA 2XASB 1ESFA 3NVYA 2L8JA 5LA6E 3Q8FA 3AB3B 5LMUT 5BMGA 3EDVA 3W1SC 5HWXA 3AULA 2L1AA 3KYDD 2BZBA 4MH8A 3HL6A 2DWGA 2IO1B 1SE9A 2SAKA 2WS3B 3BK9A 4JI5T 2DZJA 3TLSA 5JDGA 3ZDMC 4WJPA 1B7TA 4DBGA 3AA0B 3TLWA 2V6YB 4DR7T 1Y56A 5KXJA 1KRHA 1TBEA 5L4EA 3P42A 2W3SA 3EVYA 4KV2A 3AV8A 4HKQA 4YTMA 4WZXA 1BUIC 4HXDA 2O2VA 1Z8UA 5J17A 1ZUD2 2Y8DA 4WURA 2ZVOA 4N59A 3C4WA 3MC9A 5FMNA 5GXGB 2K6DB 3ZPOA 1N5WA 3OVUA 1TS5A 2RMMA 1KLUD 4KI0F 1K53A 4REZA 5T8IA 5AQTB 4EB6E 4YSXB 2PTFA 3RX6A 3T8OA 1P9DU 2I1KA 1XXGA 4ZHQE 2FUHB 2BW2A 3IXSA 3R3MA 2YVCA 5ADXL 1T72A 2MA9B 2BYVE 2X9XA 3FZLB 2V7MA 5LJMA 2E9XC 1ZOYA 4ISTA 1I4QA 4ZOHC 3OAWA 1D3ZA 2MEKA 1GC6A 1X9BA 4O4LE 3ZNHB 1KK7A 1RM6C 3LFMA 1M62A 1VCTA 5AQPB 3FC4A 2W82A 2B3AA 2L8KA 3QA8A 4TSSA 2FNJB 2FCQA 2MOZA 1C3TA 4EEBA 1S94A 1T7SA 2N0SB 3VFKA 2PMVA 1FRRA 3AE9A 5JDNA 1LXDA 3NWIA 3DTOA 2YEPB 5DPSA 2DLBA 3T8MA 1OEDA 2RA1A 1WZ3A 2D9DA 4U3CA 1BR0A 5LNKA 2L76A 4LF4T 3WAOA 2C60A 1IP9A 1TKGA 3DHGC 5DQVA 3NS1A 2UWQA 4MEMA 3RPFC 4EIWA 5KX5E 3SRZA 4IE5A 2X51A 2AQ2B 3LK42 4PK5A 4OZCA 2IZVB 5EE0A 2L32A 3H7PB 5AQNB 3ZN1B 4DV4T 4ANWA 1RYJA 3LB8C 3OTOT 2JQHA 2N1GA 2W4XA 1TS2A 2JX5A 4CO7A 4TNWA 3LK3B 4Z8XA 2RD0A 2NOXA 3PZDA 4IWOA 3T3NA 2V7LA 2KOXA 2NMQA 2LRLA 4AKGA 1L0YB 3DOWA 1FO4A 2W66A 3CX7B 4YJ3E 4ZI3C 3TEYA 3ZJVA 3W1SA 3ZDTA 3Q3OC 4ZYSA 4BJNA 2VRRB 3ZNGC 1VDVA 2Q9QC 2RPQA 2KSRA 3W1YA 4XYCA 4K3BA 4TX5A 3H3MA 4W9EA 4YTPB 3CQXC 2V7IA 5A1LA 3QAQA 1FXTB 2L05A 4UV9B 3OBVE 3U3IA 2WDVB 2BYTA 5EZYE 4OYKA 5JREA 3ZJUA 2KX3A 2VKHA 2AWTA 1IBXA 2O6VD 5GMVA 2XAJB 3HKEE 5GONE 2IDYA 2LGDA 2WXQA 3I63C 4Z90A 5TSSA 2NBUA 1J8CA 4KMCA 2C7MB 4ZYNA 2L0TA 3QHTA 1IPGA 1HG2A 2HJ8A 2ZM2A 3UT5E 3CSFA 3Q8BA 3RYCE 5KHQA 1GB4A 3KWLA 1NI3A 2XM1A 4B6WA 3R6NA 2ZLYA 2J4GA 2WWVA 5FKAC 4E3CA 3C51A 4MGKE 4M1PA 4PS8A 2E2AA 1KOTA 3A1QB 2ICIA 3ZLIA 1HG5A 3OJ4B 2WDTB 4G3XB 4IE0A 4HFVA 2V26A 2N9EB 4NAMA 4DR6T 2LHEA 1SEBD 4ANUA 5DPWA 4ZI7E 3DVNV 2VKDA 3RGLA 1XEEA 2V9HA 3UQAA 5AQRB 3PDYA 1XF5L 3N9PA 1HR0T 2XQ6A 3P8CD 3AE7A 5E6OA 4LF8T 2O6VA 5AQKB 1US7B 2MBQA 5L83A 1S1QB 3CX8B 1E8WA 4PK6A 2LMCA 2E6XA 3ZMUB 2LSGA 1L5PA 4U7YA 1WH3A 4ZI3D 4BFRA 2KJRA 2PIAA 2WYQA 3RRWA 3DVGY 3JCFA 4CN4A 4UELA 5AQFB 3EUHA 3ZT5A 4A20A 3NY5A 2MRPA 1VOMA 3P4QA 4H9SE 3C0RB 3NS8A 3JC6C 3ECIA 5G5GA 4XWTA 4OVVA 1N6ZA 2LGSA 4MACA 4WAAA 4C7YA 5AQQB 4ASKA 2K5BB 3I0OA 1W09A 3Q8CA 5CB4E 2VL0A 3KYCD 3NRYA 2H89A 4YLHA 3AEEB 3C64A 4TZ4C 3B13A 1WE6A 1WY8A 1V9DA 1C4AA 2QVAA 4YWGG 3R8BA 2CJOA 2M56B 1JCKB 4LNIA 4FADA 2K48A 4DR3T 2ZNVC 1G73A 5LOVE 4A97A 1IAPA 2GRIA 4JWSC 2K39A 2QILA 4ZRQA 5H92C 1UBQA 1HCIA 5LGUB 3FILA 1WX8A 3RCZA 3U30A 4P09A 3KQ4A 4IWPA 3SFEB 1XDPA 3PRPB 2VURA 4EE2A 1STEA 5JH5C 3AEBA 2J0JA 2ZEQA 4DV7T 5FKYA 5LGNB 2FAZA 2JYTA 2DX5B 3P7IA 4PFOA 3U52E 1T6BX 2F4VT 4ISSA 4HJKA 2MJ3A 2XQ5A 1ZKEA 3U4EG 3QC9A 4JPSA 2GOWA 3VR8A 4NAWA 1P7EA 3JW0X 4LNFA 5JDQA 2KFJA 3LSVA 1FMVA 3KV9A 2BS4A 4WYVA 1HE8A 1MPEA 2OJRA 1NEKA 2PTLA 1PGAA 2BBJA 2PPHA 2OOBB 2VH1A 2DZMA 4DNDA 2GLSA 3ZCJA 3AXJB 2PEAA 3O13A 2K1FA 2M8SA 5H6RB 3P4PA 1DYQA 2MSED 1EO6A 4QHOA 4B3TT 4GDLB 3ZN0B 1D5ZC 4A5XA 1HZ5A 2IDOB 2YDSA 4TV8E 4CXXA 1FCLA 2VB6A 4WAFA 1KLVA 3ZRFA 2V1YA 4XZ4A 5CA1E 2RSUA 2X68A 2BVCA 1WXAA 2BKRB 4PK1A 2Z8LA 3O65B 4HRSA 1AN8A 3V3XA 3RC3A 5JVDE 1NDDA 3KH0A 3MHZA 3TEXA 3HKDE 2D2SA 3VRAA 2E9XB 3HM3A 4LFBT 2KNDA 4YTNA 1RFAA 5H6QB 3DHHC 4XZCA 3VQIA 4WWPA 3C19A 4TNVA 4KIKB 2WWUA 3APCA 3V6CB 2DHRA 2XZEA 2JZPA 1TT5B 2BQQA 2UU7A 5LBMA 4P1NA 1WRDA 4NQLB 2WMOA 4ZS2A 5HYAA 3U78A 5D3IB 2XJ7A 3F2EA 2UU9T 1AW7A 1FRDA 3L3PA 5C3JB 3ZRCA 4JE3B 4MHCA 1WI0A 2A4ZA 4ZRPA 2JPHA 5AZGA 3QARA 3ZNID 1WFDA 4C00A 1YOVB 2ACXA 2L52A 4QH1A 4KUMB 2LSIA 4HFHA 1SF0A 2QCZA 2M19A 3Q8AA 4EOZB 4E71A 3ZYYX 2JVCA 1VZ8A 1CMXB 1M4VA 3MK7C 5D6JB 1A70A 1T0YA 4E74A 5HXRA 3Q69A 1RRBA 4OVUA 2DBYA 3HVZA 4JI6T 4N6EB 3RZFA 4XWWA 3WAKA 3VVWB 2WXFA 1EF5A 2BKFA 2W55A 1LGRA 4XDCA 1WIAA 3NZ3A 1FCCC 4K0UA 4NUVA 3L10B 3F31A 2BS3B 4WQOB 2H88B 3NBXX 1I42A 1UURA 2LGXA 4WBNE 1NAFA 4GDKA 4EEDA 4OX9T 4ZDVA 3VAWA 3RLFF 3FB2A 1HFAA 3AE4B 2FE8A 3JVZX 2NW9A 1ZXIA 5LXTE 2PKOA 3N1XC 3TBLD 2XQYA 2BVMA 1E7UA 2R2OA 5HG2A 1BR2A 4ASWC 3PV1A 2WXNA 1G8XA 2CE7A 1Z2MA 1XNQT 2INNE 3RIUC 2R61A 4I4TE 4LJOB 2Q9QB 2YEPF 5C23A 2XAGB 3LBXB 3IA3A 4M8NA 1ET9A 1ENFA 2KT7A 2LZ6A 3N9NA 3PUGA 1WMHA 2HTME 4EGWA 2FJDA 1XZYA 1HNWT 5IAAC 4DWFA 4JWUC 3H37A 1W9RA 3KWVA 3UTKA 2PFVA 2IGGA 2GBMA 3SOLA 2KTRB 2GB1A 4EAHA 2MJEA 3DBHB 1R4MI 4HWDA 1XD3B 2D5GA 4RMAA 1C1YB 4CXYA 2VASA 2SPCA 1HNXT 2CR5A 2JRHA 2BG9A 1TGZB 1TKEA 4N58A 2Y5CA 1OEYJ 4XBFB 4LF7T 1IJ6A 4KP3C 1C4PA 4ZRKA 4BOZB 1OWAA 3O1HA 3G06A 2D07B 3H3AA 1F2RI 4NPNA 2WDQA 5LXIB 3BQKA 5AZHA 3VKGA 3JADA 1YN4A 4UXNB 3CMMB 5FXWA 2RR9A 3BIID 3QWZB 2L3ZA 2NR4A 2EMSA 4K7WA 3K8PC 1F0ZA 3RRCA 5AUIA 2W67A 3AEDB 4RGNA 4UDUC 3GOEA 4GOCA 4A55A 3UU4A 3KV6A 2BVLA 4V1Av 3VUXA 2MJDA 4ILCA 5HEOA 2DNFA 1ZP0B 4W9IA 2I6HA 2JQ9A 4MJSB 3W5VB 4WH4A 2ACZA 2Q5WD 3HUIA 2LJLA 2WQYA 3PUSA 2XEWA 2LUMA 4H63V 2A3DA 3CQGB 4KZ0A 1IBMT 2LFIA 2RPVA 4QXCB 3PJAJ 5H8YE 1V1PB 1V49A 2AL3A 4I0UA 4N78D 1D4BA 4QAYA 2KKCA 2WXMA 1YQ3B 1JNRA 1ZKHA 2B76B 2E5LT 4PYUA 4BZAA 4IT4A 5C2TB 1MVKA 2KJ6A 4IDQA 3UI3A 4JLCA 4HCPB 4B6XA 4P6VF 2WS3A 4EYYR 2E3TA 2OV9A 1WGKA 2AQ1B 3ONSA 1T3QA 1X79A 3Q6BA 1FNVA 2W00A 1Q1OA 2V6YA 3I3TB 1CJEA 3MC0B 2YLMA 2ZNVB 3PLVA 1UX5A 1E6EB 3B2GA 4O1NA 4M02A 1I4RA 1WCRA 1L6VA 4PK4A 2QEJC 3AXCA 4NJ6A 5D3DA 1BT0A 5J2UE 1LFDA 2MHJA 3UU3A 2Z59B 5CX3A 2GMIC 3ZYMA 1KFYB 1MG8A 2C0SA 3T1HT 3OYXA 3RIUA 3I57A 1XQQA 4GSWA 3CWIA 3HHMA 1PFDA 4YSXA 2HPJA 1WMHB 2LRKA 2I38A 3Q9DA 1HXYD 3ZXRA 3A33B 3JSVB 4NQKE 4B3RT 3APDA 4LMLA 4MH0E 3CWZB 1JWAD 5L2LA 3TJPA 3K3NA 1R4NI 3WANA 3RULA 3MZKB 4HWHA 4MGYE 3V61A 3O4XE 2MBBB 2WDRB 4DHJB 3DBRI 3PREA 3JAFA 2DI4A 2W0GA 3T3OA 1S3SG 2WSSV 2YEVC 4LFCT 2Y48B 4H63H 1JWMD 3D0TA 4XGAB 2HJ1A 3UU6A 3ANWB 4FJOA 1KJTA 2IMLA 4GOUA 3TKLB 4DO0A 2D3GA 4MM3B 3H7SA 5IUXA 3KUZA 2V3NA 4ITKA 5FK9C 1GPXA 3FBLA 2INDC 2KMCA 2XHEB 4W9KA 4HFIA 4UVCB 5AQIB 3ZSSA 2ZCBA 5CTRC 5KDMC 3KUCB 4X1IE 2CLYB 4KBMB 4FHJA 4AWJA 2AX5A 2VK9A 4FJVB 1A5RA 3A5XA 2MBOA 5JDLA 4NY0A 5TAOA 1ZHCA 4P7IA 1HQRD 3H7PA 3DJBA 2EKEC 3ZT6A 4KGSA 2KMAA 3PTFC 4IUMB 2UXNB 3OYZA 1KF6B 3NG0A 2CHZA 4CHKA 2BG9E 4QKNA 3EI0A 3QOFA 2C7NB 2NPTB 3V5SA 2C9WB 2K8CA 2E5VA 4X20E 2WP9B 3KLSX 4OZBA 3ZEFB 1WGRA 1T98A 4I55E 3PU3A 1YKHB 4YSYB 3P4SA 3C50A 2KDEB 4JEUB 4M01A 3GE3C 4RFBA 1NVID 4UF0B 2WCAA 4BBNC 4RCOA 1OGWA 3S2AA 2PE9A 1OEYA 5J2TE 4DUZT 1V97A 2PJHA 2LHNA 5EE3A 3CKDA 3ZVVA 1F77A 2ONQA 3P4RB 4YTPA 2JUOA 2CRBA 2WXHA 2VKOA 5J2RA 2WDVA 2D0UA 2GBRA 1EF1A 2KAJA 4MSQB 5FY7A 1MJDA 2IW5B 1UX4A 4M00A 4GN1A 1WJ4A 1J19A 2KWCA 4HWCA 1NWMX 5DQWA 2UUAT 1T5XD 1SBBB 4HGAA 3ZIMA 4UR9A 4LDTB 4TUYE 1AWDA 1KTKA 4S0RA 4FBJB 5C8YE 3UIPB 4DDGD 3PUXF 4B9KA 4MFRA 4ZS3A 2Y3AA 4HFCA 5D7GA 4DIDB 2Y5PA 3K1SA 1YJJA 4KGTA 2WMNA 2KWUB 1MI0A 3QC8B 5LHHB 2W2UA 3X0WA 3I0QA 3DBLB 4CN1A 2QDFA 4DXAB 4AOFA 3A1QA 4KDIC 2KQSA 5D2MB 2BKPA 2OEDA 3DHIC 3PS6A 3RIFA 3E22E 1TY2A 3H1UA 3VU7H 1GAQB 4W9JA 5HHDG 3NZQA 1VZ7A 2VQET 1SB3C 4WWOA 5JDMA 2UUCT 2BTEA 2MP2B 4BA9A 3M63B 3AAEB 2YDRA 5FL0A 4II2B 4CN6A 3C8YA 1K52A 4AXPA 4GIWA 1L6UA 4A8XC 3B1LX 4GB9A 3NHEB 3EAMA 3BQLA 4OW0A 4AQFC 1AARA 2CBIA 3K3OA 2D10A 3DBSA 3PTRB 2HDEA 4AUQC 4DV0T 3AA1B 3R66C 4JI7T 3RYHE 1I94T 4G2AA 4X5TA 4DXGA 4ICVA 3EFCA 4W9GA 3QK6A 1OXZA 1SE2A 2NW8A 1V86A 4RGMA 5BYSA 3RNGC 3PUYF 4F1SA 4OK0A 3P4WA 2UYZB 2K3UA 4K81A 3IF8B 4P16A 1N32T 2LXCA 4WQMA 2M6IA 3UUNA 3V05A 4HKZE 5G5HA 1FXAA 4GU2A 3AEEA 1WM3A 1P0RA 3N9YC 4H2AA 3BY4B 3A4RA 1HX8A 2V7KA 4BKGA 1KLGD 2TSSA 5FVKA 4L2YA 2DLRA 2G4SA 5IYZE 2KZRA 1N34T 2VWAA 3VDZA 2QMTA 5AQGB 1E0ZA 4LMJA 3NVWA 2LE8A 1ZDXA 3E56A 3ZLZA 1S35A 4FI5A 1YQ4B 1WF9A 3SFEA 3P4SB 5AFUL 4JV5T 5IA7A 3TLUA 3MKDA 2QA7A 5DPTA 3GN5B 3PUVF 4JI2T 2G4DB 3RNBC 4KKJA 3A7MA 1ZDVA 4EKUA 4KSLC 5HEHA 5FXVA 5FP3A 2E9XD 3L4PA 5G55A 1G6JA 3OWEB 4HPLB 2IO0B 1VJKA 2LOPA 2VVNA 4GYRA 5J1GA 4CI1B 4BAXA 2X8XX 1EWYC 2ON8A 2ZMAA 5AQUB 4M0WA 3UF8A 