4HWIB

Crystal structure of atbag1 in complex with hsp70
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
177
structure length
177
Chain Sequence
MIRVRIKYGAVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
molecule keywords Heat shock cognate 71 kDa protein
total genus 66
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwiB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hwiB01
2N9PC 3PRZA 2JXXA 3IVFA 1G6JA 3APDA 1GG3A 3PPAA 3TBLD 1WXMA 2BYEA 2CHWA 1LM8B 2JRHA 2KVRA 1QZEA 4GXBA 4HWDA 4TQ0A 2I1JA 4KV2A 1Q5WB 4JGHB 4M0WB 5L83A 4KDLB 3V60A 1YD8U 2MP2B 4F7ZA 2KWCA 1V86A 5AQLB 2KQ7A 1Y8RC 4HCPB 2HTHA 2BWFA 2A4ZA 4GSWA 2LWPA 3FZFB 5D94A 1V2YA 5LLIA 1BT0A 4KSKC 4MSQB 4BKSA 4B95A 1R4MI 2LVOA 4MJSB 5AQOB 3A9JB 5AQRB 2KN5A 3V6CB 1SGHA 3VTUA 2GOWA 3N3KB 4HCNB 1RFAA 2LGYA 4OVUA 4XZ4A 5CX3A 2D10A 1WRDB 3QCAA 1M7KA 4HLEA 3IG3A 5AQVB 5IA7A 3LJ3A 2V1YA 2KC2A 4MSMB 4GU2A 5E6NA 3V61A 3MTNB 4PS7A 1A5RA 4FHKA 3ZLZA 3QC8B 1TBEA 2K39A 1UZXB 2KWVB 4WAAA 1RAXA 1K8RB 5AQFB 3AU4A 4M8NA 4BBNC 2MQJA 1WGRA 3L0WB 2FAZA 4IW0A 2LUEA 3AI5A 3RYTA 4BVUC 3K9PB 1YX6B 1FXTB 2IO3B 4FHJA 2FCQA 5DCNA 1V5TA 4KDIC 2BYVE 3L54A 2MCNB 3SHQA 4K7SA 4M8MA 2KFKA 2I1KA 3DVGY 1YX5B 2LRUA 3H7PB 2N1WA 2O6VA 4IUMB 4W9EA 3U7DA 1IP9A 4KVGB 3FZMB 5AQNB 2JWZA 5GMVA 1WGHA 2BPSA 3A9JA 3DDCB 4BOZB 5KHQA 4LJOB 2DAFA 2LJ5A 4URKA 3B1LX 3K9OB 2FNJB 3AU5A 3KH0A 4JL9A 4LDTD 1L7YA 3A4RA 2BWES 4LDTB 3Q3FA 1EF1A 4DWFA 4FN2A 2LRWA 3X23A 1ZW7A 4BFRA 1UK5A 3ZTDA 4CO7A 2N4FA 5DPRA 4II2B 3SDLC 4BKTA 2KXJA 5JHBA 2K6DB 3N32A 3PSEB 1JRUA 1KLVA 4W9GA 2KKCA 1H4RA 2IO0B 5AQSB 4WJPA 1V81A 3VFKA 2IZVB 4FBJB 3FZLB 4BOSC 2DYMA 2B3AA 1XT9B 2K6QA 2LI5A 3AULA 4G50A 3HM3A 4FJZA 4KIKB 3VH4B 3UQAA 5G55A 3UQBA 2MA9B 4JQWC 1J19A 4EZJA 3LDQB 2NCNA 4GB9A 4AJYB 2J0JA 2KC1A 3NHEB 1E8YA 4B6WA 2WWZA 1P9DU 4NPNA 2REXA 2L3ZA 4GN1A 5J18A 2ZCBA 2AWTA 4MH0E 1P3QU 5AQQB 5JZEB 4IC7B 3JSVA 3EECA 2L05A 3HK0A 3TIXA 5LXIB 1XD3B 3RULA 1WIAA 1KJTA 5AQUB 2RGFA 3ZO5B 4A20A 2MW5A 2KMAA 1X1MA 2J7QB 3A8YC 3ZDTA 5CHWA 1C1YB 2RPQA 4TKNA 3ML8A 2D11A 4KIKA 2N7EA 2JPHA 2VRRB 3H9DA 1LQBA 3RT3B 2J0KA 4MM3A 3KUCB 2JF5A 4OVVA 3QARA 2DENB 3NZSA 3KYDD 5EDSA 1OQYA 5JH5C 4MGYE 4DDID 5CHFA 2C7NB 3O65B 2NPTB 3V62A 2K25A 2KANA 3QA8A 5IAAC 3H6NA 1VD2A 5AEKB 2D9DA 2R2OA 3DCGA 2MBBB 2KTRA 3QX1A 2V4LA 4G11A 4I6NB 2AL6A 3JYUA 4BKGA 2WX1A 3M95A 5D6JB 2D2QA 3M62B 4FULA 3VUXA 4EZKA 3DVGX 4AWJA 4E71A 4HK2A 2W9NA 2MBHA 2GMIC 4N9F4 4FADA 2M8SA 1F9JA 4ZYNA 4GDLA 4JIOU 3WALA 3B08A 3NY5A 4HDQA 5CHVC 2M17A 3GOEA 3M3JA 1WGGA 3QJZA 1IYFA 3DBRI 3IBEA 2Z0EB 1GNUA 2NVUI 5AQMB 2KFKB 2N9EB 2HD5B 3C0RB 3DVNU 2ZVNA 2R2QA 4WJNA 3VHTC 4ANUA 2OJRA 3ENEA 3DPDA 3SU8X 2NPTA 2CKHB 4BBNF 2JY6A 3KUDB 1GJZA 1UGMA 2GBJA 3OJ3A 2KZRA 2D07B 1OTRB 2JZZA 2XEWA 3H1UA 3KW5B 3I3TB 3ZW3A 4W9JA 2M4NA 2V3SA 1PQSA 4MEMA 4AP4C 2XBBC 4I6LB 3UGBB 2GBNA 1NBFC 2MSED 4W9LA 2MP2A 2C7MB 4W9KA 1YIWA 3HM6X 3N30A 3BY4B 4WQOB 2CHZA 4E3CA 2N9XA 3DOWA 4FLHA 2PE6B 3L08A 2N7DA 3LDZE 4MDKE 4A3PA 2MBQA 2N1VA 1E5WA 2JRIB 3HIZA 3JVZX 3M63B 4PS3A 3WAPA 3ZTCA 5C1ZA 2QHOA 4W9FA 1WE6A 2MRPA 4FJYA 4BKSD 3NOBA 4EOYA 4PS8A 2G4SA 3VXWA 5G2NA 2EMSA 2ZZPB 2L76A 2UYZB 3ZNGC 1KOTA 3A1QA 3VUWA 3U30A 3P2BA 5C23A 1GUAB 1E7VA 1OEYA 2CHXA 4ICVA 1E8XA 3VTWA 2GBMA 3A33B 3CSFA 3WIMA 1V6EA 4EFOA 3PV1A 3A9KA 2BF8B 2KDBA 2NS5A 1E7UA 4JLCA 3TCAA 3CMMB 1WR1A 1WXAA 3W1SA 2KMCA 4DHZB 5FR6A 4HVBA 5AQJB 4GDKA 3PZDA 3ZNZB 1ZGUB 2L7RA 2L8JA 3NS8A 4IM2A 2KX0A 3QIJA 2CU1A 2NBVB 2DZIA 3VUYA 4DXAB 2O6VB 3QHTA 1NI2A 3L13A 1I6ZA 1UBIA 4X57B 1XQQA 3W1SC 3DBLI 1H8CA 3PS6A 2WDTB 3EC8A 2C5LC 3B0AA 3NZUA 3QAQA 2IYDB 4J6IA 1P98A 2ASQA 1WMHA 2K8BA 3GZNI 4B9KA 3ONSA 3W1YA 4II3B 1P0RA 1YQBA 2A5UA 2C60A 4CYEA 2DZMA 4MGZE 2PJHA 1TGZB 5AQHB 1OGWA 2K8CA 2LVPA 3ALBA 4IM0A 4EEWA 4HWHA 4KZCA 4WWPA 4F8CB 3JSVB 2HE7A 3QQ8B 2C9WB 5L95C 2KNBA 2ZJDA 3A9KB 3L16A 4XX5A 2ZPYA 3PGEA 2CR5A 4IM3A 4HXDA 2KDEB 4ANVA 1ISNA 3A4SC 1SE9A 2KTFA 3T8MA 4ZDVA 2KJHB 3KYCD 4NJ6A 1WJUA 3BINA 2JUOA 4EUTA 4LJPB 4EKUA 1WM2A 1Q1OA 2AL3A 4ANXA 1WGYA 2NR2A 4RM9A 1E90A 2KDFB 3PTFC 4HPMB 1SIFA 4NAWB 3VAWA 3ZVVA 1WR6E 3AXCA 2G45B 2WX0A 3L10B 2KFJA 1OEYJ 1Z2MA 5LXHA 1V5OA 4HPLB 1WZ3A 4W9CA 4PYZA 3PRPB 4HJKA 3U8ZA 1M62A 1LFDA 4DDGD 3ZUNA 2L0FA 4RMAA 3OAWA 4ASWC 2M1MA 4IWQA 3WANA 3TJPA 2BKRB 2LASA 2PE9A 3PREA 1UH6A 4E74A 3VTVA 5AQPB 2IO2B 1S1QB 2Y5BB 4AOFA 2K1FA 2RR9A 2IBIB 2KJ6A 4HWCA 1GC6A 1V80A 2DAJA 3CF6E 1GC7A 3Q3JA 5AZHA 3HHMA 3R7RA 3VH3B 3R66C 4A3OA 5J2RA 1WM3A 4IWOA 3FZHB 2RSUA 3WAMA 1VCBA 1E8WA 1WYWB 3OJ4B 3OLMD 4K7UA 4TUUA 3WA0A 3JW0X 4LCDE 4K7WA 4RM8A 4WWOA 3UINB 1WGDA 2DYOA 2PPHA 3QWZB 1UBQA 1UGOA 1EUVB 3PHWB 4WWNA 2RD0A 3ZIMA 4WJOA 2G3QB 2IY1B 3EHVA 3DBHI 1WF9A 3KVFB 4W9HA 4ZRIA 1WJ4A 2ZNVC 3MJWA 4P7IA 3ZRCA 2DHZA 1J8CA 3CSTA 3KUZA 3MHSD 4DK5A 2KLGA 1T7SA 1V9JA 2MBEA 1EF5A 2PEAA 3S2AA 1E8ZA 2WYQA 4PYUA 1KM7A 4DHZE 1WXSA 3PVLA 4TV3A 1AARA 2K8HA 3APFA 2MWSB 5BO4B 3VDZA 2DZJA 4HDOA 4MGIE 3RUIB 4DHJD 4DHJB 1UD7A 2FUHB 1EO6A 4WJQA 5DPSA 4TQ1A 2XK5B 1IPGA 1WJNA 2KQSA 3H7SA 5TR5A 5J17A 5JHAA 4ICUA 4KZ0A 3ZRFA 1UELA 3UIPB 4EZLA 3M3ZB 1D3ZA 4HWIB 4W9DA 2EMTA 2DYBA 3ZDMC 2CS4A 5D7GA 4NY0A 1P1AA 4NJ7A 4FA6A 2DZKA 4NNJB 2C7HA 5DPWA 5E6OA 2LVQA 2FIFA 1M94A 1T0YA 2FIDA 3FZKB 5AQGB 2IY0B 2GBRA 3PHXB 2MX2A 2NBUA 2OOBB 3R7QA 2JZ3B 2KWUB 1C3TA 4YL8A 1I35A 4G3XB 3RZFA 4AUQC 2D3GA 1WX9A 3D32A 2AEHA 4GGQA 4XC2A 3R3MA 2FCSA 2JVCA 2LD9A 3RCZA 2ZCCA 2ZVOA 3ML9A 2DX5B 2UWQA 1R4NI 2BKFA 1WI0A 3RD2A 2HJ8A 2G4DB 2LGDA 4GDKB 2MBOA 5AQKB 4NQLB 3X0WA 4GMVA 1WX8A 2LGXA 2BGFA 1LXDA 2KK8A 2AYOB 2M0XA 2IO1B 3DVNV 4DBGA 3DBSA 3L17A 5HKHA 2KTRB 3VVWB 2GBKA 1WY8A 1Z5SB 5E6PA 3PRMB 2LXCA 1WJ6A 2KD0A 3UIOB 3DQVA 2O2VA 2Z0DB 1RLFA 3ZKJC 3V6EB 4I6PA 1HE8A 3IHPC 4MGKE 1TZ1A 4ZRJA 1CMXB 2NBWB 3APCA 4MJSA 1L2NA 2ZNVB 4GIVA 2FCMA 2YVCA 1J0GA 2O6VD 2KDIA 5CTRC 1YJ1A 2KO3A 4NQKE 3SD5A 3ECIA 4IWPA 2KHWB 2ZEQA 2ZPNA 1I42A 5AQTB 4HWFA 2JT4B 3TMPB 3ZNHB 2BYFA 1U4AA 2L00B 5D2MB 1V49A 1Q0WB 1WMHB 2XK5A 1WZ0A 3PLUA 2KLCA 1NDDA 2KX3A 3PLVA 5DPTA 3IFWB 3UF8A 5KHOA 4IG7B 1WX7A 3QK0A 4W9IA 3RZWC 2O2VB 4G0NB 4K81A 1WXVA 3T9LA 3PT2B 4MELA 4ZRKA 4CHKA 3EFUA 1HX1B 1WE7A 2J0MA 1ZKHA 3ZNID 4AJWA 4GDLB 2KJRA 4GOCA 2LXAA 3WAOA 1RRBA 2MLBA 2LZ6A 5AQIB 3VQIA 1S3SG 2KOXA 3H7PA 2Z59B 4KSLC 5AZGA 4K1RB 4F1SA 1TTNA 5AZFA 4FJVB 1MG8A 1WH3A 2EKEC 1WFYA 2YLMA 3A1QB 4NAWA 3TL5A 4ANWA 2L0TA 2FCNA
chains in the Genus database with same CATH superfamily
3O9XA 4YTPA 2N9PC 3PRZA 4H9RC 3IVFA 5HCMA 1GG3A 2IIUA 3F57A 2CHWA 2ZLYA 2E5VA 3PUVF 2MTQA 3AE3B 5BYRA 3SOLA 1I4QA 4TQ0A 2RA1A 4CZZB 1C76A 5L83A 4O1NA 4JI0T 4F7ZA 5LP6E 4DV1T 5FL1A 4WYVA 1OXZA 3P4PB 2X9YA 2RMMA 5LHGB 2BWFA 3JC6C 2LVOA 3BYTB 3NG0A 5LNKA 3J7Yq 1F1HA 4HCNB 4XZ4A 1WRDB 1Y56A 2J4XA 5FXXA 5FYMA 4HLEA 5JXVA 1ZXHA 2RDHA 4GU2A 5E6NA 1D0XA 1UCUA 4LK0M 1A5RA 4AI6A 1YQ3A 2X38A 2KWVB 1TY2A 4WAAA 1RAXA 1K8RB 4ZYSA 3AU4A 5J2TE 2CLYB 5L47A 2KSRA 2ACZB 1ROEA 3AI5A 2VWAA 3AA0B 3AE9B 3U4EG 2PBIA 1YX6B 4O2AE 1B7TA 3RQWA 4LF9T 1V5TA 3UUBA 2BG9C 2BYVE 5HI1A 2MCNB 4C56C 3GN5A 2KFKA 5IP4D 3DVGY 3HVDA 4W9EA 2O6VA 1Y01A 1IP9A 2WP9B 5AQNB 5JDHA 5FY0A 2EHOB 3TLUA 1FPYA 5KX5E 3P50A 4URKA 1KFYA 4C7ZA 4TX5A 1WRDA 4QHOA 3FILB 2ODUA 4X66T 4LDTD 3RYFE 2WXIA 4CXYA 1EF1A 4FN2A 2WQYB 1X79A 1UK5A 1L6UA 1HZ6A 3AA7B 1VRAB 2K6DB 1MPEA 2G0UA 2XQAA 2WXMA 2C0SA 4MLKA 4LFCT 1MFWA 4BOSC 1A70A 3UQAA 4G50A 3VH4B 4HJGE 5GXGB 3MXZA 1PYWD 2KMMA 3IXSA 1ZOYB 1KF6A 2L1AA 1R8IA 2NCNA 4GB9A 4LFAT 2BS3A 3AE5B 1KRHA 3AVRA 4B6WA 3T3OA 4ILAA 1P9DU 1QILA 4HEA1 4TNVA 5J18A 1HEZE 2WGSA 2AWTA 4MH0E 5JZEB 3PTRB 3TIXA 3JSVA 3AE2A 2GK9A 3OYZA 5LXIB 3RULA 3ZCIA 5LMUT 5FL0A 5BR8T 4A20A 1D1CA 3ZDTA 4X1YE 5CHWA 3ML8A 5GONE 1T0QC 4ANJA 2JPHA 4PK6A 3H9DA 1LQBA 2J1DG 2JWUA 3TLVA 3P4RB 3RT3B 4MM3A 2AQ1B 5ABGA 2JF5A 2QSDA 3AECB 2DENB 3NZSA 5EDSA 4HKAA 2LJIA 3O65B 3P8CD 2M67A 5DQWA 3QA8A 3RPFC 3H6NA 2WSSV 5AEKB 2D9DA 4I6NB 2KTRA 2V4LA 2AL6A 3JYUA 3B2GA 3EA6A 3FAHA 3M95A 5D6JB 2LRKA 5ADXL 2X0HA 2J62A 2WNMA 5HAXA 3ZXRA 4A90A 3IT4B 3KBTA 3WALA 1TS2A 3B08A 2IMLA 1TS3A 2BBCA 3GOEA 3ZT5A 4EAHA 2DLBA 1QLBB 3IBEA 2ZM8A 2NVUI 1SJHD 3PUSA 2PIAA 5FNVE 3C0RB 4RH6A 5CFBA 3VHTC 5ABEA 2BB6A 3ENEA 3IEEA 2LOPA 4FXCA 2LKHA 4BBNF 3KUDB 1GJZA 2ZW0A 4C80A 4F6RC 5H92C 3C50A 5IOIA 3UU3A 2XEWA 4UIGA 3H1UA 4DXFA 1N32T 5H8YE 2E3TA 2V3SA 4MEMA 2XPKA 2LSGA 1AWDA 3AB3B 2MSED 2CBJA 1FXAA 2EELA 1YIWA 1STEA 5BYSA 3ZJ1A 4HE8A 3DOWA 2MPKA 4A3PA 4AIUA 4YSZA 1RYJA 4U3CA 2JRIB 4ILCA 2K24A 1US7B 2I59A 4P09A 4ACFA 2C5IT 3O13A 5FP3A 2R61A 4IDPA 1N61A 1OEDB 4DV0T 4KMCA 4C90A 2VVSA 4OX9T 1BXTA 2MHJA 5C23A 5LG3A 1GAQB 1XWMA 4NUVA 4ZEYA 4ZRPA 4NZLB 4WAFA 2CHXA 4Z8XA 4NJCA 3AEGB 3A33B 4A8XC 3GB1A 3N2KE 4RF1A 2V8SV 2W2UA 2LJLA 3PV1A 1SE2A 1EM7A 2BKPA 4IE5A 3LBXB 1WR1A 2LUMA 1FD6A 1GB4A 4AQFC 3TKLB 3ONJA 3IAM1 2LHEA 1D5MC 3PZDA 3ZNZB 2AQ3B 4HKZE 1EWCA 2KX0A 5EE1A 3QIJA 1XEEA 3IA3A 4RGNA 2O6VB 3QHTA 3PUAA 3AA1B 2XTLA 3L13A 1R7SA 3DBLI 1H8CA 3A7MA 2UU7A 4MHCA 2BS2A 3B0AA 2HPLA 4A98A 3QAQA 2L32A 1P98A 4C4VB 2W63A 4PJLA 2KN4A 4HN9A 1QSDA 2UXBT 3MHZA 4MH8A 4CYEA 4AXPA 2CJOA 2WXGA 1JWSD 4ARIA 2CA5A 3KV6A 2X8XX 4WWPA 2X0LB 4F8CB 2HE7A 2XQ5A 1VCSA 2CPTA 3UTKA 1N5WA 4N6EB 3U2SC 2KDEB 4ANVA 1ISNA 4TUYE 1SE9A 3T8MA 3O4XE 4JBWF 1CJEA 4AKRB 2KJHB 4LLGM 2JXTA 3KYCD 4NJ6A 3BINA 4UELA 2Y8DA 1L6VA 4LJPB 3SEBA 2AL3A 3KINB 4COFA 1HTQA 3AXJA 2FUPA 3SFEA 4HPMB 3ZVVA 2WX0A 3L10B 5JDMA 1Z2MA 3L4PA 5LXHA 4XBFB 1BMLC 1HZ5A 3MFGA 2QVAA 2CM0A 2H88B 1YKHB 1T5XD 3AE9A 1M62A 4XYCA 4LNNA 4DDGD 2DWQA 4H9PC 1UUPA 4U7YA 3AEFB 3N9YC 3DWGC 2J47A 2LT3A 3P4SA 4M01A 2LRLA 1XCTL 3WANA 4EZ4A 3TJPA 3AEDB 2DWKA 5LGUB 1C9FA 4E74A 3NVWA 1Z8UA 2HDEA 3S4UA 3VTVA 3FBLA 2Y5BB 4L2YA 4X20E 2IC6A 1V80A 2UUAT 3EUB2 3ZYMA 3AV8A 2WXQA 1VDVA 2VKDA 4CI3B 1SUMB 4IWOA 2WBLA 3H3MA 1VCBA 4TZ4C 1E8WA 1XLNA 1S94A 4TUUA 3ZJUA 2XZEA 4WWOA 3UINB 2DYOA 1FIOA 