4HWIB

Crystal structure of atbag1 in complex with hsp70
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
177
structure length
177
Chain Sequence
MIRVRIKYGAVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
molecule keywords Heat shock cognate 71 kDa protein
total genus 66
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwiB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hwiB01
3JW0X 2O2VB 5D2MB 4IWQA 4IUMB 2N7DA 4KIKA 4RMAA 5AQPB 4MEMA 4XZ4A 2KXJA 3PV1A 4WWOA 5IAAC 4NJ6A 1SIFA 2O2VA 3HIZA 3R7QA 5AQRB 2IO3B 2KQ7A 3QWZB 1YX5B 1LXDA 4EZJA 2RSUA 2KC1A 2MP2A 2IO0B 3QX1A 4BKSD 2ASQA 3AXCA 3N32A 4FLHA 1WGGA 4G0NB 4HXDA 4KSLC 5DPRA 2AWTA 1E7UA 3W1SA 4ANVA 4G3XB 3ZTDA 3IFWB 4F1SA 1GNUA 1ZGUB 2XK5B 4HVBA 2J0KA 5AQSB 1V6EA 2WX0A 1Q1OA 3B0AA 1VCBA 4HWDA 1XQQA 3X0WA 1YX6B 2L0FA 2GMIC 3ENEA 3M3JA 2JUOA 1L2NA 5EDSA 3AU4A 3ZW3A 2BYEA 4DHJD 2KKCA 2L0TA 2D10A 2MRPA 4HJKA 4P7IA 2L00B 1A5RA 5E6OA 1V2YA 1S1QB 2FNJB 1V49A 4FULA 3A9JB 3L08A 3L54A 4ICUA 3DBHI 4MGYE 4NQLB 1J0GA 3QAQA 1JRUA 2LRUA 4EUTA 4DK5A 3S2AA 3DBSA 4MGKE 3O65B 2D07B 3A1QA 1LQBA 2EKEC 4ZRJA 4AWJA 3OJ3A 2LJ5A 3GOEA 1J8CA 5AQKB 2BF8B 2WYQA 2ZJDA 2IO1B 4KZCA 3ZNID 3K9PB 4K7WA 1WMHB 2O6VA 4II2B 2CR5A 2MLBA 2D2QA 2JZ3B 4IM0A 3X23A 3EECA 4TKNA 3HHMA 5AQVB 2BGFA 3U8ZA 2FCMA 2GBMA 1GG3A 3KUZA 5AZHA 3M62B 4FJYA 3M95A 4BOZB 5LXIB 2IY1B 3CMMB 4ANWA 3JSVB 3ZTCA 4KV2A 2GBNA 3A1QB 2NVUI 4PS3A 4PYUA 3UIOB 5JHAA 1IP9A 5JHBA 4K7SA 2M8SA 2K6QA 3JSVA 4DWFA 1EF5A 2JRHA 2MP2B 2WX1A 1ZKHA 1WMHA 2O6VB 2KLGA 3NY5A 4ZYNA 1G6JA 1UH6A 2KJHB 2CS4A 3SHQA 1BT0A 1WM2A 5KHQA 1D3ZA 1GJZA 2N1VA 3A9KA 3VQIA 1UBQA 2KN5A 5AQJB 3AI5A 4ASWC 3KVFB 4I6LB 2GBJA 4GDKB 1C3TA 5GMVA 2C7MB 2KTRA 2MBQA 3D32A 3ZRCA 4LCDE 2W9NA 4KSKC 2IY0B 4WJNA 3TJPA 4E74A 3ML8A 4GXBA 3RUIB 4M8MA 2MBHA 2G4SA 2G3QB 1K8RB 2KK8A 4K81A 2FIFA 5J2RA 1M94A 3CF6E 3SDLC 5AZFA 3SD5A 4XC2A 5CX3A 4DHZB 4KDIC 1M7KA 1WFYA 4IWOA 3NZUA 2IZVB 3QHTA 3L16A 1WF9A 3QARA 2LWPA 1KM7A 5HKHA 2M0XA 2KTRB 4ANUA 1TZ1A 3M3ZB 4HCPB 1IYFA 1QZEA 4JLCA 4B9KA 1T0YA 3U7DA 1FXTB 2PPHA 3HM6X 2DYBA 3A4SC 3IG3A 5LXHA 1HX1B 1E8ZA 3BINA 1Z2MA 4BOSC 2JY6A 3ZDTA 3M63B 4G11A 5TR5A 1M62A 2L8JA 2ZNVC 3I3TB 4WWPA 4BKGA 3DOWA 1Q5WB 4LDTD 1WXAA 4MSMB 3RCZA 3PRMB 4GSWA 4DBGA 4BKSA 3EFUA 4AJYB 2LRWA 5DPTA 2CHWA 2KO3A 2FIDA 2DAJA 3IBEA 3VUXA 3IVFA 4HPMB 3RD2A 2AL6A 1V86A 5C1ZA 1SGHA 1GUAB 2DYMA 2AEHA 3RZFA 2WWZA 5AQIB 1TTNA 3B1LX 3VTWA 5J18A 1UGMA 1UGOA 3UQBA 4ANXA 2M4NA 3V61A 5G2NA 2V3SA 2KWVB 1V81A 3HK0A 4K7UA 3L10B 3ZNHB 3N30A 4JQWC 2KD0A 1P3QU 3WA0A 5L95C 1NI2A 1LM8B 2LXAA 3QA8A 3FZKB 2ZEQA 3PVLA 4FN2A 1I42A 2KFJA 3PZDA 3QJZA 1I6ZA 3U30A 2R2OA 2Y5BB 2BPSA 2Z59B 2V4LA 2DENB 3H6NA 4KDLB 3QIJA 3QQ8B 1TGZB 1PQSA 2MSED 3QCAA 4W9JA 2NBUA 3ZVVA 4KVGB 2LI5A 1WE6A 2IBIB 4MJSB 2AYOB 2GOWA 4PYZA 1MG8A 3VVWB 2KANA 3UIPB 3W1SC 2C7HA 2D11A 2KOXA 4I6NB 2DHZA 4M8NA 3KUCB 3WIMA 2RGFA 3HM3A 4MJSA 2I1KA 2JVCA 2BKRB 2KFKB 2MW5A 4RM9A 1S3SG 3KW5B 4GGQA 2CHXA 4HWFA 2KWCA 2CU1A 2N7EA 2KHWB 2UYZB 3C0RB 4LDTB 2NS5A 2C9WB 2ZNVB 4F7ZA 3RULA 2HD5B 4EOYA 3MJWA 3VH3B 3B08A 3PHWB 2LVPA 2LUEA 3DVGX 1WXVA 1WRDB 1RFAA 1E90A 2CKHB 3NS8A 3PPAA 3UQAA 4EZLA 2GBRA 3FZFB 5AEKB 2FUHB 2K8BA 2MX2A 4ICVA 4BBNC 3APFA 4GU2A 4HWHA 1P9DU 4A3OA 4W9FA 5AQNB 1OEYJ 3VFKA 3VHTC 1YIWA 2KDEB 4GIVA 1AARA 1YJ1A 1Q0WB 1WR1A 1WXMA 3MHSD 1V9JA 2A4ZA 1EF1A 4DDGD 4FJVB 2Z0DB 1E8XA 3P2BA 4EZKA 5CHFA 3RT3B 2LGYA 2C60A 3PHXB 4G50A 2DZKA 2DZJA 4KIKB 5AQUB 2BYFA 2ZPNA 3Q3JA 2KDBA 3OAWA 4LJPB 4TUUA 3JYUA 2NPTA 3ZUNA 2KTFA 2K25A 3KYCD 4GMVA 1WXSA 3KUDB 3EHVA 3VDZA 2CHZA 2V1YA 4NAWA 1KLVA 1UBIA 2KWUB 2MWSB 4WQOB 2EMSA 3TIXA 2JF5A 5KHOA 1V5OA 4FHJA 3RZWC 2NPTB 3K9OB 1WX7A 2FCQA 3WAPA 1KJTA 4IM2A 5AZGA 2FCNA 2K8CA 3QC8B 3WALA 4WWNA 2REXA 4NAWB 1WYWB 2XBBC 4F8CB 1UK5A 4WJQA 1OQYA 1E5WA 1R4MI 3A9JA 5C23A 2AL3A 4II3B 1WJ4A 2PE9A 4HDQA 2EMTA 4TQ1A 5L83A 4W9EA 3GZNI 5AQGB 2JPHA 2KDFB 3JVZX 3PT2B 3TMPB 4JGHB 4WAAA 2FCSA 2J7QB 1H4RA 4AJWA 2BWFA 4FJZA 4W9HA 3L0WB 1V5TA 4B95A 4B6WA 1YQBA 2GBKA 2OJRA 