2PVGC 3KVFB 1SE4A 3OPCA 1KNZA 2R6GF 3Q2MA 2CU3A 3N2OA 3AEAB 1T0SC 5L3CB 1TZOA 3AXJA 4TWFA 5DABA 2FJBA 5LCYA 1ZEEA 1YJ1A 1Z5SB 2NVUI 5DCNA 3SFDB 3HK0A 2ES0A 1GOZA 2ZW1A 4E7ZA 3MJWA 3VH3B 4GDLA 4BOSC 4DMWA 4DBQA 4KHZF 4WJQA 5IOIA 2BWES 1XLQA 4USAA 2KX0A 1XWMA 4G50A 4GGQA 4JEHB 3SHQA 1ZV4X 1NYQA 3UIOB 4AISA 3N2GE 4AKLA 3HVDA 4GYSA 3WAMA 2E9XA 3VTWA 2JJ9A 4YFSA 1N5XA 1V9JA 5IN7A 4IE7A 5LBQB 1I4GA 3RFZB 4DHZE 4KIKA 1IBLT 4AJYB 4QH4A 5E0OA 2JWZA 4TMAB 2Y6XA 1JRUA 1SIFA 5JZEB 4ANXA 2KDFB 2KFKB 2ZM0A 4IDPA 2LM2A 3AA7B 1YD8U 4ZRJA 5ABEA 4W9DA 2XQ3A 2C5LC 3RQUA 5C3JA 4K3CA 4LJPB 4EFOA 1BXTA 4UVBB 3E9SA 2MPKA 5LB7B 2Q9QD 3OLMD 3FZKB 2KWVB 2WU5B 2M6BA 3BINA 4XE0A 4CQIA 3N9LA 1HA5A 3PUWF 1IUEA 3EECA 4K7SA 4ANVA 2LUEA 2MLBA 4PAGA 1V1OA 2AL6A 4YSZB 2JU6X 5KMGP 1XLNA 2N4FA 4H9QC 4B3MT 2LEKA 4TWDA 3DQVA 4KSKC 2BDEA 4DBRA 4IDZA 5JRCB 5JXVA 2M0AA 3RNCC 2BS3A 4LFAT 2H88A 1WR0A 1V2YA 3P1MA 4XC2A 3HRDD 1YX6B 3RI7C 2DL1A 3U8ZA 2BPSA 3QK0A 3AE4A 2XY8B 3JAEA 2AXDS 3O1JA 5AQMB 1OEDE 2BB5A 4PW8A 1E10A 2GK9A 1VLBA 4PJMA 2Q9QA 4AKRB 2C5JA 4IM0A 3GMIA 3LBXA 1H7CA 5CFBA 4OHJA 2LGYA 5L4HA 4CI2B 1J7AA 3ZW3A 4IE6A 2OA5A 3AM9A 2GBKA 3CPZA 3FXEB 1E8ZA 1U4AA 4PFPA 2VZKB 1QOAA 4GK0E 2LVPA 4M0WB 2KTRA 1LO5D 4U7IA 2D0TA 1RWSA 3VRBB 1C78A 2ZPNA 3VR9B 3AE3B 2KZ7B 2CHWA 2H7OA 2LVQA 5HEGA 2LD9A 3ZC1A 1AJ3A 1XDOA 1CK1A 3DVNU 4OVZA 3M62B 4IL4A 1YX5B 3I9V1 4COFA 2IGDA 4ARCA 1VCSA 4G63A 1C9FA 4ZHOA 4BAYB 1FNUA 3JC6D 2IY0B 4L5GA 5HCMA 4NXNT 3IHPC 3PT2B 3DCGA 2CBJA 1HEZE 3A8YC 2QYWA 2Y5BB 3ZXVA 3AEDA 3VTVA 5L95C 4LF6T 1NBFC 2DHZA 3NZSA 2CLYC 2LSKA 4DVDA 3CSTA 1FEWA 2MX2A 2OJWA 2Z0DB 1ZP0A 2NTSA 2XQ8A 1TS3A 4ZXLA 5AQJB 1J7CA 1J1JA 4MJSA 5LHIB 5ABGA 2XK5A 2UXDT 2J42A 3ONJA 5LJNA 4DUYT 1MFWA 2KNBA 2K3WA 1E9MA 2G3QB 5BMHA 4QX7B 2DYBA 3T9LA 4K0KT 3UFEA 2CCQA 4FN2A 4U2YA 2WM9A 1TY0A 1V1PA 4W9LA 4CQNA 4MSMB 5EDSA 2XAFB 1YQ3A 4P0AA 5FY1A 1Y64B 2RDBC 4KKIA 2B76A 4LNNA 3HR0A 1JMLA 5C2TA 2IC9A 1PQSA 3MHSD 1HNZT 4Q2JA 3CK6A 2NW7A 2BKNA 4IGUA 4F6RC 1TS4A 3R7QA 4BVUC 1WR6A 1PYWD 4DQOC 1EM7A 2JRKA 4JI1T 4KDLB 3GWHA 2KD0A 4DR1T 4RH6A 2PE6B 3CMLA 4JX1C 4DHJD 4D2KA 2JXTA 3NZPA 3AN1A 1YMHE 1BMLC 4TQ1A 3VUWA 1GC7A 1L0VB 5JH7E 3TIXA 4DK5A 4URKA 1D1AA 2L83A 5HI1A 1EU3A 3WIMA 2UXXB 4IDNA 5IKCM 2HE7A 2W9NA 1N33T 2IUBA 4HWIB 1TKYA 3FAHA 1MHXA 1FNWA 1L2NA 1KFYA 1MMGA 3KVBA 4IREA 2AYOB 3MJXA 2KQ4X 1SGHA 2V4IB 1FMWA 4DXFA 2CXLA 1WGHA 1FEHA 4O4IE 4MGZE 3UUBA 2Z0EB 1SE7A 5L3FB 1UELA 1IGCA 3SD5A 2LJIA 1WRIA 2XNAC 2XTLA 4HE8A 5D94A 5JQGE 3JSVA 2HD5B 2KWDA 4H9NC 1DGJA 4I6NB 4Q25A 2DCFA 1QLBB 1QT9A 4O2BE 2J52A 5FXZA 4HCNB 3WCQA 1KEYA 3A9JB 4MLKA 4TV3A 2MBEA 2JWUA 4TN7B 2WDRA 1MHHE 4JI4T 1UZXB 1ZW7A 2LEHA 1WZ0A 2GBJA 2HPLA 1TZ1A 2JZ3B 3EGRA 3MFGA 5HEUA 2KHWB 3RC8A 2MW5A 4HEAA 5CHFA 3AH7A 3RF1A 4EOYA 5LHGB 3ML8A 2L0FA 2KACA 4MT5A 3RKGA
chains in the Genus database with same CATH topology
4IWOA 2KOXA 3A9JA 4FHJA 4AWJA 3L0WB 5AQSB 1WYWB 3DOWA 4MM3A 4FJVB 1A5RA 1Y8RC 2MBOA 2FCNA 4NY0A 1XT9B 4P7IA 3ZNZB 3H7PA 4BKTA 1WXMA 2KVRA 3ZO5B 1E7VA 1E90A 2EKEC 2JT4B 1V81A 2K25A 4A3PA 2KMAA 3PTFC 4IUMB 3W1SA 3ZDTA 4BKSD 1P3QU 2CHZA 4RM8A 2LJ5A 2VRRB 4CHKA 1H8CA 3ZNGC 3VXWA 2C7NB 2KC1A 3AI5A 2NPTB 2RPQA 3W1YA 3N30A 1E8YA 2C9WB 2K8CA 5AQHB 1WFYA 4W9EA 4GIVA 3QAQA 1FXTB 1WGRA 2L05A 3TL5A 3PZDA 2XK5B 3QJZA 1WGDA 1YIWA 5HKHA 1RLFA 4LDTD 3Q3JA 2KX3A 2AWTA 2KDEB 4W9CA 1H4RA 2O6VD 5GMVA 3N32A 3ZTCA 4FJYA 4BBNC 1I6ZA 1OGWA 3S2AA 2NS5A 1OEYA 2LGDA 2PE9A 2NPTA 1TTNA 2NBUA 1J8CA 2C7MB 2FIFA 2PJHA 3UQBA 4ZYNA 3ZVVA 2L0TA 3QHTA 2IY1B 1I35A 1IPGA 4EZLA 2JUOA 2REXA 1F9JA 2HJ8A 5KHQA 2N1VA 3CSFA 5J2RA 2GBRA 4B6WA 1EF1A 1WGYA 4JGHB 4MSQB 3QX1A 2N1WA 3TCAA 4GN1A 1WJ4A 1J19A 2KWCA 5AQVB 2BYEA 4IWQA 4HWCA 4MGKE 4PS8A 4E3CA 2KO3A 1KOTA 3A1QB 2M17A 1LQBA 3ZIMA 2HTHA 4LDTB 3OJ4B 4G3XB 2WDTB 3R7RA 4BKSA 4FBJB 2KTFA 3UIPB 3WA0A 2O6VB 2DYMA 4DDGD 2N9EB 4B9KA 1J0GA 1WGGA 5D7GA 3NZUA 3FZFB 4ANUA 2KWUB 5DPWA 3QC8B 4G0NB 3X0WA 3DVNV 4LCDE 3ZTDA 3PSEB 4ICUA 4DXAB 2KC2A 1E8XA 2ZPYA 3AU5A 4AOFA 5AQRB 3A1QA 3UQAA 4KDIC 2KQSA 4IG7B 5D2MB 4EZJA 2N7EA 1WJUA 3RD2A 3PS6A 5E6OA 2O6VA 5AQKB 2FIDA 3RZWC 3RUIB 4EZKA 3H1UA 2MBQA 5L83A 1S1QB 3L16A 1E8WA 4W9JA 1KM7A 4WWOA 1WH3A 3L17A 2LRUA 2MP2B 4BFRA 2KJRA 2LVOA 3M63B 4HPMB 2LWPA 2WYQA 4J6IA 3IBEA 4II2B 1WR1A 2A5UA 3DVGY 2K6QA 2LRWA 3H6NA 3H9DA 1V6EA 5AQFB 4PS7A 1UGMA 3M3JA 4GMVA 2CHXA 3B1LX 4GB9A 4KVGB 4A20A 3NY5A 4F8CB 3NHEB 3LJ3A 2MRPA 2NR2A 1AARA 3C0RB 3NS8A 3ECIA 2D10A 3PGEA 4OVVA 2DENB 3DBSA 5CHWA 4WAAA 2MP2A 4AUQC 5AQQB 4NNJB 3R66C 1WM2A 2KXJA 2CS4A 3KYCD 3UGBB 1M7KA 4DDID 4ICVA 4W9GA 3LDZE 1WXVA 2C7HA 1V86A 2JY6A 1WE6A 1WY8A 3ML9A 4CYEA 4F1SA 4FADA 2J0MA 4XX5A 2UYZB 2ZNVC 4PS3A 4K81A 2NBVB 4HK2A 2LXCA 4HVBA 2JF5A 5AQOB 2K39A 2KDIA 3NOBA 1UBQA 3U30A 4GU2A 1WX8A 1WM3A 3RCZA 1P0RA 4IWPA 3PRPB 4NAWB 3BY4B 4BBNF 2CU1A 3A4RA 1RAXA 1GG3A 3U7DA 5JH5C 2J0JA 2ZEQA 2FAZA 2G4SA 2DX5B 2KZRA 4IC7B 2IBIB 2M4NA 3VDZA 5AQGB 4HJKA 2MQJA 4WJOA 1X1MA 3SDLC 4EUTA 5E6PA 3ZLZA 3L54A 2GOWA 4I6LB 1WF9A 4HDQA 3PVLA 1UBIA 4NAWA 3JW0X 5IA7A 1V5TA 2IYDB 2KFJA 4N9F4 1GJZA 3K9OB 5DPTA 3ZUNA 2G4DB 3A9KB 1OQYA 1HE8A 2I1JA 2OJRA 2EMTA 4EKUA 4KSLC 2PPHA 3PLUA 3Q3FA 2OOBB 1WE7A 2DZMA 2AEHA 2M0XA 4ZRIA 5G55A 4FJZA 2PEAA 3DDCB 2K1FA 2M8SA 4HPLB 4KZCA 3V60A 2D11A 2IO0B 2MSED 1EO6A 3VH4B 2IO3B 2DYOA 4WWNA 4GDLB 4FHKA 3X23A 5AQUB 2R2QA 3UF8A 4HWFA 3A9KA 3KVFB 2FCSA 3PRZA 5CHVC 1P1AA 3ZRFA 1KLVA 2V1YA 4XZ4A 2K8BA 2DAJA 2RSUA 4BKGA 1WXAA 1YJ1A 2BKRB 1UD7A 1Z5SB 2NVUI 5DCNA 3O65B 2BWFA 3UINB 4JL9A 1WRDB 3HK0A 1NDDA 3KH0A 1WXSA 1ZGUB 2V3SA 3EC8A 3HM3A 4W9FA 5LXHA 3MJWA 3VH3B 1RFAA 4GDLA 4BOSC 2KANA 4WJQA 3VQIA 2BWES 4WWPA 4IM3A 4KIKB 1WX9A 3APCA 2DZKA 2KX0A 2NBWB 3V6CB 4G50A 4GGQA 3SHQA 1UGOA 2V4LA 4TKNA 4NQLB 3UIOB 4II3B 2WWZA 3WAMA 4PYZA 3VTWA 5DPRA 3OJ3A 1V9JA 2G45B 3ZRCA 2A4ZA 1WI0A 2JPHA 4DHZE 1M94A 4KIKA 3QARA 5AZGA 2QHOA 3JYUA 3ZNID 5AQLB 4AJYB 2JWZA 1NI2A 1JRUA 1SIFA 5JZEB 4ANXA 1WJNA 4WJNA 2KDFB 2KFKB 3L08A 4E71A 5AEKB 2JVCA 1YD8U 3AU4A 4ZRJA 1CMXB 2JZZA 1WJ6A 4FULA 4W9DA 2C5LC 1T0YA 5D6JB 4E74A 4OVUA 1GUAB 1RRBA 4RM9A 4YL8A 3KW5B 4GDKB 4LJPB 4EFOA 3RZFA 3DBHI 5E6NA 3VVWB 1EF5A 2BKFA 3OLMD 3DVGX 3FZKB 2KWVB 1WIAA 2KFKA 3BINA 2WX1A 1WR6E 5JHBA 3L10B 3HM6X 3EECA 4K7SA 4WQOB 4ANVA 2LUEA 2MCNB 1I42A 2MLBA 3FZMB 2LGXA 2AL6A 4GDKA 4ZDVA 5C1ZA 2GBNA 1Q0WB 3VAWA 2LASA 3GZNI 3JVZX 2N4FA 4KSKC 3DQVA 2BF8B 3TBLD 2R2OA 1E7UA 4ASWC 3PV1A 2MBHA 1Z2MA 3L13A 3QCAA 2BGFA 2J7QB 2D2QA 4LJOB 5C23A 1V2YA 4XC2A 5TR5A 1P98A 3PHXB 4M8NA 1YX6B 2ZCCA 3U8ZA 1IYFA 2LZ6A 2BYFA 1GNUA 2BPSA 1WMHA 3QK0A 3RT3B 3B0AA 3CF6E 5IAAC 3APFA 1Q5WB 4DWFA 2N9PC 2WX0A 3M3ZB 2KDBA 5AQMB 2GBMA 2KTRB 2ZJDA 3QIJA 4TQ0A 2DZIA 1R4MI 4HWDA 1XD3B 3WALA 3FZHB 2M1MA 4IM0A 1C1YB 4RMAA 4GXBA 1OTRB 2LGYA 2CR5A 3EFUA 2JRHA 3ZW3A 1TGZB 5JHAA 2NCNA 1OEYJ 2GBKA 1E8ZA 1VD2A 4K1RB 1U4AA 3PPAA 4ZRKA 4BOZB 2D07B 2LVPA 3V62A 4M0WB 4MGIE 2FCMA 2KTRA 4NPNA 3TMPB 5LXIB 2L00B 2ZPNA 1WX7A 5AZHA 4M8MA 4TUUA 2CHWA 5FR6A 3V6EB 2LVQA 3CMMB 3A4SC 2LD9A 2RR9A 2ASQA 3QWZB 2L3ZA 5AZFA 2EMSA 3VUYA 4K7WA 3DVNU 4I6PA 3M62B 3PHWB 3PRMB 3P2BA 1YX5B 2ZZPB 4G11A 3IFWB 4HDOA 1ISNA 3M95A 3GOEA 4GOCA 4X57B 4FA6A 2DAFA 1EUVB 3VUXA 4EEWA 1HX1B 4AJWA 2IY0B 3HIZA 3DBLI 2KLGA 3B08A 1VCBA 3IHPC 4W9IA 2XBBC 5LLIA 2L8JA 4MJSB 1G6JA 3PT2B 2KK8A 2N9XA 3DCGA 3W1SC 3AULA 4DHZB 3KYDD 3A8YC 1YQBA 2XEWA 2IO1B 1SE9A 2Y5BB 3VTVA 5L95C 3N3KB 2DHZA 1NBFC 4KZ0A 3NZSA 1LM8B 2LXAA 2O2VB 4FLHA 2DZJA 3D32A 3CSTA 3VTUA 3ZDMC 2MX2A 4WJPA 4W9HA 4JQWC 4K7UA 1V49A 2AL3A 2Z0DB 4DBGA 2MWSB 1V80A 5AQJB 2KKCA 4MJSA 2XK5A 4MELA 1ZKHA 4PYUA 1TBEA 2CKHB 2KNBA 4NJ7A 2G3QB 2KJ6A 2DYBA 3T9LA 4KV2A 2LI5A 4HCPB 4JLCA 4HXDA 2O2VA 5J17A 4FN2A 2KJHB 3ONSA 4W9LA 5J18A 4MSMB 2ZVOA 1Q1OA 5EDSA 2K6DB 3I3TB 4IM2A 3IVFA 2YLMA 3SU8X 1PQSA 2ZNVB 1UK5A 3MHSD 5AQTB 3PLVA 2I1KA 3VHTC 1P9DU 3R7QA 4BVUC 2FUHB 5G2NA 3AXCA 4NJ6A 1BT0A 1LFDA 4KDLB 2KD0A 4MDKE 2IO2B 3WAPA 2PE6B 3R3MA 2YVCA 2KN5A 2Z59B 2L7RA 5CX3A 2GMIC 1E5WA 2MA9B 