3RIFA 2BVCA 4BJMA 2RD0A 4EYUA 3ABVA 2A3DA 2J53A 5FK9C 1L4ZB 1HNWT 2RDGA 3DBHI 1WF9A 3PO0A 1O3XA 2HN2A 1YQ4A 4OK0A 3CSTA 4OZAA 2MBEA 2SEBD 1EF5A 4B3ST 1E8ZA 2N9LA 3URYA 5JRCB 1NAFA 2NOXA 3UU4A 4D2KA 4JEHB 2DZJA 4HDOA 1K53A 3RUIB 5AUIA 4DHJB 4AQYT 2H7OA 2V3PA 4WJQA 4TQ1A 5HWXA 1IPGA 1WJNA 5JHAA 4KZ0A 4TMAB 4PT5A 1D5ZC 1BR0A 2HJ1A 4U33A 3SRZA 4PK1A 2XQ8A 4G63A 2KLQA 3QNUA 2V0GA 3ZDMC 2DYBA 2M6BA 2WXRA 3SS1A 1YQ3B 3N2GE 3RLFF 5DPWA 2LMCA 3CX7B 2HPJA 4AISA 2W66A 3PHXB 5AQGB 5CA1E 2MX2A 1F52A 1XO3A 3R7QA 2KMFA 2JZ3B 4N78D 3RF1A 5H6RB 4ZI7E 3AEAB 2VURA 4YL8A 4P1BC 1I35A 3AVSA 4PFPA 1WX9A 2LD9A 2L8KA 2YINA 3PZ8A 2YU2A 1QOAA 3SR6A 4P16A 3LK42 3E0ZA 3MKDA 3X0WA 5CB4E 1ET6A 2D0UA 1WX8A 4GMVA 5F3JA 1LXDA 2KK8A 4YXDB 4GK5E 3P63A 4DIDB 3DVNV 2FJAA 3KWLA 3RYCE 1QKZA 5HKHA 2KTRB 4C00A 3ZSTA 2GBKA 1WY8A 4O2BE 4C7YA 4U2YA 2PFVA 2YDRA 2KD0A 2W61A 2MAWA 3AE3A 3I9WA 2Z0DB 3RI5A 2M6IA 2RDBC 1JWUD 1IBMT 3B13A 3IHPC 4REZA 3V5SA 2EHOC 2NBWB 4GK0E 2ZNVB 2YVCA 5HEJA 5G5GA 5CTRC 3WAKA 1V1PA 5L3FB 4Z91A 3N9OA 5FKYA 3SD5A 4OZBA 2KHWB 5AQTB 1U4AA 1JNZA 2BDEA 3AAEB 3PLUA 2KLCA 2KX3A 2NW7A 4N59A 4KX6B 3IFWB 1JALA 1UWMA 1JRPA 3UF8A 4TWFA 1J5ET 1MJDA 1C79A 4K81A 2WLBA 4X1IE 4L1BA 4ZRKA 4BJNA 2NW8A 2J0MA 4UXNB 2KJRA 1RWSA 2MLBA 3SFDB 4XGAB 2E8IA 4L9IA 4DR2T 4FJVB 3PUXF 2WDVB 3OYXA 1SE4A 3JADA 3DP7A 1RFKA 5IO9A 1YN5A 4JE3B 2Z8LA 1C77A 4MALA 2WU5A 3PPAA 3KV5A 2E2AA 4XDCA 2JRHA 3NWIA 1E2AA 4O4HE 4X1KE 4HWDA 1KH0A 4CI2B 1YKEB 3ZT7A 3AE7B 1IJ5A 2ZMAA 3Q14C 4JGHB 1YD8U 4CQIA 2MP2B 1LVFA 4TNWA 3BK9A 2KWCA 3FXEB 1F2RC 4YT0B 1UGJA 1L4DB 2A4ZA 2BS4B 2XAQB 3FZFB 4GSWA 1DOXA 4AKLA 5LLIA 4B95A 4OYKA 3UUNA 1SE7A 5AQOB 1R4MI 2KN5A 3A9JB 4MJSB 3QC9A 5DJQC 4DMWA 1RFAA 2CEAA 4UF0A 5CX3A 2BBHA 3QCAA 3ZCJA 4US8A 1WCRA 5AQVB 3GMIA 4EIWA 4MSMB 4B3TT 3ZSSA 3V61A 4EEDA 3AM9A 3MTNB 4PS7A 2DHRA 3QC8B 1TBEA 3M65A 3FB2A 1E10A 4EOZB 1UZXB 2YK0A 3ABVB 5AQFB 4M8NA 4IDIA 2WS3A 4H9OC 3DJBA 3K9PB 3LFMA 1WWTA 1TKEA 2IO3B 4FHJA 2XSAA 4KDIC 1N62A 2RPAA 2QDFA 3L54A 4K7SA 3CVRA 2LRUA 3KDSE 4I50E 3DWMA 3VRAB 2N1WA 3MC9A 4KVGB 1EU4A 1WGHA 3I1AA 3K3QC 5KHQA 3NRYA 2X68A 4UVAB 3EGRA 3B1LX 3K9OB 2FNJB 3AU5A 4JL9A 3EUHA 3GZNB 1L7YA 3A4RA 2RP4A 3RRCA 5JR9B 4DWFA 2LRWA 1ZW7A 4S17A 3ZYYX 4I4TE 2N4FA 4II2B 2ZM6T 1JRUA 1KLVA 1H4RA 1JNRA 3RX6A 4J2CA 4WJPA 1V81A 3VFKA 2IZVB 4HFHA 2L3LA 5ETWA 2DYMA 4YTNA 2W3SA 2YOEA 4L0RA 2K6QA 4ZHOA 5G55A 2I0MA 2JRKA 2MA9B 2VH2A 5JDQA 1J19A 5C2TA 1FNWA 4ZS3A 4AJYB 2KC1A 3PJAA 2BZBA 4IE4A 1E8YA 3Q8AA 3DHGC 5HCJA 2REXA 2L3ZA 1TIFA 1XNQT 4JI5T 1U4QA 5AQQB 4LF7T 1P3QU 3CMLA 4IC7B 1XD3B 3E08A 2E9XC 5AQUB 1X1MA 2J7QB 5ABFB 3UFGA 4H63H 2D11A 4IKGA 2AE9A 2DBYA 2N7EA 2QA7A 4NXMT 3Q8CA 2WHIA 2DI4A 3KUCB 1YXRA 4TSSA 1MIVA 5AFUL 4QH1A 1JW9D 2D2SA 1OQYA 3KYDD 4ZOHC 2XAFB 5CHFA 2XJ7A 1DOIA 2NPTB 3BQKA 5IAAC 3WA0A 1G73A 1I4XA 2AXDS 3N9QA 2QRXA 1T3QA 3MC0B 3PURA 2D2QA 3M62B 5M4YA 4EZKA 1IAPA 4HK2A 4R3DA 4N9F4 2LSYA 4FADA 4GDLA 1XNRT 1MG4A 3NY5A 1ZHCA 3IBPA 4DNDA 3DBHB 5CHVC 5IWAT 2X66A 3QJZA 2N2NA 5L3EB 4OHFA 2WMOA 2Z0EB 2WDVA 2IGDA 1KNRA 5IKCM 4KHPT 3DVNU 4JI1T 2HD5B 4WJNA 1LRZA 2OJRA 5LHHB 3SU8X 3ONXA 2CKHB 2JY6A 5J1GA 1FXIA 1SXTA 1UGMA 2GBJA 1XDOA 3OJ3A 2D07B 2JQRB 2BG9B 2JZZA 3CKDA 2WXOA 3PJAJ 3ZW3A 4HFDA 4W9JA 1TS4A 2VL0A 2I38A 2M4NA 2QYWA 5HG2A 1W9RA 3P4QA 4XE0A 3UGBB 4H9SE 4LNOA 4YXDA 3CK6A 2VH1A 3P7IA 1NBFC 3MK7C 2XY8B 4W9LA 4W9KA 1HXYD 2VL8A 3HM6X 3N30A 3BY4B 4WQOB 2CHZA 2PTLA 5C3JA 3UQ4A 3EFCA 3MA9A 4OZCA 4YTNB 2LM2A 2MBQA 2XAGB 1E5WA 1F77A 3HIZA 3WAPA 5FXVA 4FJYA 4P1CC 2V7LA 3KVBA 4GKJT 4NUUA 3MP9A 1MNEA 1KNZA 3SFEB 2L76A 3Q5DA 3A1QA 3P2BA 1I94T 3UQ7A 3GWHA 2DNXA 1OEYA 1SB3C 1BR4A 2WZHA 1ZDXA 2PLPA 3VTWA 5IHYA 2GBMA 2V7IA 1T98A 3VHLA 1DOYA 2LGIA 3UUMA 4JLCA 2WCAA 3OG5A 3TCAA 2G9HD 3LJCA 3W1SA 1AYFA 2CMRA 2LE8A 4UVCB 5BYQA 4ILUA 3N5LA 1ZGUB 2L7RA 3N20C 3QOFA 4IM2A 2WXPA 5LB7B 3VUYA 2CBIA 3U52E 2XM1A 1SF0A 4X57B 3HKDE 1BR2A 2A9UA 2WXNA 3Q8FA 2NMQA 4RGMA 3MJXA 3K1SA 4J6IA 3I0OA 5J0ZA 2V26A 3W1YA 1S35A 3L39A 3EI0A 5TAOA 2C60A 1TKGA 4MGZE 2X9XA 2PJHA 3RNFC 3ALBA 2K8CA 4IM0A 4ADZA 4EEWA 4HWHA 2K5BB 2V3NA 3JSVB 1XF5L 4H2AA 1WSPA 5L95C 3L16A 1MHHE 3PGEA 3E56A 4HXDA 2WP9A 3RYIE 4IGUA 2LHDA 4OVZA 4U74A 1PGAA 4ZDVA 2INNE 1W0BA 1D1BA 1MI0A 3ZLIA 1F2RI 2HH7A 5L3GB 2JUOA 1Q1OA 1CK1A 2QC8A 1ZP0A 2NR2A 3P4QB 4RM9A 4NAWB 3VAWA 4HFIA 1WR6E 3AXCA 1TY0A 3BZDB 2WWVA 1NENA 2ICIA 2M19A 2Q5WD 4EXTA 4CN4A 4H9NC 2MJDA 3FKYA 3PRPB 4HJKA 1CQVA 1LFDA 3Q5XA 3ZUNA 3AEEA 2Q9QC 3OAWA 4KGRA 3N1YC 3ETRA 2XQ7A 4FI5A 3NZ3A 2IC9A 1L0VA 1CZPA 4C91A 5JQGE 3C8YA 4LNIA 1ZEEA 3MZKB 3HVZA 4CQNA 3LB8C 5AQPB 3RC3A 2IBIB 4ISTA 1GC6A 1XMQT 3Q3JA 2LSJA 3R7RA 5J2RA 4H63V 2NTSA 1HA5A 5JDGA 4DBQA 3R6NA 2RSUA 4RFBA 2XQ3A 3BVMA 3OLMD 2WB5A 3JW0X 4IL9A 2TSSA 5AUKA 5E0OA 2XAJB 2YDQA 2CWYA 3EVYA 4EZHA 2PPHA 1EUVB 1P7EA 3PHWB 2LFIA 1YJJA 4WJOA 2BKOA 3I5JC 4GYSA 3ZRCA 1KTKA 3KVFB 4ZRIA 1BUIC 2HHHT 1J8CA 3MHSD 4DK5A 3AEEB 5HHDG 2ZM0A 4YSZB 3LG7A 4WBOA 1KM7A 3NS1A 4DHZE 2SAKA 1WXSA 2KVZA 5HXRA 3AE1B 4HKQA 3VDZA 4QH5A 2X67A 5BO4B 2VK9A 1XLQA 3NZQA 1UD7A 2KQSA 3AMZA 3H7SA 3ZRFA 4S0RA 2H3RA 1IGCA 1XZYA 4A56A 1D3ZA 3AEGA 4HWIB 2IGGA 3RC8A 3WAJA 3BK2A 3SWHA 2OEDA 2EMTA 4W9DA 2JMHA 4O8SA 1PGBA 5D7GA 1E7PA 1PDXA 2FIFA 2OLTA 1WYBA 1NYQA 4PK4A 5HYAA 2GBRA 2IY0B 1GQEA 3C4WA 3WCQA 3VRAA 1C3TA 3Q2AC 4KBMB 4G3XB 4XWTA 2D3GA 1WR6A 2AEHA 4GGQA 4XC2A 3RCZA 2DL1A 2ZVOA 3P4SB 1I4GA 4KUMB 1T72A 2VKHA 4HROA 2BKFA 3C98B 4JI7T 5JR9A 3AE5A 2BS3B 2V6YB 1KF6B 3GE3C 2ACXA 2M0XA 3AE2B 4DUZT 4US9A 3BQLA 5FXWA 3IF8B 1Z5SB 4DV4T 2YKSA 2IDOB 4UDUC 1J1JA 2LXCA 2Y3AA 1KNPA 1RLFA 2MJEA 3ZKJC 3V6EB 4DV5T 2HN1A 3GN5B 3NJTA 1VCTA 3CWZB 4OHJA 2F4VT 4MJSA 3P4RA 2CXLA 3F31A 3ETUA 1YW0A 4TV8E 4JV5T 1YJ1A 1I7HA 2KO3A 4IT4A 3AN1A 3FXDB 4NQKE 2V6YA 2BG9A 1K52A 3ECIA 3ZJVA 4NAMA 3TLWA 2ZEQA 1K50A 1TYGB 3TMPB 4B0EA 3C19A 5JR9C 1J5WA 1V49A 4GYRA 4JI4T 4AKIA 2V7MA 3N2OA 5L2LA 5HEHA 4IE6A 2J42A 3UFEA 3PLVA 3TSSA 4DUYT 3N9PA 4EE2A 2UU9T 4F8HA 3QK0A 4ZI3C 2E5LT 1WE7A 2OHFA 1Q10A 1SJED 1RRBA 1MIYA 2LZ6A 4HRSA 2PMVA 3VQIA 1S3SG 2LEHA 3H7PA 3NRZA 4USAA 4K1RB 3BIID 2E9XD 1TTNA 5AZFA 2I2YA 2WAUA 4NAWA 1X9BA 1VOMA 3P42A 4B6XA 5JDNA 4ANWA 3L8RA 5LG4A 3CX8B 4WNKA 2JXXA 1G6JA 4QXBB 4AKHA 3ETVA 4PNIA 2IAKA 1I4RA 3APDA 1NENB 3G06A 1WXMA 1OEDC 2BYEA 4IIJE 1XLPA 2KVRA 1QZEA 4GXBA 1GPXA 3AE4A 3C4ZA 5L3BB 3RNEC 3ZC0A 3U3IA 4M0WB 4KDLB 3EABA 3C64A 1V86A 4JPSA 1Y8RC 1QOBA 4HCPB 4U2ZA 5KMGP 4DR7T 1E1HB 2IJ0A 2CE7A 4DO0A 2XUEA 4XZCA 5D94A 4ZS2A 1BT0A 2KINB 4KSKC 1FNVA 1D5XC 3V6CB 3VTUA 4L23A 2GOWA 1D6EC 4JI3T 3AEBB 2D10A 1M7KA 3IG3A 4TV9E 4X62T 5HEOA 2N9DA 1OQRA 2V1YA 3OPCA 3ZMUB 1I4HA 1D0ZA 2WQYA 2IPKD 2K39A 4ZXLA 2JU6X 2ODVA 4LTUA 4M00A 3B2FA 1KLUD 4M0WA 4U72A 2MQJA 4BBNC 2XQ6A 4EGWA 5LCYA 2NW9A 1WGRA 3Q3MC 2FAZA 4IW0A 1N36T 3RHWA 1TKYA 1HTOA 2FCQA 4PFOA 2VZKD 4M8MA 3CIRB 1YX5B 2BQQA 1FEWA 1C78A 4M02A 4UV9B 3U7DA 5JDFA 4KGTA 3HKEE 3VR8A 4ZI2C 3FC4A 4BZAA 2JQQA 2LJ5A 2BBJA 1TS5A 3PUWF 1ZE3D 1UURA 2L9QA 4LDTB 3Q3FA 2P9BA 2JJ9A 1H7CA 3L3PA 4JEUB 5DPRA 4BKTA 5JHBA 2KXJA 1XXGA 3N32A 3PSEB 2VQET 1ZUD2 2WXFA 3PUZF 4JWUC 4DV3T 3HR0A 2IO0B 2DLRA 2GB1A 4MM3B 4FBJB 2WM9A 1XDPA 2B3AA 1XT9B 2LI5A 3AULA 4ZHPA 3UQBA 2BS4A 2VASA 2D3CA 4JQWC 2KDMA 1HFAA 4J3OD 4O4IE 2XQ9A 4EZJA 3LDQB 2V6XA 4IDNA 2D3BA 1U5PA 3NHEB 3IAS1 3JAFA 2XASB 2WWZA 2INPE 2ZW1A 1GOZA 3AE6B 4WH4A 1FMAD 1GB1A 3EECA 2L05A 3HK0A 1WFDA 3EHZA 2UXCT 2CXFA 1KJTA 3ZO5B 3LK3B 2MW5A 5L3DB 3A8YC 2LOSA 3BQIA 3RRWA 1Y64B 3EDVA 4TKNA 3UT5E 1T0SC 4EYYR 4WZXA 3HA4A 3IHRA 5IN7A 2J0KA 2WDQB 3I9YA 3O1JA 1YOVB 4DR4T 5JH5C 2X9WA 2C7NB 3VR9A 4IOIE 1ZDVA 2K25A 3OWEB 3AE6A 3NRXA 2E6XA 3BK1A 3Q9DA 4C4VA 3AAAB 1T0RC 5LOVE 2X51A 2R2OA 2MBBB 3B5MA 1N63A 3QX1A 4JLEA 4BKGA 2QJLA 2WX1A 2QEJC 3VUXA 3DVGX 4X65T 1FO4A 2GMIC 1OEDE 2M8SA 1F9JA 2WU2A 1WRIA 5CA0E 4HDQA 2M17A 3M3JA 1YQ4B 3TLTA 3DBRI 2V7KA 1GNUA 2QIEB 3KFWX 5FR3A 2IDYA 4EEBA 2KFKB 4ZRQA 5JREA 2N9EB 1V97A 2R2QA 2N7JA 2VQFT 3VRBB 1M4VA 2NTYA 2IUBA 1MVKA 1I4PA 3VR9B 2N9KA 4NIQA 2H89A 2Y48B 1OFFA 2YEPF 1YJIA 2XM2A 2KZRA 3ZKRA 4TN7B 2N0SB 2LEKA 1FCLA 4AP4C 4OW0A 2XBBC 4I6LB 4JWSC 4MACA 2X0YA 2KYWA 2GBNA 5FVKA 2VVNA 3W5UB 2FJBA 1MIWA 3NZPA 4PAGA 4JI8T 4A9AA 4I43B 4EB6E 1JWAD 2N9XA 4E3CA 1HNXT 3L08A 4MDKE 2M56B 4QAYA 4HTEA 4PS3A 3M63B 3ZTCA 5C1ZA 1ET9A 4W9FA 1WE6A 2MRPA 1PFDA 4BKSD 3PZ7A 3AEAA 4EOYA 4PS8A 2G4SA 3VXWA 5G2NA 1HS7A 1JMLA 3ZNGC 4A5XA 3VUWA 2YU1A 3RYHE 1GUAB 1IBLT 2JYTA 4ICVA 1F0ZA 4MFRA 1E8XA 1JROA 4HPPA 3T3NA 3WIMA 2K9AA 1T8BA 4EFOA 4YT0A 2BF8B 2NS5A 2LHNA 1D0YA 1WXAA 3CMMB 1FMWA 3KV4A 4V1Av 3KVAA 2A2FX 3TEZA 2WXHA 3ZC1A 4ITKA 3RIUA 5AQJB 4GDKA 1YN3A 3W5VB 4UEMA 1OEDA 2KZ7B 2UUCT 2CU1A 3GP7A 4LMJA 4DXAB 3CPZA 1UBIA 1XQQA 3W1SC 3AA6B 3BVZA 5LA6E 1B1ZA 2WDTB 3PS6A 2C5LC 1QF6A 2DWGA 4LF6T 2IYDB 4L5GA 2ASQA 1WMHA 2K8BA 2Y5CA 3GZNI 4B9KA 3NVOA 4DQOC 2CLYC 2YEVC 4WWMA 1P0RA 2A5UA 3TEXA 2CHNA 2XHEB 2DZMA 3PU3A 1T6BX 2MYSA 1OGWA 4RNAA 2W67A 3A5XA 1MMNA 3BVGA 3LBXA 4ARCA 3QQ8B 2C9WB 5IUXA 2KNBA 1EWYC 1MMGA 2ZJDA 4XX5A 2ZPYA 2CR5A 1P7FA 3PUGA 3A4SC 2WMNA 3P4PA 1IBXA 4JYAT 3AEBA 5C8YE 2K22A 1WYGA 2W54A 4Q2JA 3CQCB 4EUTA 4EKUA 2FE8A 1V1OA 4A55A 4ZOLE 4GLSC 4DR5T 1KEYA 4E7ZA 3HRDD 1ACCA 2KDFB 1NWMX 3PTFC 3EAMA 3UU8A 1SIFA 5DQVA 1K51A 3Q3NC 5LYJE 2KFJA 2ZM2A 2AQ2B 1KK7A 3QB5A 1V5OA 1WZ3A 2QMTA 4PYZA 1YNTE 4BA9A 3RGLA 3AE7A 3U8ZA 4QXHB 1FFUA 4DMVA 4ASWC 2CRBA 2BKRB 2IGHA 2PE9A 3ZXVA 5KDMC 1UH6A 3ZN1B 4AOFA 3HI2A 4TWDA 4UR9A 5EE0A 2KJ6A 4HWCA 2DAJA 1IBKT 5AZHA 1GC7A 2M0AA 4A3OA 1FIQA 1E0ZA 1R4NB 5EE3A 4FJOA 3V05A 5ABHA 3RH3A 3WAMA 3OJ4B 4YTPB 4K7UA 4RM8A 4PJMA 3AXJB 4HFBA 3OVUA 5TSSA 1L0XB 2NTTA 2L83A 4LNFA 3DTOA 5FXZA 4K3BA 1UBQA 2MOZA 4B3RT 3J9CA 4HFVA 3ZIMA 4AQFA 5T8IA 2G3QB 2KWDA 3C51A 4W9HA 2ZNVC 3D0TA 4P7IA 1L0YB 1TT5B 1T7SA 1VRBA 3TUOA 2W00A 4E7SA 2JPFA 2PEAA 3S2AA 4PYUA 5LHIB 3RNAC 4RGOS 3R8BA 4P0BA 2K3UA 