1VD2A 4JL9A 4W9GA 1E7VA 1WH3A 2IYDB 3EC8A 3UGBB 3V6CB 4GB9A 4DHZE 4GOCA 5AQTB 2C5LC 3DBRI 1E8YA 3FZHB 5D6JB 3ZKJC 1EUVB 1WIAA 3IHPC 2J0MA 4WJOA 5CTRC 2MBEA 1WZ0A 4N9F4 3H1UA 3CSFA 4BVUC 2O6VD 4AP4C 2RR9A 4DHJB 2N9XA 2NBVB 3ZLZA 2N9PC 4JIOU 2KMAA 3H7SA 3APCA 4MDKE 3L17A 4HCNB 3ZRFA 1WGHA 3N3KB 2HE7A 2ZVOA 3PLUA 2LGXA 2PE6B 3TCAA 3PTFC 2YVCA 1WE7A 2JZZA 3DVGY 1C1YB 3VTVA 3BY4B 1P98A 4K1RB 4MGIE 1UD7A 4CHKA 1L7YA 4YL8A 5CHWA 1OEYA 4MGZE 2OOBB 2C7NB 2BYVE 1XD3B 2MA9B 3DVNV 4W9KA 5DPWA 2LXCA 1WJ6A 5AQOB 3UF8A 1U4AA 3WANA 2LVOA 4EEWA 1ISNA 1RAXA 2IO2B 2HTHA 4HDOA 5CHVC 5LLIA 3VH4B 4BKTA 3FZLB 2JT4B 2DAFA 3KH0A 2KMCA 4WJPA 3H9DA 4MELA 3PSEB 3A33B 1WX9A 3DQVA 2HJ8A 1LFDA 3LDZE 4X57B 3T8MA 3T9LA 1WR6E 2L3ZA 2DX5B 2MQJA 2KZRA 2LZ6A 4FHKA 4W9LA 2KJ6A 4E3CA 3ML9A 2K39A 2KNBA 3VAWA 4KZ0A 2N9EB 3UINB 5AQFB 2JWZA 2KVRA 1GC7A 1SE9A 5FR6A 2JRIB 3TL5A 2UWQA 4DDID 1Y8RC 2MBOA 1RRBA 4IG7B 2D9DA 4W9IA 1WGRA 4A3PA 4FADA 3V60A 3ALBA 1WI0A 3W1YA 2KX3A 2LGDA 3OJ4B 5IA7A 1OGWA 3PGEA 4MH0E 2R2QA 4HK2A 4FA6A 2A5UA 4CO7A 4BBNF 2K8HA 2ZPYA 2N1WA 2I1JA 3ONSA 4RM8A 4HWCA 1P1AA 4PS7A 2XEWA 3PLVA 5G55A 4IM3A 1WY8A 2K1FA 1J19A 1NDDA 3Q3FA 2B3AA 1TBEA 1E8WA 1XT9B 1F9JA 2M1MA 2YLMA 3ZNGC 2MCNB 5JH5C 3VXWA 4GDLA 4FBJB 1X1MA 5DCNA 2DZMA 1WM3A 4MSQB 3V62A 3ZIMA 4URKA 3LJ3A 3AULA 1WJNA 4DXAB 1RLFA 2Z0EB 4IC7B 2ZVNA 3H7PB 1WX8A 2L7RA 3PRZA 2NCNA 4E71A 1NBFC 5AQHB 1WJUA 1GC6A 2VRRB 3DPDA 1V80A 1YD8U 3VTUA 1OTRB 3A9KB 3PREA 5AQLB 4TQ0A 5AQMB 1HE8A 2FAZA 4EKUA 2ZZPB 2KLCA 1UELA 2D3GA 3FZMB 4W9DA 2ZCCA 3WAMA 4GDKA 3NHEB 3DBLI 1R4NI 1WGYA 3PS6A 2DYOA 3R7RA 1KOTA 5AQQB 2KFKA 3DDCB 4W9CA 5DPSA 2KC2A 5D7GA 3RYTA 2KQSA 3DCGA 4NPNA 2BWES 4M0WB 4NY0A 4OVVA 5BO4B 4NJ7A 5E6NA 1CMXB 4AUQC 4MM3A 2M17A 2LVQA 3LDQB 1P0RA 2MBBB 3DVNU 2K6DB 4AOFA 3APDA 2RPQA 4I6PA 3PRPB 1IPGA 2PJHA 2KJRA 1T7SA 4NNJB 4HWIB 5D94A 3NOBA 3ZNZB 2RD0A 2L76A 2ZCBA 4GN1A 4NQKE 4BFRA 2DZIA 4XX5A 2G45B 3R66C 4J6IA 3ZO5B 3MTNB 2KDIA 2NBWB 4HLEA 3R3MA 3L13A 4IWPA 1UZXB 3KYDD 4ZDVA 2J0JA 2NR2A 2G4DB 4A20A 1H8CA 3VUWA 4IW0A 3AU5A 3A8YC 1EO6A 1WGDA 4GDLB 2XK5A 4LJOB 3WAOA 3SU8X 3VUYA 2LASA 4ZRKA 4CYEA 1WZ3A 2BKFA 2WDTB 5E6PA 2KX0A 3NZSA 2L05A 1Z5SB 4TV3A 3TBLD 2JXXA 4EFOA 3H7PA 4PS8A 2PEAA 4ZRIA 3A4RA 1I35A 4OVUA 2QHOA 3QK0A 5J17A 3ZDMC 3OLMD 1ZW7A 3CSTA 5JZEB 2N4FA 4HPLB 2LD9A 3ECIA 3V6EB
chains in the Genus database with same CATH superfamily
3T8OA 2OLTA 4IWQA 2CXLA 2XSBA 2N7DA 2WDQA 5AQPB 5L3CB 2VH1A 3EUB2 4RMAA 2I6HA 2VK9A 3CK6A 1SIFA 3R7QA 1NAFA 2IO3B 1YX5B 4EZJA 2X38A 2MP2A 5HXEA 2IDYA 4FLHA 1WGGA 4YSXB 2CPTA 4KSLC 4QH5A 1E7UA 2M6BA 4ANVA 3RKOA 1KF6A 2JQKA 1GNUA 1ZGUB 1JWMD 3RPFC 4HVBA 2VKJA 2J0KA 4XDCA 1T0SC 1MG4A 5IUXA 3B0AA 1VCBA 2RDHA 4HWDA 1TS2A 1XQQA 2GMIC 3X0WA 3KV4A 2X9XA 5F5WA 3U7ZA 4ZI7E 1F1HA 2UXNB 2MJEA 3AU4A 1HEZE 4P16A 4IGUA 2KKCA 4P7IA 2GK9A 2L00B 4UF0A 3ZCIA 4AKIA 1V49A 3E08A 3L54A 3DBHI 3QAQA 1FMWA 2VZKB 2E2AA 1JQ4A 2X9YA 3S2AA 4OHJA 4BAYB 1NWMX 1LQBA 5HEOA 5LGUB 4AWJA 3GOEA 2BF8B 2WYQA 2ZJDA 2IO1B 4KZCA 5BMGA 4C00A 1G73A 4X1KE 1MIYA 2MLBA 5T8IA 2JZ3B 3HA4A 4O4IE 5HG2A 2ES0A 4IDIA 3DTOA 5AUIA 1WRIA 2BQQA 3IAM1 1ZDXA 2FCMA 5AZHA 3M62B 4AQ7A 3K3QC 5LXIB 2IY1B 3CMMB 4U74A 1IGDA 3AEEB 3ZTCA 2GBNA 2V6YA 2HDEA 1W9RA 3I9WA 1KFYA 4HE8A 4K7SA 3JSVA 3J9X1 3WAJA 4RNAA 4DWFA 3AN1A 4UELA 4ACFA 2O6VB 1QLBA 5ADXL 2KJHB 2CS4A 3VQIA 1XDOA 3E9SA 2MJDA 3KVFB 3RHWA 3AEGA 5IWAT 2C7MB 4YWGG 4KX6A 5GMVA 1AJ3A 2IY0B 4UVCB 3UTKA 3TEXA 2BS3A 2SAKA 4PK1A 4HFHA 2JYTA 5IOIA 2QILA 1LRZA 1M94A 3CF6E 4ASKA 1TT5B 5H6QB 3SD5A 4XC2A 4AS1A 2LGSA 3Q69A 4ZRPA 1FNWA 1WFYA 3EAMA 2MPKA 3R6NA 3VR9A 2LWPA 1KM7A 2XTLA 2KTRB 1TZ1A 1CUNA 1C76A 2LHEA 2HPLA 1QZEA 1L5PA 1QT9A 2VB6A 1T0YA 2PPHA 3U7DA 1VCSA 5HXRA 3RFZB 3MACA 3IG3A 3V5UA 5LXHA 2Q9QA 1UCUA 3HKEE 4G11A 2AQ1B 3AE6A 2V1DB 3DHHC 4WBNE 2L8JA 4O4LE 4GYRA 1ZUD2 4BKGA 2Y5CA 5F8PA 4KHZF 3PRMB 3EFUA 2HN2A 2CHWA 5D3IB 2FIDA 3DWMA 3ETRA 1NEKB 3VUXA 5HXHA 3RD2A 4B3TT 4TUYE 1FD6A 2AL6A 3HUIA 5LA6E 5CB4E 3N1ZC 1GUAB 4US8A 3GN5A 2WWZA 5J18A 4HEAA 