1MG8A 2BYVE 4DHJD 3FZLB 1XQQA 4GSWA 4JIOU 3OAWA 1D3ZA 4TQ1A 3ALBA 1GC6A 2J0KA 3VUWA 1GC7A 3HHMA 3ZNHB 1WMHB 3TIXA 4DK5A 1M62A 4URKA 5AQPB 2B3AA 3WIMA 3IG3A 2HE7A 2W9NA 3QA8A 2N7DA 2FNJB 3A33B 4HWIB 2FCQA 3JSVB 4NQKE 3APDA 1C3TA 2RGFA 4MH0E 1K8RB 1L2NA 3TJPA 1T7SA 1R4NI 1UH6A 2AYOB 3VFKA 3WANA 3ZKJC 3RULA 4HWHA 4MGYE 1SGHA 3V61A 1LXDA 1WGHA 2MBBB 1V5OA 3K9PB 4MGZE 5DPSA 2KQ7A 3T8MA 4DHJB 2Z0EB 3DBRI 3PREA 1WZ3A 1UELA 4B95A 2D9DA 3SD5A 2L76A 1S3SG 3WAOA 2C60A 5D94A 2JRIB 3JSVA 1IP9A 4HLEA 2HD5B 4IW0A 4I6NB 2UWQA 4MEMA 4HCNB 3LDQB 3QQ8B 4A3OA 3A9JB 3ENEA 1KJTA 4TV3A 2D3GA 2MBEA 2JXXA 2K8HA 3H7SA 1QZEA 1L7YA 2IZVB 3KUZA 1UZXB 1ZW7A 3KUDB 1WZ0A 5BO4B 2GBJA 4AP4C 3H7PB 3EHVA 5AQNB 4ANWA 1TZ1A 2JZ3B 3MTNB 5KHOA 2KHWB 2MW5A 3DPDA 2KMCA 3RYTA 4W9KA 5AQIB 2ZCBA 5CHFA 4EOYA 4CO7A 2KLCA 5CTRC 3KUCB 3ML8A 2L0FA 2ZVNA 4F7ZA 2RD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IWO A;  2KOX A;  3A9J A;  4FHJ A;  4AWJ A;  3L0W B;  5AQS B;  1WYW B;  3DOW A;  4MM3 A;  4FJV B;  1A5R A;  1Y8R C;  2MBO A;  2FCN A;  4NY0 A;  1XT9 B;  4P7I A;  3ZNZ B;  3H7P A;  4BKT A;  1WXM A;  2KVR A;  3ZO5 B;  1E7V A;  1E90 A;  2EKE C;  2JT4 B;  1V81 A;  2K25 A;  4A3P A;  2KMA A;  3PTF C;  4IUM B;  3W1S A;  3ZDT A;  4BKS D;  1P3Q U;  2CHZ A;  4RM8 A;  2LJ5 A;  2VRR B;  4CHK A;  1H8C A;  3ZNG C;  3VXW A;  2C7N B;  2KC1 A;  3AI5 A;  2NPT B;  2RPQ A;  3W1Y A;  3N30 A;  1E8Y A;  2C9W B;  2K8C A;  5AQH B;  1WFY A;  4W9E A;  4GIV A;  3QAQ A;  1FXT B;  1WGR A;  2L05 A;  3TL5 A;  3PZD A;  2XK5 B;  3QJZ A;  1WGD A;  1YIW A;  5HKH A;  1RLF A;  4LDT D;  3Q3J A;  2KX3 A;  2AWT A;  2KDE B;  4W9C A;  1H4R A;  2O6V D;  5GMV A;  3N32 A;  3ZTC A;  4FJY A;  4BBN C;  1I6Z A;  1OGW A;  3S2A A;  2NS5 A;  1OEY A;  2LGD A;  2PE9 A;  2NPT A;  1TTN A;  2NBU A;  1J8C A;  2C7M B;  2FIF A;  2PJH A;  3UQB A;  4ZYN A;  3ZVV A;  2L0T A;  3QHT A;  2IY1 B;  1I35 A;  1IPG A;  4EZL A;  2JUO A;  2REX A;  1F9J A;  2HJ8 A;  5KHQ A;  2N1V A;  3CSF A;  5J2R A;  2GBR A;  4B6W A;  1EF1 A;  1WGY A;  4JGH B;  4MSQ B;  3QX1 A;  2N1W A;  3TCA A;  4GN1 A;  1WJ4 A;  1J19 A;  2KWC A;  5AQV B;  2BYE A;  4IWQ A;  4HWC A;  4MGK E;  4PS8 A;  4E3C A;  2KO3 A;  1KOT A;  3A1Q B;  2M17 A;  1LQB A;  3ZIM A;  2HTH A;  4LDT B;  3OJ4 B;  4G3X B;  2WDT B;  3R7R A;  4BKS A;  4FBJ B;  2KTF A;  3UIP B;  3WA0 A;  2O6V B;  2DYM A;  4DDG D;  2N9E B;  4B9K A;  1J0G A;  1WGG A;  5D7G A;  3NZU A;  3FZF B;  4ANU A;  2KWU B;  5DPW A;  3QC8 B;  4G0N B;  3X0W A;  3DVN V;  4LCD E;  3ZTD A;  3PSE B;  4ICU A;  4DXA B;  2KC2 A;  1E8X A;  2ZPY A;  3AU5 A;  4AOF A;  5AQR B;  3A1Q A;  3UQA A;  4KDI C;  2KQS A;  4IG7 B;  5D2M B;  4EZJ A;  2N7E A;  1WJU A;  3RD2 A;  3PS6 A;  5E6O A;  2O6V A;  5AQK B;  2FID A;  3RZW C;  3RUI B;  4EZK A;  3H1U A;  2MBQ A;  5L83 A;  1S1Q B;  3L16 A;  1E8W A;  4W9J A;  1KM7 A;  4WWO A;  1WH3 A;  3L17 A;  2LRU A;  2MP2 B;  4BFR A;  2KJR A;  2LVO A;  3M63 B;  4HPM B;  2LWP A;  2WYQ A;  4J6I A;  3IBE A;  4II2 B;  1WR1 A;  2A5U A;  3DVG Y;  2K6Q A;  2LRW A;  3H6N A;  3H9D A;  1V6E A;  5AQF B;  4PS7 A;  1UGM A;  3M3J A;  4GMV A;  2CHX A;  3B1L X;  4GB9 A;  4KVG B;  4A20 A;  3NY5 A;  4F8C B;  3NHE B;  3LJ3 A;  2MRP A;  2NR2 A;  1AAR A;  3C0R B;  3NS8 A;  3ECI A;  2D10 A;  3PGE A;  4OVV A;  2DEN B;  3DBS A;  5CHW A;  4WAA A;  2MP2 A;  4AUQ C;  5AQQ B;  4NNJ B;  3R66 C;  1WM2 A;  2KXJ A;  2CS4 A;  3KYC D;  3UGB B;  1M7K A;  4DDI D;  4ICV A;  4W9G A;  3LDZ E;  1WXV A;  2C7H A;  1V86 A;  2JY6 A;  1WE6 A;  1WY8 A;  3ML9 A;  4CYE A;  4F1S A;  4FAD A;  2J0M A;  4XX5 A;  2UYZ B;  2ZNV C;  4PS3 A;  4K81 A;  2NBV B;  4HK2 A;  2LXC A;  4HVB A;  2JF5 A;  5AQO B;  2K39 A;  2KDI A;  3NOB A;  1UBQ A;  3U30 A;  4GU2 A;  1WX8 A;  1WM3 A;  3RCZ A;  1P0R A;  4IWP A;  3PRP B;  4NAW B;  3BY4 B;  4BBN F;  2CU1 A;  3A4R A;  1RAX A;  1GG3 A;  3U7D A;  5JH5 C;  2J0J A;  2ZEQ A;  2FAZ A;  2G4S A;  2DX5 B;  2KZR A;  4IC7 B;  2IBI B;  2M4N A;  3VDZ A;  5AQG B;  4HJK A;  2MQJ A;  4WJO A;  1X1M A;  3SDL C;  4EUT A;  5E6P A;  3ZLZ A;  3L54 A;  2GOW A;  4I6L B;  1WF9 A;  4HDQ A;  3PVL A;  1UBI A;  4NAW A;  3JW0 X;  5IA7 A;  1V5T A;  2IYD B;  2KFJ A;  4N9F 4;  1GJZ A;  3K9O B;  5DPT A;  3ZUN A;  2G4D B;  3A9K B;  1OQY A;  1HE8 A;  2I1J A;  2OJR A;  2EMT A;  4EKU A;  4KSL C;  2PPH A;  3PLU A;  3Q3F A;  2OOB B;  1WE7 A;  2DZM A;  2AEH A;  2M0X A;  4ZRI A;  5G55 A;  4FJZ A;  2PEA A;  3DDC B;  2K1F A;  2M8S A;  4HPL B;  4KZC A;  3V60 A;  2D11 A;  2IO0 B;  2MSE D;  1EO6 A;  3VH4 B;  2IO3 B;  2DYO A;  4WWN A;  4GDL B;  4FHK A;  3X23 A;  5AQU B;  2R2Q A;  3UF8 A;  4HWF A;  3A9K A;  3KVF B;  2FCS A;  3PRZ A;  5CHV C;  1P1A A;  3ZRF A;  1KLV A;  2V1Y A;  4XZ4 A;  2K8B A;  2DAJ A;  2RSU A;  4BKG A;  1WXA A;  1YJ1 A;  2BKR B;  1UD7 A;  1Z5S B;  2NVU I;  5DCN A;  3O65 B;  2BWF A;  3UIN B;  4JL9 A;  1WRD B;  3HK0 A;  1NDD A;  3KH0 A;  1WXS A;  1ZGU B;  2V3S A;  3EC8 A;  3HM3 A;  4W9F A;  5LXH A;  3MJW A;  3VH3 B;  1RFA A;  4GDL A;  4BOS C;  2KAN A;  4WJQ A;  3VQI A;  2BWE S;  4WWP A;  4IM3 A;  4KIK B;  1WX9 A;  3APC A;  2DZK A;  2KX0 A;  2NBW B;  3V6C B;  4G50 A;  4GGQ A;  3SHQ A;  1UGO A;  2V4L A;  4TKN A;  4NQL B;  3UIO B;  4II3 B;  2WWZ A;  3WAM A;  4PYZ A;  3VTW A;  5DPR A;  3OJ3 A;  1V9J A;  2G45 B;  3ZRC A;  2A4Z A;  1WI0 A;  2JPH A;  4DHZ E;  1M94 A;  4KIK A;  3QAR A;  5AZG A;  2QHO A;  3JYU A;  3ZNI D;  5AQL B;  4AJY B;  2JWZ A;  1NI2 A;  1JRU A;  1SIF A;  5JZE B;  4ANX A;  1WJN A;  4WJN A;  2KDF B;  2KFK B;  3L08 A;  4E71 A;  5AEK B;  2JVC A;  1YD8 U;  3AU4 A;  4ZRJ A;  1CMX B;  2JZZ A;  1WJ6 A;  4FUL A;  4W9D A;  2C5L C;  1T0Y A;  5D6J B;  4E74 A;  4OVU A;  1GUA B;  1RRB A;  4RM9 A;  4YL8 A;  3KW5 B;  4GDK B;  4LJP B;  4EFO A;  3RZF A;  3DBH I;  5E6N A;  3VVW B;  1EF5 A;  2BKF A;  3OLM D;  3DVG X;  3FZK B;  2KWV B;  1WIA A;  2KFK A;  3BIN A;  2WX1 A;  1WR6 E;  5JHB A;  3L10 B;  3HM6 X;  3EEC A;  4K7S A;  4WQO B;  4ANV A;  2LUE A;  2MCN B;  1I42 A;  2MLB A;  3FZM B;  2LGX A;  2AL6 A;  4GDK A;  4ZDV A;  5C1Z A;  2GBN A;  1Q0W B;  3VAW A;  2LAS A;  3GZN I;  3JVZ X;  2N4F A;  4KSK C;  3DQV A;  2BF8 B;  3TBL D;  2R2O A;  1E7U A;  4ASW C;  3PV1 A;  2MBH A;  1Z2M A;  3L13 A;  3QCA A;  2BGF A;  2J7Q B;  2D2Q A;  4LJO B;  5C23 A;  1V2Y A;  4XC2 A;  5TR5 A;  1P98 A;  3PHX B;  4M8N A;  1YX6 B;  2ZCC A;  3U8Z A;  1IYF A;  2LZ6 A;  2BYF A;  1GNU A;  2BPS A;  1WMH A;  3QK0 A;  3RT3 B;  3B0A A;  3CF6 E;  5IAA C;  3APF A;  1Q5W B;  4DWF A;  2N9P C;  2WX0 A;  3M3Z B;  2KDB A;  5AQM B;  2GBM A;  2KTR B;  2ZJD A;  3QIJ A;  4TQ0 A;  2DZI A;  1R4M I;  4HWD A;  1XD3 B;  3WAL A;  3FZH B;  2M1M A;  4IM0 A;  1C1Y B;  4RMA A;  4GXB A;  1OTR B;  2LGY A;  2CR5 A;  3EFU A;  2JRH A;  3ZW3 A;  1TGZ B;  5JHA A;  2NCN A;  1OEY J;  2GBK A;  1E8Z A;  1VD2 A;  4K1R B;  1U4A A;  3PPA A;  4ZRK A;  4BOZ B;  2D07 B;  2LVP A;  3V62 A;  4M0W B;  4MGI E;  2FCM A;  2KTR A;  4NPN A;  3TMP B;  5LXI B;  2L00 B;  2ZPN A;  1WX7 A;  5AZH A;  4M8M A;  4TUU A;  2CHW A;  5FR6 A;  3V6E B;  2LVQ A;  3CMM B;  3A4S C;  2LD9 A;  2RR9 A;  2ASQ A;  3QWZ B;  2L3Z A;  5AZF A;  2EMS A;  3VUY A;  4K7W A;  3DVN U;  4I6P A;  3M62 B;  3PHW B;  3PRM B;  3P2B A;  1YX5 B;  2ZZP B;  4G11 A;  3IFW B;  4HDO A;  1ISN A;  3M95 A;  3GOE A;  4GOC A;  4X57 B;  4FA6 A;  2DAF A;  1EUV B;  3VUX A;  4EEW A;  1HX1 B;  4AJW A;  2IY0 B;  3HIZ A;  3DBL I;  2KLG A;  3B08 A;  1VCB A;  3IHP C;  4W9I A;  2XBB C;  5LLI A;  2L8J A;  4MJS B;  1G6J A;  3PT2 B;  2KK8 A;  2N9X A;  3DCG A;  3W1S C;  3AUL A;  4DHZ B;  3KYD D;  3A8Y C;  1YQB A;  2XEW A;  2IO1 B;  1SE9 A;  2Y5B B;  3VTV A;  5L95 C;  3N3K B;  2DHZ A;  1NBF C;  4KZ0 A;  3NZS A;  1LM8 B;  2LXA A;  2O2V B;  4FLH A;  2DZJ A;  3D32 A;  3CST A;  3VTU A;  3ZDM C;  2MX2 A;  4WJP A;  4W9H A;  4JQW C;  4K7U A;  1V49 A;  2AL3 A;  2Z0D B;  4DBG A;  2MWS B;  1V80 A;  5AQJ B;  2KKC A;  4MJS A;  2XK5 A;  4MEL A;  1ZKH A;  4PYU A;  1TBE