3PVLA 4TV3A 3RMKC 2Z6EA 3WI3A 3J9X1 4MGIE 2H89B 3HL6A 2EHOD 2FUHB 5DPSA 2UUBT 1EO6A 1N60A 2JX5A 5J17A 4ICUA 4EZLA 3ZMSB 5LBQB 4JI2T 5FMNA 3NKZA 2Y6XA 4ERRA 1N34T 1HF8A 2JMKA 3P4WA 1P1AA 4FA6A 2DZKA 4NNJB 2C7HA 2D3AA 5E6OA 2QGSA 3RNCC 1M94A 4AQ7A 4YJ3E 2FIDA 3FZKB 1E6EB 5HWYA 2KWUB 4HEAA 2FBWA 5F8PA 4A97A 3AH7A 3Q69A 4AUQC 2DCFA 3D32A 2FCSA 5EK2A 1FM0D 3NBXX 1C4AA 1FEHA 2UWQA 1HCIA 3ZPOA 4YLHA 5L3CB 1R4NI 3RD2A 5CGMA 2LSKA 4NXNT 3ZMVB 2RPVA 2ON8A 4ZI3D 2AYOB 4DBGA 2JQHA 3DBSA 3L17A 5MPOA 3ANWA 1FFVA 2UXXB 3VVWB 5E6PA 3Q6BA 3UIOB 3DQVA 2O2VA 4AS1A 4X64T 1SA0E 2Q9QD 1HE8A 1ZV4X 4MGKE 1CMXB 3CX6B 4ZZBA 2Q9QB 3NVVA 1LKXA 5LXTE 4DV6T 1JWBD 3R2TA 2KDIA 4DR6T 3I63C 5D3IB 4IWPA 4CN1A 2B76A 1I42A 4HWFA 2JT4B 3ZNHB 4YHHT 3H8HA 2BYFA 2L00B 2MEKA 5D2MB 3Q8EA 1B9RA 4ISSA 4QX8B 1WMHB 1DU2A 2XK5A 1LVKA 5HEGA 1NDDA 1D4BA 3UUXB 4IG7B 1WX7A 2KT7A 3RZWC 2O2VB 3T9LA 1FMVA 2CU3A 5LMNT 3PT2B 4I0UA 4MELA 4CHKA 3EFUA 1HX1B 1UUSA 5HEUA 1ZKHA 4AJWA 4H9QC 4GDLB 4GOCA 2LXAA 2Y5PA 3WAOA 3Q5EA 3Q8BA 2ACZA 5AQIB 2KOXA 2PW9A 2Z59B 4F1SA 4P1NA 1ZPSA 3HKCE 2BVLA 5C2TB 1WR0A 3KBUA 3N9MA 5LJNA 2EKEC 2YLMA 3W9CB 4YFSA 4YSYB 2L0TA 3K3OA 2FCNA 3K8PC 1MHXA 4O4JE 1UWXA 3TBLD 5L4EA 1SE3A 2EKIA 1LM8B 3RNGC 2GLSA 1KFYB 3ZGZA 5BMIA 2I1JA 4KV2A 3CQXC 2WXJA 3W2DA 4IDZA 1Q5WB 2K5PA 1W09A 2W55A 3V60A 3QUJA 5AQLB 2E9XA 2KQ7A 3I9V1 5I4DA 2HTHA 4G2AA 5HFYA 2PKOA 4A6QA 3ESLA 2MBGA 2LWPA 2C5KT 1V2YA 1NVID 2XNAC 4BKSA 4MSQB 2KXPB 3JAEA 1N33T 5AQRB 1SGHA 3N3KB 3RI7C 3BYYB 2LGYA 1JCKB 2V4IB 4OVUA 4GOUA 4LMKA 4PJJA 1QOFA 5IA7A 3LJ3A 2OJWA 1MMDA 2KC2A 1UX5A 4IDOA 3C4XA 3DHIC 3JCFA 2A72A 3VU7H 3E9SA 3RN9C 1L5PA 4FHKA 3ZLZA 3ZYKA 3EDUA 2IW5B 5LJMA 2K3WA 5L4HA 4UVBB 2WZIA 2QCZA 1IJ6A 4KGSA 3T8OA 4JX1C 3L0WB 4DR3T 2LUEA 3RYTA 4BVUC 3RPUA 2Q9QA 2W3RA 1FXTB 4DBRA 5DCNA 2XAHB 5JH7E 3SHQA 4I55E 4UF0B 3ZN0B 2I1KA 2VZKB 4LNKA 3H7PB 4IUMB 4K0KT 5JRCA 3FZMB 3T1HT 2JWZA 5GMVA 3A9JA 4X5TA 2BPSA 3DDCB 3Q5WA 4BOZB 3I0QA 2LHRA 4LJOB 2EHOA 2DAFA 2BW2A 3KH0A 2CHOA 2B76B 2KACA 3OJAA 2WY2A 2L52A 2J52A 3FILA 4LF4T 2BWES 1OQQA 4BFRA 3X23A 1SEBD 3ZTDA 2XQYA 3RQUA 4XDDA 4CO7A 1E9MA 3SDLC 1CHUA 2W62A 2CJNA 5ABFA 5IYZE 4W9GA 2KKCA 4LMLA 1G8XA 1R4MB 5AQSB 5EK4A 1QLBA 2WXKA 1SBBB 3FZLB 4AQGA 5BMHA 4KIKB 2W0GA 5LGTB 3HM3A 4FJZA 4ASKA 4RCOA 2BS2B 2NR4A 3NVYA 3ZQ4A 2LLYA 1RM6C 2WU5B 4PJNA 5LBMA 2J0JA 4OFZA 3B9JA 1DYQA 1XLOA 4NPNA 4GN1A 2NP9A 3ANWB 2ZCBA 3HUIA 3IT6B 1KOTA 3ZEFB 1ZXIA 5FY7A 1WIAA 2RGFA 4CXXA 1YMHE 2KMAA 2DNFA 4CXWA 4U31A 1EU3A 3GA8A 3P1MA 1C1YB 2RPQA 3ZMTB 2BYTA 4KIKA 2VRRB 1WXQA 2FUG1 4OVVA 4IREA 3QARA 2XSBA 3FBZA 3R84B 1VZ7A 1NI3A 4MGYE 4DDID 3QB5K 2D5GA 3V62A 4IDQA 2KANA 4BAXA 5A1LA 1FRDA 1HG2A 1VD2A 4WBNE 3DCGA 1HQRD 4G11A 3GE8C 1HTJF 1EZ3A 4FULA 5DABA 4AWJA 2K0PA 4E71A 4KHZF 5FY1A 2W9NA 3OTOT 2K9XA 2MBHA 3AEFA 4ZYNA 4JIOU 1AJ3A 2X9HA 3AE4B 2WS3B 2KT9A 2J4GA 2WU2B 4K3CA 5C3JB 1D1AA 3B57A 1WGGA 1IYFA 1ENFA 3GS2A 5G5HA 3LYYA 3VKGA 4XAXB 5AQMB 1VZ6A 4PK5A 2ONQA 3DBRB 4TWHA 2ZVNA 3ZMZB 4ANUA 4YSYA 3DPDA 1N5XA 1PGXA 3T1YT 5CJ5A 2NPTA 1WGKA 4BAYB 1FCCC 4HGAA 1TZOA 5F5WA 5BMGA 2CWOA 4YY3T 5FKAC 3AE1A 1OTRB 1LO5D 1ZOYA 3KW5B 3I3TB 3KWVA 1PQSA 3Q3OC 1E7PB 2LGSA 2MP2A 2C7MB 2PVOD 4JI6T 2W82A 1WYCA 2WDQA 4OYJA 4FLHA 2PE6B 2N7DA 2WWUA 2GRIA 3LDZE 1VJKA 4AKGA 2SPCA 2N1VA 3JVZX 3NUHB 1ZKEA 2MJ3A 2QHOA 4ZHQE 2GI9A 4N58A 3NOBA 1L0VB 3I57A 3CIRA 4CN6A 3ONLC 4Q25A 2EMSA 2BVMA 3CWIA 4LFBT 1BR1A 4NPPA 2ZZPB 2INDC 2UYZB 3E22E 4YJ2E 3ZT6A 3U30A 4DVDA 3PUQA 3RKOA 5HXHA 2XQ4A 1E7VA 4KKJA 1NEKA 5KXJA 3CSFA 2KWIB 1V6EA 3AE8B 4DXGA 2C5JA 1MMAA 5FVLA 2FJEA 1UX4A 2KDBA 1E7UA 3A9KA 2QILA 3AEDA 4RGTA 1SIJA 2KMCA 4DHZB 3VKHA 3LXFA 2YEPB 3H3AA 5FR6A 4HVBA 4YTMA 3O1HA 2FBWB 3BWUD 4QWNB 4O4LE 3NS8A 2L8JA 4YSXA 3LK2B 2LM9A 5JVDE 1QOGA 2NBVB 2DZIA 2JIWA 4IL4A 1NI2A 1I6ZA 2VKOA 2WXLA 5J2UE 3PV0F 1IGDA 3RNBC 3EC8A 3NZUA 2BKNA 5HXEA 2AX5A 3N1ZC 3ONSA 2BT6A 1ZP0B 3UULA 2BB5A 4II3B 4RF0A 2NWBA 1VR9A 1YQBA 2OV9A 3O1IA 4JUYA 1TGZB 5AQHB 2LVPA 4YTMB 5JDLA 2D0TA 1ESFA 4KZCA 2KNDA 3PDYA 4MT5A 4GIWA 4ILBA 4WW0A 3A9KB 3CQGB 1XMOT 2NTXA 1W0AA 5EE9A 2PVGC 4IM3A 1WLXA 1V9DA 2LSIA 2N1GA 2PTFA 3PU8A 2E9XB 2KTFA 1NYRA 4Z90A 4WQMA 5LGNB 2VB6A 2INCC 1Z0PA 2CCQA 4GKKT 1WJUA 1IZNB 5BMVE 1WM2A 4ANXA 1AN8A 1WGYA 1MNDA 1E90A 2ES0A 2G45B 2BG9E 4K0UA 1OEYJ 2KAJA 3MACA 4HPLB 4KX6A 4W9CA 1HR0T 3W15B 4IE0A 2L0FA 4RMAA 4LF5T 2JYEA 2M1MA 4IWQA 1FJGT 2LASA 3L09A 4QKNA 2PJQA 3PREA 1VLBA 2IO2B 4EV6A 1S1QB 2K1FA 2RR9A 1N6ZA 1SSNA 3CF6E 3VH3B 3HHMA 4LF8T 3R66C 2V5DA 4DV7T 2CXDA 1WM3A 4ZZCA 1HG5A 3FZHB 4HFCA 4KI0F 1J7AA 1WYWB 4IE7A 4LCDE 1IUEA 1V8CA 4K7WA 3N9LA 5E6JA 1WGDA 2UXNB 1FNUA 2JQ9A 3U78A 3QWZB 3HKBE 1UGOA 2XN9C 4MBQA 4WWNA 3K3NA 2K48A 4CI1B 2IY1B 3EHVA 3PUYF 1WJ4A 3KV9A 3MJWA 3TEWA 2DHZA 3KUZA 2KLGA 3AE8A 1V9JA 2D5UA 4YSXB 2I6HA 2WYQA 4YHJA 3AAIA 1J7BA 3PE0A 1C4CA 1HNZT 1AARA 2K8HA 2MWSB 3APFA 4DHJD 1XCQL 1FRRA 1IBXB 4PW8A 5LNK1 1V1PB 2UXDT 1VZ8A 2XK5B 3UU6A 5TR5A 3Q2MA 1DGJA 2KQ4X 1C4PA 1UELA 3UIPB 5HXCA 3M3ZB 2IHR1 2B1EA 4YWGG 3DHHC 1TJEA 2CS4A 4NY0A 4NJ7A 1SHZC 2LVQA 1YN4A 1T0YA 4U7IA 1CUNA 2VKJA 1JWMD 3QK6A 1QT9A 2H88A 2NBUA 5JTGA 2OOBB 2V1DB 2PG8A 1QQRA 4XWWA 3KQ4A 3RZFA 2G1EA 2HTME 3R3MA 3RIUC 3OKQA 2JVCA 3RIAA 4WURA 2ZCCA 3ML9A 2DX5B 3SFDA 4QXCB 1J7CA 2W4XA 1WI0A 2HJ8A 2G4DB 2WDRA 2LGDA 4GDKB 4UV8B 4WIPA 2MBOA 4HFEA 5AQKB 4NQLB 4P6VF 1NEKB 3TLSA 2JZPA 1QUUA 2LGXA 3LSVA 2BGFA 2OA5A 4B0MA 5H6QB 1UNSA 2IO1B 3F2EA 5EZYE 3JC6D 2FJDA 2LKGA 3ZJTA 1UF0A 3PRMB 4M1PA 4B3MT 2V5CA 1WJ6A 3AB5A 4KP3C 5D3DA 1OWAA 3U7ZA 5EK3A 4P0AA 4I6PA 3ZYLA 1TZ1A 4ZRJA 3APCA 3N9NA 1L2NA 3V5UA 4GIVA 2FCMA 1J0GA 2O6VD 3VR8B 2R6GF 3UI3A 2YDSA 1KLGD 4DV2T 3FHNA 1HX8A 3UU5A 2H7VC 3AECA 4IHJE 2ZPNA 4QX7B 1YD8G 2WDRB 2MH7A 3MJ5A 3DBLB 2V7JA 4ZI2D 1Q0WB 2JQKA 1WZ0A 1PUTA 2V9HA 5DPTA 4KKIA 5KHOA 4DR1T 4W9IA 1LGRA 3RFZB 4G0NB 1WXVA 3ZJ2A 2BTEA 4QH4A 3ZNID 1JQ4A 2JSVX 3H37A 5AZGA 2YN6A 4KSLC 3X1DA 3R2IA 3MC8A 3TEYA 3NVZA 5HXSA 1MG8A 1WH3A 2KWHA 3OBVE 1AW7A 1WFYA 3A1QB 3KLSX 3V3XA 3TL5A 3VRBA 3N1XC 3RKGA
chains in the Genus database with same CATH topology
2N9PC 3PRZA 2JXXA 3IVFA 1G6JA 3APDA 1GG3A 3PPAA 3TBLD 1WXMA 2BYEA 2CHWA 1LM8B 2JRHA 2KVRA 1QZEA 4GXBA 4HWDA 4TQ0A 2I1JA 4KV2A 1Q5WB 4JGHB 4M0WB 5L83A 4KDLB 3V60A 1YD8U 2MP2B 4F7ZA 2KWCA 1V86A 5AQLB 2KQ7A 1Y8RC 4HCPB 2HTHA 2BWFA 2A4ZA 4GSWA 2LWPA 3FZFB 5D94A 1V2YA 5LLIA 1BT0A 4KSKC 4MSQB 4BKSA 4B95A 1R4MI 2LVOA 4MJSB 5AQOB 3A9JB 5AQRB 2KN5A 3V6CB 1SGHA 3VTUA 2GOWA 3N3KB 4HCNB 1RFAA 2LGYA 4OVUA 4XZ4A 5CX3A 2D10A 1WRDB 3QCAA 1M7KA 4HLEA 3IG3A 5AQVB 5IA7A 3LJ3A 2V1YA 2KC2A 4MSMB 4GU2A 5E6NA 3V61A 3MTNB 4PS7A 1A5RA 4FHKA 3ZLZA 3QC8B 1TBEA 2K39A 1UZXB 2KWVB 4WAAA 1RAXA 1K8RB 5AQFB 3AU4A 4M8NA 4BBNC 2MQJA 1WGRA 3L0WB 2FAZA 4IW0A 2LUEA 3AI5A 3RYTA 4BVUC 3K9PB 1YX6B 1FXTB 2IO3B 4FHJA 2FCQA 5DCNA 1V5TA 4KDIC 2BYVE 3L54A 2MCNB 3SHQA 4K7SA 4M8MA 2KFKA 2I1KA 3DVGY 1YX5B 2LRUA 3H7PB 2N1WA 2O6VA 4IUMB 4W9EA 3U7DA 1IP9A 4KVGB 3FZMB 5AQNB 2JWZA 5GMVA 1WGHA 2BPSA 3A9JA 3DDCB 4BOZB 5KHQA 4LJOB 2DAFA 2LJ5A 4URKA 3B1LX 3K9OB 2FNJB 3AU5A 3KH0A 4JL9A 4LDTD 1L7YA 3A4RA 2BWES 4LDTB 3Q3FA 1EF1A 4DWFA 4FN2A 2LRWA 3X23A 1ZW7A 4BFRA 1UK5A 3ZTDA 4CO7A 2N4FA 5DPRA 4II2B 3SDLC 4BKTA 2KXJA 5JHBA 2K6DB 3N32A 3PSEB 1JRUA 1KLVA 4W9GA 2KKCA 1H4RA 2IO0B 5AQSB 4WJPA 1V81A 3VFKA 2IZVB 4FBJB 3FZLB 4BOSC 2DYMA 2B3AA 1XT9B 2K6QA 2LI5A 3AULA 4G50A 3HM3A 4FJZA 4KIKB 3VH4B 3UQAA 5G55A 3UQBA 2MA9B 4JQWC 1J19A 4EZJA 3LDQB 2NCNA 4GB9A 4AJYB 2J0JA 2KC1A 3NHEB 1E8YA 4B6WA 2WWZA 1P9DU 4NPNA 2REXA 2L3ZA 4GN1A 5J18A 2ZCBA 2AWTA 4MH0E 1P3QU 5AQQB 5JZEB 4IC7B 3JSVA 3EECA 2L05A 3HK0A 3TIXA 5LXIB 1XD3B 3RULA 1WIAA 1KJTA 5AQUB 2RGFA 3ZO5B 4A20A 2MW5A 2KMAA 1X1MA 2J7QB 3A8YC 3ZDTA 5CHWA 1C1YB 2RPQA 4TKNA 3ML8A 2D11A 4KIKA 2N7EA 2JPHA 2VRRB 3H9DA 1LQBA 3RT3B 2J0KA 4MM3A 3KUCB 2JF5A 4OVVA 3QARA 2DENB 3NZSA 3KYDD 5EDSA 1OQYA 5JH5C 4MGYE 4DDID 5CHFA 2C7NB 3O65B 2NPTB 3V62A 2K25A 2KANA 3QA8A 5IAAC 3H6NA 1VD2A 5AEKB 2D9DA 2R2OA 3DCGA 2MBBB 2KTRA 3QX1A 2V4LA 4G11A 4I6NB 2AL6A 3JYUA 4BKGA 2WX1A 3M95A 5D6JB 2D2QA 3M62B 4FULA 3VUXA 4EZKA 3DVGX 4AWJA 4E71A 4HK2A 2W9NA 2MBHA 2GMIC 4N9F4 4FADA 2M8SA 1F9JA 4ZYNA 4GDLA 4JIOU 3WALA 3B08A 3NY5A 4HDQA 5CHVC 2M17A 3GOEA 3M3JA 1WGGA 3QJZA 1IYFA 3DBRI 3IBEA 2Z0EB 1GNUA 2NVUI 5AQMB 2KFKB 2N9EB 2HD5B 3C0RB 3DVNU 2ZVNA 2R2QA 4WJNA 3VHTC 4ANUA 2OJRA 3ENEA 3DPDA 3SU8X 2NPTA 2CKHB 4BBNF 2JY6A 3KUDB 1GJZA 1UGMA 2GBJA 3OJ3A 2KZRA 2D07B 1OTRB 2JZZA 2XEWA 3H1UA 3KW5B 3I3TB 3ZW3A 4W9JA 2M4NA 2V3SA 1PQSA 4MEMA 4AP4C 2XBBC 4I6LB 3UGBB 2GBNA 1NBFC 2MSED 4W9LA 2MP2A 2C7MB 4W9KA 1YIWA 3HM6X 3N30A 3BY4B 4WQOB 2CHZA 4E3CA 2N9XA 3DOWA 4FLHA 2PE6B 3L08A 2N7DA 3LDZE 4MDKE 4A3PA 2MBQA 2N1VA 1E5WA 2JRIB 3HIZA 3JVZX 3M63B 4PS3A 3WAPA 3ZTCA 5C1ZA 2QHOA 4W9FA 1WE6A 2MRPA 4FJYA 4BKSD 3NOBA 4EOYA 4PS8A 2G4SA 3VXWA 5G2NA 2EMSA 2ZZPB 2L76A 2UYZB 3ZNGC 1KOTA 3A1QA 3VUWA 3U30A 3P2BA 5C23A 1GUAB 1E7VA 1OEYA 2CHXA 4ICVA 1E8XA 3VTWA 2GBMA 3A33B 3CSFA 3WIMA 1V6EA 4EFOA 3PV1A 3A9KA 2BF8B 2KDBA 2NS5A 1E7UA 4JLCA 3TCAA 3CMMB 1WR1A 1WXAA 3W1SA 2KMCA 4DHZB 5FR6A 4HVBA 5AQJB 4GDKA 3PZDA 3ZNZB 1ZGUB 2L7RA 2L8JA 3NS8A 4IM2A 2KX0A 3QIJA 2CU1A 2NBVB 2DZIA 3VUYA 4DXAB 2O6VB 3QHTA 1NI2A 3L13A 1I6ZA 1UBIA 4X57B 1XQQA 3W1SC 3DBLI 1H8CA 3PS6A 2WDTB 3EC8A 2C5LC 3B0AA 3NZUA 3QAQA 2IYDB 4J6IA 1P98A 2ASQA 1WMHA 2K8BA 3GZNI 4B9KA 3ONSA 3W1YA 4II3B 1P0RA 1YQBA 2A5UA 2C60A 4CYEA 2DZMA 4MGZE 2PJHA 1TGZB 5AQHB 1OGWA 2K8CA 2LVPA 3ALBA 4IM0A 4EEWA 4HWHA 4KZCA 4WWPA 4F8CB 3JSVB 2HE7A 3QQ8B 2C9WB 5L95C 2KNBA 2ZJDA 3A9KB 3L16A 4XX5A 2ZPYA 3PGEA 2CR5A 4IM3A 4HXDA 2KDEB 4ANVA 1ISNA 3A4SC 1SE9A 2KTFA 3T8MA 4ZDVA 2KJHB 3KYCD 4NJ6A 1WJUA 3BINA 2JUOA 4EUTA 4LJPB 4EKUA 1WM2A 1Q1OA 2AL3A 4ANXA 1WGYA 2NR2A 4RM9A 1E90A 2KDFB 3PTFC 4HPMB 1SIFA 4NAWB 3VAWA 3ZVVA 1WR6E 3AXCA 2G45B 2WX0A 3L10B 2KFJA 1OEYJ 1Z2MA 5LXHA 1V5OA 