3EABA 3TSSA 2ZM2A 1UGOA 2M4NA 3MC8A 5G2NA 2DNXA 3AXJA 1L0VA 2KWVB 4JX1C 4YTPA 3ZT7A 3HK0A 4BA9A 4K7UA 3CIRB 1SXTA 2ZLYA 2V4IB 4DXGA 1LM8B 2WDRA 1YQ4B 3UU4A 3NS1A 4LNFA 1KEYA 3U78A 4JWUC 1I6ZA 3U30A 2R2OA 2Z59B 2DENB 3B2FA 3C98B 3ZVVA 1XWMA 1VCTA 5MPOA 2NBUA 3AM9A 1WE6A 3P4QA 2IBIB 1HA5A 3RYHE 3VRAA 3SRZA 3I9YA 5L3FB 3SFDA 2R6GF 5F3JA 3JADA 3Q14C 4QAYA 1TY2A 3NRZA 3WIMA 4PJLA 2I1KA 4QH4A 4RM9A 4IE6A 4A56A 4GGQA 4JI6T 2CHXA 4ZHPA 1E0ZA 2CU1A 3ONJA 5FMNA 2C9WB 4LFAT 1SHZC 4ZOLE 1XCTL 2RPAA 3VH3B 2YU2A 4DV1T 1RFAA 2WXHA 1EU4A 1QOAA 2M19A 2LSYA 1FEHA 1GQEA 2KQ4X 2TSSA 4JI2T 2KINB 1AW7A 1HZ5A 1KRHA 4WWMA 5AEKB 3LK2B 3MC0B 2IJ0A 3Q3MC 4PK5A 5C3JA 3APFA 4GU2A 3PJAA 2E9XA 2L1AA 4K3BA 3CPZA 4KUMB 2J4XA 4GIVA 4U33A 2QVAA 1YJ1A 1Q0WB 1NEKA 3C64A 4K3CA 2ZW0A 2UXBT 2WXRA 1EM7A 4DUZT 1KFYB 2CLYB 4QHOA 1J7BA 3N9NA 4FJVB 3C4ZA 3P2BA 1AWDA 1HS7A 4KGSA 2X0HA 2LGYA 3C8YA 3IT4B 2BBJA 4OYJA 4BAXA 2ZPNA 3Q3JA 3OAWA 4TUUA 3ZUNA 3JYUA 2KTFA 2K25A 1G8XA 4YJ2E 1XXGA 2W3RA 3ZJ1A 3KYCD 1KLVA 2V1YA 3N2GE 1MJDA 1D1BA 4U2ZA 2MYSA 2EMSA 1I4PA 2NPTB 2OV9A 1S35A 3KBUA 4TSSA 1KJTA 5LBMA 1MMAA 2YK0A 3QC8B 4XGAB 1EZ3A 3TLSA 3AA7B 2NW9A 2REXA 1J5WA 4NAWB 3ESLA 4US9A 3JCFA 2D0UA 1E5WA 3JAEA 4DR3T 4EYUA 1R4MI 3L8RA 2BBCA 2XNAC 2UXCT 3A9JA 4II3B 3ZYYX 1F0ZA 4HDQA 4LF5T 2X0YA 5L83A 3AEDA 3NVZA 3J7Yq 3VU7H 3JVZX 2JPHA 2KDFB 3UU3A 4I50E 2J7QB 1C78A 2Y48B 1IJ6A 3P4RA 5EE1A 4B95A 4HKAA 4GK5E 2CXFA 1FEWA 1RFKA 3PO0A 3ZN0B 4JL9A 1PGBA 4TWFA 1WH3A 3EC8A 3UGBB 3V6CB 4GOCA 3BIID 3FZHB 5JDFA 3DBRB 5IYZE 5CTRC 2XM1A 2MBEA 3CSFA 1YKHB 2E9XB 2N9DA 4DV6T 3ZSSA 4WAFA 3RNEC 2QDFA 2KMAA 4HCNB 1XNQT 5EK4A 3NZQA 3R2IA 2E8IA 1XF5L 3W5UB 3LK3B 3VTVA 3ZMTB 2LOSA 4MGIE 4QX7B 1C77A 4HFEA 4TV8E 3AA6B 4ILUA 3T1YT 4MGZE 2BYVE 3DVNV 1QQRA 4O1NA 5DPWA 2WXJA 4PK6A 1U4AA 3WANA 1T0QC 1VLBA 2ONQA 1FMAD 4LF7T 4EEWA 5CFBA 1ISNA 3WI3A 2HTHA 5LLIA 3VH4B 4BKTA 2IDOB 4AKRB 3H9DA 4MELA 3PSEB 3RQUA 5HXCA 4X57B 2K9AA 2L3ZA 2DX5B 4N6EB 3RPUA 4W9LA 2H7OA 2LZ6A 4FHKA 5HEJA 3B2GA 3VRAB 2K39A 1Z0PA 1R4MB 2XQ3A 3DJBA 1SE9A 1WR0A 2WXLA 3TL5A 5LOVE 3T3OA 1TKYA 3ZPOA 2NWBA 2D3BA 3P42A 3P4PA 4FADA 1WGKA 2KT9A 3ALBA 3NRXA 3IA3A 4M02A 4MM3B 1QF6A 2LGDA 3OJ4B 3PGEA 1L0VB 2IC6A 4BBNF 3TLUA 1TS3A 3ONSA 4RM8A 3A5XA 5LHHB 1ZPSA 5G55A 4KX6B 1J19A 3UFGA 4JEHB 2B3AA 4CI2B 3FILA 4RGMA 3UUMA 2M1MA 2YLMA 5JH5C 4IT4A 4X66T 3VXWA 2VH2A 3ZIMA 1R8IA 5HEHA 1WM3A 5JREA 3QUJA 4JYAT 1WJNA 2ZVNA 2WP9A 2BS2B 3PRZA 3P4SA 3NBXX 1W0BA 5L2LA 4AKGA 2B1EA 5AQHB 2XPKA 3A9KB 3PREA 2K5BB 3GP7A 2NW7A 3N9YC 5JRCB 2UU7A 4QKNA 1YQ3A 2XQ8A 2NR4A 4P1CC 3SR6A 2A9UA 1UELA 3ZKRA 4W9DA 3FXDB 4GDKA 3NHEB 2LSGA 3PS6A 4GOUA 2WU2A 2LM2A 2N7JA 4B3ST 2BWES 3CIRA 1QOFA 2WQYB 4NJ7A 5E6NA 1XLOA 3BQLA 2DL1A 1OQQA 2LHDA 2P9BA 3CX6B 3KFWX 1P0RA 2JYEA 3DVNU 4CXWA 3APDA 2MJ3A 3RKGA 1VDVA 5D94A 1T7SA 3NOBA 2CJOA 2XAJB 4UIGA 1FXIA 4J6IA 2W54A 2H7VC 3AE4A 1QILA 1UZXB 4ZDVA 4YSYA 2J0JA 2V26A 5C2TA 1H8CA 4GDLB 3WAOA 4EAHA 2LASA 1FPYA 4OHFA 5E6PA 2KX0A 2QA7A 2JXXA 4EFOA 3RYIE 2V6YB 4C91A 4ZRIA 5ABFA 1ZV4X 3A4RA 2J62A 4RGTA 1I35A 2J53A 1HNWT 5JR9C 5J17A 1KK7A 1ZW7A 2X66A 2N4FA 2QIEB 2L9QA 4HPLB 4XYCA 3LG7A 3ZYKA 2JRKA 3Q3OC 3JW0X 2O2VB 4DR5T 1SE2A 1TZOA 4LMLA 5CA1E 5HI1A 3CVRA 5LBQB 1IGCA 4WWOA 2VL8A 5IAAC 2O2VA 3KVAA 1F2RI 4FI5A 2XQ9A 3LSVA 2KQ7A 3BVGA 1BR4A 2BS4A 4PJMA 2IO0B 1LKXA 3Q8EA 2ASQA 2FJAA 4X5TA 3N32A 1B9RA 3F57A 4G0NB 2YDSA 3EDVA 5JR9A 2AWTA 1AYFA 2BS4B 4WBOA 5ABEA 2AQ2B 2BS2A 4P0BA 2WP9B 2E6XA 3B13A 1I94T 2FUPA 4P1BC 2XK5B 4H9OC 2MHJA 3ZSTA 1B1ZA 2WXPA 3H37A 3N1XC 4QH1A 5EDSA 3SFEB 3ZW3A 5FKYA 5C8YE 2FBWA 2L0TA 2VASA 2NW8A 2WXIA 5E6OA 1V2YA 2W82A 2WDVA 1S1QB 3DBHB 3L08A 4ICUA 3TEYA 1WYCA 3DBSA 3VRBB 3MXZA 3GE3C 2UUBT 4O4HE 4ZRJA 2BVLA 1J8CA 2LJ5A 5C2TB 3ZC0A 2O6VA 3CWZB 4II2B 4J2CA 5BMVE 4OK0A 2K24A 1IJ5A 4DV3T 2JQ9A 1ZXHA 4TKNA 4WIPA 2W0GA 2ACXA 2EHOC 2LGIA 2Q9QC 2WS3A 1MMGA 1GG3A 1PFDA 3I9V1 2VQET 3KUZA 1P7EA 2VVSA 2GI9A 1ZKEA 1JROA 3SEBA 4NPPA 1MIVA 4Z8XA 3JSVB 2NP9A 3VR8B 2BG9B 3WAKA 3A1QB 4PS3A 4PYUA 3UIOB 2Z8LA 