A;  2CKH B;  2KNB A;  4NJ7 A;  2G3Q B;  2KJ6 A;  2DYB A;  3T9L A;  4KV2 A;  2LI5 A;  4HCP B;  4JLC A;  4HXD A;  2O2V A;  5J17 A;  4FN2 A;  2KJH B;  3ONS A;  4W9L A;  5J18 A;  4MSM B;  2ZVO A;  1Q1O A;  5EDS A;  2K6D B;  3I3T B;  4IM2 A;  3IVF A;  2YLM A;  3SU8 X;  1PQS A;  2ZNV B;  1UK5 A;  3MHS D;  5AQT B;  3PLV A;  2I1K A;  3VHT C;  1P9D U;  3R7Q A;  4BVU C;  2FUH B;  5G2N A;  3AXC A;  4NJ6 A;  1BT0 A;  1LFD A;  4KDL B;  2KD0 A;  4MDK E;  2IO2 B;  3WAP A;  2PE6 B;  3R3M A;  2YVC A;  2KN5 A;  2Z59 B;  2L7R A;  5CX3 A;  2GMI C;  1E5W A;  2MA9 B;  1MG8 A;  2BYV E;  4DHJ D;  3FZL B;  1XQQ A;  4GSW A;  4JIO U;  3OAW A;  1D3Z A;  4TQ1 A;  3ALB A;  1GC6 A;  2J0K A;  3VUW A;  1GC7 A;  3HHM A;  3ZNH B;  1WMH B;  3TIX A;  4DK5 A;  1M62 A;  4URK A;  5AQP B;  2B3A A;  3WIM A;  3IG3 A;  2HE7 A;  2W9N A;  3QA8 A;  2N7D A;  2FNJ B;  3A33 B;  4HWI B;  2FCQ A;  3JSV B;  4NQK E;  3APD A;  1C3T A;  2RGF A;  4MH0 E;  1K8R B;  1L2N A;  3TJP A;  1T7S A;  1R4N I;  1UH6 A;  2AYO B;  3VFK A;  3WAN A;  3ZKJ C;  3RUL A;  4HWH A;  4MGY E;  1SGH A;  3V61 A;  1LXD A;  1WGH A;  2MBB B;  1V5O A;  3K9P B;  4MGZ E;  5DPS A;  2KQ7 A;  3T8M A;  4DHJ B;  2Z0E B;  3DBR I;  3PRE A;  1WZ3 A;  1UEL A;  4B95 A;  2D9D A;  3SD5 A;  2L76 A;  1S3S G;  3WAO A;  2C60 A;  5D94 A;  2JRI B;  3JSV A;  1IP9 A;  4HLE A;  2HD5 B;  4IW0 A;  4I6N B;  2UWQ A;  4MEM A;  4HCN B;  3LDQ B;  3QQ8 B;  4A3O A;  3A9J B;  3ENE A;  1KJT A;  4TV3 A;  2D3G A;  2MBE A;  2JXX A;  2K8H A;  3H7S A;  1QZE A;  1L7Y A;  2IZV B;  3KUZ A;  1UZX B;  1ZW7 A;  3KUD B;  1WZ0 A;  5BO4 B;  2GBJ A;  4AP4 C;  3H7P B;  3EHV A;  5AQN B;  4ANW A;  1TZ1 A;  2JZ3 B;  3MTN B;  5KHO A;  2KHW B;  2MW5 A;  3DPD A;  2KMC A;  3RYT A;  4W9K A;  5AQI B;  2ZCB A;  5CHF A;  4EOY A;  4CO7 A;  2KLC A;  5CTR C;  3KUC B;  3ML8 A;  2L0F A;  2ZVN A;  4F7Z A;  2RD0 A; 
#chains in the Genus database with same CATH topology
 5AUK A;  1J5E T;  4J2C A;  2KVZ A;  3ANW A;  3RYF E;  2N7J A;  3B9J A;  4PT5 A;  2EKI A;  4MM3 A;  2LSJ A;  2X67 A;  4DMV A;  1Y8R C;  3MC8 A;  2FCN A;  1XT9 B;  5BR8 T;  2H7V C;  4BKT A;  2J62 A;  2V8S V;  1E7V A;  1R4N B;  1WWT A;  2JT4 B;  3ZO5 B;  1V81 A;  1MMD A;  2K25 A;  1FPY A;  4A3P A;  1EZ3 A;  1P3Q U;  1EU4 A;  2LJ5 A;  2XUE A;  4RM8 A;  3NVO A;  1H8C A;  3VXW A;  2KC1 A;  4WW0 A;  5ABH A;  3DBR B;  4DR5 T;  1L4Z B;  4U74 A;  2VH2 A;  3N30 A;  3ZJT A;  1XLP A;  4PJJ A;  3TEZ A;  2PVO D;  2OLT A;  2XK5 B;  1XLO A;  4AQG A;  3KDS E;  1YW0 A;  3TUO A;  3Q5X A;  5L3E B;  1WGD A;  1YIW A;  1FMA D;  4LDT D;  1EWC A;  1KF6 A;  1WXQ A;  4RGT A;  5FVL A;  3AE1 B;  4W9C A;  5F3J A;  5BMV E;  4P1C C;  1B9R A;  4FJY A;  1E2A A;  4X64 T;  1I6Z A;  2K9X A;  2X66 A;  2NPT A;  1TTN A;  1R7S A;  4TV9 E;  4A56 A;  2BS2 B;  2LT3 A;  2WP9 A;  5ETW A;  4F8H A;  3UQ7 A;  1T0Q C;  2KMM A;  2LGI A;  3I9W A;  4EZL A;  1I35 A;  2VKJ A;  2N1V A;  2C5I T;  4YHH T;  1F52 A;  1LRZ A;  1WGY A;  3HKC E;  4JGH B;  4YSY A;  3ZMZ B;  3LK2 B;  1HTO A;  3TCA A;  3N20 C;  5JR9 B;  5AQV B;  2BYE A;  2RP4 A;  1MIV A;  4UF0 A;  2WXI A;  1OQQ A;  2KO3 A;  3ZJ2 A;  1ZE3 D;  5EE1 A;  2M17 A;  3PU8 A;  3VKH A;  1LQB A;  1I4X A;  3AE6 B;  4RGO S;  3R7R A;  2X9H A;  3AEC B;  2KTF A;  3WA0 A;  2DYM A;  3P4R A;  5ABF B;  3W5U B;  3N2K E;  1WGG A;  3B57 A;  1KNP A;  3NZU A;  2D3C A;  3FZF B;  4G0N B;  2WNM A;  4C4V B;  2XPK A;  3QB5 K;  1LKX A;  2JQR B;  4LCD E;  1D5M C;  3PSE B;  3ZTD A;  3AE2 B;  4ICU A;  1E8X A;  2KLQ A;  3AU5 A;  2X38 A;  3ZT7 A;  5LYJ E;  3ESL A;  4EZJ A;  2PG8 A;  2N7E A;  3RD2 A;  5EE9 A;  3NRX A;  1PUT A;  4EZK A;  3RUI B;  2W62 A;  4P0B A;  1DOX A;  2YOE A;  4UIG A;  2LLY A;  4AKH A;  4PJN A;  1KM7 A;  2CHO A;  3L17 A;  3MXZ A;  2LRU A;  3RNF C;  2LVO A;  2LWP A;  3RIA A;  2ZM6 T;  4J6I A;  3IBE A;  5BYQ A;  3N1Y C;  1YXR A;  2A5U A;  3F57 A;  2K6Q A;  2LRW A;  2JYE A;  4WNK A;  3H9D A;  2YKS A;  1UGM A;  3M3J A;  4F8C B;  3QB5 A;  3LJ3 A;  3RPU A;  2NR2 A;  2J53 A;  2KYW A;  2RDH A;  3Q3M C;  3RI5 A;  5L3B B;  4XDD A;  3PGE A;  2DEN B;  2KT9 A;  3KFW X;  2MP2 A;  4NNJ B;  2DNX A;  4JI8 T;  4X66 T;  1KNR A;  5F8P A;  4CI3 B;  4DDI D;  4LNK A;  2ZM8 A;  1MMA A;  3I5J C;  3LDZ E;  3Q5W A;  1WXV A;  2PJQ A;  4YT0 B;  3ML9 A;  2XAQ B;  2XM2 A;  4CYE A;  1GB1 A;  3SWH A;  5FL1 A;  4PJL A;  2YN6 A;  2N2N A;  2CM0 A;  3GA8 A;  4GLS C;  2XSA A;  3V5U A;  2J0M A;  2LM9 A;  4XX5 A;  4IL9 A;  4NPP A;  3RQW A;  1D6E C;  1VZ6 A;  4PS3 A;  1XMO T;  4YJ2 E;  4HVB A;  2JF5 A;  2KDI A;  3RN9 C;  4X1Y E;  2WXJ A;  3NOB A;  3U7Z A;  4AQ7 A;  4GKK T;  4H9O C;  2A9U A;  4IDO A;  2WXO A;  2YU1 A;  4BBN F;  4RNA A;  2W61 A;  3KVA A;  2K22 A;  1RAX A;  3LXF A;  3UU5 A;  1SA0 E;  2ODU A;  2WU2 B;  1FIO A;  4DV6 T;  2IBI B;  4IC7 B;  4YXD A;  4LF5 T;  1B1Z A;  2IIU A;  2MQJ A;  4WJO A;  5HXS A;  3KV4 A;  3SR6 A;  1OED C;  4CZZ B;  5E6P A;  4EUT A;  4HDQ A;  3C4Z A;  2V6X A;  1V5T A;  1GJZ A;  4N9F 4;  3K9O B;  2FJE A;  3UFG A;  3A9K B;  2I1J A;  4HKA A;  5LG3 A;  4DV1 T;  1I4H A;  4DV2 T;  3PLU A;  3Q3F A;  5CA0 E;  1WE7 A;  3ZYK A;  3BVM A;  2AEH A;  2M0X A;  4ZRI A;  1AYF A;  2JMK A;  3DDC B;  3V60 A;  1YQ4 A;  2D11 A;  1SE3 A;  2W3R A;  5LGT B;  3VH4 B;  2IO3 B;  4U2Z A;  3RH3 A;  4ADZ A;  2DYO A;  1WLX A;  3PZ7 A;  1WYB A;  4WWN A;  1PDX A;  4FHK A;  3GN5 A;  5IO9 A;  2MAW A;  2J1D G;  5M4Y A;  3PRZ A;  5CHV C;  1P1A A;  1D1B A;  3ZC0 A;  2V1D B;  2WXL A;  4QXB B;  1DOI A;  1NEN B;  3BZD B;  4NZL B;  3KBU A;  2IPK D;  3ZST A;  3FKY A;  2FJA A;  2N9K A;  4JL9 A;  3UIN B;  2CPT A;  2LOS A;  5I4D A;  1ZGU B;  3T1Y T;  4AKI A;  5LXH A;  3WAJ A;  1QOF A;  3K3Q C;  2IHR 1;  2DWK A;  3HKB E;  4ZI2 C;  4LF9 T;  3BVZ A;  2DZK A;  2NBW B;  2I0M A;  3GS2 A;  3KBT A;  2HHH T;  1LVK A;  4US9 A;  1UGO A;  3AEA A;  2L3L A;  1FFU A;  2B1E A;  2CXD A;  3ETR A;  1PGX A;  2NTT A;  3CQC B;  3SFD A;  3E08 A;  4X1K E;  4KX6 B;  4TKN A;  4OHF A;  4II3 B;  2WWZ A;  3O9X A;  4PYZ A;  3OJ3 A;  4YHJ A;  1TIF A;  2FUG 1;  1JRP A;  2V5D A;  2XQ4 A;  3JYU A;  5AQL B;  4JI0 T;  1WJN A;  2MBG A;  2XAH B;  4HFD A;  3L08 A;  4JYA T;  1CUN A;  4ACF A;  4C80 A;  4O4H E;  3PJA A;  2JZZ A;  2JSV X;  5CGM A;  1WJ6 A;  1YJI A;  2MTQ A;  3ETU A;  4RM9 A;  3KW5 B;  1D5X C;  2QRX A;  1WYC A;  5E6N A;  3B5M A;  3URY A;  4I50 E;  2KMF A;  4J3O D;  1N60 A;  2INC C;  2XN9 C;  1F2R C;  4C7Z A;  1XNR T;  2KFK A;  4O2A E;  5JHB A;  3P50 A;  2MCN B;  1N36 T;  2PLP A;  3FZM B;  2K0P A;  2MH7 A;  3IAM 1;  3LG7 A;  1Q0W B;  2KN4 A;  3AE5 B;  3GZN I;  1L0X B;  3RKO A;  3TLV A;  2V0G A;  2BF8 B;  3ZYL A;  5FR3 A;  2IC6 A;  3ABV B;  2AE9 A;  2WU5 A;  3AEG B;  5BYR A;  3L13 A;  2J7Q B;  4U33 A;  4HRO A;  2J47 A;  4YXD B;  1ET6 A;  2AQ3 B;  2K5P A;  5TR5 A;  1P98 A;  4UEM A;  2JMH A;  4YSZ A;  2VZK D;  1BR1 A;  1YD8 G;  3ONL C;  3AEF B;  3B0A A;  3CF6 E;  2NWB A;  2RPA A;  3WI3 A;  2QC8 A;  2N9P C;  2NTX A;  1OQR A;  3PUR A;  5JRC A;  4AI6 A;  4ZI2 D;  3CIR B;  2HN2 A;  3FXD B;  3ZCI A;  1QIL A;  4Z91 A;  4L1B A;  2DZI A;  3FZH B;  3PZ8 A;  1JW9 D;  5HFY A;  3AB5 A;  1N63 A;  5JHA A;  1T0R C;  2NCN A;  2N9D A;  1O3X A;  1SXT A;  3CX6 B;  4GKJ T;  3V62 A;  1U5P A;  3LJC A;  4MGI E;  3L8R A;  2L00 B;  2PW9 A;  4I43 B;  5E6J A;  1HF8 A;  1UUS A;  2YU2 A;  4O4J E;  4ZZB A;  1E7P B;  1QQR A;  1SIJ A;  3BYT B;  5FR6 A;  3V6E B;  3C98 B;  2ASQ A;  3DWG C;  5AZF A;  1BR4 A;  1JAL A;  2QJL A;  3P2B A;  4G11 A;  3IFW B;  4ZZC A;  1P7F A;  4HDO A;  3M95 A;  3VRB A;  3OKQ A;  1DU2 A;  4X57 B;  2X0L B;  4OZA A;  3VR9 A;  3AE3 A;  4EEW A;  4HPP A;  1HX1 B;  2YK0 A;  1JWS D;  4ARI A;  3DBL I;  2KLG A;  3B08 A;  4DR4 T;  1VCB A;  3RNA C;  3DP7 A;  2XBB C;  5LLI A;  2BBC A;  5LG4 A;  1MG4 A;  2KK8 A;  2N9X A;  3LYY A;  4NJC A;  4DHZ B;  2RDG A;  4GK5 E;  1UGJ A;  1YQB A;  2WXP A;  4TWH A;  3UUX B;  4A6Q A;  3N3K B;  4YTM B;  1LM8 B;  2LXA A;  2O2V B;  4FLH