4HPLB 1WZ3A 4W9CA 4PYZA 3PRPB 4HJKA 3U8ZA 1M62A 1LFDA 4DDGD 3ZUNA 2L0FA 4RMAA 3OAWA 4ASWC 2M1MA 4IWQA 3WANA 3TJPA 2BKRB 2LASA 2PE9A 3PREA 1UH6A 4E74A 3VTVA 5AQPB 2IO2B 1S1QB 2Y5BB 4AOFA 2K1FA 2RR9A 2IBIB 2KJ6A 4HWCA 1GC6A 1V80A 2DAJA 3CF6E 1GC7A 3Q3JA 5AZHA 3HHMA 3R7RA 3VH3B 3R66C 4A3OA 5J2RA 1WM3A 4IWOA 3FZHB 2RSUA 3WAMA 1VCBA 1E8WA 1WYWB 3OJ4B 3OLMD 4K7UA 4TUUA 3WA0A 3JW0X 4LCDE 4K7WA 4RM8A 4WWOA 3UINB 1WGDA 2DYOA 2PPHA 3QWZB 1UBQA 1UGOA 1EUVB 3PHWB 4WWNA 2RD0A 3ZIMA 4WJOA 2G3QB 2IY1B 3EHVA 3DBHI 1WF9A 3KVFB 4W9HA 4ZRIA 1WJ4A 2ZNVC 3MJWA 4P7IA 3ZRCA 2DHZA 1J8CA 3CSTA 3KUZA 3MHSD 4DK5A 2KLGA 1T7SA 1V9JA 2MBEA 1EF5A 2PEAA 3S2AA 1E8ZA 2WYQA 4PYUA 1KM7A 4DHZE 1WXSA 3PVLA 4TV3A 1AARA 2K8HA 3APFA 2MWSB 5BO4B 3VDZA 2DZJA 4HDOA 4MGIE 3RUIB 4DHJD 4DHJB 1UD7A 2FUHB 1EO6A 4WJQA 5DPSA 4TQ1A 2XK5B 1IPGA 1WJNA 2KQSA 3H7SA 5TR5A 5J17A 5JHAA 4ICUA 4KZ0A 3ZRFA 1UELA 3UIPB 4EZLA 3M3ZB 1D3ZA 4HWIB 4W9DA 2EMTA 2DYBA 3ZDMC 2CS4A 5D7GA 4NY0A 1P1AA 4NJ7A 4FA6A 2DZKA 4NNJB 2C7HA 5DPWA 5E6OA 2LVQA 2FIFA 1M94A 1T0YA 2FIDA 3FZKB 5AQGB 2IY0B 2GBRA 3PHXB 2MX2A 2NBUA 2OOBB 3R7QA 2JZ3B 2KWUB 1C3TA 4YL8A 1I35A 4G3XB 3RZFA 4AUQC 2D3GA 1WX9A 3D32A 2AEHA 4GGQA 4XC2A 3R3MA 2FCSA 2JVCA 2LD9A 3RCZA 2ZCCA 2ZVOA 3ML9A 2DX5B 2UWQA 1R4NI 2BKFA 1WI0A 3RD2A 2HJ8A 2G4DB 2LGDA 4GDKB 2MBOA 5AQKB 4NQLB 3X0WA 4GMVA 1WX8A 2LGXA 2BGFA 1LXDA 2KK8A 2AYOB 2M0XA 2IO1B 3DVNV 4DBGA 3DBSA 3L17A 5HKHA 2KTRB 3VVWB 2GBKA 1WY8A 1Z5SB 5E6PA 3PRMB 2LXCA 1WJ6A 2KD0A 3UIOB 3DQVA 2O2VA 2Z0DB 1RLFA 3ZKJC 3V6EB 4I6PA 1HE8A 3IHPC 4MGKE 1TZ1A 4ZRJA 1CMXB 2NBWB 3APCA 4MJSA 1L2NA 2ZNVB 4GIVA 2FCMA 2YVCA 1J0GA 2O6VD 2KDIA 5CTRC 1YJ1A 2KO3A 4NQKE 3SD5A 3ECIA 4IWPA 2KHWB 2ZEQA 2ZPNA 1I42A 5AQTB 4HWFA 2JT4B 3TMPB 3ZNHB 2BYFA 1U4AA 2L00B 5D2MB 1V49A 1Q0WB 1WMHB 2XK5A 1WZ0A 3PLUA 2KLCA 1NDDA 2KX3A 3PLVA 5DPTA 3IFWB 3UF8A 5KHOA 4IG7B 1WX7A 3QK0A 4W9IA 3RZWC 2O2VB 4G0NB 4K81A 1WXVA 3T9LA 3PT2B 4MELA 4ZRKA 4CHKA 3EFUA 1HX1B 1WE7A 2J0MA 1ZKHA 3ZNID 4AJWA 4GDLB 2KJRA 4GOCA 2LXAA 3WAOA 1RRBA 2MLBA 2LZ6A 5AQIB 3VQIA 1S3SG 2KOXA 3H7PA 2Z59B 4KSLC 5AZGA 4K1RB 4F1SA 1TTNA 5AZFA 4FJVB 1MG8A 1WH3A 2EKEC 1WFYA 2YLMA 3A1QB 4NAWA 3TL5A 4ANWA 2L0TA 2FCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9P C;  3PRZ A;  2JXX A;  3IVF A;  1G6J A;  3APD A;  1GG3 A;  3PPA A;  3TBL D;  1WXM A;  2BYE A;  2CHW A;  1LM8 B;  2JRH A;  2KVR A;  1QZE A;  4GXB A;  4HWD A;  4TQ0 A;  2I1J A;  4KV2 A;  1Q5W B;  4JGH B;  4M0W B;  5L83 A;  4KDL B;  3V60 A;  1YD8 U;  2MP2 B;  4F7Z A;  2KWC A;  1V86 A;  5AQL B;  2KQ7 A;  1Y8R C;  4HCP B;  2HTH A;  2BWF A;  2A4Z A;  4GSW A;  2LWP A;  3FZF B;  5D94 A;  1V2Y A;  5LLI A;  1BT0 A;  4KSK C;  4MSQ B;  4BKS A;  4B95 A;  1R4M I;  2LVO A;  4MJS B;  5AQO B;  3A9J B;  5AQR B;  2KN5 A;  3V6C B;  1SGH A;  3VTU A;  2GOW A;  3N3K B;  4HCN B;  1RFA A;  2LGY A;  4OVU A;  4XZ4 A;  5CX3 A;  2D10 A;  1WRD B;  3QCA A;  1M7K A;  4HLE A;  3IG3 A;  5AQV B;  5IA7 A;  3LJ3 A;  2V1Y A;  2KC2 A;  4MSM B;  4GU2 A;  5E6N A;  3V61 A;  3MTN B;  4PS7 A;  1A5R A;  4FHK A;  3ZLZ A;  3QC8 B;  1TBE A;  2K39 A;  1UZX B;  2KWV B;  4WAA A;  1RAX A;  1K8R B;  5AQF B;  3AU4 A;  4M8N A;  4BBN C;  2MQJ A;  1WGR A;  3L0W B;  2FAZ A;  4IW0 A;  2LUE A;  3AI5 A;  3RYT A;  4BVU C;  3K9P B;  1YX6 B;  1FXT B;  2IO3 B;  4FHJ A;  2FCQ A;  5DCN A;  1V5T A;  4KDI C;  2BYV E;  3L54 A;  2MCN B;  3SHQ A;  4K7S A;  4M8M A;  2KFK A;  2I1K A;  3DVG Y;  1YX5 B;  2LRU A;  3H7P B;  2N1W A;  2O6V A;  4IUM B;  4W9E A;  3U7D A;  1IP9 A;  4KVG B;  3FZM B;  5AQN B;  2JWZ A;  5GMV A;  1WGH A;  2BPS A;  3A9J A;  3DDC B;  4BOZ B;  5KHQ A;  4LJO B;  2DAF A;  2LJ5 A;  4URK A;  3B1L X;  3K9O B;  2FNJ B;  3AU5 A;  3KH0 A;  4JL9 A;  4LDT D;  1L7Y A;  3A4R A;  2BWE S;  4LDT B;  3Q3F A;  1EF1 A;  4DWF A;  4FN2 A;  2LRW A;  3X23 A;  1ZW7 A;  4BFR A;  1UK5 A;  3ZTD A;  4CO7 A;  2N4F A;  5DPR A;  4II2 B;  3SDL C;  4BKT A;  2KXJ A;  5JHB A;  2K6D B;  3N32 A;  3PSE B;  1JRU A;  1KLV A;  4W9G A;  2KKC A;  1H4R A;  2IO0 B;  5AQS B;  4WJP A;  1V81 A;  3VFK A;  2IZV B;  4FBJ B;  3FZL B;  4BOS C;  2DYM A;  2B3A A;  1XT9 B;  2K6Q A;  2LI5 A;  3AUL A;  4G50 A;  3HM3 A;  4FJZ A;  4KIK B;  3VH4 B;  3UQA A;  5G55 A;  3UQB A;  2MA9 B;  4JQW C;  1J19 A;  4EZJ A;  3LDQ B;  2NCN A;  4GB9 A;  4AJY B;  2J0J A;  2KC1 A;  3NHE B;  1E8Y A;  4B6W A;  2WWZ A;  1P9D U;  4NPN A;  2REX A;  2L3Z A;  4GN1 A;  5J18 A;  2ZCB A;  2AWT A;  4MH0 E;  1P3Q U;  5AQQ B;  5JZE B;  4IC7 B;  3JSV A;  3EEC A;  2L05 A;  3HK0 A;  3TIX A;  5LXI B;  1XD3 B;  3RUL A;  1WIA A;  1KJT A;  5AQU B;  2RGF A;  3ZO5 B;  4A20 A;  2MW5 A;  2KMA A;  1X1M A;  2J7Q B;  3A8Y C;  3ZDT A;  5CHW A;  1C1Y B;  2RPQ A;  4TKN A;  3ML8 A;  2D11 A;  4KIK A;  2N7E A;  2JPH A;  2VRR B;  3H9D A;  1LQB A;  3RT3 B;  2J0K A;  4MM3 A;  3KUC B;  2JF5 A;  4OVV A;  3QAR A;  2DEN B;  3NZS A;  3KYD D;  5EDS A;  1OQY A;  5JH5 C;  4MGY E;  4DDI D;  5CHF A;  2C7N B;  3O65 B;  2NPT B;  3V62 A;  2K25 A;  2KAN A;  3QA8 A;  5IAA C;  3H6N A;  1VD2 A;  5AEK B;  2D9D A;  2R2O A;  3DCG A;  2MBB B;  2KTR A;  3QX1 A;  2V4L A;  4G11 A;  4I6N B;  2AL6 A;  3JYU A;  4BKG A;  2WX1 A;  3M95 A;  5D6J B;  2D2Q A;  3M62 B;  4FUL A;  3VUX A;  4EZK A;  3DVG X;  4AWJ A;  4E71 A;  4HK2 A;  2W9N A;  2MBH A;  2GMI C;  4N9F 4;  4FAD A;  2M8S A;  1F9J A;  4ZYN A;  4GDL A;  4JIO U;  3WAL A;  3B08 A;  3NY5 A;  4HDQ A;  5CHV C;  2M17 A;  3GOE A;  3M3J A;  1WGG A;  3QJZ A;  1IYF A;  3DBR I;  3IBE A;  2Z0E B;  1GNU A;  2NVU I;  5AQM B;  2KFK B;  2N9E B;  2HD5 B;  3C0R B;  3DVN U;  2ZVN A;  2R2Q A;  4WJN A;  3VHT C;  4ANU A;  2OJR A;  3ENE A;  3DPD A;  3SU8 X;  2NPT A;  2CKH B;  4BBN F;  2JY6 A;  3KUD B;  1GJZ A;  1UGM A;  2GBJ A;  3OJ3 A;  2KZR A;  2D07 B;  1OTR B;  2JZZ A;  2XEW A;  3H1U A;  3KW5 B;  3I3T B;  3ZW3 A;  4W9J A;  2M4N A;  2V3S A;  1PQS A;  4MEM A;  4AP4 C;  2XBB C;  4I6L B;  3UGB B;  2GBN A;  1NBF C;  2MSE D;  4W9L A;  2MP2 A;  2C7M B;  4W9K A;  1YIW A;  3HM6 X;  3N30 A;  3BY4 B;  4WQO B;  2CHZ A;  4E3C A;  2N9X A;  3DOW A;  4FLH A;  2PE6 B;  3L08 A;  2N7D A;  3LDZ E;  4MDK E;  4A3P A;  2MBQ A;  2N1V A;  1E5W A;  2JRI B;  3HIZ A;  3JVZ X;  3M63 B;  4PS3 A;  3WAP A;  3ZTC A;  5C1Z A;  2QHO A;  4W9F A;  1WE6 A;  2MRP A;  4FJY A;  4BKS D;  3NOB A;  4EOY A;  4PS8 A;  2G4S A;  3VXW A;  5G2N A;  2EMS A;  2ZZP B;  2L76 A;  2UYZ B;  3ZNG C;  1KOT A;  3A1Q A;  3VUW A;  3U30 A;  3P2B A;  5C23 A;  1GUA B;  1E7V A;  1OEY A;  2CHX A;  4ICV A;  1E8X A;  3VTW A;  2GBM A;  3A33 B;  3CSF A;  3WIM A;  1V6E A;  4EFO A;  3PV1 A;  3A9K A;  2BF8 B;  2KDB A;  2NS5 A;  1E7U A;  4JLC A;  3TCA A;  3CMM B;  1WR1 A;  1WXA A;  3W1S A;  2KMC A;  4DHZ B;  5FR6 A;  4HVB A;  5AQJ B;  4GDK A;  3PZD A;  3ZNZ B;  1ZGU B;  2L7R A;  2L8J A;  3NS8 A;  4IM2 A;  2KX0 A;  3QIJ A;  2CU1 A;  2NBV B;  2DZI A;  3VUY A;  4DXA B;  2O6V B;  3QHT A;  1NI2 A;  3L13 A;  1I6Z A;  1UBI A;  4X57 B;  1XQQ A;  3W1S C;  3DBL I;  1H8C A;  3PS6 A;  2WDT B;  3EC8 A;  2C5L C;  3B0A A;  3NZU A;  3QAQ A;  2IYD B;  4J6I A;  1P98 A;  2ASQ A;  1WMH A;  2K8B A;  3GZN I;  4B9K A;  3ONS A;  3W1Y A;  4II3 B;  1P0R A;  1YQB A;  2A5U A;  2C60 A;  4CYE A;  2DZM A;  4MGZ E;  2PJH A;  1TGZ B;  5AQH B;  1OGW A;  2K8C A;  2LVP A;  3ALB A;  4IM0 A;  4EEW A;  4HWH A;  4KZC A;  4WWP A;  4F8C B;  3JSV B;  2HE7 A;  3QQ8 B;  2C9W B;  5L95 C;  2KNB A;  2ZJD A;  3A9K B;  3L16 A;  4XX5 A;  2ZPY A;  3PGE A;  2CR5 A;  4IM3 A;  4HXD A;  2KDE B;  4ANV A;  1ISN A;  3A4S C;  1SE9 A;  2KTF A;  3T8M A;  4ZDV A;  2KJH B;  3KYC D;  4NJ6 A;  1WJU A;  3BIN A;  2JUO A;  4EUT A;  4LJP B;  4EKU A;  1WM2 A;  1Q1O A;  2AL3 A;  4ANX A;  1WGY A;  2NR2 A;  4RM9 A;  1E90 A;  2KDF B;  3PTF C;  4HPM B;  1SIF A;  4NAW B;  3VAW A;  3ZVV A;  1WR6 E;  3AXC A;  2G45 B;  2WX0 A;  3L10 B;  2KFJ A;  1OEY J;  1Z2M A;  5LXH A;  1V5O A;  4HPL B;  1WZ3 A;  4W9C A;  4PYZ A;  3PRP B;  4HJK A;  3U8Z A;  1M62 A;  1LFD A;  4DDG D;  3ZUN A;  2L0F A;  4RMA A;  3OAW A;  4ASW C;  2M1M A;  4IWQ A;  3WAN A;  3TJP A;  2BKR B;  2LAS A;  2PE9 A;  3PRE A;  1UH6 A;  4E74 A;  3VTV A;  5AQP B;  2IO2 B;  1S1Q B;  2Y5B B;  4AOF A;  2K1F A;  2RR9 A;  2IBI B;  2KJ6 A;  4HWC A;  1GC6 A;  1V80 A;  2DAJ A;  3CF6 E;  1GC7 A;  3Q3J A;  5AZH A;  3HHM A;  3R7R A;  3VH3 B;  3R66 C;  4A3O A;  5J2R A;  1WM3 A;  4IWO A;  3FZH B;  2RSU A;  3WAM A;  1VCB A;  1E8W A;  1WYW B;  3OJ4 B;  3OLM D;  4K7U A;  4TUU A;  3WA0 A;  3JW0 X;  4LCD E;  4K7W A;  4RM8 A;  4WWO A;  3UIN B;  1WGD A;  2DYO A;  2PPH A;  3QWZ B;  1UBQ A;  1UGO A;  1EUV B;  3PHW B;  4WWN A;  2RD0 A;  3ZIM A;  4WJO A;  2G3Q B;  2IY1 B;  3EHV A;  3DBH I;  1WF9 A;  3KVF B;  4W9H A;  4ZRI A;  1WJ4 A;  2ZNV C;  3MJW A;  4P7I A;  3ZRC A;  2DHZ A;  1J8C A;  3CST A;  3KUZ A;  3MHS D;  4DK5 A;  2KLG A;  1T7S A;  1V9J A;  2MBE A;  1EF5 A;  2PEA A;  3S2A A;  1E8Z A;  2WYQ A;  4PYU A;  1KM7 A;  4DHZ E;  1WXS A;  3PVL A;  4TV3 A;  1AAR A;  2K8H A;  3APF A;  2MWS B;  5BO4 B;  3VDZ A;  2DZJ A;  4HDO A;  4MGI E;  3RUI B;  4DHJ D;  4DHJ B;  1UD7 A;  2FUH B;  1EO6 A;  4WJQ A;  5DPS A;  4TQ1 A;  2XK5 B;  1IPG A;  1WJN A;  2KQS A;  3H7S A;  5TR5 A;  5J17 A;  5JHA A;  4ICU A;  4KZ0 A;  3ZRF A;  1UEL A;  3UIP B;  4EZL A;  3M3Z B;  1D3Z A;  4HWI B;  4W9D A;  2EMT A;  2DYB A;  3ZDM C;  2CS4 A;  5D7G A;  4NY0 A;  1P1A A;  4NJ7 A;  4FA6 A;  2DZK A;  4NNJ B;  2C7H A;  5DPW A;  5E6O A;  2LVQ A;  2FIF A;  1M94 A;  1T0Y A;  2FID A;  3FZK B;  5AQG B;  2IY0 B;  2GBR A;  3PHX B;  2MX2 A;  2NBU A;  2OOB B;  3R7Q A;  2JZ3 B;  2KWU B;  1C3T A;  4YL8 A;  1I35 A;  4G3X B;  3RZF A;  4AUQ C;  2D3G A;  1WX9 A;  3D32 A;  2AEH A;  4GGQ A;  4XC2 A;  3R3M A;  2FCS A;  2JVC A;  2LD9 A;  3RCZ A;  2ZCC A;  2ZVO A;  3ML9 A;  2DX5 B;  2UWQ A;  1R4N I;  2BKF A;  1WI0 A;  3RD2 A;  2HJ8 A;  2G4D B;  2LGD A;  4GDK B;  2MBO A;  5AQK B;  4NQL B;  3X0W A;  4GMV A;  1WX8 A;  2LGX A;  2BGF A;  1LXD A;  2KK8 A;  2AYO B;  2M0X A;  2IO1 B;  3DVN V;  4DBG A;  3DBS A;  3L17 A;  5HKH A;  2KTR B;  3VVW B;  2GBK A;  1WY8 A;  1Z5S B;  5E6P A;  3PRM B;  2LXC A;  1WJ6 A;  2KD0 A;  3UIO B;  3DQV A;  2O2V A;  2Z0D B;  1RLF A;  3ZKJ C;  3V6E B;  4I6P A;  1HE8 A;  3IHP C;  4MGK E;  1TZ1 A;  4ZRJ A;  1CMX B;  2NBW B;  3APC A;  4MJS A;  1L2N A;  2ZNV B;  4GIV A;  2FCM A;  2YVC A;  1J0G A;  2O6V D;  2KDI A;  5CTR C;  1YJ1 A;  2KO3 A;  4NQK E;  3SD5 A;  3ECI A;  4IWP A;  2KHW B;  2ZEQ A;  2ZPN A;  1I42 A;  5AQT B;  4HWF A;  2JT4 B;  3TMP B;  3ZNH B;  2BYF A;  1U4A A;  2L00 B;  5D2M B;  1V49 A;  1Q0W B;  1WMH B;  2XK5 A;  1WZ0 A;  3PLU A;  2KLC A;  1NDD A;  2KX3 A;  3PLV A;  5DPT A;  3IFW B;  3UF8 A;  5KHO A;  4IG7 B;  1WX7 A;  3QK0 A;  4W9I A;  3RZW C;  2O2V B;  4G0N B;  4K81 A;  1WXV A;  3T9L A;  3PT2 B;  4MEL A;  4ZRK A;  4CHK A;  3EFU A;  1HX1 B;  1WE7 A;  2J0M A;  1ZKH A;  3ZNI D;  4AJW A;  4GDL B;  2KJR A;  4GOC A;  2LXA A;  3WAO A;  1RRB A;  2MLB A;  2LZ6 A;  5AQI B;  3VQI A;  1S3S G;  2KOX A;  3H7P A;  2Z59 B;  4KSL C;  5AZG A;  4K1R B;  4F1S A;  1TTN A;  5AZF A;  4FJV B;  1MG8 A;  1WH3 A;  2EKE C;  1WFY A;  2YLM A;  3A1Q B;  4NAW A;  3TL5 A;  4ANW A;  2L0T A;  2FCN A; 