2LHRA 1IP9A 5JHBA 5DJQC 2HHHT 2M8SA 1QUUA 5FXWA 4DR4T 1EF5A 2ACZA 2WX1A 3LXFA 4EYYR 3AE6B 4ZYNA 1G6JA 3AE5B 1WM2A 2N1VA 3A9KA 4JBWF 4HFVA 1VR9A 4I6LB 2KTRA 3OWEB 3P4SB 3ZJVA 4YSXA 4GXBA 3NRYA 4M8MA 3QB5K 2KK8A 2W55A 4K81A 3HVZA 3BQKA 3SDLC 5AZFA 1H7CA 4EB6E 2YKSA 3NZUA 3P1MA 3L16A 3QARA 2PG8A 2MTQA 2KT7A 3TEZA 4QXHB 1SB3C 5HKHA 1ET9A 2I38A 4ANUA 3M3ZB 2L83A 3KWVA 3AEFA 2WGSA 3HM6X 3AMZA 4YHHT 3PE0A 1E2AA 1MMDA 4BOSC 3M63B 4NXNT 4P09A 4IDPA 1JWSD 2K48A 2JSVX 1TJEA 3SFEA 2ZNVC 3I3TB 4WWPA 3PZ8A 3DOWA 1WXAA 4MSMB 1FCLA 4MH8A 4DBGA 3I5JC 4AJYB 4DV4T 5DPTA 1WCRA 4OZBA 2KO3A 1OEDB 3RNFC 3IVFA 4HPMB 2BG9C 3UU5A 2WNMA 5LJMA 2AEHA 3RZFA 3W5VB 5AQIB 3B1LX 2K3UA 4AISA 4COFA 3V61A 2KDMA 3NVOA 4A9AA 2HPJA 3RMKC 5L3EB 5E0OA 4HGAA 3N30A 1JWAD 4JQWC 4ZZBA 2WSSV 5L95C 2LXAA 1T6BX 4IIJE 2CBIA 3FZKB 1ET6A 3PVLA 2CJNA 3PZDA 2WMNA 3OJAA 2H88B 4KDLB 1TGZB 1PQSA 3QCAA 4KVGB 2LI5A 4M01A 3ZGZA 2EHOD 1KF6B 4DV7T 4LF6T 2X9HA 2GOWA 4PYZA 3N2OA 3VVWB 2DWGA 1TY0A 5J0ZA 2C0SA 3AEAA 2D11A 3KUCB 1KNRA 4MJSA 3OG5A 2XY8B 2KFKB 2PVOD 4N59A 3W2DA 3RNGC 1ZP0A 4FJOA 3OYZA 2QGSA 3AE1B 4M0WA 2JQQA 5HFYA 1FM0D 1JNRA 4TN7B 2ZNVB 4CI1B 2HD5B 3RULA 1ENFA 3HKDE 2FBWB 1CHUA 3OBVE 3Q5DA 1SIJA 2LVPA 3B08A 3N5LA 3SWHA 2CKHB 3UQAA 3TLVA 1ZEEA 1SE3A 1QSDA 4B3RT 1P9DU 5FY7A 3RI7C 4L23A 2XAQB 1D6EC 1YIWA 1SJED 2KDEB 2D3CA 1WR1A 1N6ZA 1I4GA 5LGNB 1JW9D 4EXTA 4YXDA 3I0QA 1V9JA 4Z90A 1R4NB 2BDEA 1D4BA 4O8SA 3PURA 4DR6T 3RT3B 1OEDA 1W09A 2CA5A 2WAUA 4EV6A 3UT5E 2W66A 2BYTA 4EZ4A 4S0RA 4KIKB 2BG9A 5AQUB 2BYFA 1MNEA 1L0XB 4LJPB 5HXSA 2NPTA 3CMLA 1JRPA 3AAIA 4Z91A 4NAWA 4WQOB 5H92C 3TIXA 2DWKA 2WM9A 4FHJA 3RZWC 3K9OB 1V1PA 3WAPA 3VRBA 3AE7B 3O1JA 4JLEA 3NVWA 2J42A 3WALA 3KDSE 1DOXA 2BT6A 1T0RC 2KMMA 3UUNA 4Q25A 3UU8A 3ZMZB 3QB5A 2AE9A 3GZNB 1LVFA 3O4XE 5AQGB 4QX8B 3PT2B 4KBMB 4C4VB 3ZN1B 2FCSA 2SEBD 4PT5A 2YEVC 4W9HA 4PW8A 1V5TA 3L0WB 1IAPA 4OX9T 2IIUA 1I4QA 4B6WA 1YQBA 2JMHA 2OJRA 4ZI2D 1VD2A 4W9GA 1IBMT 3MFGA 2BKNA 5AQTB 3AEBB 5D6JB 2XQ6A 2WWVA 1UX4A 1WZ0A 1ACCA 3H1UA 3PUGA 2O6VD 2OA5A 4AP4C 3O1IA 2RR9A 5JR9B 4C7ZA 1XNRT 3ZLZA 2N9PC 4X62T 2CCQA 2WCAA 3NJTA 3APCA 3DWGC 2ZVOA 2LGXA 1HCIA 2LEKA 4ZI2C 3DVGY 5D3DA 3FBZA 3BY4B 1FRDA 4O2AE 3HVDA 2CM0A 1UD7A 4YL8A 4EGWA 3Q5XA 1BMLC 1OEYA 1WSPA 3JC6C 5CHWA 3AEGB 3Q5EA 4YTNB 5FXZA 3UULA 4IL4A 4A97A 2WXFA 2G0UA 2OHFA 2LOPA 4HRSA 1PUTA 2OEDA 3HRDD 2V7LA 3R2TA 3OKQA 1XCQL 4RCOA 2IO2B 2V3PA 4HFIA 1FIQA 2INNE 3PUZF 2WDRB 5L4EA 3C4XA 2DAFA 3KH0A 4NAMA 4RGNA 2ZM8A 2PBIA 4IDNA 5JDHA 4TX5A 1V1PB 3A33B 1YN5A 1KNPA 2HJ8A 2Y3AA 1XLQA 4LNKA 4X20E 1LFDA 3LDZE 5M4YA 3T9LA 2INPE 2YOEA 3JC6D 2MQJA 2PMVA 4B3MT 3VAWA 4PK4A 2KNBA 4KZ0A 1D0YA 2N9EB 3UINB 3E56A 1C9FA 1KLUD 2KVRA 1GB1A 3P4PB 4TZ4C 1FRRA 4DDID 5LMNT 2MBOA 4P6VF 1X79A 3RN9C 4KP3C 4A3PA 4L9IA 3W1YA 2CHNA 4MH0E 4I4TE 1SA0E 1C4AA 2XAGB 2G1EA 1UF0A 1SUMB 1HTJF 2K8HA 2W62A 3IEEA 3M65A 2I1JA 1NENB 2N1WA 2ZPYA 3Q6BA 2V5DA 2HN1A 4CZZB 3AH7A 2JU6X 4L2YA 3S4UA 1E8WA 2I0MA 2YDQA 2VURA 4FBJB 5DCNA 3ZJUA 3P7IA 3LJ3A 1I4RA 3Q2AC 1GAQB 3AULA 4YXDB 3C51A 3AEBA 3R8BA 1RLFA 3H7PB 5J1GA 4A98A 1XLPA 3IHRA 5HAXA 3ZT6A 4IOIE 2KZ7B 1SSNA 4OZCA 1VZ8A 1WJUA 3AV8A 2BKPA 3DPDA 2X0LB 1V80A 4BJNA 2CHOA 5ABHA 4RH6A 4TQ0A 5AQMB 2LKGA 3AEEA 2HH7A 2ZZPB 1WWTA 4ZS3A 4ILAA 3FZMB 4AKLA 3H8HA 4IDQA 2XASB 3RC8A 1Y01A 3Q8BA 1F2RC 3DBLI 3N9LA 3RX6A 4L5GA 1Y64B 4H63H 1GB4A 2KC2A 1UWXA 5D7GA 3RYTA 1IBLT 4NPNA 4YSYB 4YFSA 5LXTE 4OVVA 4JV5T 2CLYC 1STEA 3E0ZA 5JDLA 4AUQC 2IC9A 4MM3A 4I55E 1E7PB 4MALA 2EELA 3ABVA 3FC4A 5L3BB 4I6PA 3PRPB 2INCC 1IPGA 3ZNZB 2JQRB 4HWIB 5ETWA 4GN1A 4BFRA 4XX5A 3AE2A 2G45B 2X9WA 2CWYA 1EU3A 1VRAB 2J47A 4HLEA 3L13A 4YT0A 4YLHA 3AE2B 4LFBT 4ZZCA 2G4DB 4A20A 4REZA 5ABGA 5LHIB 3AU5A 1WGDA 2Y6XA 1NENA 4LJOB 3SU8X 3VUYA 3F31A 3P4WA 4CYEA 2H3RA 2BKFA 2IPKD 3NZSA 2L05A 4LMKA 2VKDA 1GOZA 2HTME 3MA9A 4ZHQE 4TV3A 1BR0A 3VR8A 3IXSA 2E9XD 5LCYA 3RH3A 2QHOA 3QK0A 4QXBB 3DHIC 2CWOA 1ESFA 2Q5WD 2LD9A 1TKEA 3V6EB 4XDDA 4IUMB 4XZ4A 3PV1A 1E6EB 1OWAA 4DBRA 2PLPA 3ZJTA 1EWCA 4WQMA 5BYSA 