A;  3AVR A;  3MAC A;  3D32 A;  3VTU A;  1HTQ A;  4W9H A;  3NVZ A;  4JQW C;  4K7U A;  5HEJ A;  1NYR A;  2MWS B;  1MND A;  3AA6 B;  4EZH A;  1V80 A;  2W63 A;  1W0B A;  4MEL A;  3W2D A;  1C4C A;  1RFK A;  1JRO A;  2CKH B;  3M65 A;  4NJ7 A;  3KIN B;  4S17 A;  3CVR A;  1TYG B;  2LI5 A;  1YN3 A;  4HTE A;  2JPF A;  1C77 A;  2G0U A;  4OFZ A;  1PGB A;  2KJH B;  1LVF A;  2WAU A;  5J18 A;  2H3R A;  2XQA A;  4AQF A;  1QUU A;  3N9Q A;  1ZPS A;  1ZOY B;  4IM2 A;  1DOY A;  5JDF A;  1IBK T;  5HWY A;  3IVF A;  3SU8 X;  2UUB T;  5LP6 E;  1UK5 A;  1UF0 A;  3ZQ4 A;  3VHT C;  3RMK C;  1C79 A;  4MBQ A;  4ZEY A;  1SSN A;  5G2N A;  1K50 A;  1D0Y A;  4MDK E;  1Q10 A;  2IO2 B;  3WAP A;  3TEW A;  3IAS 1;  1CZP A;  2KN5 A;  1IJ5 A;  2L7R A;  3J9C A;  1E5W A;  4UV8 B;  1R8I A;  3AE9 B;  5JR9 C;  4JIO U;  4C91 A;  1VRA B;  3ALB A;  2J0K A;  3E0Z A;  2X9W A;  3I9Y A;  2WHI A;  1OED B;  3TLT A;  2IJ0 A;  1FXI A;  2J4X A;  3IG3 A;  2N7D A;  5HCJ A;  2RGF A;  2I2Y A;  1K8R B;  3IT6 B;  2UXB T;  1UH6 A;  3ZKJ C;  2E8I A;  3UUL A;  1QOB A;  4R3D A;  3EDU A;  3RHW A;  1V5O A;  3K9P B;  2KQ7 A;  1L0V A;  4B95 A;  3GB1 A;  2SEB D;  4RF1 A;  3BK2 A;  3W15 B;  3ZMV B;  2JRI B;  4HEA 1;  4HLE A;  4QXH B;  2K24 A;  4IW0 A;  5IHY A;  1I4P A;  3IT4 B;  1JQ4 A;  3Q5D A;  3LDQ B;  3QQ8 B;  2LKH A;  4A3O A;  3ENE A;  4ILU A;  2JXX A;  2K8H A;  5FYM A;  3ZJ1 A;  3ZKR A;  4X65 T;  1L7Y A;  1QZE A;  4AP4 C;  3KUD B;  5BO4 B;  2KXP B;  3EHV A;  3MTN B;  3PO0 A;  5KHO A;  1E1H B;  3DPD A;  3RYT A;  2JQK A;  3EUB 2;  2VVS A;  2KLC A;  2D3A A;  1D0X A;  2ZVN A;  1QLB A;  4F7Z A;  2CHN A;  1YKE B;  1ACC A;  2LHD A;  3A9J A;  3BK1 A;  3L0W B;  5AQS B;  1WYW B;  4QH5 A;  2G1E A;  3ZNZ B;  4JBW F;  4B0M A;  4QX8 B;  1WXM A;  2KVR A;  1E90 A;  1K51 A;  1IZN B;  3RNE C;  1SUM B;  4RF0 A;  3N1Z C;  4BKS D;  1IBX B;  5HAX A;  3R84 B;  1UNS A;  5CJ5 A;  1V8C A;  3GE8 C;  4L23 A;  2IGH A;  2KDM A;  3AI5 A;  3EA6 A;  2A72 A;  2XQ9 A;  1E8Y A;  3P63 A;  5AQH B;  4QWN B;  1WFY A;  2WZH A;  4DV5 T;  1MMN A;  4GIV A;  2BG9 C;  3KV5 A;  3TL5 A;  3QJZ A;  3ZMT B;  2FBW A;  1R4M B;  3I1A A;  5HKH A;  1RLF A;  2YIN A;  3Q3J A;  2L9Q A;  1MIW A;  1H4R A;  3N32 A;  3ZTC A;  3U2S C;  2NS5 A;  1FIQ A;  2FIF A;  4LTU A;  3UQB A;  2IY1 B;  4U31 A;  3J9X 1;  2REX A;  5HXC A;  1F9J A;  4A90 A;  2LKG A;  1I7H A;  3QX1 A;  2N1W A;  5HXE A;  3AE1 A;  2WLB A;  4IWQ A;  3O1I A;  4P1B C;  2HTH A;  3GP7 A;  4BKS A;  3AE7 B;  2BS2 A;  2NP9 A;  4HFB A;  2O6V B;  2C5K T;  3ZGZ A;  1J0G A;  4WIP A;  4AIU A;  1XMQ T;  3R2T A;  3QUJ A;  3S4U A;  5FNV E;  5JDH A;  2CEA A;  5MPO A;  5JR9 A;  2INP E;  3NRZ A;  2KC2 A;  2ZPY A;  3H8H A;  1D1C A;  1QOG A;  2EHO C;  4IG7 B;  3AE6 A;  3C4X A;  3AEC A;  1WJU A;  2UXC T;  5LMN T;  2Z6E A;  2FID A;  5ABF A;  3AVS A;  2ZW0 A;  5L3D B;  3RZW C;  3EAB A;  3ETV A;  4B3S T;  4ZHP A;  3L16 A;  3P4Q B;  3BQI A;  1Y01 A;  5IP4 D;  1CQV A;  4C4V A;  3AE8 A;  4HPM B;  1JNZ A;  1WR1 A;  3AE2 A;  4ILA A;  4LMK A;  1TJE A;  4EV6 A;  2H89 B;  3H6N A;  1V6E A;  4PS7 A;  4GMV A;  2CXF A;  2CHX A;  1F1H A;  4C56 C;  4KVG B;  4EZ4 A;  3IBP A;  4HN9 A;  3PV0 F;  4PNI A;  3ONX A;  2CWO A;  4H9R C;  3NJT A;  1VR9 A;  4IHJ E;  5CHW A;  2A2F X;  3BVG A;  3N9O A;  1WM2 A;  2KXJ A;  2CS4 A;  1XCQ L;  3UGB B;  1M7K A;  1IGD A;  3RYI E;  3FIL B;  2WXG A;  3R2I A;  3OG5 A;  2MYS A;  2C7H A;  2JY6 A;  4CXW A;  3SEB A;  1J5W A;  2CWY A;  3J7Y q;  2BB6 A;  4IIJ E;  3AEB B;  5BMI A;  4DR2 T;  4H9P C;  3OJA A;  2NBV B;  4HK2 A;  1U4Q A;  1D0Z A;  2QSD A;  5AQO B;  2DWQ A;  5F5W A;  3VR8 B;  3L09 A;  4IE4 A;  4NAW B;  4YT0 A;  2CU1 A;  1GG3 A;  3U7D A;  4US8 A;  2M67 A;  3SS1 A;  4JUY A;  2BS4 B;  3ZMS B;  2M4N A;  1NEK B;  4NXM T;  1FM0 D;  2P9B A;  4L0R A;  5EK2 A;  1X1M A;  4B0E A;  2HN1 A;  3SDL C;  2FBW B;  3L54 A;  3P4P B;  4I6L B;  4ILB A;  4LLG M;  3PVL A;  1UBI A;  1HZ6 A;  2IYD B;  3N9M A;  4ZOL E;  2EHO D;  3QNU A;  2IAK A;  1XCT L;  3ZUN A;  3VHL A;  2CMR A;  1OQY A;  4JI3 T;  2WU2 A;  2EMT A;  3Q8E A;  2GI9 A;  1WSP A;  3PUZ F;  4KHP T;  4FJZ A;  3IHR A;  4KZC A;  3X1D A;  2WBL A;  2G9H D;  2WGS A;  1HS7 A;  1UUP A;  3VRA B;  1QF6 A;  2JIW A;  3FHN A;  4YTN B;  3X23 A;  3MJ5 A;  2R2Q A;  2YDQ A;  4HWF A;  5L47 A;  3A9K A;  3EHZ A;  2FCS A;  2X0H A;  1YNT E;  3AMZ A;  2K8B A;  2BT6 A;  1CHU A;  2DAJ A;  3PE0 A;  1UD7 A;  2BWF A;  1WRD B;  3BYY B;  3MA9 A;  1WXS A;  4O8S A;  2V3S A;  3EC8 A;  4W9F A;  3L39 A;  2WZI A;  2KAN A;  1QSD A;  4IM3 A;  3UUM A;  4A98 A;  2VQF T;  2CA5 A;  1WX9 A;  2BBH A;  4IDI A;  1NEN A;  2EHO A;  2LHR A;  1WYG A;  2V4L A;  2I59 A;  4EYU A;  3BWU D;  1T8B A;  3Q2A C;  1OFF A;  4AS1 A;  1UWX A;  3AE8 B;  5FY0 A;  1UCU A;  3NVV A;  5DPR A;  4ERR A;  2G45 B;  3TSS A;  1N62 A;  1M94 A;  3UU8 A;  3HA4 A;  2QHO A;  1NI2 A;  1JWB D;  2QIE B;  4WJN A;  2LSY A;  5AEK B;  3N5L A;  4KX6 A;  3AU4 A;  3AAI A;  4FUL A;  1SHZ C;  4IKG A;  3NKZ A;  4AQY T;  1GUA B;  4YY3 T;  4YL8 A;  3FBZ A;  2KWI B;  4GDK B;  1SJH D;  2D3B A;  4JLE A;  3DBH I;  1MNE A;  4U72 A;  1JWU D;  3MP9 A;  3NUH B;  1GQE A;  5EK4 A;  3DVG X;  1FD6 A;  5L3G B;  2WX1 A;  1WR6 E;  2EEL A;  2JQQ A;  3HM6 X;  2PBI A;  3Q5E A;  4X62 T;  3PUQ A;  4OYJ A;  1KH0 A;  2QGS A;  1L4D B;  5C1Z A;  2GBN A;  2WXR A;  2LAS A;  1XO3 A;  3IEE A;  2K9A A;  4NIQ A;  2V3P A;  5DJQ C;  4HJG E;  5LNK 1;  2MBH A;  4C90 A;  3QCA A;  2BGF A;  1QKZ A;  2D2Q A;  5FXX A;  4EXT A;  3PUA A;  3Q14 C;  2KIN B;  3PHX B;  2WXK A;  2ZCC A;  4WWM A;  1IYF A;  2BYF A;  2N9L A;  1GNU A;  2BG9 B;  3AE5 A;  1N61 A;  3RT3 B;  2X9Y A;  3APF A;  1Q5W B;  3B2F A;  4UVA B;  1FJG T;  3ABV A;  3M3Z B;  2WX0 A;  2KDB A;  2ZJD A;  3AEG A;  2WY2 A;  3QIJ A;  4TQ0 A;  4ANJ A;  2WDQ B;  1VRB A;  4WBO A;  4LK0 M;  5HXH A;  2VL8 A;  3WAL A;  3DWM A;  2V7J A;  2CJN A;  2M1M A;  1YN5 A;  3HI2 A;  4GXB A;  1OTR B;  3EFU A;  3AEF A;  3UQ4 A;  1VD2 A;  4K1R B;  3PPA A;  1ROE A;  3CIR A;  4BJM A;  2FCM A;  4MAL A;  3TMP B;  4IOI E;  2BKO A;  2NTY A;  4XAX B;  4KGR A;  5EK3 A;  3GZN B;  2KWH A;  4HFE A;  5IWA T;  1WX7 A;  1W0A A;  2X0Y A;  4M8M A;  4TUU A;  1FFV A;  1J7B A;  5JTG A;  1HTJ F;  3A4S C;  3AAA B;  2XQ7 A;  5J0Z A;  1ZXH A;  2W54 A;  3VUY A;  4NUU A;  4I6P A;  4L9I A;  3PHW B;  1SJE D;  2ACZ B;  3Q3N C;  4DV3 T;  3PRM B;  3W9C B;  2HH7 A;  2ZZP B;  1Z0P A;  4LNO A;  1C76 A;  2WQY B;  2WB5 A;  2XSB A;  1ISN A;  4E7S A;  1MIY A;  4A9A A;  2OHF A;  1UWM A;  4FA6 A;  2DAF A;  1E7P A;  2FUP A;  2EHO B;  1EUV B;  4FXC A;  4AJW A;  3HIZ A;  2D5U A;  2V5C A;  2ODV A;  2XAS B;  1ESF A;  3NVY A;  2L8J A;  5LA6 E;  3Q8F A;  3AB3 B;  5LMU T;  5BMG A;  3EDV A;  3W1S C;  5HWX A;  3AUL A;  2L1A A;  3KYD D;  2BZB A;  4MH8 A;  3HL6 A;  2DWG A;  2IO1 B;  1SE9 A;  2SAK A;  2WS3 B;  3BK9 A;  4JI5 T;  2DZJ A;  3TLS A;  5JDG A;  3ZDM C;  4WJP A;  1B7T A;  4DBG A;  3AA0 B;  3TLW A;  2V6Y B;  4DR7 T;  1Y56 A;  5KXJ A;  1KRH A;  1TBE A;  5L4E A;  3P42 A;  2W3S A;  3EVY A;  4KV2 A;  3AV8 A;  4HKQ A;  4YTM A;  4WZX A;  1BUI C;  4HXD A;  2O2V A;  1Z8U A;  5J17 A;  1ZUD 2;  2Y8D A;  4WUR A;  2ZVO A;  4N59 A;  3C4W A;  3MC9 A;  5FMN A;  5GXG B;  2K6D B;  3ZPO A;  1N5W A;  3OVU A;  1TS5 A;  2RMM A;  1KLU D;  4KI0 F;  1K53 A;  4REZ A;  5T8I A;  5AQT B;  4EB6 E;  4YSX B;  2PTF A;  3RX6 A;  3T8O A;  1P9D U;  2I1K A;  1XXG A;  4ZHQ E;  2FUH B;  2BW2 A;  3IXS A;  3R3M A;  2YVC A;  5ADX L;  1T72 A;  2MA9 B;  2BYV E;  2X9X A;  3FZL B;  2V7M A;  5LJM A;  2E9X C;  1ZOY A;  4IST A;  1I4Q A;  4ZOH C;  3OAW A;  1D3Z A;  2MEK A;  1GC6 A;  1X9B A;  4O4L E;  3ZNH B;  1KK7 A;  1RM6 C;  3LFM A;  1M62 A;  1VCT A;  5AQP B;  3FC4 A;  2W82 A;  2B3A A;  2L8K A;  3QA8 A;  4TSS A;  2FNJ B;  2FCQ A;  2MOZ A;  1C3T A;  4EEB A;  1S94 A;  1T7S A;  2N0S B;  3VFK A;  2PMV A;  1FRR A;  3AE9 A;  5JDN A;  1LXD A;  3NWI A;  3DTO A;  2YEP B;  5DPS A;  2DLB A;  3T8M