#chains in the Genus database with same CATH topology
 3O9X A;  4YTP A;  2N9P C;  3PRZ A;  4H9R C;  3IVF A;  5HCM A;  1GG3 A;  2IIU A;  3F57 A;  2CHW A;  2ZLY A;  2E5V A;  3PUV F;  2MTQ A;  3AE3 B;  5BYR A;  3SOL A;  1I4Q A;  4TQ0 A;  2RA1 A;  4CZZ B;  1C76 A;  5L83 A;  4O1N A;  4JI0 T;  4F7Z A;  5LP6 E;  4DV1 T;  5FL1 A;  4WYV A;  1OXZ A;  3P4P B;  2X9Y A;  2RMM A;  5LHG B;  2BWF A;  3JC6 C;  2LVO A;  3BYT B;  3NG0 A;  5LNK A;  3J7Y q;  1F1H A;  4HCN B;  4XZ4 A;  1WRD B;  1Y56 A;  2J4X A;  5FXX A;  5FYM A;  4HLE A;  5JXV A;  1ZXH A;  2RDH A;  4GU2 A;  5E6N A;  1D0X A;  1UCU A;  4LK0 M;  1A5R A;  4AI6 A;  1YQ3 A;  2X38 A;  2KWV B;  1TY2 A;  4WAA A;  1RAX A;  1K8R B;  4ZYS A;  3AU4 A;  5J2T E;  2CLY B;  5L47 A;  2KSR A;  2ACZ B;  1ROE A;  3AI5 A;  2VWA A;  3AA0 B;  3AE9 B;  3U4E G;  2PBI A;  1YX6 B;  4O2A E;  1B7T A;  3RQW A;  4LF9 T;  1V5T A;  3UUB A;  2BG9 C;  2BYV E;  5HI1 A;  2MCN B;  4C56 C;  3GN5 A;  2KFK A;  5IP4 D;  3DVG Y;  3HVD A;  4W9E A;  2O6V A;  1Y01 A;  1IP9 A;  2WP9 B;  5AQN B;  5JDH A;  5FY0 A;  2EHO B;  3TLU A;  1FPY A;  5KX5 E;  3P50 A;  4URK A;  1KFY A;  4C7Z A;  4TX5 A;  1WRD A;  4QHO A;  3FIL B;  2ODU A;  4X66 T;  4LDT D;  3RYF E;  2WXI A;  4CXY A;  1EF1 A;  4FN2 A;  2WQY B;  1X79 A;  1UK5 A;  1L6U A;  1HZ6 A;  3AA7 B;  1VRA B;  2K6D B;  1MPE A;  2G0U A;  2XQA A;  2WXM A;  2C0S A;  4MLK A;  4LFC T;  1MFW A;  4BOS C;  1A70 A;  3UQA A;  4G50 A;  3VH4 B;  4HJG E;  5GXG B;  3MXZ A;  1PYW D;  2KMM A;  3IXS A;  1ZOY B;  1KF6 A;  2L1A A;  1R8I A;  2NCN A;  4GB9 A;  4LFA T;  2BS3 A;  3AE5 B;  1KRH A;  3AVR A;  4B6W A;  3T3O A;  4ILA A;  1P9D U;  1QIL A;  4HEA 1;  4TNV A;  5J18 A;  1HEZ E;  2WGS A;  2AWT A;  4MH0 E;  5JZE B;  3PTR B;  3TIX A;  3JSV A;  3AE2 A;  2GK9 A;  3OYZ A;  5LXI B;  3RUL A;  3ZCI A;  5LMU T;  5FL0 A;  5BR8 T;  4A20 A;  1D1C A;  3ZDT A;  4X1Y E;  5CHW A;  3ML8 A;  5GON E;  1T0Q C;  4ANJ A;  2JPH A;  4PK6 A;  3H9D A;  1LQB A;  2J1D G;  2JWU A;  3TLV A;  3P4R B;  3RT3 B;  4MM3 A;  2AQ1 B;  5ABG A;  2JF5 A;  2QSD A;  3AEC B;  2DEN B;  3NZS A;  5EDS A;  4HKA A;  2LJI A;  3O65 B;  3P8C D;  2M67 A;  5DQW A;  3QA8 A;  3RPF C;  3H6N A;  2WSS V;  5AEK B;  2D9D A;  4I6N B;  2KTR A;  2V4L A;  2AL6 A;  3JYU A;  3B2G A;  3EA6 A;  3FAH A;  3M95 A;  5D6J B;  2LRK A;  5ADX L;  2X0H A;  2J62 A;  2WNM A;  5HAX A;  3ZXR A;  4A90 A;  3IT4 B;  3KBT A;  3WAL A;  1TS2 A;  3B08 A;  2IML A;  1TS3 A;  2BBC A;  3GOE A;  3ZT5 A;  4EAH A;  2DLB A;  1QLB B;  3IBE A;  2ZM8 A;  2NVU I;  1SJH D;  3PUS A;  2PIA A;  5FNV E;  3C0R B;  4RH6 A;  5CFB A;  3VHT C;  5ABE A;  2BB6 A;  3ENE A;  3IEE A;  2LOP A;  4FXC A;  2LKH A;  4BBN F;  3KUD B;  1GJZ A;  2ZW0 A;  4C80 A;  4F6R C;  5H92 C;  3C50 A;  5IOI A;  3UU3 A;  2XEW A;  4UIG A;  3H1U A;  4DXF A;  1N32 T;  5H8Y E;  2E3T A;  2V3S A;  4MEM A;  2XPK A;  2LSG A;  1AWD A;  3AB3 B;  2MSE D;  2CBJ A;  1FXA A;  2EEL A;  1YIW A;  1STE A;  5BYS A;  3ZJ1 A;  4HE8 A;  3DOW A;  2MPK A;  4A3P A;  4AIU A;  4YSZ A;  1RYJ A;  4U3C A;  2JRI B;  4ILC A;  2K24 A;  1US7 B;  2I59 A;  4P09 A;  4ACF A;  2C5I T;  3O13 A;  5FP3 A;  2R61 A;  4IDP A;  1N61 A;  1OED B;  4DV0 T;  4KMC A;  4C90 A;  2VVS A;  4OX9 T;  1BXT A;  2MHJ A;  5C23 A;  5LG3 A;  1GAQ B;  1XWM A;  4NUV A;  4ZEY A;  4ZRP A;  4NZL B;  4WAF A;  2CHX A;  4Z8X A;  4NJC A;  3AEG B;  3A33 B;  4A8X C;  3GB1 A;  3N2K E;  4RF1 A;  2V8S V;  2W2U A;  2LJL A;  3PV1 A;  1SE2 A;  1EM7 A;  2BKP A;  4IE5 A;  3LBX B;  1WR1 A;  2LUM A;  1FD6 A;  1GB4 A;  4AQF C;  3TKL B;  3ONJ A;  3IAM 1;  2LHE A;  1D5M C;  3PZD A;  3ZNZ B;  2AQ3 B;  4HKZ E;  1EWC A;  2KX0 A;  5EE1 A;  3QIJ A;  1XEE A;  3IA3 A;  4RGN A;  2O6V B;  3QHT A;  3PUA A;  3AA1 B;  2XTL A;  3L13 A;  1R7S A;  3DBL I;  1H8C A;  3A7M A;  2UU7 A;  4MHC A;  2BS2 A;  3B0A A;  2HPL A;  4A98 A;  3QAQ A;  2L32 A;  1P98 A;  4C4V B;  2W63 A;  4PJL A;  2KN4 A;  4HN9 A;  1QSD A;  2UXB T;  3MHZ A;  4MH8 A;  4CYE A;  4AXP A;  2CJO A;  2WXG A;  1JWS D;  4ARI A;  2CA5 A;  3KV6 A;  2X8X X;  4WWP A;  2X0L B;  4F8C B;  2HE7 A;  2XQ5 A;  1VCS A;  2CPT A;  3UTK A;  1N5W A;  4N6E B;  3U2S C;  2KDE B;  4ANV A;  1ISN A;  4TUY E;  1SE9 A;  3T8M A;  3O4X E;  4JBW F;  1CJE A;  4AKR B;  2KJH B;  4LLG M;  2JXT A;  3KYC D;  4NJ6 A;  3BIN A;  4UEL A;  2Y8D A;  1L6V A;  4LJP B;  3SEB A;  2AL3 A;  3KIN B;  4COF A;  1HTQ A;  3AXJ A;  2FUP A;  3SFE A;  4HPM B;  3ZVV A;  2WX0 A;  3L10 B;  5JDM A;  1Z2M A;  3L4P A;  5LXH A;  4XBF B;  1BML C;  1HZ5 A;  3MFG A;  2QVA A;  2CM0 A;  2H88 B;  1YKH B;  1T5X D;  3AE9 A;  1M62 A;  4XYC A;  4LNN A;  4DDG D;  2DWQ A;  4H9P C;  1UUP A;  4U7Y A;  3AEF B;  3N9Y C;  3DWG C;  2J47 A;  2LT3 A;  3P4S A;  4M01 A;  2LRL A;  1XCT L;  3WAN A;  4EZ4 A;  3TJP A;  3AED B;  2DWK A;  5LGU B;  1C9F A;  4E74 A;  3NVW A;  1Z8U A;  2HDE A;  3S4U A;  3VTV A;  3FBL A;  2Y5B B;  4L2Y A;  4X20 E;  2IC6 A;  1V80 A;  2UUA T;  3EUB 2;  3ZYM A;  3AV8 A;  2WXQ A;  1VDV A;  2VKD A;  4CI3 B;  1SUM B;  4IWO A;  2WBL A;  3H3M A;  1VCB A;  4TZ4 C;  1E8W A;  1XLN A;  1S94 A;  4TUU A;  3ZJU A;  2XZE A;  4WWO A;  3UIN B;  2DYO A;  1FIO A;  3RIF A;  2BVC A;  4BJM A;  2RD0 A;  4EYU A;  3ABV A;  2A3D A;  2J53 A;  5FK9 C;  1L4Z B;  1HNW T;  2RDG A;  3DBH I;  1WF9 A;  3PO0 A;  1O3X A;  2HN2 A;  1YQ4 A;  4OK0 A;  3CST A;  4OZA A;  2MBE A;  2SEB D;  1EF5 A;  4B3S T;  1E8Z A;  2N9L A;  3URY A;  5JRC B;  1NAF A;  2NOX A;  3UU4 A;  4D2K A;  4JEH B;  2DZJ A;  4HDO A;  1K53 A;  3RUI B;  5AUI A;  4DHJ B;  4AQY T;  2H7O A;  2V3P A;  4WJQ A;  4TQ1 A;  5HWX A;  1IPG A;  1WJN A;  5JHA A;  4KZ0 A;  4TMA B;  4PT5 A;  1D5Z C;  1BR0 A;  2HJ1 A;  4U33 A;  3SRZ A;  4PK1 A;  2XQ8 A;  4G63 A;  2KLQ A;  3QNU A;  2V0G A;  3ZDM C;  2DYB A;  2M6B A;  2WXR A;  3SS1 A;  1YQ3 B;  3N2G E;  3RLF F;  5DPW A;  2LMC A;  3CX7 B;  2HPJ A;  4AIS A;  2W66 A;  3PHX B;  5AQG B;  5CA1 E;  2MX2 A;  1F52 A;  1XO3 A;  3R7Q A;  2KMF A;  2JZ3 B;  4N78 D;  3RF1 A;  5H6R B;  4ZI7 E;  3AEA B;  2VUR A;  4YL8 A;  4P1B C;  1I35 A;  3AVS A;  4PFP A;  1WX9 A;  2LD9 A;  2L8K A;  2YIN A;  3PZ8 A;  2YU2 A;  1QOA A;  3SR6 A;  4P16 A;  3LK4 2;  3E0Z A;  3MKD A;  3X0W A;  5CB4 E;  1ET6 A;  2D0U A;  1WX8 A;  4GMV A;  5F3J A;  1LXD A;  2KK8 A;  4YXD B;  4GK5 E;  3P63 A;  4DID B;  3DVN V;  2FJA A;  3KWL A;  3RYC E;  1QKZ A;  5HKH A;  2KTR B;  4C00 A;  3ZST A;  2GBK A;  1WY8 A;  4O2B E;  4C7Y A;  4U2Y A;  2PFV A;  2YDR A;  2KD0 A;  2W61 A;  2MAW A;  3AE3 A;  3I9W A;  2Z0D B;  3RI5 A;  2M6I A;  2RDB C;  1JWU D;  1IBM T;  3B13 A;  3IHP C;  4REZ A;  3V5S A;  2EHO C;  2NBW B;  4GK0 E;  2ZNV B;  2YVC A;  5HEJ A;  5G5G A;  5CTR C;  3WAK A;  1V1P A;  5L3F B;  4Z91 A;  3N9O A;  5FKY A;  3SD5 A;  4OZB A;  2KHW B;  5AQT B;  1U4A A;  1JNZ A;  2BDE A;  3AAE B;  3PLU A;  2KLC A;  2KX3 A;  2NW7 A;  4N59 A;  4KX6 B;  3IFW B;  1JAL A;  1UWM A;  1JRP A;  3UF8 A;  4TWF A;  1J5E T;  1MJD A;  1C79 A;  4K81 A;  2WLB A;  4X1I E;  4L1B A;  4ZRK A;  4BJN A;  2NW8 A;  2J0M A;  4UXN B;  2KJR A;  1RWS A;  2MLB A;  3SFD B;  4XGA B;  2E8I A;  4L9I A;  4DR2 T;  4FJV B;  3PUX F;  2WDV B;  3OYX A;  1SE4 A;  3JAD A;  3DP7 A;  1RFK A;  5IO9 A;  1YN5 A;  4JE3 B;  2Z8L A;  1C77 A;  4MAL A;  2WU5 A;  3PPA A;  3KV5 A;  2E2A A;  4XDC A;  2JRH A;  3NWI A;  1E2A A;  4O4H E;  4X1K E;  4HWD A;  1KH0 A;  4CI2 B;  1YKE B;  3ZT7 A;  3AE7 B;  1IJ5 A;  2ZMA A;  3Q14 C;  4JGH B;  1YD8 U;  4CQI A;  2MP2 B;  1LVF A;  4TNW A;  3BK9 A;  2KWC A;  3FXE B;  1F2R C;  4YT0 B;  1UGJ A;  1L4D B;  2A4Z A;  2BS4 B;  2XAQ B;  3FZF B;  4GSW A;  1DOX A;  4AKL A;  5LLI A;  4B95 A;  4OYK A;  3UUN A;  1SE7 A;  5AQO B;  1R4M I;  2KN5 A;  3A9J B;  4MJS B;  3QC9 A;  5DJQ C;  4DMW A;  1RFA A;  2CEA A;  4UF0 A;  5CX3 A;  2BBH A;  3QCA A;  3ZCJ A;  4US8 A;  1WCR A;  5AQV B;  3GMI A;  4EIW A;  4MSM B;  4B3T T;  3ZSS A;  3V61 A;  4EED A;  3AM9 A;  3MTN B;  4PS7 A;  2DHR A;  3QC8 B;  1TBE A;  3M65 A;  3FB2 A;  1E10 A;  4EOZ B;  1UZX B;  2YK0 A;  3ABV B;  5AQF B;  4M8N A;  4IDI A;  2WS3 A;  4H9O C;  3DJB A;  3K9P B;  3LFM A;  1WWT A;  1TKE A;  2IO3 B;  4FHJ A;  2XSA A;  4KDI C;  1N62 A;  2RPA A;  2QDF A;  3L54 A;  4K7S A;  3CVR A;  2LRU A;  3KDS E;  4I50 E;  3DWM A;  3VRA B;  2N1W A;  3MC9 A;  4KVG B;  1EU4 A;  1WGH A;  3I1A A;  3K3Q C;  5KHQ A;  3NRY A;  2X68 A;  4UVA B;  3EGR A;  3B1L X;  3K9O B;  2FNJ B;  3AU5 A;  4JL9 A;  3EUH A;  3GZN B;  1L7Y A;  3A4R A;  2RP4 A;  3RRC A;  5JR9 B;  