3HIZA 1OFFA 2YINA 3V05A 2UUAT 2KWDA 1UURA 5FVLA 2XSAA 2RSUA 2PFVA 1T72A 2WDQB 2K5PA 4BKSD 2E5LT 1L4ZB 1R7SA 3AE9A 2WXNA 2K3WA 4CN4A 4HXDA 2FUG1 2LMCA 3PZ7A 5DPRA 2V7JA 3W1SA 3RGLA 2XQ7A 5L4HA 4G3XB 3AVRA 3ZTDA 3IFWB 3T3NA 3MJXA 4F1SA 4ILCA 1I4HA 1V8CA 1XDPA 5AQSB 1V6EA 3QK6A 3ENEA 2L0FA 2JUOA 1L2NA 1FFVA 4EEDA 3X1DA 3P63A 2BYEA 4DHJD 3NUHB 4I0UA 4MLKA 2MRPA 4HJKA 1SBBB 3A9JB 3PUYF 1OEDC 1XMOT 2V0GA 3N9PA 2LRUA 3SFDB 2QJLA 1YNTE 4MGKE 2D07B 3A1QA 2EKEC 4XZCA 2LSKA 2W2UA 3OJ3A 5AQKB 2HJ1A 1JWBD 3K9PB 5FVKA 2XM2A 3P50A 4U7YA 3PU3A 5FY1A 2CR5A 2D2QA 4IM0A 2N0SB 1D5MC 2OJWA 3EECA 3FKYA 5EZYE 3H3MA 2KYWA 3IBPA 4UF0B 2H89A 2WXOA 3ZXRA 3PUAA 1VZ7A 5AFUL 4FJYA 2JQHA 3QC9A 4KV2A 3PV0F 4EIWA 2L3LA 5I4DA 1BR2A 4OYKA 2PTFA 2W61A 2JRHA 2MP2B 3ANWB 4YSZB 1ZKHA 2LKHA 1WMHA 2KLGA 3NY5A 1Q10A 1MHXA 1UH6A 5KHQA 2RA1A 1UBQA 2KN5A 5AQJB 4IE7A 3AI5A 3AXJB 4ASWC 2GBJA 1C3TA 3D32A 3ZRCA 3ZJ2A 3TJPA 4KSKC 4E74A 4JI7T 3RUIB 3VHLA 1U5PA 1K8RB 2DLBA 1HZ6A 2JX5A 3HL6A 4PJJA 1N62A 2E9XC 2N2NA 3EGRA 5CX3A 4DHZB 3BYYB 4KDIC 5JDNA 2Q9QD 3AAEB 4IWOA 1AN8A 3V5SA 3LYYA 1WF9A 4UVAB 2M0XA 4ZEYA 3LB8C 4HEA1 2DWQA 1IYFA 2LHNA 3ZXVA 2XQ4A 1FXTB 3A4SC 1E8ZA 2XUEA 1Z2MA 5TR5A 1M62A 1XEEA 4RF0A 5E6JA 3RCZA 4YJ3E 2M6IA 2L32A 1FMVA 3B57A 4HFCA 2NTTA 4TV9E 2IHR1 2QMTA 2LRWA 4DVDA 4BKSA 4C4VA 3AE4B 2DAJA 2BKOA 4EE2A 4ZHOA 4HKQA 4UV9B 4AQYT 3VTWA 4HKZE 2J52A 1UGMA 4PFOA 3UQBA 5C3JB 2KXPB 1UWMA 1V81A 1VOMA 5HCJA 1DU2A 2D2SA 4AKHA 3JAFA 3N20C 3ZNHB 2LT3A 2KD0A 2LM9A 3K8PC 1P3QU 1D1CA 4UVBB 4CQIA 4X64T 2ZEQA 3QA8A 5LG4A 4FN2A 2KFJA 1WR6A 3PUXF 4U31A 4CQNA 2V4LA 1RWSA 4JI0T 1HF8A 4H2AA 4W9JA 3AEAB 1KNZA 1N34T 5KDMC 4ARIA 3PUWF 5FL1A 2WXKA 1EWYC 3KWLA 1MIWA 2KWHA 1N61A 1SE4A 1HNXT 4C80A 2C7HA 4ZRQA 2N9LA 3C19A 1TS4A 2RGFA 3HM3A 1HNZT 3P4QB 3RNCC 2BB5A 2JVCA 2MW5A 4KKJA 1D1AA 1S3SG 4WNKA 2I2YA 4O4JE 4LNOA 2N7EA 2KHWB 4E7SA 4IDZA 3C0RB 4ISSA 4K0UA 2NS5A 3UQ4A 4YY3T 5LB7B 4PFPA 4WH4A 3ABVB 3PHWB 2LUEA 1WXVA 3GS2A 5JTGA 1W0AA 1E90A 3NS8A 1N5WA 4EZLA 4XWWA 4IE5A 2GBRA 3FZFB 1A70A 2K8BA 1BXTA 4L1BA 4BBNC 2PTLA 3UUXB 4W9FA 5AQNB 2VL0A 3VFKA 3VHTC 4AQFC 3RYFE 3KV6A 3N9OA 1AARA 1Z8UA 5JH7E 1WXMA 3MHSD 5IHYA 3BQIA 1MFWA 1EF1A 1I4XA 4DR1T 4RFBA 4DDGD 4AI6A 1IZNB 2KLQA 2Z0DB 2KSRA 3F2EA 1E8XA 5CHFA 1CK1A 3PDYA 3PHXB 1P7FA 5G5GA 1UGJA 5EK3A 3RIAA 2DZKA 1MHHE 4DBQA 1HG2A 1C79A 3TEWA 1L6VA 3Q8FA 5G5HA 3HKBE 4GMVA 3NWIA 3KUDB 3EHVA 5HHDG 2MWSB 2KWUB 4MT5A 2PVGC 4LMJA 5KHOA 3VR9B 1WX7A 3Q2MA 4IE4A 2FCQA 5HEGA 3B9JA 1ZOYA 5AZGA 2FCNA 2K8CA 2Z6EA 2ZM0A 3P8CD 4WWNA 2XQYA 2WZIA 5LYJE 2XBBC 4HPPA 1OQYA 5C23A 1WXQA 2R61A 1YXRA 2MAWA 1PDXA 1WJ4A 2A72A 2EMTA 3NKZA 3AE3A 4MHCA 2JJ9A 2W63A 2WZHA 2V3NA 4W9EA 2JWUA 3SOLA 3VKHA 3HI2A 4B0MA 4JGHB 5FXXA 5FR3A 2V7KA 4WAAA 4DR2T 4U7IA 2F4VT 2IGDA 3N2KE 4UV8B 5LNK1 5L47A 3ZEFB 3TKLB 4ADZA 4H9RC 3L09A 4KMCA 4YTMA 2VZKD 4UR9A 4XBFB 2G9HD 3U4EG 4WURA 3DBRI 2KWIB 3PUQA 5EE3A 1EUVB 2AQ3B 2WLBA 4WJOA 4YTMB 5FK9C 5FP3A 1MI0A 3UI3A 3AVSA 5KX5E 4GKKT 2IMLA 5FL0A 5H6RB 3H7SA 2BBHA 3LFMA 4MDKE 4A5XA 3ZRFA 3PLUA 2J4GA 3PTFC 5AUKA 2JZZA 1C1YB 4YTNA 3K3OA 4K1RB 1FJGT 4CHKA 4G2AA 2XAHB 2OOBB 2C7NB 1XD3B 1OEDE 4ANJA 2CE7A 1ZHCA 2LXCA 1WJ6A 5AQOB 5FKAC 1FIOA 1BUIC 2V9HA 3UF8A 3P4RB 1MMNA 2H88A 2LVOA 4HDOA 4JEUB 2GRIA 3Q3NC 3IF8B 2JT4B 1ZOYB 3AEDB 1IBXB 1HR0T 5LNKA 5BMHA 1YQ3B 1T5XD 4XWTA 2CBJA 1DOIA 2XZEA 1DGJA 5L3GB 3T8MA 3OTOT 1O3XA 1N60A 1YD8G 4ZS2A 5FYMA 2KZRA 2M56B 4CXYA 3AE3B 1LVKA 4E3CA 1DOYA 1L4DB 3ML9A 1J5ET 2X51A 4EEBA 3ETUA 1YQ4A 1GC7A 3DBLB 2D0TA 3TUOA 1Y8RC 4DUYT 4RF1A 4W9IA 2MOZA 1UUSA 2XHEB 1WGRA 3NVYA 3V60A 1UX5A 4I43B 3W9CB 1WI0A 1VJKA 4GK0E 2KX3A 5TSSA 2V7IA 4HK2A 4FA6A 3FILB 3RIUC 1F77A 4GKJT 3NZPA 2WU5B 1N33T 1CJEA 3U52E 1YW0A 3GN5B 4NUVA 1SEBD 1P1AA 4PS7A 3E22E 2XEWA 3PLVA 3MK7C 1YOVB 4R3DA 2VKHA 3L3PA 1XT9B 3K1SA 1F9JA 4LF9T 1U4QA 1XMQT 4GDLA 1XLNA 3V62A 2VQFT 2Y8DA 3PU8A 1C4PA 1D0ZA 1ZE3D 2Z0EB 4IC7B 2NTXA 4A90A 1YKEB 2NCNA 4E71A 2NTYA 1ROEA 4G63A 2VRRB 1GC6A 4UDUC 3NVVA 4BZAA 1RYJA 1OTRB 3VTUA 4KHPT 2ON8A 