A;  1OED A;  2RA1 A;  1WZ3 A;  2D9D A;  4U3C A;  1BR0 A;  5LNK A;  2L76 A;  4LF4 T;  3WAO A;  2C60 A;  1IP9 A;  1TKG A;  3DHG C;  5DQV A;  3NS1 A;  2UWQ A;  4MEM A;  3RPF C;  4EIW A;  5KX5 E;  3SRZ A;  4IE5 A;  2X51 A;  2AQ2 B;  3LK4 2;  4PK5 A;  4OZC A;  2IZV B;  5EE0 A;  2L32 A;  3H7P B;  5AQN B;  3ZN1 B;  4DV4 T;  4ANW A;  1RYJ A;  3LB8 C;  3OTO T;  2JQH A;  2N1G A;  2W4X A;  1TS2 A;  2JX5 A;  4CO7 A;  4TNW A;  3LK3 B;  4Z8X A;  2RD0 A;  2NOX A;  3PZD A;  4IWO A;  3T3N A;  2V7L A;  2KOX A;  2NMQ A;  2LRL A;  4AKG A;  1L0Y B;  3DOW A;  1FO4 A;  2W66 A;  3CX7 B;  4YJ3 E;  4ZI3 C;  3TEY A;  3ZJV A;  3W1S A;  3ZDT A;  3Q3O C;  4ZYS A;  4BJN A;  2VRR B;  3ZNG C;  1VDV A;  2Q9Q C;  2RPQ A;  2KSR A;  3W1Y A;  4XYC A;  4K3B A;  4TX5 A;  3H3M A;  4W9E A;  4YTP B;  3CQX C;  2V7I A;  5A1L A;  3QAQ A;  1FXT B;  2L05 A;  4UV9 B;  3OBV E;  3U3I A;  2WDV B;  2BYT A;  5EZY E;  4OYK A;  5JRE A;  3ZJU A;  2KX3 A;  2VKH A;  2AWT A;  1IBX A;  2O6V D;  5GMV A;  2XAJ B;  3HKE E;  5GON E;  2IDY A;  2LGD A;  2WXQ A;  3I63 C;  4Z90 A;  5TSS A;  2NBU A;  1J8C A;  4KMC A;  2C7M B;  4ZYN A;  2L0T A;  3QHT A;  1IPG A;  1HG2 A;  2HJ8 A;  2ZM2 A;  3UT5 E;  3CSF A;  3Q8B A;  3RYC E;  5KHQ A;  1GB4 A;  3KWL A;  1NI3 A;  2XM1 A;  4B6W A;  3R6N A;  2ZLY A;  2J4G A;  2WWV A;  5FKA C;  4E3C A;  3C51 A;  4MGK E;  4M1P A;  4PS8 A;  2E2A A;  1KOT A;  3A1Q B;  2ICI A;  3ZLI A;  1HG5 A;  3OJ4 B;  2WDT B;  4G3X B;  4IE0 A;  4HFV A;  2V26 A;  2N9E B;  4NAM A;  4DR6 T;  2LHE A;  1SEB D;  4ANU A;  5DPW A;  4ZI7 E;  3DVN V;  2VKD A;  3RGL A;  1XEE A;  2V9H A;  3UQA A;  5AQR B;  3PDY A;  1XF5 L;  3N9P A;  1HR0 T;  2XQ6 A;  3P8C D;  3AE7 A;  5E6O A;  4LF8 T;  2O6V A;  5AQK B;  1US7 B;  2MBQ A;  5L83 A;  1S1Q B;  3CX8 B;  1E8W A;  4PK6 A;  2LMC A;  2E6X A;  3ZMU B;  2LSG A;  1L5P A;  4U7Y A;  1WH3 A;  4ZI3 D;  4BFR A;  2KJR A;  2PIA A;  2WYQ A;  3RRW A;  3DVG Y;  3JCF A;  4CN4 A;  4UEL A;  5AQF B;  3EUH A;  3ZT5 A;  4A20 A;  3NY5 A;  2MRP A;  1VOM A;  3P4Q A;  4H9S E;  3C0R B;  3NS8 A;  3JC6 C;  3ECI A;  5G5G A;  4XWT A;  4OVV A;  1N6Z A;  2LGS A;  4MAC A;  4WAA A;  4C7Y A;  5AQQ B;  4ASK A;  2K5B B;  3I0O A;  1W09 A;  3Q8C A;  5CB4 E;  2VL0 A;  3KYC D;  3NRY A;  2H89 A;  4YLH A;  3AEE B;  3C64 A;  4TZ4 C;  3B13 A;  1WE6 A;  1WY8 A;  1V9D A;  1C4A A;  2QVA A;  4YWG G;  3R8B A;  2CJO A;  2M56 B;  1JCK B;  4LNI A;  4FAD A;  2K48 A;  4DR3 T;  2ZNV C;  1G73 A;  5LOV E;  4A97 A;  1IAP A;  2GRI A;  4JWS C;  2K39 A;  2QIL A;  4ZRQ A;  5H92 C;  1UBQ A;  1HCI A;  5LGU B;  3FIL A;  1WX8 A;  3RCZ A;  3U30 A;  4P09 A;  3KQ4 A;  4IWP A;  3SFE B;  1XDP A;  3PRP B;  2VUR A;  4EE2 A;  1STE A;  5JH5 C;  3AEB A;  2J0J A;  2ZEQ A;  4DV7 T;  5FKY A;  5LGN B;  2FAZ A;  2JYT A;  2DX5 B;  3P7I A;  4PFO A;  3U52 E;  1T6B X;  2F4V T;  4ISS A;  4HJK A;  2MJ3 A;  2XQ5 A;  1ZKE A;  3U4E G;  3QC9 A;  4JPS A;  2GOW A;  3VR8 A;  4NAW A;  1P7E A;  3JW0 X;  4LNF A;  5JDQ A;  2KFJ A;  3LSV A;  1FMV A;  3KV9 A;  2BS4 A;  4WYV A;  1HE8 A;  1MPE A;  2OJR A;  1NEK A;  2PTL A;  1PGA A;  2BBJ A;  2PPH A;  2OOB B;  2VH1 A;  2DZM A;  4DND A;  2GLS A;  3ZCJ A;  3AXJ B;  2PEA A;  3O13 A;  2K1F A;  2M8S A;  5H6R B;  3P4P A;  1DYQ A;  2MSE D;  1EO6 A;  4QHO A;  4B3T T;  4GDL B;  3ZN0 B;  1D5Z C;  4A5X A;  1HZ5 A;  2IDO B;  2YDS A;  4TV8 E;  4CXX A;  1FCL A;  2VB6 A;  4WAF A;  1KLV A;  3ZRF A;  2V1Y A;  4XZ4 A;  5CA1 E;  2RSU A;  2X68 A;  2BVC A;  1WXA A;  2BKR B;  4PK1 A;  2Z8L A;  3O65 B;  4HRS A;  1AN8 A;  3V3X A;  3RC3 A;  5JVD E;  1NDD A;  3KH0 A;  3MHZ A;  3TEX A;  3HKD E;  2D2S A;  3VRA A;  2E9X B;  3HM3 A;  4LFB T;  2KND A;  4YTN A;  1RFA A;  5H6Q B;  3DHH C;  4XZC A;  3VQI A;  4WWP A;  3C19 A;  4TNV A;  4KIK B;  2WWU A;  3APC A;  3V6C B;  2DHR A;  2XZE A;  2JZP A;  1TT5 B;  2BQQ A;  2UU7 A;  5LBM A;  4P1N A;  1WRD A;  4NQL B;  2WMO A;  4ZS2 A;  5HYA A;  3U78 A;  5D3I B;  2XJ7 A;  3F2E A;  2UU9 T;  1AW7 A;  1FRD A;  3L3P A;  5C3J B;  3ZRC A;  4JE3 B;  4MHC A;  1WI0 A;  2A4Z A;  4ZRP A;  2JPH A;  5AZG A;  3QAR A;  3ZNI D;  1WFD A;  4C00 A;  1YOV B;  2ACX A;  2L52 A;  4QH1 A;  4KUM B;  2LSI A;  4HFH A;  1SF0 A;  2QCZ A;  2M19 A;  3Q8A A;  4EOZ B;  4E71 A;  3ZYY X;  2JVC A;  1VZ8 A;  1CMX B;  1M4V A;  3MK7 C;  5D6J B;  1A70 A;  1T0Y A;  4E74 A;  5HXR A;  3Q69 A;  1RRB A;  4OVU A;  2DBY A;  3HVZ A;  4JI6 T;  4N6E B;  3RZF A;  4XWW A;  3WAK A;  3VVW B;  2WXF A;  1EF5 A;  2BKF A;  2W55 A;  1LGR A;  4XDC A;  1WIA A;  3NZ3 A;  1FCC C;  4K0U A;  4NUV A;  3L10 B;  3F31 A;  2BS3 B;  4WQO B;  2H88 B;  3NBX X;  1I42 A;  1UUR A;  2LGX A;  4WBN E;  1NAF A;  4GDK A;  4EED A;  4OX9 T;  4ZDV A;  3VAW A;  3RLF F;  3FB2 A;  1HFA A;  3AE4 B;  2FE8 A;  3JVZ X;  2NW9 A;  1ZXI A;  5LXT E;  2PKO A;  3N1X C;  3TBL D;  2XQY A;  2BVM A;  1E7U A;  2R2O A;  5HG2 A;  1BR2 A;  4ASW C;  3PV1 A;  2WXN A;  1G8X A;  2CE7 A;  1Z2M A;  1XNQ T;  2INN E;  3RIU C;  2R61 A;  4I4T E;  4LJO B;  2Q9Q B;  2YEP F;  5C23 A;  2XAG B;  3LBX B;  3IA3 A;  4M8N A;  1ET9 A;  1ENF A;  2KT7 A;  2LZ6 A;  3N9N A;  3PUG A;  1WMH A;  2HTM E;  4EGW A;  2FJD A;  1XZY A;  1HNW T;  5IAA C;  4DWF A;  4JWU C;  3H37 A;  1W9R A;  3KWV A;  3UTK A;  2PFV A;  2IGG A;  2GBM A;  3SOL A;  2KTR B;  2GB1 A;  4EAH A;  2MJE A;  3DBH B;  1R4M I;  4HWD A;  1XD3 B;  2D5G A;  4RMA A;  1C1Y B;  4CXY A;  2VAS A;  2SPC A;  1HNX T;  2CR5 A;  2JRH A;  2BG9 A;  1TGZ B;  1TKE A;  4N58 A;  2Y5C A;  1OEY J;  4XBF B;  4LF7 T;  1IJ6 A;  4KP3 C;  1C4P A;  4ZRK A;  4BOZ B;  1OWA A;  3O1H A;  3G06 A;  2D07 B;  3H3A A;  1F2R I;  4NPN A;  2WDQ A;  5LXI B;  3BQK A;  5AZH A;  3VKG A;  3JAD A;  1YN4 A;  4UXN B;  3CMM B;  5FXW A;  2RR9 A;  3BII D;  3QWZ B;  2L3Z A;  2NR4 A;  2EMS A;  4K7W A;  3K8P C;  1F0Z A;  3RRC A;  5AUI A;  2W67 A;  3AED B;  4RGN A;  4UDU C;  3GOE A;  4GOC A;  4A55 A;  3UU4 A;  3KV6 A;  2BVL A;  4V1A v;  3VUX A;  2MJD A;  4ILC A;  5HEO A;  2DNF A;  1ZP0 B;  4W9I A;  2I6H A;  2JQ9 A;  4MJS B;  3W5V B;  4WH4 A;  2ACZ A;  2Q5W D;  3HUI A;  2LJL A;  2WQY A;  3PUS A;  2XEW A;  2LUM A;  4H63 V;  2A3D A;  3CQG B;  4KZ0 A;  1IBM T;  2LFI A;  2RPV A;  4QXC B;  3PJA J;  5H8Y E;  1V1P B;  1V49 A;  2AL3 A;  4I0U A;  4N78 D;  1D4B A;  4QAY A;  2KKC A;  2WXM A;  1YQ3 B;  1JNR A;  1ZKH A;  2B76 B;  2E5L T;  4PYU A;  4BZA A;  4IT4 A;  5C2T B;  1MVK A;  2KJ6 A;  4IDQ A;  3UI3 A;  4JLC A;  4HCP B;  4B6X A;  4P6V F;  2WS3 A;  4EYY R;  2E3T A;  2OV9 A;  1WGK A;  2AQ1 B;  3ONS A;  1T3Q A;  1X79 A;  3Q6B A;  1FNV A;  2W00 A;  1Q1O A;  2V6Y A;  3I3T B;  1CJE A;  3MC0 B;  2YLM A;  2ZNV B;  3PLV A;  1UX5 A;  1E6E B;  3B2G A;  4O1N A;  4M02 A;  1I4R A;  1WCR A;  1L6V A;  4PK4 A;  2QEJ C;  3AXC A;  4NJ6 A;  5D3D A;  1BT0 A;  5J2U E;  1LFD A;  2MHJ A;  3UU3 A;  2Z59 B;  5CX3 A;  2GMI C;  3ZYM A;  1KFY B;  1MG8 A;  2C0S A;  3T1H T;  3OYX A;  3RIU A;  3I57 A;  1XQQ A;  4GSW A;  3CWI A;  3HHM A;  1PFD A;  4YSX A;  2HPJ A;  1WMH B;  2LRK A;  2I38 A;  3Q9D A;  1HXY D;  3ZXR A;  3A33 B;  3JSV B;  4NQK E;  4B3R T;  3APD A;  4LML A;  4MH0 E;  3CWZ B;  1JWA D;  5L2L A;  3TJP A;  3K3N A;  1R4N I;  3WAN A;  3RUL A;  3MZK B;  4HWH A;  4MGY E;  3V61 A;  3O4X E;  2MBB B;  2WDR B;  4DHJ B;  3DBR I;  3PRE A;  3JAF A;  2DI4 A;  2W0G A;  3T3O A;  1S3S G;  2WSS V;  2YEV C;  4LFC T;  2Y48 B;  4H63 H;  1JWM D;  3D0T A;  4XGA B;  2HJ1 A;  3UU6 A;  3ANW B;  4FJO A;  1KJT A;  2IML A;  4GOU A;  3TKL B;  4DO0 A;  2D3G A;  4MM3 B;  3H7S A;  5IUX A;  3KUZ A;  2V3N A;  4ITK A;  5FK9 C;  1GPX A;  3FBL A;  2IND C;  2KMC A;  2XHE B;  4W9K A;  4HFI A;  4UVC B;  5AQI B;  3ZSS A;  2ZCB A;  5CTR C;  5KDM C;  3KUC B;  4X1I E;  2CLY B;  4KBM B;  4FHJ A;  4AWJ A;  2AX5 A;  2VK9 A;  4FJV B;  1A5R A;  3A5X A;  2MBO A;  5JDL A;  4NY0 A;  5TAO A;  1ZHC A;  4P7I A;  1HQR D;  3H7P A;  3DJB A;  2EKE C;  3ZT6 A;  4KGS A;  2KMA A;  3PTF C;  4IUM B;  2UXN B;  3OYZ A;  1KF6 B;  3NG0 A;  2CHZ A;  4CHK