4DWF A;  2LRW A;  1ZW7 A;  4S17 A;  3ZYY X;  4I4T E;  2N4F A;  4II2 B;  2ZM6 T;  1JRU A;  1KLV A;  1H4R A;  1JNR A;  3RX6 A;  4J2C A;  4WJP A;  1V81 A;  3VFK A;  2IZV B;  4HFH A;  2L3L A;  5ETW A;  2DYM A;  4YTN A;  2W3S A;  2YOE A;  4L0R A;  2K6Q A;  4ZHO A;  5G55 A;  2I0M A;  2JRK A;  2MA9 B;  2VH2 A;  5JDQ A;  1J19 A;  5C2T A;  1FNW A;  4ZS3 A;  4AJY B;  2KC1 A;  3PJA A;  2BZB A;  4IE4 A;  1E8Y A;  3Q8A A;  3DHG C;  5HCJ A;  2REX A;  2L3Z A;  1TIF A;  1XNQ T;  4JI5 T;  1U4Q A;  5AQQ B;  4LF7 T;  1P3Q U;  3CML A;  4IC7 B;  1XD3 B;  3E08 A;  2E9X C;  5AQU B;  1X1M A;  2J7Q B;  5ABF B;  3UFG A;  4H63 H;  2D11 A;  4IKG A;  2AE9 A;  2DBY A;  2N7E A;  2QA7 A;  4NXM T;  3Q8C A;  2WHI A;  2DI4 A;  3KUC B;  1YXR A;  4TSS A;  1MIV A;  5AFU L;  4QH1 A;  1JW9 D;  2D2S A;  1OQY A;  3KYD D;  4ZOH C;  2XAF B;  5CHF A;  2XJ7 A;  1DOI A;  2NPT B;  3BQK A;  5IAA C;  3WA0 A;  1G73 A;  1I4X A;  2AXD S;  3N9Q A;  2QRX A;  1T3Q A;  3MC0 B;  3PUR A;  2D2Q A;  3M62 B;  5M4Y A;  4EZK A;  1IAP A;  4HK2 A;  4R3D A;  4N9F 4;  2LSY A;  4FAD A;  4GDL A;  1XNR T;  1MG4 A;  3NY5 A;  1ZHC A;  3IBP A;  4DND A;  3DBH B;  5CHV C;  5IWA T;  2X66 A;  3QJZ A;  2N2N A;  5L3E B;  4OHF A;  2WMO A;  2Z0E B;  2WDV A;  2IGD A;  1KNR A;  5IKC M;  4KHP T;  3DVN U;  4JI1 T;  2HD5 B;  4WJN A;  1LRZ A;  2OJR A;  5LHH B;  3SU8 X;  3ONX A;  2CKH B;  2JY6 A;  5J1G A;  1FXI A;  1SXT A;  1UGM A;  2GBJ A;  1XDO A;  3OJ3 A;  2D07 B;  2JQR B;  2BG9 B;  2JZZ A;  3CKD A;  2WXO A;  3PJA J;  3ZW3 A;  4HFD A;  4W9J A;  1TS4 A;  2VL0 A;  2I38 A;  2M4N A;  2QYW A;  5HG2 A;  1W9R A;  3P4Q A;  4XE0 A;  3UGB B;  4H9S E;  4LNO A;  4YXD A;  3CK6 A;  2VH1 A;  3P7I A;  1NBF C;  3MK7 C;  2XY8 B;  4W9L A;  4W9K A;  1HXY D;  2VL8 A;  3HM6 X;  3N30 A;  3BY4 B;  4WQO B;  2CHZ A;  2PTL A;  5C3J A;  3UQ4 A;  3EFC A;  3MA9 A;  4OZC A;  4YTN B;  2LM2 A;  2MBQ A;  2XAG B;  1E5W A;  1F77 A;  3HIZ A;  3WAP A;  5FXV A;  4FJY A;  4P1C C;  2V7L A;  3KVB A;  4GKJ T;  4NUU A;  3MP9 A;  1MNE A;  1KNZ A;  3SFE B;  2L76 A;  3Q5D A;  3A1Q A;  3P2B A;  1I94 T;  3UQ7 A;  3GWH A;  2DNX A;  1OEY A;  1SB3 C;  1BR4 A;  2WZH A;  1ZDX A;  2PLP A;  3VTW A;  5IHY A;  2GBM A;  2V7I A;  1T98 A;  3VHL A;  1DOY A;  2LGI A;  3UUM A;  4JLC A;  2WCA A;  3OG5 A;  3TCA A;  2G9H D;  3LJC A;  3W1S A;  1AYF A;  2CMR A;  2LE8 A;  4UVC B;  5BYQ A;  4ILU A;  3N5L A;  1ZGU B;  2L7R A;  3N20 C;  3QOF A;  4IM2 A;  2WXP A;  5LB7 B;  3VUY A;  2CBI A;  3U52 E;  2XM1 A;  1SF0 A;  4X57 B;  3HKD E;  1BR2 A;  2A9U A;  2WXN A;  3Q8F A;  2NMQ A;  4RGM A;  3MJX A;  3K1S A;  4J6I A;  3I0O A;  5J0Z A;  2V26 A;  3W1Y A;  1S35 A;  3L39 A;  3EI0 A;  5TAO A;  2C60 A;  1TKG A;  4MGZ E;  2X9X A;  2PJH A;  3RNF C;  3ALB A;  2K8C A;  4IM0 A;  4ADZ A;  4EEW A;  4HWH A;  2K5B B;  2V3N A;  3JSV B;  1XF5 L;  4H2A A;  1WSP A;  5L95 C;  3L16 A;  1MHH E;  3PGE A;  3E56 A;  4HXD A;  2WP9 A;  3RYI E;  4IGU A;  2LHD A;  4OVZ A;  4U74 A;  1PGA A;  4ZDV A;  2INN E;  1W0B A;  1D1B A;  1MI0 A;  3ZLI A;  1F2R I;  2HH7 A;  5L3G B;  2JUO A;  1Q1O A;  1CK1 A;  2QC8 A;  1ZP0 A;  2NR2 A;  3P4Q B;  4RM9 A;  4NAW B;  3VAW A;  4HFI A;  1WR6 E;  3AXC A;  1TY0 A;  3BZD B;  2WWV A;  1NEN A;  2ICI A;  2M19 A;  2Q5W D;  4EXT A;  4CN4 A;  4H9N C;  2MJD A;  3FKY A;  3PRP B;  4HJK A;  1CQV A;  1LFD A;  3Q5X A;  3ZUN A;  3AEE A;  2Q9Q C;  3OAW A;  4KGR A;  3N1Y C;  3ETR A;  2XQ7 A;  4FI5 A;  3NZ3 A;  2IC9 A;  1L0V A;  1CZP A;  4C91 A;  5JQG E;  3C8Y A;  4LNI A;  1ZEE A;  3MZK B;  3HVZ A;  4CQN A;  3LB8 C;  5AQP B;  3RC3 A;  2IBI B;  4IST A;  1GC6 A;  1XMQ T;  3Q3J A;  2LSJ A;  3R7R A;  5J2R A;  4H63 V;  2NTS A;  1HA5 A;  5JDG A;  4DBQ A;  3R6N A;  2RSU A;  4RFB A;  2XQ3 A;  3BVM A;  3OLM D;  2WB5 A;  3JW0 X;  4IL9 A;  2TSS A;  5AUK A;  5E0O A;  2XAJ B;  2YDQ A;  2CWY A;  3EVY A;  4EZH A;  2PPH A;  1EUV B;  1P7E A;  3PHW B;  2LFI A;  1YJJ A;  4WJO A;  2BKO A;  3I5J C;  4GYS A;  3ZRC A;  1KTK A;  3KVF B;  4ZRI A;  1BUI C;  2HHH T;  1J8C A;  3MHS D;  4DK5 A;  3AEE B;  5HHD G;  2ZM0 A;  4YSZ B;  3LG7 A;  4WBO A;  1KM7 A;  3NS1 A;  4DHZ E;  2SAK A;  1WXS A;  2KVZ A;  5HXR A;  3AE1 B;  4HKQ A;  3VDZ A;  4QH5 A;  2X67 A;  5BO4 B;  2VK9 A;  1XLQ A;  3NZQ A;  1UD7 A;  2KQS A;  3AMZ A;  3H7S A;  3ZRF A;  4S0R A;  2H3R A;  1IGC A;  1XZY A;  4A56 A;  1D3Z A;  3AEG A;  4HWI B;  2IGG A;  3RC8 A;  3WAJ A;  3BK2 A;  3SWH A;  2OED A;  2EMT A;  4W9D A;  2JMH A;  4O8S A;  1PGB A;  5D7G A;  1E7P A;  1PDX A;  2FIF A;  2OLT A;  1WYB A;  1NYQ A;  4PK4 A;  5HYA A;  2GBR A;  2IY0 B;  1GQE A;  3C4W A;  3WCQ A;  3VRA A;  1C3T A;  3Q2A C;  4KBM B;  4G3X B;  4XWT A;  2D3G A;  1WR6 A;  2AEH A;  4GGQ A;  4XC2 A;  3RCZ A;  2DL1 A;  2ZVO A;  3P4S B;  1I4G A;  4KUM B;  1T72 A;  2VKH A;  4HRO A;  2BKF A;  3C98 B;  4JI7 T;  5JR9 A;  3AE5 A;  2BS3 B;  2V6Y B;  1KF6 B;  3GE3 C;  2ACX A;  2M0X A;  3AE2 B;  4DUZ T;  4US9 A;  3BQL A;  5FXW A;  3IF8 B;  1Z5S B;  4DV4 T;  2YKS A;  2IDO B;  4UDU C;  1J1J A;  2LXC A;  2Y3A A;  1KNP A;  1RLF A;  2MJE A;  3ZKJ C;  3V6E B;  4DV5 T;  2HN1 A;  3GN5 B;  3NJT A;  1VCT A;  3CWZ B;  4OHJ A;  2F4V T;  4MJS A;  3P4R A;  2CXL A;  3F31 A;  3ETU A;  1YW0 A;  4TV8 E;  4JV5 T;  1YJ1 A;  1I7H A;  2KO3 A;  4IT4 A;  3AN1 A;  3FXD B;  4NQK E;  2V6Y A;  2BG9 A;  1K52 A;  3ECI A;  3ZJV A;  4NAM A;  3TLW A;  2ZEQ A;  1K50 A;  1TYG B;  3TMP B;  4B0E A;  3C19 A;  5JR9 C;  1J5W A;  1V49 A;  4GYR A;  4JI4 T;  4AKI A;  2V7M A;  3N2O A;  5L2L A;  5HEH A;  4IE6 A;  2J42 A;  3UFE A;  3PLV A;  3TSS A;  4DUY T;  3N9P A;  4EE2 A;  2UU9 T;  4F8H A;  3QK0 A;  4ZI3 C;  2E5L T;  1WE7 A;  2OHF A;  1Q10 A;  1SJE D;  1RRB A;  1MIY A;  2LZ6 A;  4HRS A;  2PMV A;  3VQI A;  1S3S G;  2LEH A;  3H7P A;  3NRZ A;  4USA A;  4K1R B;  3BII D;  2E9X D;  1TTN A;  5AZF A;  2I2Y A;  2WAU A;  4NAW A;  1X9B A;  1VOM A;  3P42 A;  4B6X A;  5JDN A;  4ANW A;  3L8R A;  5LG4 A;  3CX8 B;  4WNK A;  2JXX A;  1G6J A;  4QXB B;  4AKH A;  3ETV A;  4PNI A;  2IAK A;  1I4R A;  3APD A;  1NEN B;  3G06 A;  1WXM A;  1OED C;  2BYE A;  4IIJ E;  1XLP A;  2KVR A;  1QZE A;  4GXB A;  1GPX A;  3AE4 A;  3C4Z A;  5L3B B;  3RNE C;  3ZC0 A;  3U3I A;  4M0W B;  4KDL B;  3EAB A;  3C64 A;  1V86 A;  4JPS A;  1Y8R C;  1QOB A;  4HCP B;  4U2Z A;  5KMG P;  4DR7 T;  1E1H B;  2IJ0 A;  2CE7 A;  4DO0 A;  2XUE A;  4XZC A;  5D94 A;  4ZS2 A;  1BT0 A;  2KIN B;  4KSK C;  1FNV A;  1D5X C;  3V6C B;  3VTU A;  4L23 A;  2GOW A;  1D6E C;  4JI3 T;  3AEB B;  2D10 A;  1M7K A;  3IG3 A;  4TV9 E;  4X62 T;  5HEO A;  2N9D A;  1OQR A;  2V1Y A;  3OPC A;  3ZMU B;  1I4H A;  1D0Z A;  2WQY A;  2IPK D;  2K39 A;  4ZXL A;  2JU6 X;  2ODV A;  4LTU A;  4M00 A;  3B2F A;  1KLU D;  4M0W A;  4U72 A;  2MQJ A;  4BBN C;  2XQ6 A;  4EGW A;  5LCY A;  2NW9 A;  1WGR A;  3Q3M C;  2FAZ A;  4IW0 A;  1N36 T;  3RHW A;  1TKY A;  1HTO A;  2FCQ A;  4PFO A;  2VZK D;  4M8M A;  3CIR B;  1YX5 B;  2BQQ A;  1FEW A;  1C78 A;  4M02 A;  4UV9 B;  3U7D A;  5JDF A;  4KGT A;  3HKE E;  3VR8 A;  4ZI2 C;  3FC4 A;  4BZA A;  2JQQ A;  2LJ5 A;  2BBJ A;  1TS5 A;  3PUW F;  1ZE3 D;  1UUR A;  2L9Q A;  4LDT B;  3Q3F A;  2P9B A;  2JJ9 A;  1H7C A;  3L3P A;  4JEU B;  5DPR A;  4BKT A;  5JHB A;  2KXJ A;  1XXG A;  3N32 A;  3PSE B;  2VQE T;  1ZUD 2;  2WXF A;  3PUZ F;  4JWU C;  4DV3 T;  3HR0 A;  2IO0 B;  2DLR A;  2GB1 A;  4MM3 B;  4FBJ B;  2WM9 A;  1XDP A;  2B3A A;  1XT9 B;  2LI5 A;  3AUL A;  4ZHP A;  3UQB A;  2BS4 A;  2VAS A;  2D3C A;  4JQW C;  2KDM A;  1HFA A;  4J3O D;  4O4I E;  2XQ9 A;  4EZJ A;  3LDQ B;  2V6X A;  4IDN A;  2D3B A;  1U5P A;  3NHE B;  3IAS 1;  3JAF A;  2XAS B;  2WWZ A;  2INP E;  2ZW1 A;  1GOZ A;  3AE6 B;  4WH4 A;  1FMA D;  1GB1 A;  3EEC A;  2L05 A;  3HK0 A;  1WFD A;  3EHZ A;  2UXC T;  2CXF A;  1KJT A;  3ZO5 B;  3LK3 B;  2MW5 A;  5L3D B;  3A8Y C;  2LOS A;  3BQI A;  3RRW A;  1Y64 B;  3EDV A;  4TKN A;  3UT5 E;  1T0S C;  4EYY R;  4WZX A;  3HA4 A;  3IHR A;  5IN7 A;  2J0K A;  2WDQ B;  3I9Y A;  3O1J A;  1YOV B;  4DR4 T;  5JH5 C;  2X9W A;  2C7N B;  3VR9 A;  4IOI E;  1ZDV A;  2K25 A;  3OWE B;  3AE6 A;  3NRX A;  2E6X A;  3BK1 A;  3Q9D A;  4C4V A;  3AAA B;  1T0R C;  5LOV E;  2X51 A;  2R2O A;  2MBB B;  3B5M A;  1N63 A;  3QX1 A;  4JLE A;  4BKG A;  2QJL A;  2WX1 A;  2QEJ C;  3VUX A;  3DVG X;  4X65 T;  1FO4 A;  2GMI C;  1OED E;  2M8S A;  1F9J A;  2WU2 A;  1WRI A;  5CA0 E;  4HDQ A;  2M17 A;  3M3J A;  1YQ4 B;  3TLT A;  3DBR I;  2V7K A;  1GNU A;  2QIE B;  3KFW X;  5FR3 A;  2IDY A;  4EEB A;  2KFK B;  4ZRQ A;  5JRE A;  2N9E B;  1V97 A;  2R2Q A;  2N7J A;  2VQF T;  3VRB B;  1M4V A;  2NTY A;  2IUB A;  1MVK A;  1I4P A;  3VR9 B;  2N9K A;  4NIQ A;  2H89 A;  2Y48 B;  1OFF A;  2YEP F;  1YJI A;  2XM2 A;  2KZR A;  3ZKR A;  4TN7 B;  2N0S B;  2LEK A;  1FCL A;  4AP4 C;  4OW0 A;  2XBB C;  4I6L B;  4JWS C;  4MAC A;  2X0Y A;  2KYW A;  2GBN A;  5FVK A;  2VVN A;  3W5U B;  2FJB A;  1MIW A;  3NZP A;  4PAG A;  4JI8 T;  4A9A A;  4I43 B;  4EB6 E;  1JWA D;  2N9X A;  4E3C A;  1HNX T;  3L08 A;  4MDK E;  2M56 B;  4QAY A;  4HTE A;  4PS3 A;  3M63 B;  3ZTC A;  5C1Z A;  1ET9 A;  4W9F A;  1WE6 A;  2MRP A;  1PFD A;  4BKS D;  3PZ7 A;  3AEA A;  4EOY A;  4PS8 A;  2G4S A;  3VXW A;  5G2N A;  1HS7 A;  1JML A;  3ZNG C;  4A5X A;  3VUW A;  2YU1 A;  3RYH E;  1GUA B;  1IBL T;  2JYT A;  4ICV A;  1F0Z A;  4MFR A;  1E8X A;  1JRO A;  4HPP A;  3T3N A;  3WIM A;  2K9A A;  1T8B A;  4EFO A;  4YT0 A;  2BF8 B;  2NS5 A;  2LHN A;  1D0Y A;  1WXA A;  3CMM B;  1FMW A;  3KV4 A;  4V1A v;  3KVA A;  2A2F X;  3TEZ A;  2WXH A;  3ZC1 A;  4ITK A;  3RIU A;  5AQJ B;  4GDK A;  1YN3 A;  3W5V B;  4UEM A;  1OED A;  2KZ7 B;  2UUC T;  2CU1 A;  3GP7 A;  4LMJ A;  4DXA B;  3CPZ A;  1UBI A;  1XQQ A;  3W1S C;  3AA6 B;  3BVZ A;  5LA6 E;  1B1Z A;  2WDT B;  3PS6 A;  2C5L C;  1QF6 A;  2DWG A;  4LF6 T;  2IYD B;  4L5G A;  2ASQ A;  