5BYQA 5AQLB 4JWSC 1HE8A 2FAZA 3AE5A 1CQVA 3ZMUB 2RDBC 3BK2A 4EKUA 3EI0A 2EKIA 2KLCA 2D3GA 3DHGC 1MNDA 3WAMA 2ZCCA 1NI3A 3U3IA 2LFIA 2C5JA 2DLRA 1J7AA 5DPSA 4X1IE 1WRDA 2KQSA 2BS3B 2A2FX 2INDC 2ODVA 4ILBA 5DABA 5BO4B 1E7PA 4NIQA 2CXDA 2PJQA 4A55A 2NTSA 2Y5PA 5JRCA 2JPFA 4AOFA 2RPQA 5LG3A 2LRKA 1V97A 2KJRA 4M1PA 2WB5A 4PNIA 2L76A 2RD0A 4DIDB 5IO9A 4NQKE 4LFCT 3CWIA 2DZIA 2AX5A 2RDGA 3EUHA 4U2YA 1M4VA 4MBQA 2KDIA 3Q5WA 2QRXA 3UU6A 2V8SV 2W67A 3LBXA 4GIWA 4IE0A 2IAKA 3VUWA 3NZ3A 4UEMA 1EO6A 1L6UA 2XK5A 3BK1A 2KVZA 3UQ7A 3BYTB 4ZRKA 1WZ3A 1N63A 5J2UE 2WDTB 1Z5SB 2NMQA 3TBLD 1RM6C 2BVCA 3H7PA 1L0YB 4OVUA 3ZLIA 1QKZA 4IL9A 2JZPA 3FAHA 3OLMD 2UXXB 3CSTA 2WQYA 1NYRA 5D2MB 4KIKA 4MEMA 2KXJA 3DP7A 4WW0A 5EE9A 4NJ6A 4ISTA 3B5MA 5AQRB 2FJEA 3KQ4A 2V7MA 2WU2B 3QWZB 5JXVA 1LXDA 1IBKT 2KC1A 2LLYA 2ACZB 3QX1A 1SF0A 4X65T 3AXCA 4UXNB 3RI5A 2FJBA 2KN4A 4LF8T 3ZT5A 3EFCA 3RIFA 4MACA 2WX0A 1Q1OA 3PUSA 1MVKA 2L8KA 1YX6B 3M3JA 2N1GA 3N9MA 4RGOS 3VKGA 1HQRD 3HR0A 3UUBA 4EZHA 3D0TA 2D10A 3KVBA 2WS3B 1A5RA 2LUMA 4LK0M 2FNJB 4FULA 4N78D 4EOZB 3RLFF 1TKGA 4DO0A 2B76A 2BVMA 2EHOA 3A7MA 3TLTA 4MGYE 1JRUA 4NQLB 2ZM6T 1J0GA 2X8XX 2FJDA 2D3AA 4EUTA 4DK5A 2X67A 3O65B 1ZDVA 2B76B 1IUEA 3ONLC 2WDVB 3ZNID 5IKCM 2IUBA 4HJGE 4K7WA 1WMHB 4FXCA 4LF4T 3X23A 4HROA 3HHMA 4LTUA 5AQVB 2JXTA 4IHJE 2BGFA 2LSJA 3U8ZA 2GBMA 3J9CA 5FXVA 3V3XA 3AECA 2XJ7A 3ANWA 4YSZA 3M95A 4BOZB 2DHRA 3CQXC 3Q9DA 4ANWA 1J1JA 2WBLA 3H3AA 1CZPA 1WYGA 2PW9A 4OVZA 3PTRB 2NVUI 4CN1A 5JHAA 1IBXA 2RPVA 2K6QA 2QSDA 5GXGB 1FNUA 2ZMAA 1V9DA 5LP6E 4M00A 2A3DA 2LJLA 5HWYA 2LE8A 1BT0A 3SHQA 3UFEA 1D3ZA 1GJZA 5TAOA 1FCCC 5IP4D 1KTKA 4IDOA 3RF1A 3EDUA 4GDKB 2MBQA 4LCDE 2W9NA 2WXGA 3EA6A 4WJNA 2WXMA 5A1LA 3ML8A 2MBHA 2C5IT 2G4SA 4JI3T 2G3QB 3FB2A 3AB3B 2FIFA 4DR7T 5J2RA 5LJNA 4LLGM 4TNVA 3G06A 3MKDA 1JWUD 1S94A 1NYQA 5BYRA 1M7KA 2LEHA 1T8BA 2M67A 3I0OA 2IZVB 5BMIA 1JCKB 4AQGA 5EK2A 2BG9E 1Y56A 3QHTA 3MP9A 4X1YE 3RQWA 4HCPB 4JLCA 4IKGA 4CI3B 4B9KA 1FXAA 2WY2A 1VZ6A 4QWNB 2DYBA 3KBTA 1HX1B 1B7TA 2W4XA 3BINA 2JY6A 2UXDT 4JI4T 3ZDTA 3BK9A 4P1NA 5FY0A 2KAJA 2DBYA 3ZCJA 2GLSA 4GSWA 1JNZA 1Q5WB 4LDTD 4C56C 4TMAB 2VWAA 3WCQA 3PUVF 3GMIA 5HYAA 3KLSX 1KH0A 2D5GA 5KMGP 3IBEA 5JVDE 4LNNA 2WU5A 2YU1A 4MFRA 1LGRA 1V86A 5C1ZA 1SGHA 2DYMA 4AIUA 2UU9T 4S17A 2C5KT 4B0EA 1TTNA 3ZQ4A 1SE7A 4ANXA 2V3SA 4F6RC 5CGMA 2M0AA 2ZW1A 4U3CA 2BTEA 3ZMSB 3L10B 3WA0A 4H63V 1NI2A 1OXZA 4ITKA 4D2KA 4IREA 2CMRA 1UNSA 1FO4A 1I42A 3RC3A 3QJZA 5L3DB 1ZP0B 5LMUT 2BPSA 2Y5BB 3H6NA 4ZOHC 3QIJA 1K52A 4NUUA 1TIFA 3QQ8B 2MSED 2YEPF 4DMVA 5ABFB 1WFDA 4MJSB 3C50A 1QLBB 2AYOB 3MHZA 1I7HA 5IN7A 1MG8A 2KANA 2V5CA 4DV5T 3AEFB 3UIPB 3W1SC 2KOXA 4I6NB 2BZBA 2DHZA 4M8NA 2LRLA 3PJAJ 4QXCB 2UUCT 5KXJA 2K9XA 4C7YA 2BKRB 2X68A 3KW5B 3O1HA 4ZXLA 3BVMA 1T3QA 2CU3A 3ZC1A 4HWFA 2IGGA 2KWCA 1NVID 1FNVA 2UYZB 4LDTB 2EHOB 3RRCA 3KINB 4NJCA 2CRBA 4F7ZA 4U72A 4AQFA 1TS5A 5HEUA 4EOYA 3MJWA 1GPXA 5LHGB 3RRWA 1QOGA 3DVGX 1WRDB 4H9SE 1VRBA 3PPAA 4Q2JA 4B6XA 4OZAA 4CN6A 2FUHB 3FHNA 2MX2A 4ICVA 4H9NC 4NZLB 2BB6A 4HWHA 4A3OA 2ICIA 1OEYJ 3NG0A 2Q9QB 3ONXA 4PAGA 2D5UA 4DQOC 1V1OA 4DMWA 1US7B 3AE8A 3RNAC 2A4ZA 2I59A 5JDQA 4A6QA 1N36T 1SJHD 4HN9A 1C4CA 1T98A 1E9MA 4A8XC 4DXFA 4EZKA 2E3TA 2N9KA 3Q8AA 3OVUA 4G50A 2C60A 3R84B 2QC8A 3AA0B 2DZJA 2QYWA 4HFDA 4BJMA 3GE8C 4KKIA 2DCFA 3CX8B 2KDBA 3EVYA 1WXSA 3VDZA 2XN9C 2CHZA 1UBIA 4H9QC 1ZXIA 4TWDA 1V5OA 2JF5A 3I1AA 3T1HT 3EHZA 4O2BE 4P0AA 4IM2A 3AE9B 5CJ5A 3OYXA 1JALA 2NOXA 2E5VA 1WYWB 4F8CB 1UK5A 3C4WA 1K51A 4WJQA 1YN4A 2JIWA 2AL3A 2FE8A 2SPCA 1XZYA 2VKOA 4TWHA 3KV5A 4WZXA 2PE9A 4JUYA 1QOBA 4TQ1A 4TNWA 2XQ5A 3AA1B 3GZNI 1BR1A 3TMPB 5JQGE 4XE0A 1H4RA 4AJWA 1HG5A 2BWFA 4FJZA 3MC9A 3TLWA 2ODUA 1JMLA 3O9XA 1HTOA 2GBKA 1E1HB 4L0RA 4ZYSA 1E7VA 1KLGD 2IYDB 4DHZE 4GB9A 3GWHA 2C5LC 4YT0B 3ZKJC 1E8YA 1PYWD 5J2TE 1N5XA 3GB1A 3IHPC 1WIAA 2J0MA 1YN3A 1X9BA 4N9F4 4BVUC 3BWUD 3U2SC 4DHJB 1OQRA 3CKDA 2N9XA 2NBVB 2IW5B 3I57A 3MJ5A 2W3SA 4JIOU 4E7ZA 3L17A 1E10A 5HCMA 1WGHA 3N3KB 2HE7A 4H9PC 4YHJA 2PE6B 3TCAA 