A;  2BG9 E;  4QKN A;  3EI0 A;  3QOF A;  2C7N B;  2NPT B;  3V5S A;  2C9W B;  2K8C A;  2E5V A;  4X20 E;  2WP9 B;  3KLS X;  4OZB A;  3ZEF B;  1WGR A;  1T98 A;  4I55 E;  3PU3 A;  1YKH B;  4YSY B;  3P4S A;  3C50 A;  2KDE B;  4JEU B;  4M01 A;  3GE3 C;  4RFB A;  1NVI D;  4UF0 B;  2WCA A;  4BBN C;  4RCO A;  1OGW A;  3S2A A;  2PE9 A;  1OEY A;  5J2T E;  4DUZ T;  1V97 A;  2PJH A;  2LHN A;  5EE3 A;  3CKD A;  3ZVV A;  1F77 A;  2ONQ A;  3P4R B;  4YTP A;  2JUO A;  2CRB A;  2WXH A;  2VKO A;  5J2R A;  2WDV A;  2D0U A;  2GBR A;  1EF1 A;  2KAJ A;  4MSQ B;  5FY7 A;  1MJD A;  2IW5 B;  1UX4 A;  4M00 A;  4GN1 A;  1WJ4 A;  1J19 A;  2KWC A;  4HWC A;  1NWM X;  5DQW A;  2UUA T;  1T5X D;  1SBB B;  4HGA A;  3ZIM A;  4UR9 A;  4LDT B;  4TUY E;  1AWD A;  1KTK A;  4S0R A;  4FBJ B;  5C8Y E;  3UIP B;  4DDG D;  3PUX F;  4B9K A;  4MFR A;  4ZS3 A;  2Y3A A;  4HFC A;  5D7G A;  4DID B;  2Y5P A;  3K1S A;  1YJJ A;  4KGT A;  2WMN A;  2KWU B;  1MI0 A;  3QC8 B;  5LHH B;  2W2U A;  3X0W A;  3I0Q A;  3DBL B;  4CN1 A;  2QDF A;  4DXA B;  4AOF A;  3A1Q A;  4KDI C;  2KQS A;  5D2M B;  2BKP A;  2OED A;  3DHI C;  3PS6 A;  3RIF A;  3E22 E;  1TY2 A;  3H1U A;  3VU7 H;  1GAQ B;  4W9J A;  5HHD G;  3NZQ A;  1VZ7 A;  2VQE T;  1SB3 C;  4WWO A;  5JDM A;  2UUC T;  2BTE A;  2MP2 B;  4BA9 A;  3M63 B;  3AAE B;  2YDR A;  5FL0 A;  4II2 B;  4CN6 A;  3C8Y A;  1K52 A;  4AXP A;  4GIW A;  1L6U A;  4A8X C;  3B1L X;  4GB9 A;  3NHE B;  3EAM A;  3BQL A;  4OW0 A;  4AQF C;  1AAR A;  2CBI A;  3K3O A;  2D10 A;  3DBS A;  3PTR B;  2HDE A;  4AUQ C;  4DV0 T;  3AA1 B;  3R66 C;  4JI7 T;  3RYH E;  1I94 T;  4G2A A;  4X5T A;  4DXG A;  4ICV A;  3EFC A;  4W9G A;  3QK6 A;  1OXZ A;  1SE2 A;  2NW8 A;  1V86 A;  4RGM A;  5BYS A;  3RNG C;  3PUY F;  4F1S A;  4OK0 A;  3P4W A;  2UYZ B;  2K3U A;  4K81 A;  3IF8 B;  4P16 A;  1N32 T;  2LXC A;  4WQM A;  2M6I A;  3UUN A;  3V05 A;  4HKZ E;  5G5H A;  1FXA A;  4GU2 A;  3AEE A;  1WM3 A;  1P0R A;  3N9Y C;  4H2A A;  3BY4 B;  3A4R A;  1HX8 A;  2V7K A;  4BKG A;  1KLG D;  2TSS A;  5FVK A;  4L2Y A;  2DLR A;  2G4S A;  5IYZ E;  2KZR A;  1N34 T;  2VWA A;  3VDZ A;  2QMT A;  5AQG B;  1E0Z A;  4LMJ A;  3NVW A;  2LE8 A;  1ZDX A;  3E56 A;  3ZLZ A;  1S35 A;  4FI5 A;  1YQ4 B;  1WF9 A;  3SFE A;  3P4S B;  5AFU L;  4JV5 T;  5IA7 A;  3TLU A;  3MKD A;  2QA7 A;  5DPT A;  3GN5 B;  3PUV F;  4JI2 T;  2G4D B;  3RNB C;  4KKJ A;  3A7M A;  1ZDV A;  4EKU A;  4KSL C;  5HEH A;  5FXV A;  5FP3 A;  2E9X D;  3L4P A;  5G55 A;  1G6J A;  3OWE B;  4HPL B;  2IO0 B;  1VJK A;  2LOP A;  2VVN A;  4GYR A;  5J1G A;  4CI1 B;  4BAX A;  2X8X X;  1EWY C;  2ON8 A;  2ZMA A;  5AQU B;  4M0W A;  3UF8 A;  2PVG C;  3KVF B;  1SE4 A;  3OPC A;  1KNZ A;  2R6G F;  3Q2M A;  2CU3 A;  3N2O A;  3AEA B;  1T0S C;  5L3C B;  1TZO A;  3AXJ A;  4TWF A;  5DAB A;  2FJB A;  5LCY A;  1ZEE A;  1YJ1 A;  1Z5S B;  2NVU I;  5DCN A;  3SFD B;  3HK0 A;  2ES0 A;  1GOZ A;  2ZW1 A;  4E7Z A;  3MJW A;  3VH3 B;  4GDL A;  4BOS C;  4DMW A;  4DBQ A;  4KHZ F;  4WJQ A;  5IOI A;  2BWE S;  1XLQ A;  4USA A;  2KX0 A;  1XWM A;  4G50 A;  4GGQ A;  4JEH B;  3SHQ A;  1ZV4 X;  1NYQ A;  3UIO B;  4AIS A;  3N2G E;  4AKL A;  3HVD A;  4GYS A;  3WAM A;  2E9X A;  3VTW A;  2JJ9 A;  4YFS A;  1N5X A;  1V9J A;  5IN7 A;  4IE7 A;  5LBQ B;  1I4G A;  3RFZ B;  4DHZ E;  4KIK A;  1IBL T;  4AJY B;  4QH4 A;  5E0O A;  2JWZ A;  4TMA B;  2Y6X A;  1JRU A;  1SIF A;  5JZE B;  4ANX A;  2KDF B;  2KFK B;  2ZM0 A;  4IDP A;  2LM2 A;  3AA7 B;  1YD8 U;  4ZRJ A;  5ABE A;  4W9D A;  2XQ3 A;  2C5L C;  3RQU A;  5C3J A;  4K3C A;  4LJP B;  4EFO A;  1BXT A;  4UVB B;  3E9S A;  2MPK A;  5LB7 B;  2Q9Q D;  3OLM D;  3FZK B;  2KWV B;  2WU5 B;  2M6B A;  3BIN A;  4XE0 A;  4CQI A;  3N9L A;  1HA5 A;  3PUW F;  1IUE A;  3EEC A;  4K7S A;  4ANV A;  2LUE A;  2MLB A;  4PAG A;  1V1O A;  2AL6 A;  4YSZ B;  2JU6 X;  5KMG P;  1XLN A;  2N4F A;  4H9Q C;  4B3M T;  2LEK A;  4TWD A;  3DQV A;  4KSK C;  2BDE A;  4DBR A;  4IDZ A;  5JRC B;  5JXV A;  2M0A A;  3RNC C;  2BS3 A;  4LFA T;  2H88 A;  1WR0 A;  1V2Y A;  3P1M A;  4XC2 A;  3HRD D;  1YX6 B;  3RI7 C;  2DL1 A;  3U8Z A;  2BPS A;  3QK0 A;  3AE4 A;  2XY8 B;  3JAE A;  2AXD S;  3O1J A;  5AQM B;  1OED E;  2BB5 A;  4PW8 A;  1E10 A;  2GK9 A;  1VLB A;  4PJM A;  2Q9Q A;  4AKR B;  2C5J A;  4IM0 A;  3GMI A;  3LBX A;  1H7C A;  5CFB A;  4OHJ A;  2LGY A;  5L4H A;  4CI2 B;  1J7A A;  3ZW3 A;  4IE6 A;  2OA5 A;  3AM9 A;  2GBK A;  3CPZ A;  3FXE B;  1E8Z A;  1U4A A;  4PFP A;  2VZK B;  1QOA A;  4GK0 E;  2LVP A;  4M0W B;  2KTR A;  1LO5 D;  4U7I A;  2D0T A;  1RWS A;  3VRB B;  1C78 A;  2ZPN A;  3VR9 B;  3AE3 B;  2KZ7 B;  2CHW A;  2H7O A;  2LVQ A;  5HEG A;  2LD9 A;  3ZC1 A;  1AJ3 A;  1XDO A;  1CK1 A;  3DVN U;  4OVZ A;  3M62 B;  4IL4 A;  1YX5 B;  3I9V 1;  4COF A;  2IGD A;  4ARC A;  1VCS A;  4G63 A;  1C9F A;  4ZHO A;  4BAY B;  1FNU A;  3JC6 D;  2IY0 B;  4L5G A;  5HCM A;  4NXN T;  3IHP C;  3PT2 B;  3DCG A;  2CBJ A;  1HEZ E;  3A8Y C;  2QYW A;  2Y5B B;  3ZXV A;  3AED A;  3VTV A;  5L95 C;  4LF6 T;  1NBF C;  2DHZ A;  3NZS A;  2CLY C;  2LSK A;  4DVD A;  3CST A;  1FEW A;  2MX2 A;  2OJW A;  2Z0D B;  1ZP0 A;  2NTS A;  2XQ8 A;  1TS3 A;  4ZXL A;  5AQJ B;  1J7C A;  1J1J A;  4MJS A;  5LHI B;  5ABG A;  2XK5 A;  2UXD T;  2J42 A;  3ONJ A;  5LJN A;  4DUY T;  1MFW A;  2KNB A;  2K3W A;  1E9M A;  2G3Q B;  5BMH A;  4QX7 B;  2DYB A;  3T9L A;  4K0K T;  3UFE A;  2CCQ A;  4FN2 A;  4U2Y A;  2WM9 A;  1TY0 A;  1V1P A;  4W9L A;  4CQN A;  4MSM B;  5EDS A;  2XAF B;  1YQ3 A;  4P0A A;  5FY1 A;  1Y64 B;  2RDB C;  4KKI A;  2B76 A;  4LNN A;  3HR0 A;  1JML A;  5C2T A;  2IC9 A;  1PQS A;  3MHS D;  1HNZ T;  4Q2J A;  3CK6 A;  2NW7 A;  2BKN A;  4IGU A;  4F6R C;  1TS4 A;  3R7Q A;  4BVU C;  1WR6 A;  1PYW D;  4DQO C;  1EM7 A;  2JRK A;  4JI1 T;  4KDL B;  3GWH A;  2KD0 A;  4DR1 T;  4RH6 A;  2PE6 B;  3CML A;  4JX1 C;  4DHJ D;  4D2K A;  2JXT A;  3NZP A;  3AN1 A;  1YMH E;  1BML C;  4TQ1 A;  3VUW A;  1GC7 A;  1L0V B;  5JH7 E;  3TIX A;  4DK5 A;  4URK A;  1D1A A;  2L83 A;  5HI1 A;  1EU3 A;  3WIM A;  2UXX B;  4IDN A;  5IKC M;  2HE7 A;  2W9N A;  1N33 T;  2IUB A;  4HWI B;  1TKY A;  3FAH A;  1MHX A;  1FNW A;  1L2N A;  1KFY A;  1MMG A;  3KVB A;  4IRE A;  2AYO B;  3MJX A;  2KQ4 X;  1SGH A;  2V4I B;  1FMW A;  4DXF A;  2CXL A;  1WGH A;  1FEH A;  4O4I E;  4MGZ E;  3UUB A;  2Z0E B;  1SE7 A;  5L3F B;  1UEL A;  1IGC A;  3SD5 A;  2LJI A;  1WRI A;  2XNA C;  2XTL A;  4HE8 A;  5D94 A;  5JQG E;  3JSV A;  2HD5 B;  2KWD A;  4H9N C;  1DGJ A;  4I6N B;  4Q25 A;  2DCF A;  1QLB B;  1QT9 A;  4O2B E;  2J52 A;  5FXZ A;  4HCN B;  3WCQ A;  1KEY A;  3A9J B;  4MLK A;  4TV3 A;  2MBE A;  2JWU A;  4TN7 B;  2WDR A;  1MHH E;  4JI4 T;  1UZX B;  1ZW7 A;  2LEH A;  1WZ0 A;  2GBJ A;  2HPL A;  1TZ1 A;  2JZ3 B;  3EGR A;  3MFG A;  5HEU A;  2KHW B;  3RC8 A;  2MW5 A;  4HEA A;  5CHF A;  3AH7 A;  3RF1 A;  4EOY A;  5LHG B;  3ML8 A;  2L0F A;  2KAC A;  4MT5 A;  3RKG A; 
#chains in the Genus database with same CATH homology