1WMH A;  2K8B A;  2Y5C A;  3GZN I;  4B9K A;  3NVO A;  4DQO C;  2CLY C;  2YEV C;  4WWM A;  1P0R A;  2A5U A;  3TEX A;  2CHN A;  2XHE B;  2DZM A;  3PU3 A;  1T6B X;  2MYS A;  1OGW A;  4RNA A;  2W67 A;  3A5X A;  1MMN A;  3BVG A;  3LBX A;  4ARC A;  3QQ8 B;  2C9W B;  5IUX A;  2KNB A;  1EWY C;  1MMG A;  2ZJD A;  4XX5 A;  2ZPY A;  2CR5 A;  1P7F A;  3PUG A;  3A4S C;  2WMN A;  3P4P A;  1IBX A;  4JYA T;  3AEB A;  5C8Y E;  2K22 A;  1WYG A;  2W54 A;  4Q2J A;  3CQC B;  4EUT A;  4EKU A;  2FE8 A;  1V1O A;  4A55 A;  4ZOL E;  4GLS C;  4DR5 T;  1KEY A;  4E7Z A;  3HRD D;  1ACC A;  2KDF B;  1NWM X;  3PTF C;  3EAM A;  3UU8 A;  1SIF A;  5DQV A;  1K51 A;  3Q3N C;  5LYJ E;  2KFJ A;  2ZM2 A;  2AQ2 B;  1KK7 A;  3QB5 A;  1V5O A;  1WZ3 A;  2QMT A;  4PYZ A;  1YNT E;  4BA9 A;  3RGL A;  3AE7 A;  3U8Z A;  4QXH B;  1FFU A;  4DMV A;  4ASW C;  2CRB A;  2BKR B;  2IGH A;  2PE9 A;  3ZXV A;  5KDM C;  1UH6 A;  3ZN1 B;  4AOF A;  3HI2 A;  4TWD A;  4UR9 A;  5EE0 A;  2KJ6 A;  4HWC A;  2DAJ A;  1IBK T;  5AZH A;  1GC7 A;  2M0A A;  4A3O A;  1FIQ A;  1E0Z A;  1R4N B;  5EE3 A;  4FJO A;  3V05 A;  5ABH A;  3RH3 A;  3WAM A;  3OJ4 B;  4YTP B;  4K7U A;  4RM8 A;  4PJM A;  3AXJ B;  4HFB A;  3OVU A;  5TSS A;  1L0X B;  2NTT A;  2L83 A;  4LNF A;  3DTO A;  5FXZ A;  4K3B A;  1UBQ A;  2MOZ A;  4B3R T;  3J9C A;  4HFV A;  3ZIM A;  4AQF A;  5T8I A;  2G3Q B;  2KWD A;  3C51 A;  4W9H A;  2ZNV C;  3D0T A;  4P7I A;  1L0Y B;  1TT5 B;  1T7S A;  1VRB A;  3TUO A;  2W00 A;  4E7S A;  2JPF A;  2PEA A;  3S2A A;  4PYU A;  5LHI B;  3RNA C;  4RGO S;  3R8B A;  4P0B A;  2K3U A;  3PVL A;  4TV3 A;  3RMK C;  2Z6E A;  3WI3 A;  3J9X 1;  4MGI E;  2H89 B;  3HL6 A;  2EHO D;  2FUH B;  5DPS A;  2UUB T;  1EO6 A;  1N60 A;  2JX5 A;  5J17 A;  4ICU A;  4EZL A;  3ZMS B;  5LBQ B;  4JI2 T;  5FMN A;  3NKZ A;  2Y6X A;  4ERR A;  1N34 T;  1HF8 A;  2JMK A;  3P4W A;  1P1A A;  4FA6 A;  2DZK A;  4NNJ B;  2C7H A;  2D3A A;  5E6O A;  2QGS A;  3RNC C;  1M94 A;  4AQ7 A;  4YJ3 E;  2FID A;  3FZK B;  1E6E B;  5HWY A;  2KWU B;  4HEA A;  2FBW A;  5F8P A;  4A97 A;  3AH7 A;  3Q69 A;  4AUQ C;  2DCF A;  3D32 A;  2FCS A;  5EK2 A;  1FM0 D;  3NBX X;  1C4A A;  1FEH A;  2UWQ A;  1HCI A;  3ZPO A;  4YLH A;  5L3C B;  1R4N I;  3RD2 A;  5CGM A;  2LSK A;  4NXN T;  3ZMV B;  2RPV A;  2ON8 A;  4ZI3 D;  2AYO B;  4DBG A;  2JQH A;  3DBS A;  3L17 A;  5MPO A;  3ANW A;  1FFV A;  2UXX B;  3VVW B;  5E6P A;  3Q6B A;  3UIO B;  3DQV A;  2O2V A;  4AS1 A;  4X64 T;  1SA0 E;  2Q9Q D;  1HE8 A;  1ZV4 X;  4MGK E;  1CMX B;  3CX6 B;  4ZZB A;  2Q9Q B;  3NVV A;  1LKX A;  5LXT E;  4DV6 T;  1JWB D;  3R2T A;  2KDI A;  4DR6 T;  3I63 C;  5D3I B;  4IWP A;  4CN1 A;  2B76 A;  1I42 A;  4HWF A;  2JT4 B;  3ZNH B;  4YHH T;  3H8H A;  2BYF A;  2L00 B;  2MEK A;  5D2M B;  3Q8E A;  1B9R A;  4ISS A;  4QX8 B;  1WMH B;  1DU2 A;  2XK5 A;  1LVK A;  5HEG A;  1NDD A;  1D4B A;  3UUX B;  4IG7 B;  1WX7 A;  2KT7 A;  3RZW C;  2O2V B;  3T9L A;  1FMV A;  2CU3 A;  5LMN T;  3PT2 B;  4I0U A;  4MEL A;  4CHK A;  3EFU A;  1HX1 B;  1UUS A;  5HEU A;  1ZKH A;  4AJW A;  4H9Q C;  4GDL B;  4GOC A;  2LXA A;  2Y5P A;  3WAO A;  3Q5E A;  3Q8B A;  2ACZ A;  5AQI B;  2KOX A;  2PW9 A;  2Z59 B;  4F1S A;  4P1N A;  1ZPS A;  3HKC E;  2BVL A;  5C2T B;  1WR0 A;  3KBU A;  3N9M A;  5LJN A;  2EKE C;  2YLM A;  3W9C B;  4YFS A;  4YSY B;  2L0T A;  3K3O A;  2FCN A;  3K8P C;  1MHX A;  4O4J E;  1UWX A;  3TBL D;  5L4E A;  1SE3 A;  2EKI A;  1LM8 B;  3RNG C;  2GLS A;  1KFY B;  3ZGZ A;  5BMI A;  2I1J A;  4KV2 A;  3CQX C;  2WXJ A;  3W2D A;  4IDZ A;  1Q5W B;  2K5P A;  1W09 A;  2W55 A;  3V60 A;  3QUJ A;  5AQL B;  2E9X A;  2KQ7 A;  3I9V 1;  5I4D A;  2HTH A;  4G2A A;  5HFY A;  2PKO A;  4A6Q A;  3ESL A;  2MBG A;  2LWP A;  2C5K T;  1V2Y A;  1NVI D;  2XNA C;  4BKS A;  4MSQ B;  2KXP B;  3JAE A;  1N33 T;  5AQR B;  1SGH A;  3N3K B;  3RI7 C;  3BYY B;  2LGY A;  1JCK B;  2V4I B;  4OVU A;  4GOU A;  4LMK A;  4PJJ A;  1QOF A;  5IA7 A;  3LJ3 A;  2OJW A;  1MMD A;  2KC2 A;  1UX5 A;  4IDO A;  3C4X A;  3DHI C;  3JCF A;  2A72 A;  3VU7 H;  3E9S A;  3RN9 C;  1L5P A;  4FHK A;  3ZLZ A;  3ZYK A;  3EDU A;  2IW5 B;  5LJM A;  2K3W A;  5L4H A;  4UVB B;  2WZI A;  2QCZ A;  1IJ6 A;  4KGS A;  3T8O A;  4JX1 C;  3L0W B;  4DR3 T;  2LUE A;  3RYT A;  4BVU C;  3RPU A;  2Q9Q A;  2W3R A;  1FXT B;  4DBR A;  5DCN A;  2XAH B;  5JH7 E;  3SHQ A;  4I55 E;  4UF0 B;  3ZN0 B;  2I1K A;  2VZK B;  4LNK A;  3H7P B;  4IUM B;  4K0K T;  5JRC A;  3FZM B;  3T1H T;  2JWZ A;  5GMV A;  3A9J A;  4X5T A;  2BPS A;  3DDC B;  3Q5W A;  4BOZ B;  3I0Q A;  2LHR A;  4LJO B;  2EHO A;  2DAF A;  2BW2 A;  3KH0 A;  2CHO A;  2B76 B;  2KAC A;  3OJA A;  2WY2 A;  2L52 A;  2J52 A;  3FIL A;  4LF4 T;  2BWE S;  1OQQ A;  4BFR A;  3X23 A;  1SEB D;  3ZTD A;  2XQY A;  3RQU A;  4XDD A;  4CO7 A;  1E9M A;  3SDL C;  1CHU A;  2W62 A;  2CJN A;  5ABF A;  5IYZ E;  4W9G A;  2KKC A;  4LML A;  1G8X A;  1R4M B;  5AQS B;  5EK4 A;  1QLB A;  2WXK A;  1SBB B;  3FZL B;  4AQG A;  5BMH A;  4KIK B;  2W0G A;  5LGT B;  3HM3 A;  4FJZ A;  4ASK A;  4RCO A;  2BS2 B;  2NR4 A;  3NVY A;  3ZQ4 A;  2LLY A;  1RM6 C;  2WU5 B;  4PJN A;  5LBM A;  2J0J A;  4OFZ A;  3B9J A;  1DYQ A;  1XLO A;  4NPN A;  4GN1 A;  2NP9 A;  3ANW B;  2ZCB A;  3HUI A;  3IT6 B;  1KOT A;  3ZEF B;  1ZXI A;  5FY7 A;  1WIA A;  2RGF A;  4CXX A;  1YMH E;  2KMA A;  2DNF A;  4CXW A;  4U31 A;  1EU3 A;  3GA8 A;  3P1M A;  1C1Y B;  2RPQ A;  3ZMT B;  2BYT A;  4KIK A;  2VRR B;  1WXQ A;  2FUG 1;  4OVV A;  4IRE A;  3QAR A;  2XSB A;  3FBZ A;  3R84 B;  1VZ7 A;  1NI3 A;  4MGY E;  4DDI D;  3QB5 K;  2D5G A;  3V62 A;  4IDQ A;  2KAN A;  4BAX A;  5A1L A;  1FRD A;  1HG2 A;  1VD2 A;  4WBN E;  3DCG A;  1HQR D;  4G11 A;  3GE8 C;  1HTJ F;  1EZ3 A;  4FUL A;  5DAB A;  4AWJ A;  2K0P A;  4E71 A;  4KHZ F;  5FY1 A;  2W9N A;  3OTO T;  2K9X A;  2MBH A;  3AEF A;  4ZYN A;  4JIO U;  1AJ3 A;  2X9H A;  3AE4 B;  2WS3 B;  2KT9 A;  2J4G A;  2WU2 B;  4K3C A;  5C3J B;  1D1A A;  3B57 A;  1WGG A;  1IYF A;  1ENF A;  3GS2 A;  5G5H A;  3LYY A;  3VKG A;  4XAX B;  5AQM B;  1VZ6 A;  4PK5 A;  2ONQ A;  3DBR B;  4TWH A;  2ZVN A;  3ZMZ B;  4ANU A;  4YSY A;  3DPD A;  1N5X A;  1PGX A;  3T1Y T;  5CJ5 A;  2NPT A;  1WGK A;  4BAY B;  1FCC C;  4HGA A;  1TZO A;  5F5W A;  5BMG A;  2CWO A;  4YY3 T;  5FKA C;  3AE1 A;  1OTR B;  1LO5 D;  1ZOY A;  3KW5 B;  3I3T B;  3KWV A;  1PQS A;  3Q3O C;  1E7P B;  2LGS A;  2MP2 A;  2C7M B;  2PVO D;  4JI6 T;  2W82 A;  1WYC A;  2WDQ A;  4OYJ A;  4FLH A;  2PE6 B;  2N7D A;  2WWU A;  2GRI A;  3LDZ E;  1VJK A;  4AKG A;  2SPC A;  2N1V A;  3JVZ X;  3NUH B;  1ZKE A;  2MJ3 A;  2QHO A;  4ZHQ E;  2GI9 A;  4N58 A;  3NOB A;  1L0V B;  3I57 A;  3CIR A;  4CN6 A;  3ONL C;  4Q25 A;  2EMS A;  2BVM A;  3CWI A;  4LFB T;  1BR1 A;  4NPP A;  2ZZP B;  2IND C;  2UYZ B;  3E22 E;  4YJ2 E;  3ZT6 A;  3U30 A;  4DVD A;  3PUQ A;  3RKO A;  5HXH A;  2XQ4 A;  1E7V A;  4KKJ A;  1NEK A;  5KXJ A;  3CSF A;  2KWI B;  1V6E A;  3AE8 B;  4DXG A;  2C5J A;  1MMA A;  5FVL A;  2FJE A;  1UX4 A;  2KDB A;  1E7U A;  3A9K A;  2QIL A;  3AED A;  4RGT A;  1SIJ A;  2KMC A;  4DHZ B;  3VKH A;  3LXF A;  2YEP B;  3H3A A;  5FR6 A;  4HVB A;  4YTM A;  3O1H A;  2FBW B;  3BWU D;  4QWN B;  4O4L E;  3NS8 A;  2L8J A;  4YSX A;  3LK2 B;  2LM9 A;  5JVD E;  1QOG A;  2NBV B;  2DZI A;  2JIW A;  4IL4 A;  1NI2 A;  1I6Z A;  2VKO A;  2WXL A;  5J2U E;  3PV0 F;  1IGD A;  3RNB C;  3EC8 A;  3NZU A;  2BKN A;  5HXE A;  2AX5 A;  3N1Z C;  3ONS A;  2BT6 A;  1ZP0 B;  3UUL A;  2BB5 A;  4II3 B;  4RF0 A;  2NWB A;  1VR9 A;  1YQB A;  2OV9 A;  3O1I A;  4JUY A;  1TGZ B;  5AQH B;  2LVP A;  4YTM B;  5JDL A;  2D0T A;  1ESF A;  4KZC A;  2KND A;  3PDY A;  4MT5 A;  4GIW A;  4ILB A;  4WW0 A;  3A9K B;  3CQG B;  1XMO T;  2NTX A;  1W0A A;  5EE9 A;  2PVG C;  4IM3 A;  1WLX A;  1V9D A;  2LSI A;  2N1G A;  2PTF A;  3PU8 A;  2E9X B;  2KTF A;  1NYR A;  4Z90 A;  4WQM A;  5LGN B;  2VB6 A;  2INC C;  1Z0P A;  2CCQ A;  4GKK T;  1WJU A;  1IZN B;  5BMV E;  1WM2 A;  4ANX A;  1AN8 A;  1WGY A;  1MND A;  1E90 A;  2ES0 A;  2G45 B;  2BG9 E;  4K0U A;  1OEY J;  2KAJ A;  3MAC A;  4HPL B;  4KX6 A;  4W9C A;  1HR0 T;  3W15 B;  4IE0 A;  2L0F A;  4RMA A;  4LF5 T;  2JYE A;  2M1M A;  4IWQ A;  1FJG T;  2LAS A;  3L09 A;  4QKN A;  2PJQ A;  3PRE A;  1VLB A;  2IO2 B;  4EV6 A;  1S1Q B;  2K1F A;  2RR9 A;  1N6Z A;  1SSN A;  3CF6 E;  3VH3 B;  3HHM A;  4LF8 T;  3R66 C;  2V5D A;  4DV7 T;  2CXD A;  1WM3 A;  4ZZC A;  1HG5 A;  3FZH B;  4HFC A;  4KI0 F;  1J7A A;  1WYW B;  4IE7 A;  4LCD E;  1IUE A;  1V8C A;  4K7W A;  3N9L A;  5E6J A;  1WGD A;  2UXN B;  1FNU A;  2JQ9 A;  3U78 A;  3QWZ B;  3HKB E;  1UGO A;  2XN9 C;  4MBQ A;  4WWN A;  3K3N A;  2K48 A;  4CI1 B;  2IY1 B;  3EHV A;  3PUY F;  1WJ4 A;  3KV9 A;  3MJW A;  3TEW A;  2DHZ A;  3KUZ A;  2KLG A;  3AE8 A;  1V9J A;  2D5U A;  4YSX B;  2I6H A;  2WYQ A;  4YHJ A;  3AAI A;  1J7B A;  3PE0 A;  1C4C A;  1HNZ T;  1AAR A;  2K8H A;  2MWS B;  3APF A;  4DHJ D;  1XCQ L;  1FRR A;  1IBX B;  4PW8 A;  5LNK 1;  1V1P B;  2UXD T;  1VZ8 A;  2XK5 B;  3UU6 A;  5TR5 A;  3Q2M A;  1DGJ A;  2KQ4 X;  1C4P A;  1UEL A;  3UIP B;  5HXC A;  3M3Z B;  2IHR 1;  2B1E A;  4YWG G;  3DHH C;  1TJE A;  2CS4 A;  4NY0 A;  4NJ7 A;  1SHZ C;  2LVQ A;  1YN4 A;  1T0Y A;  4U7I A;  1CUN A;  2VKJ A;  1JWM D;  3QK6 A;  1QT9 A;  2H88 A;  2NBU A;  5JTG A;  2OOB B;  2V1D B;  2PG8 A;  1QQR A;  4XWW A;  3KQ4 A;  3RZF A;  2G1E A;  2HTM E;  3R3M A;  3RIU C;  3OKQ A;  2JVC A;  3RIA A;  4WUR A;  2ZCC A;  3ML9 A;  2DX5 B;  3SFD A;  4QXC B;  1J7C A;  2W4X A;  1WI0 A;  2HJ8 A;  2G4D B;  2WDR A;  2LGD A;  4GDK B;  4UV8 B;  4WIP A;  2MBO A;  4HFE A;  5AQK B;  4NQL B;  4P6V F;  1NEK B;  3TLS A;  2JZP A;  1QUU A;  2LGX A;  3LSV A;  2BGF A;  2OA5 A;  4B0M A;  5H6Q B;  1UNS A;  2IO1 B;  3F2E A;  5EZY E;  3JC6 D;  2FJD A;  2LKG A;  3ZJT A;  1UF0 A;  3PRM B;  4M1P A;  4B3M T;  2V5C A;  1WJ6 A;  3AB5 A;  4KP3 C;  5D3D A;  1OWA A;  3U7Z A;  5EK3 A;  4P0A A;  4I6P A;  3ZYL A;  1TZ1 A;  4ZRJ A;  3APC A;  3N9N A;  1L2N A;  3V5U A;  4GIV A;  2FCM A;  1J0G A;  2O6V D;  3VR8 B;  2R6G F;  3UI3 A;  2YDS A;  1KLG D;  4DV2 T;  3FHN A;  1HX8 A;  3UU5 A;  2H7V C;  3AEC A;  4IHJ E;  2ZPN A;  4QX7 B;  1YD8 G;  2WDR B;  2MH7 A;  3MJ5 A;  3DBL B;  2V7J A;  4ZI2 D;  1Q0W B;  2JQK A;  1WZ0 A;  1PUT A;  2V9H A;  5DPT A;  4KKI A;  5KHO A;  4DR1 T;  4W9I A;  1LGR A;  3RFZ B;  4G0N B;  1WXV A;  3ZJ2 A;  2BTE A;  4QH4 A;  3ZNI D;  1JQ4 A;  2JSV X;  3H37 A;  5AZG A;  2YN6 A;  4KSL C;  3X1D A;  3R2I A;  3MC8 A;  3TEY A;  3NVZ A;  5HXS A;  1MG8 A;  1WH3 A;  2KWH A;  3OBV E;  1AW7 A;  1WFY A;  3A1Q B;  3KLS X;  3V3X A;  3TL5 A;  3VRB A;  3N1X C;  3RKG A; 