2YVCA 1WE7A 3KV9A 1PGXA 4OFZA 2XAFB 2RP4A 2DI4A 3LK42 4PJNA 1P98A 1D0XA 4N58A 2RMMA 5JDGA 1L7YA 2MA9B 3BVZA 1N32T 4W9KA 1TYGB 3AE7A 4JE3B 3IT6B 2W00A 4CXXA 2KNDA 5JDMA 4K0KT 1RAXA 5CHVC 2PKOA 4DV2T 2GB1A 4JPSA 3FZLB 3ZYLA 4F8HA 2KMCA 4WJPA 3CQGB 4AXPA 2KACA 3RIUA 5LGTB 1K50A 1WX9A 3DQVA 2K0PA 4KGTA 1WR6E 3LBXB 2WWUA 4JI8T 2H89B 3RNBC 4ARCA 4ZI3D 2PIAA 2CEAA 2KJ6A 3IAS1 3N1YC 3BZDB 5AQFB 1YMHE 2JWZA 3HKCE 5H8YE 5FR6A 2JRIB 2UWQA 2YEPB 3K3NA 1RRBA 4IG7B 2D9DA 3ZYMA 3RYCE 2JMKA 5IA7A 2V6XA 1OGWA 2R2QA 2BW2A 2K22A 2A5UA 4CO7A 1MPEA 3O13A 3W15B 4HWCA 4HFBA 2QCZA 4IM3A 1PGAA 1WY8A 2K1FA 1NDDA 3Q3FA 4JI1T 1TBEA 4GLSC 3ZNGC 2MCNB 3CX7B 1X1MA 1F52A 2DZMA 4MSQB 4KGRA 4URKA 3FXEB 3I63C 4DXAB 3Q8CA 4HTEA 4XAXB 2LJIA 3FBLA 5FNVE 3GA8A 3QNUA 1WX8A 2L7RA 2YN6A 1DYQA 1NBFC 2XQAA 1YJIA 4DNDA 2IGHA 4C90A 2VVNA 1YD8U 3AECB 1HX8A 3QOFA 1HXYD 1J7CA 2MH7A 4ZI3C 2AXDS 1WLXA 2WXQA 1R4NI 1WGYA 2WMOA 2DYOA 3R7RA 2MBGA 4USAA 1KOTA 5AQQB 2KFKA 3DDCB 2MEKA 4W9CA 1WYBA 4YTPB 3DCGA 5CA0E 3AE1A 4M0WB 4NY0A 4GYSA 4NXMT 1XO3A 1UUPA 1CMXB 3L4PA 1K53A 2M17A 2LVQA 3LDQB 2MBBB 5DQWA 3AAAB 2K6DB 4LNIA 2L52A 2PJHA 4NNJB 3L39A 1HTQA 2ZCBA 3MZKB 3R66C 3N9QA 3ZO5B 3AE8B 4DV0T 2J1DG 5BR8T 2NBWB 3MTNB 3R3MA 4IWPA 3KYDD 4ERRA 3ETVA 3CQCB 3URYA 2KMFA 2NR2A 3OPCA 1FFUA 4V1Av 4IW0A 3A8YC 3AB5A 4JI5T 2WHIA 2LSIA 4OW0A 5GONE 1D5ZC 5EE0A 1LO5D 4KI0F 2YDRA 1YJJA 2PEAA 4PS8A 2DNFA 3LJCA 5DQVA 3ZMVB 4J3OD 3ZDMC 5HWXA 2QEJC 5JZEB 1D5XC 4WYVA 3SS1A 1HFAA 3ECIA
chains in the Genus database with same CATH topology
3JW0X 2O2VB 5D2MB 4IWQA 4IUMB 2N7DA 4KIKA 4RMAA 5AQPB 4MEMA 4XZ4A 2KXJA 3PV1A 4WWOA 5IAAC 4NJ6A 1SIFA 2O2VA 3HIZA 3R7QA 5AQRB 2IO3B 2KQ7A 3QWZB 1YX5B 1LXDA 4EZJA 2RSUA 2KC1A 2MP2A 2IO0B 3QX1A 4BKSD 2ASQA 3AXCA 3N32A 4FLHA 1WGGA 4G0NB 4HXDA 4KSLC 5DPRA 2AWTA 1E7UA 3W1SA 4ANVA 4G3XB 3ZTDA 3IFWB 4F1SA 1GNUA 1ZGUB 2XK5B 4HVBA 2J0KA 5AQSB 1V6EA 2WX0A 1Q1OA 3B0AA 1VCBA 4HWDA 1XQQA 3X0WA 1YX6B 2L0FA 2GMIC 3ENEA 3M3JA 2JUOA 1L2NA 5EDSA 3AU4A 3ZW3A 2BYEA 4DHJD 2KKCA 2L0TA 2D10A 2MRPA 4HJKA 4P7IA 2L00B 1A5RA 5E6OA 1V2YA 1S1QB 2FNJB 1V49A 4FULA 3A9JB 3L08A 3L54A 4ICUA 3DBHI 4MGYE 4NQLB 1J0GA 3QAQA 1JRUA 2LRUA 4EUTA 4DK5A 3S2AA 3DBSA 4MGKE 3O65B 2D07B 3A1QA 1LQBA 2EKEC 4ZRJA 4AWJA 3OJ3A 2LJ5A 3GOEA 1J8CA 5AQKB 2BF8B 2WYQA 2ZJDA 2IO1B 4KZCA 3ZNID 3K9PB 4K7WA 1WMHB 2O6VA 4II2B 2CR5A 2MLBA 2D2QA 2JZ3B 4IM0A 3X23A 3EECA 4TKNA 3HHMA 5AQVB 2BGFA 3U8ZA 2FCMA 2GBMA 1GG3A 3KUZA 5AZHA 3M62B 4FJYA 3M95A 4BOZB 5LXIB 2IY1B 3CMMB 4ANWA 3JSVB 3ZTCA 4KV2A 2GBNA 3A1QB 2NVUI 4PS3A 4PYUA 3UIOB 5JHAA 1IP9A 5JHBA 4K7SA 2M8SA 2K6QA 3JSVA 4DWFA 1EF5A 2JRHA 2MP2B 2WX1A 1ZKHA 1WMHA 2O6VB 2KLGA 3NY5A 4ZYNA 1G6JA 1UH6A 2KJHB 2CS4A 3SHQA 1BT0A 1WM2A 5KHQA 1D3ZA 1GJZA 2N1VA 3A9KA 3VQIA 1UBQA 2KN5A 5AQJB 3AI5A 4ASWC 3KVFB 4I6LB 2GBJA 4GDKB 1C3TA 5GMVA 2C7MB 2KTRA 2MBQA 3D32A 3ZRCA 4LCDE 2W9NA 4KSKC 2IY0B 4WJNA 3TJPA 4E74A 3ML8A 4GXBA 3RUIB 4M8MA 2MBHA 2G4SA 2G3QB 1K8RB 2KK8A 4K81A 2FIFA 5J2RA 1M94A 3CF6E 3SDLC 5AZFA 3SD5A 4XC2A 5CX3A 4DHZB 4KDIC 1M7KA 1WFYA 4IWOA 3NZUA 2IZVB 3QHTA 3L16A 1WF9A 3QARA 2LWPA 1KM7A 5HKHA 2M0XA 2KTRB 4ANUA 1TZ1A 3M3ZB 4HCPB 1IYFA 1QZEA 4JLCA 4B9KA 1T0YA 3U7DA 1FXTB 2PPHA 3HM6X 2DYBA 3A4SC 3IG3A 5LXHA 1HX1B 1E8ZA 3BINA 1Z2MA 4BOSC 2JY6A 3ZDTA 3M63B 4G11A 5TR5A 1M62A 2L8JA 2ZNVC 3I3TB 4WWPA 4BKGA 3DOWA 1Q5WB 4LDTD 1WXAA 4MSMB 3RCZA 3PRMB 4GSWA 4DBGA 4BKSA 3EFUA 4AJYB 2LRWA 5DPTA 2CHWA 2KO3A 2FIDA 2DAJA 3IBEA 3VUXA 3IVFA 4HPMB 3RD2A 2AL6A 1V86A 5C1ZA 1SGHA 1GUAB 2DYMA 2AEHA 3RZFA 2WWZA 5AQIB 1TTNA 3B1LX 3VTWA 5J18A 1UGMA 1UGOA 3UQBA 4ANXA 2M4NA 3V61A 5G2NA 2V3SA 2KWVB 1V81A 3HK0A 4K7UA 3L10B 3ZNHB 3N30A 4JQWC 2KD0A 1P3QU 3WA0A 5L95C 1NI2A 1LM8B 2LXAA 3QA8A 3FZKB 2ZEQA 3PVLA 4FN2A 1I42A 2KFJA 3PZDA 3QJZA 1I6ZA 3U30A 2R2OA 2Y5BB 2BPSA 2Z59B 2V4LA 2DENB 3H6NA 4KDLB 3QIJA 3QQ8B 1TGZB 1PQSA 2MSED 3QCAA 4W9JA 2NBUA 3ZVVA 4KVGB 2LI5A 1WE6A 2IBIB 4MJSB 2AYOB 2GOWA 4PYZA 1MG8A 3VVWB 2KANA 3UIPB 3W1SC 2C7HA 2D11A 2KOXA 4I6NB 2DHZA 4M8NA 3KUCB 3WIMA 