 4IWO A;  2KOX A;  3A9J A;  4FHJ A;  4AWJ A;  3L0W B;  5AQS B;  1WYW B;  3DOW A;  4MM3 A;  4FJV B;  1A5R A;  1Y8R C;  2MBO A;  2FCN A;  4NY0 A;  1XT9 B;  4P7I A;  3ZNZ B;  3H7P A;  4BKT A;  1WXM A;  2KVR A;  3ZO5 B;  1E7V A;  1E90 A;  2EKE C;  2JT4 B;  1V81 A;  2K25 A;  4A3P A;  2KMA A;  3PTF C;  4IUM B;  3W1S A;  3ZDT A;  4BKS D;  1P3Q U;  2CHZ A;  4RM8 A;  2LJ5 A;  2VRR B;  4CHK A;  1H8C A;  3ZNG C;  3VXW A;  2C7N B;  2KC1 A;  3AI5 A;  2NPT B;  2RPQ A;  3W1Y A;  3N30 A;  1E8Y A;  2C9W B;  2K8C A;  5AQH B;  1WFY A;  4W9E A;  4GIV A;  3QAQ A;  1FXT B;  1WGR A;  2L05 A;  3TL5 A;  3PZD A;  2XK5 B;  3QJZ A;  1WGD A;  1YIW A;  5HKH A;  1RLF A;  4LDT D;  3Q3J A;  2KX3 A;  2AWT A;  2KDE B;  4W9C A;  1H4R A;  2O6V D;  5GMV A;  3N32 A;  3ZTC A;  4FJY A;  4BBN C;  1I6Z A;  1OGW A;  3S2A A;  2NS5 A;  1OEY A;  2LGD A;  2PE9 A;  2NPT A;  1TTN A;  2NBU A;  1J8C A;  2C7M B;  2FIF A;  2PJH A;  3UQB A;  4ZYN A;  3ZVV A;  2L0T A;  3QHT A;  2IY1 B;  1I35 A;  1IPG A;  4EZL A;  2JUO A;  2REX A;  1F9J A;  2HJ8 A;  5KHQ A;  2N1V A;  3CSF A;  5J2R A;  2GBR A;  4B6W A;  1EF1 A;  1WGY A;  4JGH B;  4MSQ B;  3QX1 A;  2N1W A;  3TCA A;  4GN1 A;  1WJ4 A;  1J19 A;  2KWC A;  5AQV B;  2BYE A;  4IWQ A;  4HWC A;  4MGK E;  4PS8 A;  4E3C A;  2KO3 A;  1KOT A;  3A1Q B;  2M17 A;  1LQB A;  3ZIM A;  2HTH A;  4LDT B;  3OJ4 B;  4G3X B;  2WDT B;  3R7R A;  4BKS A;  4FBJ B;  2KTF A;  3UIP B;  3WA0 A;  2O6V B;  2DYM A;  4DDG D;  2N9E B;  4B9K A;  1J0G A;  1WGG A;  5D7G A;  3NZU A;  3FZF B;  4ANU A;  2KWU B;  5DPW A;  3QC8 B;  4G0N B;  3X0W A;  3DVN V;  4LCD E;  3ZTD A;  3PSE B;  4ICU A;  4DXA B;  2KC2 A;  1E8X A;  2ZPY A;  3AU5 A;  4AOF A;  5AQR B;  3A1Q A;  3UQA A;  4KDI C;  2KQS A;  4IG7 B;  5D2M B;  4EZJ A;  2N7E A;  1WJU A;  3RD2 A;  3PS6 A;  5E6O A;  2O6V A;  5AQK B;  2FID A;  3RZW C;  3RUI B;  4EZK A;  3H1U A;  2MBQ A;  5L83 A;  1S1Q B;  3L16 A;  1E8W A;  4W9J A;  1KM7 A;  4WWO A;  1WH3 A;  3L17 A;  2LRU A;  2MP2 B;  4BFR A;  2KJR A;  2LVO A;  3M63 B;  4HPM B;  2LWP A;  2WYQ A;  4J6I A;  3IBE A;  4II2 B;  1WR1 A;  2A5U A;  3DVG Y;  2K6Q A;  2LRW A;  3H6N A;  3H9D A;  1V6E A;  5AQF B;  4PS7 A;  1UGM A;  3M3J A;  4GMV A;  2CHX A;  3B1L X;  4GB9 A;  4KVG B;  4A20 A;  3NY5 A;  4F8C B;  3NHE B;  3LJ3 A;  2MRP A;  2NR2 A;  1AAR A;  3C0R B;  3NS8 A;  3ECI A;  2D10 A;  3PGE A;  4OVV A;  2DEN B;  3DBS A;  5CHW A;  4WAA A;  2MP2 A;  4AUQ C;  5AQQ B;  4NNJ B;  3R66 C;  1WM2 A;  2KXJ A;  2CS4 A;  3KYC D;  3UGB B;  1M7K A;  4DDI D;  4ICV A;  4W9G A;  3LDZ E;  1WXV A;  2C7H A;  1V86 A;  2JY6 A;  1WE6 A;  1WY8 A;  3ML9 A;  4CYE A;  4F1S A;  4FAD A;  2J0M A;  4XX5 A;  2UYZ B;  2ZNV C;  4PS3 A;  4K81 A;  2NBV B;  4HK2 A;  2LXC A;  4HVB A;  2JF5 A;  5AQO B;  2K39 A;  2KDI A;  3NOB A;  1UBQ A;  3U30 A;  4GU2 A;  1WX8 A;  1WM3 A;  3RCZ A;  1P0R A;  4IWP A;  3PRP B;  4NAW B;  3BY4 B;  4BBN F;  2CU1 A;  3A4R A;  1RAX A;  1GG3 A;  3U7D A;  5JH5 C;  2J0J A;  2ZEQ A;  2FAZ A;  2G4S A;  2DX5 B;  2KZR A;  4IC7 B;  2IBI B;  2M4N A;  3VDZ A;  5AQG B;  4HJK A;  2MQJ A;  4WJO A;  1X1M A;  3SDL C;  4EUT A;  5E6P A;  3ZLZ A;  3L54 A;  2GOW A;  4I6L B;  1WF9 A;  4HDQ A;  3PVL A;  1UBI A;  4NAW A;  3JW0 X;  5IA7 A;  1V5T A;  2IYD B;  2KFJ A;  4N9F 4;  1GJZ A;  3K9O B;  5DPT A;  3ZUN A;  2G4D B;  3A9K B;  1OQY A;  1HE8 A;  2I1J A;  2OJR A;  2EMT A;  4EKU A;  4KSL C;  2PPH A;  3PLU A;  3Q3F A;  2OOB B;  1WE7 A;  2DZM A;  2AEH A;  2M0X A;  4ZRI A;  5G55 A;  4FJZ A;  2PEA A;  3DDC B;  2K1F A;  2M8S A;  4HPL B;  4KZC A;  3V60 A;  2D11 A;  2IO0 B;  2MSE D;  1EO6 A;  3VH4 B;  2IO3 B;  2DYO A;  4WWN A;  4GDL B;  4FHK A;  3X23 A;  5AQU B;  2R2Q A;  3UF8 A;  4HWF A;  3A9K A;  3KVF B;  2FCS A;  3PRZ A;  5CHV C;  1P1A A;  3ZRF A;  1KLV A;  2V1Y A;  4XZ4 A;  2K8B A;  2DAJ A;  2RSU A;  4BKG A;  1WXA A;  1YJ1 A;  2BKR B;  1UD7 A;  1Z5S B;  2NVU I;  5DCN A;  3O65 B;  2BWF A;  3UIN B;  4JL9 A;  1WRD B;  3HK0 A;  1NDD A;  3KH0 A;  1WXS A;  1ZGU B;  2V3S A;  3EC8 A;  3HM3 A;  4W9F A;  5LXH A;  3MJW A;  3VH3 B;  1RFA A;  4GDL A;  4BOS C;  2KAN A;  4WJQ A;  3VQI A;  2BWE S;  4WWP A;  4IM3 A;  4KIK B;  1WX9 A;  3APC A;  2DZK A;  2KX0 A;  2NBW B;  3V6C B;  4G50 A;  4GGQ A;  3SHQ A;  1UGO A;  2V4L A;  4TKN A;  4NQL B;  3UIO B;  4II3 B;  2WWZ A;  3WAM A;  4PYZ A;  3VTW A;  5DPR A;  3OJ3 A;  1V9J A;  2G45 B;  3ZRC A;  2A4Z A;  1WI0 A;  2JPH A;  4DHZ E;  1M94 A;  4KIK A;  3QAR A;  5AZG A;  2QHO A;  3JYU A;  3ZNI D;  5AQL B;  4AJY B;  2JWZ A;  1NI2 A;  1JRU A;  1SIF A;  5JZE B;  4ANX A;  1WJN A;  4WJN A;  2KDF B;  2KFK B;  3L08 A;  4E71 A;  5AEK B;  2JVC A;  1YD8 U;  3AU4 A;  4ZRJ A;  1CMX B;  2JZZ A;  1WJ6 A;  4FUL A;  4W9D A;  2C5L C;  1T0Y A;  5D6J B;  4E74 A;  4OVU A;  1GUA B;  1RRB A;  4RM9 A;  4YL8 A;  3KW5 B;  4GDK B;  4LJP B;  4EFO A;  3RZF A;  3DBH I;  5E6N A;  3VVW B;  1EF5 A;  2BKF A;  3OLM D;  3DVG X;  3FZK B;  2KWV B;  1WIA A;  2KFK A;  3BIN A;  2WX1 A;  1WR6 E;  5JHB A;  3L10 B;  3HM6 X;  3EEC A;  4K7S A;  4WQO B;  4ANV A;  2LUE A;  2MCN B;  1I42 A;  2MLB A;  3FZM B;  2LGX A;  2AL6 A;  4GDK A;  4ZDV A;  5C1Z A;  2GBN A;  1Q0W B;  3VAW A;  2LAS A;  3GZN I;  3JVZ X;  2N4F A;  4KSK C;  3DQV A;  2BF8 B;  3TBL D;  2R2O A;  1E7U A;  4ASW C;  3PV1 A;  2MBH A;  1Z2M A;  3L13 A;  3QCA A;  2BGF A;  2J7Q B;  2D2Q A;  4LJO B;  5C23 A;  1V2Y A;  4XC2 A;  5TR5 A;  1P98 A;  3PHX B;  4M8N A;  1YX6 B;  2ZCC A;  3U8Z A;  1IYF A;  2LZ6 A;  2BYF A;  1GNU A;  2BPS A;  1WMH A;  3QK0 A;  3RT3 B;  3B0A A;  3CF6 E;  5IAA C;  3APF A;  1Q5W B;  4DWF A;  2N9P C;  2WX0 A;  3M3Z B;  2KDB A;  5AQM B;  2GBM A;  2KTR B;  2ZJD A;  3QIJ A;  4TQ0 A;  2DZI A;  1R4M I;  4HWD A;  1XD3 B;  3WAL A;  3FZH B;  2M1M A;  4IM0 A;  1C1Y B;  4RMA A;  4GXB A;  1OTR B;  2LGY A;  2CR5 A;  3EFU A;  2JRH A;  3ZW3 A;  1TGZ B;  5JHA A;  2NCN A;  1OEY J;  2GBK A;  1E8Z A;  1VD2 A;  4K1R B;  1U4A A;  3PPA A;  4ZRK A;  4BOZ B;  2D07 B;  2LVP A;  3V62 A;  4M0W B;  4MGI E;  2FCM A;  2KTR A;  4NPN A;  3TMP B;  5LXI B;  2L00 B;  2ZPN A;  1WX7 A;  5AZH A;  4M8M A;  4TUU A;  2CHW A;  5FR6 A;  3V6E B;  2LVQ A;  3CMM B;  3A4S C;  2LD9 A;  2RR9 A;  2ASQ A;  3QWZ B;  2L3Z A;  5AZF A;  2EMS A;  3VUY A;  4K7W A;  3DVN U;  4I6P A;  3M62 B;  3PHW B;  3PRM B;  3P2B A;  1YX5 B;  2ZZP B;  4G11 A;  3IFW B;  4HDO A;  1ISN A;  3M95 A;  3GOE A;  4GOC A;  4X57 B;  4FA6 A;  2DAF A;  1EUV B;  3VUX A;  4EEW A;  1HX1 B;  4AJW A;  2IY0 B;  3HIZ A;  3DBL I;  2KLG A;  3B08 A;  1VCB A;  3IHP C;  4W9I A;  2XBB C;  5LLI A;  2L8J A;  4MJS B;  1G6J A;  3PT2 B;  2KK8 A;  2N9X A;  3DCG A;  3W1S C;  3AUL A;  4DHZ B;  3KYD D;  3A8Y C;  1YQB A;  2XEW A;  2IO1 B;  1SE9 A;  2Y5B B;  3VTV A;  5L95 C;  3N3K B;  2DHZ A;  1NBF C;  4KZ0 A;  3NZS A;  1LM8 B;  2LXA A;  2O2V B;  4FLH A;  2DZJ A;  3D32 A;  3CST A;  3VTU A;  3ZDM C;  2MX2 A;  4WJP A;  4W9H A;  4JQW C;  4K7U A;  1V49 A;  2AL3 A;  2Z0D B;  4DBG A;  2MWS B;  1V80 A;  5AQJ B;  2KKC A;  4MJS A;  2XK5 A;  4MEL A;  1ZKH A;  4PYU A;  1TBE A;  2CKH B;  2KNB A;  4NJ7 A;  2G3Q B;  2KJ6 A;  2DYB A;  3T9L A;  4KV2 A;  2LI5 A;  4HCP B;  4JLC A;  4HXD A;  2O2V A;  5J17 A;  4FN2 A;  2KJH B;  3ONS A;  4W9L A;  5J18 A;  4MSM B;  2ZVO A;  1Q1O A;  5EDS A;  2K6D B;  3I3T B;  4IM2 A;  3IVF A;  2YLM A;  3SU8 X;  1PQS A;  2ZNV B;  1UK5 A;  3MHS D;  5AQT B;  3PLV A;  2I1K A;  3VHT C;  1P9D U;  3R7Q A;  4BVU C;  2FUH B;  5G2N A;  3AXC A;  4NJ6 A;  1BT0 A;  1LFD A;  4KDL B;  2KD0 A;  4MDK E;  2IO2 B;  3WAP A;  2PE6 B;  3R3M A;  2YVC A;  2KN5 A;  2Z59 B;  2L7R A;  5CX3 A;  2GMI C;  1E5W A;  2MA9 B;  1MG8 A;  2BYV E;  4DHJ D;  3FZL B;  1XQQ A;  4GSW A;  4JIO U;  3OAW A;  1D3Z A;  4TQ1 A;  3ALB A;  1GC6 A;  2J0K A;  3VUW A;  1GC7 A;  3HHM A;  3ZNH B;  1WMH B;  3TIX A;  4DK5 A;  1M62 A;  4URK A;  5AQP B;  2B3A A;  3WIM A;  3IG3 A;  2HE7 A;  2W9N A;  3QA8 A;  2N7D A;  2FNJ B;  3A33 B;  4HWI B;  2FCQ A;  3JSV B;  4NQK E;  3APD A;  1C3T A;  2RGF A;  4MH0 E;  1K8R B;  1L2N A;  3TJP A;  1T7S A;  1R4N I;  1UH6 A;  2AYO B;  3VFK A;  3WAN A;  3ZKJ C;  3RUL A;  4HWH A;  4MGY E;  1SGH A;  3V61 A;  1LXD A;  1WGH A;  2MBB B;  1V5O A;  3K9P B;  4MGZ E;  5DPS A;  2KQ7 A;  3T8M A;  4DHJ B;  2Z0E B;  3DBR I;  3PRE A;  1WZ3 A;  1UEL A;  4B95 A;  2D9D A;  3SD5 A;  2L76 A;  1S3S G;  3WAO A;  2C60 A;  5D94 A;  2JRI B;  3JSV A;  1IP9 A;  4HLE A;  2HD5 B;  4IW0 A;  4I6N B;  2UWQ A;  4MEM A;  4HCN B;  3LDQ B;  3QQ8 B;  4A3O A;  3A9J B;  3ENE A;  1KJT A;  4TV3 A;  2D3G A;  2MBE A;  2JXX A;  2K8H A;  3H7S A;  1QZE A;  1L7Y A;  2IZV B;  3KUZ A;  1UZX B;  1ZW7 A;  3KUD B;  1WZ0 A;  5BO4 B;  2GBJ A;  4AP4 C;  3H7P B;  3EHV A;  5AQN B;  4ANW A;  1TZ1 A;  2JZ3 B;  3MTN B;  5KHO A;  2KHW B;  2MW5 A;  3DPD A;  2KMC A;  3RYT A;  4W9K A;  5AQI B;  2ZCB A;  5CHF A;  4EOY A;  4CO7 A;  2KLC A;  5CTR C;  3KUC B;  3ML8 A;  2L0F A;  2ZVN A;  4F7Z A;  2RD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...