#chains in the Genus database with same CATH homology
 2N9P C;  3PRZ A;  2JXX A;  3IVF A;  1G6J A;  3APD A;  1GG3 A;  3PPA A;  3TBL D;  1WXM A;  2BYE A;  2CHW A;  1LM8 B;  2JRH A;  2KVR A;  1QZE A;  4GXB A;  4HWD A;  4TQ0 A;  2I1J A;  4KV2 A;  1Q5W B;  4JGH B;  4M0W B;  5L83 A;  4KDL B;  3V60 A;  1YD8 U;  2MP2 B;  4F7Z A;  2KWC A;  1V86 A;  5AQL B;  2KQ7 A;  1Y8R C;  4HCP B;  2HTH A;  2BWF A;  2A4Z A;  4GSW A;  2LWP A;  3FZF B;  5D94 A;  1V2Y A;  5LLI A;  1BT0 A;  4KSK C;  4MSQ B;  4BKS A;  4B95 A;  1R4M I;  2LVO A;  4MJS B;  5AQO B;  3A9J B;  5AQR B;  2KN5 A;  3V6C B;  1SGH A;  3VTU A;  2GOW A;  3N3K B;  4HCN B;  1RFA A;  2LGY A;  4OVU A;  4XZ4 A;  5CX3 A;  2D10 A;  1WRD B;  3QCA A;  1M7K A;  4HLE A;  3IG3 A;  5AQV B;  5IA7 A;  3LJ3 A;  2V1Y A;  2KC2 A;  4MSM B;  4GU2 A;  5E6N A;  3V61 A;  3MTN B;  4PS7 A;  1A5R A;  4FHK A;  3ZLZ A;  3QC8 B;  1TBE A;  2K39 A;  1UZX B;  2KWV B;  4WAA A;  1RAX A;  1K8R B;  5AQF B;  3AU4 A;  4M8N A;  4BBN C;  2MQJ A;  1WGR A;  3L0W B;  2FAZ A;  4IW0 A;  2LUE A;  3AI5 A;  3RYT A;  4BVU C;  3K9P B;  1YX6 B;  1FXT B;  2IO3 B;  4FHJ A;  2FCQ A;  5DCN A;  1V5T A;  4KDI C;  2BYV E;  3L54 A;  2MCN B;  3SHQ A;  4K7S A;  4M8M A;  2KFK A;  2I1K A;  3DVG Y;  1YX5 B;  2LRU A;  3H7P B;  2N1W A;  2O6V A;  4IUM B;  4W9E A;  3U7D A;  1IP9 A;  4KVG B;  3FZM B;  5AQN B;  2JWZ A;  5GMV A;  1WGH A;  2BPS A;  3A9J A;  3DDC B;  4BOZ B;  5KHQ A;  4LJO B;  2DAF A;  2LJ5 A;  4URK A;  3B1L X;  3K9O B;  2FNJ B;  3AU5 A;  3KH0 A;  4JL9 A;  4LDT D;  1L7Y A;  3A4R A;  2BWE S;  4LDT B;  3Q3F A;  1EF1 A;  4DWF A;  4FN2 A;  2LRW A;  3X23 A;  1ZW7 A;  4BFR A;  1UK5 A;  3ZTD A;  4CO7 A;  2N4F A;  5DPR A;  4II2 B;  3SDL C;  4BKT A;  2KXJ A;  5JHB A;  2K6D B;  3N32 A;  3PSE B;  1JRU A;  1KLV A;  4W9G A;  2KKC A;  1H4R A;  2IO0 B;  5AQS B;  4WJP A;  1V81 A;  3VFK A;  2IZV B;  4FBJ B;  3FZL B;  4BOS C;  2DYM A;  2B3A A;  1XT9 B;  2K6Q A;  2LI5 A;  3AUL A;  4G50 A;  3HM3 A;  4FJZ A;  4KIK B;  3VH4 B;  3UQA A;  5G55 A;  3UQB A;  2MA9 B;  4JQW C;  1J19 A;  4EZJ A;  3LDQ B;  2NCN A;  4GB9 A;  4AJY B;  2J0J A;  2KC1 A;  3NHE B;  1E8Y A;  4B6W A;  2WWZ A;  1P9D U;  4NPN A;  2REX A;  2L3Z A;  4GN1 A;  5J18 A;  2ZCB A;  2AWT A;  4MH0 E;  1P3Q U;  5AQQ B;  5JZE B;  4IC7 B;  3JSV A;  3EEC A;  2L05 A;  3HK0 A;  3TIX A;  5LXI B;  1XD3 B;  3RUL A;  1WIA A;  1KJT A;  5AQU B;  2RGF A;  3ZO5 B;  4A20 A;  2MW5 A;  2KMA A;  1X1M A;  2J7Q B;  3A8Y C;  3ZDT A;  5CHW A;  1C1Y B;  2RPQ A;  4TKN A;  3ML8 A;  2D11 A;  4KIK A;  2N7E A;  2JPH A;  2VRR B;  3H9D A;  1LQB A;  3RT3 B;  2J0K A;  4MM3 A;  3KUC B;  2JF5 A;  4OVV A;  3QAR A;  2DEN B;  3NZS A;  3KYD D;  5EDS A;  1OQY A;  5JH5 C;  4MGY E;  4DDI D;  5CHF A;  2C7N B;  3O65 B;  2NPT B;  3V62 A;  2K25 A;  2KAN A;  3QA8 A;  5IAA C;  3H6N A;  1VD2 A;  5AEK B;  2D9D A;  2R2O A;  3DCG A;  2MBB B;  2KTR A;  3QX1 A;  2V4L A;  4G11 A;  4I6N B;  2AL6 A;  3JYU A;  4BKG A;  2WX1 A;  3M95 A;  5D6J B;  2D2Q A;  3M62 B;  4FUL A;  3VUX A;  4EZK A;  3DVG X;  4AWJ A;  4E71 A;  4HK2 A;  2W9N A;  2MBH A;  2GMI C;  4N9F 4;  4FAD A;  2M8S A;  1F9J A;  4ZYN A;  4GDL A;  4JIO U;  3WAL A;  3B08 A;  3NY5 A;  4HDQ A;  5CHV C;  2M17 A;  3GOE A;  3M3J A;  1WGG A;  3QJZ A;  1IYF A;  3DBR I;  3IBE A;  2Z0E B;  1GNU A;  2NVU I;  5AQM B;  2KFK B;  2N9E B;  2HD5 B;  3C0R B;  3DVN U;  2ZVN A;  2R2Q A;  4WJN A;  3VHT C;  4ANU A;  2OJR A;  3ENE A;  3DPD A;  3SU8 X;  2NPT A;  2CKH B;  4BBN F;  2JY6 A;  3KUD B;  1GJZ A;  1UGM A;  2GBJ A;  3OJ3 A;  2KZR A;  2D07 B;  1OTR B;  2JZZ A;  2XEW A;  3H1U A;  3KW5 B;  3I3T B;  3ZW3 A;  4W9J A;  2M4N A;  2V3S A;  1PQS A;  4MEM A;  4AP4 C;  2XBB C;  4I6L B;  3UGB B;  2GBN A;  1NBF C;  2MSE D;  4W9L A;  2MP2 A;  2C7M B;  4W9K A;  1YIW A;  3HM6 X;  3N30 A;  3BY4 B;  4WQO B;  2CHZ A;  4E3C A;  2N9X A;  3DOW A;  4FLH A;  2PE6 B;  3L08 A;  2N7D A;  3LDZ E;  4MDK E;  4A3P A;  2MBQ A;  2N1V A;  1E5W A;  2JRI B;  3HIZ A;  3JVZ X;  3M63 B;  4PS3 A;  3WAP A;  3ZTC A;  5C1Z A;  2QHO A;  4W9F A;  1WE6 A;  2MRP A;  4FJY A;  4BKS D;  3NOB A;  4EOY A;  4PS8 A;  2G4S A;  3VXW A;  5G2N A;  2EMS A;  2ZZP B;  2L76 A;  2UYZ B;  3ZNG C;  1KOT A;  3A1Q A;  3VUW A;  3U30 A;  3P2B A;  5C23 A;  1GUA B;  1E7V A;  1OEY A;  2CHX A;  4ICV A;  1E8X A;  3VTW A;  2GBM A;  3A33 B;  3CSF A;  3WIM A;  1V6E A;  4EFO A;  3PV1 A;  3A9K A;  2BF8 B;  2KDB A;  2NS5 A;  1E7U A;  4JLC A;  3TCA A;  3CMM B;  1WR1 A;  1WXA A;  3W1S A;  2KMC A;  4DHZ B;  5FR6 A;  4HVB A;  5AQJ B;  4GDK A;  3PZD A;  3ZNZ B;  1ZGU B;  2L7R A;  2L8J A;  3NS8 A;  4IM2 A;  2KX0 A;  3QIJ A;  2CU1 A;  2NBV B;  2DZI A;  3VUY A;  4DXA B;  2O6V B;  3QHT A;  1NI2 A;  3L13 A;  1I6Z A;  1UBI A;  4X57 B;  1XQQ A;  3W1S C;  3DBL I;  1H8C A;  3PS6 A;  2WDT B;  3EC8 A;  2C5L C;  3B0A A;  3NZU A;  3QAQ A;  2IYD B;  4J6I A;  1P98 A;  2ASQ A;  1WMH A;  2K8B A;  3GZN I;  4B9K A;  3ONS A;  3W1Y A;  4II3 B;  1P0R A;  1YQB A;  2A5U A;  2C60 A;  4CYE A;  2DZM A;  4MGZ E;  2PJH A;  1TGZ B;  5AQH B;  1OGW A;  2K8C A;  2LVP A;  3ALB A;  4IM0 A;  4EEW A;  4HWH A;  4KZC A;  4WWP A;  4F8C B;  3JSV B;  2HE7 A;  3QQ8 B;  2C9W B;  5L95 C;  2KNB A;  2ZJD A;  3A9K B;  3L16 A;  4XX5 A;  2ZPY A;  3PGE A;  2CR5 A;  4IM3 A;  4HXD A;  2KDE B;  4ANV A;  1ISN A;  3A4S C;  1SE9 A;  2KTF A;  3T8M A;  4ZDV A;  2KJH B;  3KYC D;  4NJ6 A;  1WJU A;  3BIN A;  2JUO A;  4EUT A;  4LJP B;  4EKU A;  1WM2 A;  1Q1O A;  2AL3 A;  4ANX A;  1WGY A;  2NR2 A;  4RM9 A;  1E90 A;  2KDF B;  3PTF C;  4HPM B;  1SIF A;  4NAW B;  3VAW A;  3ZVV A;  1WR6 E;  3AXC A;  2G45 B;  2WX0 A;  3L10 B;  2KFJ A;  1OEY J;  1Z2M A;  5LXH A;  1V5O A;  4HPL B;  1WZ3 A;  4W9C A;  4PYZ A;  3PRP B;  4HJK A;  3U8Z A;  1M62 A;  1LFD A;  4DDG D;  3ZUN A;  2L0F A;  4RMA A;  3OAW A;  4ASW C;  2M1M A;  4IWQ A;  3WAN A;  3TJP A;  2BKR B;  2LAS A;  2PE9 A;  3PRE A;  1UH6 A;  4E74 A;  3VTV A;  5AQP B;  2IO2 B;  1S1Q B;  2Y5B B;  4AOF A;  2K1F A;  2RR9 A;  2IBI B;  2KJ6 A;  4HWC A;  1GC6 A;  1V80 A;  2DAJ A;  3CF6 E;  1GC7 A;  3Q3J A;  5AZH A;  3HHM A;  3R7R A;  3VH3 B;  3R66 C;  4A3O A;  5J2R A;  1WM3 A;  4IWO A;  3FZH B;  2RSU A;  3WAM A;  1VCB A;  1E8W A;  1WYW B;  3OJ4 B;  3OLM D;  4K7U A;  4TUU A;  3WA0 A;  3JW0 X;  4LCD E;  4K7W A;  4RM8 A;  4WWO A;  3UIN B;  1WGD A;  2DYO A;  2PPH A;  3QWZ B;  1UBQ A;  1UGO A;  1EUV B;  3PHW B;  4WWN A;  2RD0 A;  3ZIM A;  4WJO A;  2G3Q B;  2IY1 B;  3EHV A;  3DBH I;  1WF9 A;  3KVF B;  4W9H A;  4ZRI A;  1WJ4 A;  2ZNV C;  3MJW A;  4P7I A;  3ZRC A;  2DHZ A;  1J8C A;  3CST A;  3KUZ A;  3MHS D;  4DK5 A;  2KLG A;  1T7S A;  1V9J A;  2MBE A;  1EF5 A;  2PEA A;  3S2A A;  1E8Z A;  2WYQ A;  4PYU A;  1KM7 A;  4DHZ E;  1WXS A;  3PVL A;  4TV3 A;  1AAR A;  2K8H A;  3APF A;  2MWS B;  5BO4 B;  3VDZ A;  2DZJ A;  4HDO A;  4MGI E;  3RUI B;  4DHJ D;  4DHJ B;  1UD7 A;  2FUH B;  1EO6 A;  4WJQ A;  5DPS A;  4TQ1 A;  2XK5 B;  1IPG A;  1WJN A;  2KQS A;  3H7S A;  5TR5 A;  5J17 A;  5JHA A;  4ICU A;  4KZ0 A;  3ZRF A;  1UEL A;  3UIP B;  4EZL A;  3M3Z B;  1D3Z A;  4HWI B;  4W9D A;  2EMT A;  2DYB A;  3ZDM C;  2CS4 A;  5D7G A;  4NY0 A;  1P1A A;  4NJ7 A;  4FA6 A;  2DZK A;  4NNJ B;  2C7H A;  5DPW A;  5E6O A;  2LVQ A;  2FIF A;  1M94 A;  1T0Y A;  2FID A;  3FZK B;  5AQG B;  2IY0 B;  2GBR A;  3PHX B;  2MX2 A;  2NBU A;  2OOB B;  3R7Q A;  2JZ3 B;  2KWU B;  1C3T A;  4YL8 A;  1I35 A;  4G3X B;  3RZF A;  4AUQ C;  2D3G A;  1WX9 A;  3D32 A;  2AEH A;  4GGQ A;  4XC2 A;  3R3M A;  2FCS A;  2JVC A;  2LD9 A;  3RCZ A;  2ZCC A;  2ZVO A;  3ML9 A;  2DX5 B;  2UWQ A;  1R4N I;  2BKF A;  1WI0 A;  3RD2 A;  2HJ8 A;  2G4D B;  2LGD A;  4GDK B;  2MBO A;  5AQK B;  4NQL B;  3X0W A;  4GMV A;  1WX8 A;  2LGX A;  2BGF A;  1LXD A;  2KK8 A;  2AYO B;  2M0X A;  2IO1 B;  3DVN V;  4DBG A;  3DBS A;  3L17 A;  5HKH A;  2KTR B;  3VVW B;  2GBK A;  1WY8 A;  1Z5S B;  5E6P A;  3PRM B;  2LXC A;  1WJ6 A;  2KD0 A;  3UIO B;  3DQV A;  2O2V A;  2Z0D B;  1RLF A;  3ZKJ C;  3V6E B;  4I6P A;  1HE8 A;  3IHP C;  4MGK E;  1TZ1 A;  4ZRJ A;  1CMX B;  2NBW B;  3APC A;  4MJS A;  1L2N A;  2ZNV B;  4GIV A;  2FCM A;  2YVC A;  1J0G A;  2O6V D;  2KDI A;  5CTR C;  1YJ1 A;  2KO3 A;  4NQK E;  3SD5 A;  3ECI A;  4IWP A;  2KHW B;  2ZEQ A;  2ZPN A;  1I42 A;  5AQT B;  4HWF A;  2JT4 B;  3TMP B;  3ZNH B;  2BYF A;  1U4A A;  2L00 B;  5D2M B;  1V49 A;  1Q0W B;  1WMH B;  2XK5 A;  1WZ0 A;  3PLU A;  2KLC A;  1NDD A;  2KX3 A;  3PLV A;  5DPT A;  3IFW B;  3UF8 A;  5KHO A;  4IG7 B;  1WX7 A;  3QK0 A;  4W9I A;  3RZW C;  2O2V B;  4G0N B;  4K81 A;  1WXV A;  3T9L A;  3PT2 B;  4MEL A;  4ZRK A;  4CHK A;  3EFU A;  1HX1 B;  1WE7 A;  2J0M A;  1ZKH A;  3ZNI D;  4AJW A;  4GDL B;  2KJR A;  4GOC A;  2LXA A;  3WAO A;  1RRB A;  2MLB A;  2LZ6 A;  5AQI B;  3VQI A;  1S3S G;  2KOX A;  3H7P A;  2Z59 B;  4KSL C;  5AZG A;  4K1R B;  4F1S A;  1TTN A;  5AZF A;  4FJV B;  1MG8 A;  1WH3 A;  2EKE C;  1WFY A;  2YLM A;  3A1Q B;  4NAW A;  3TL5 A;  4ANW A;  2L0T A;  2FCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...