2RGFA 3HM3A 4MJSA 2I1KA 2JVCA 2BKRB 2KFKB 2MW5A 4RM9A 1S3SG 3KW5B 4GGQA 2CHXA 4HWFA 2KWCA 2CU1A 2N7EA 2KHWB 2UYZB 3C0RB 4LDTB 2NS5A 2C9WB 2ZNVB 4F7ZA 3RULA 2HD5B 4EOYA 3MJWA 3VH3B 3B08A 3PHWB 2LVPA 2LUEA 3DVGX 1WXVA 1WRDB 1RFAA 1E90A 2CKHB 3NS8A 3PPAA 3UQAA 4EZLA 2GBRA 3FZFB 5AEKB 2FUHB 2K8BA 2MX2A 4ICVA 4BBNC 3APFA 4GU2A 4HWHA 1P9DU 4A3OA 4W9FA 5AQNB 1OEYJ 3VFKA 3VHTC 1YIWA 2KDEB 4GIVA 1AARA 1YJ1A 1Q0WB 1WR1A 1WXMA 3MHSD 1V9JA 2A4ZA 1EF1A 4DDGD 4FJVB 2Z0DB 1E8XA 3P2BA 4EZKA 5CHFA 3RT3B 2LGYA 2C60A 3PHXB 4G50A 2DZKA 2DZJA 4KIKB 5AQUB 2BYFA 2ZPNA 3Q3JA 2KDBA 3OAWA 4LJPB 4TUUA 3JYUA 2NPTA 3ZUNA 2KTFA 2K25A 3KYCD 4GMVA 1WXSA 3KUDB 3EHVA 3VDZA 2CHZA 2V1YA 4NAWA 1KLVA 1UBIA 2KWUB 2MWSB 4WQOB 2EMSA 3TIXA 2JF5A 5KHOA 1V5OA 4FHJA 3RZWC 2NPTB 3K9OB 1WX7A 2FCQA 3WAPA 1KJTA 4IM2A 5AZGA 2FCNA 2K8CA 3QC8B 3WALA 4WWNA 2REXA 4NAWB 1WYWB 2XBBC 4F8CB 1UK5A 4WJQA 1OQYA 1E5WA 1R4MI 3A9JA 5C23A 2AL3A 4II3B 1WJ4A 2PE9A 4HDQA 2EMTA 4TQ1A 5L83A 4W9EA 3GZNI 5AQGB 2JPHA 2KDFB 3JVZX 3PT2B 3TMPB 4JGHB 4WAAA 2FCSA 2J7QB 1H4RA 4AJWA 2BWFA 4FJZA 4W9HA 3L0WB 1V5TA 4B95A 4B6WA 1YQBA 2GBKA 2OJRA 1VD2A 4JL9A 4W9GA 1E7VA 1WH3A 2IYDB 3EC8A 3UGBB 3V6CB 4GB9A 4DHZE 4GOCA 5AQTB 2C5LC 3DBRI 1E8YA 3FZHB 5D6JB 3ZKJC 1EUVB 1WIAA 3IHPC 2J0MA 4WJOA 5CTRC 2MBEA 1WZ0A 4N9F4 3H1UA 3CSFA 4BVUC 2O6VD 4AP4C 2RR9A 4DHJB 2N9XA 2NBVB 3ZLZA 2N9PC 4JIOU 2KMAA 3H7SA 3APCA 4MDKE 3L17A 4HCNB 3ZRFA 1WGHA 3N3KB 2HE7A 2ZVOA 3PLUA 2LGXA 2PE6B 3TCAA 3PTFC 2YVCA 1WE7A 2JZZA 3DVGY 1C1YB 3VTVA 3BY4B 1P98A 4K1RB 4MGIE 1UD7A 4CHKA 1L7YA 4YL8A 5CHWA 1OEYA 4MGZE 2OOBB 2C7NB 2BYVE 1XD3B 2MA9B 3DVNV 4W9KA 5DPWA 2LXCA 1WJ6A 5AQOB 3UF8A 1U4AA 3WANA 2LVOA 4EEWA 1ISNA 1RAXA 2IO2B 2HTHA 4HDOA 5CHVC 5LLIA 3VH4B 4BKTA 3FZLB 2JT4B 2DAFA 3KH0A 2KMCA 4WJPA 3H9DA 4MELA 3PSEB 3A33B 1WX9A 3DQVA 2HJ8A 1LFDA 3LDZE 4X57B 3T8MA 3T9LA 1WR6E 2L3ZA 2DX5B 2MQJA 2KZRA 2LZ6A 4FHKA 4W9LA 2KJ6A 4E3CA 3ML9A 2K39A 2KNBA 3VAWA 4KZ0A 2N9EB 3UINB 5AQFB 2JWZA 2KVRA 1GC7A 1SE9A 5FR6A 2JRIB 3TL5A 2UWQA 4DDID 1Y8RC 2MBOA 1RRBA 4IG7B 2D9DA 4W9IA 1WGRA 4A3PA 4FADA 3V60A 3ALBA 1WI0A 3W1YA 2KX3A 2LGDA 3OJ4B 5IA7A 1OGWA 3PGEA 4MH0E 2R2QA 4HK2A 4FA6A 2A5UA 4CO7A 4BBNF 2K8HA 2ZPYA 2N1WA 2I1JA 3ONSA 4RM8A 4HWCA 1P1AA 4PS7A 2XEWA 3PLVA 5G55A 4IM3A 1WY8A 2K1FA 1J19A 1NDDA 3Q3FA 2B3AA 1TBEA 1E8WA 1XT9B 1F9JA 2M1MA 2YLMA 3ZNGC 2MCNB 5JH5C 3VXWA 4GDLA 4FBJB 1X1MA 5DCNA 2DZMA 1WM3A 4MSQB 3V62A 3ZIMA 4URKA 3LJ3A 3AULA 1WJNA 4DXAB 1RLFA 2Z0EB 4IC7B 2ZVNA 3H7PB 1WX8A 2L7RA 3PRZA 2NCNA 4E71A 1NBFC 5AQHB 1WJUA 1GC6A 2VRRB 3DPDA 1V80A 1YD8U 3VTUA 1OTRB 3A9KB 3PREA 5AQLB 4TQ0A 5AQMB 1HE8A 2FAZA 4EKUA 2ZZPB 2KLCA 1UELA 2D3GA 3FZMB 4W9DA 2ZCCA 3WAMA 4GDKA 3NHEB 3DBLI 1R4NI 1WGYA 3PS6A 2DYOA 3R7RA 1KOTA 5AQQB 2KFKA 3DDCB 4W9CA 5DPSA 2KC2A 5D7GA 3RYTA 2KQSA 3DCGA 4NPNA 2BWES 4M0WB 4NY0A 4OVVA 5BO4B 4NJ7A 5E6NA 1CMXB 4AUQC 4MM3A 2M17A 2LVQA 3LDQB 1P0RA 2MBBB 3DVNU 2K6DB 4AOFA 3APDA 2RPQA 4I6PA 3PRPB 1IPGA 2PJHA 2KJRA 1T7SA 4NNJB 4HWIB 5D94A 3NOBA 3ZNZB 2RD0A 2L76A 2ZCBA 4GN1A 4NQKE 4BFRA 2DZIA 4XX5A 2G45B 3R66C 4J6IA 3ZO5B 3MTNB 2KDIA 2NBWB 4HLEA 3R3MA 3L13A 4IWPA 1UZXB 3KYDD 4ZDVA 2J0JA 2NR2A 2G4DB 4A20A 1H8CA 3VUWA 4IW0A 3AU5A 3A8YC 1EO6A 1WGDA 4GDLB 2XK5A 4LJOB 3WAOA 3SU8X 3VUYA 2LASA 4ZRKA 4CYEA 1WZ3A 2BKFA 2WDTB 5E6PA 2KX0A 3NZSA 2L05A 1Z5SB 4TV3A 3TBLD 2JXXA 4EFOA 3H7PA 4PS8A 2PEAA 4ZRIA 3A4RA 1I35A 4OVUA 2QHOA 3QK0A 5J17A 3ZDMC 3OLMD 1ZW7A 3CSTA 5JZEB 2N4FA 4HPLB 2LD9A 3ECIA 3V6EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JW0 X;  2O2V B;  5D2M B;  4IWQ A;  4IUM B;  2N7D A;  4KIK A;  4RMA A;  5AQP B;  4MEM A;  4XZ4 A;  2KXJ A;  3PV1 A;  4WWO A;  5IAA C;  4NJ6 A;  1SIF A;  2O2V A;  3HIZ A;  3R7Q A;  5AQR B;  2IO3 B;  2KQ7 A;  3QWZ B;  1YX5 B;  1LXD A;  4EZJ A;  2RSU A;  2KC1 A;  2MP2 A;  2IO0 B;  3QX1 A;  4BKS D;  2ASQ A;  3AXC A;  3N32 A;  4FLH A;  1WGG A;  4G0N B;  4HXD A;  4KSL C;  5DPR A;  2AWT A;  1E7U A;  3W1S A;  4ANV A;  4G3X B;  3ZTD A;  3IFW B;  4F1S A;  1GNU A;  1ZGU B;  2XK5 B;  4HVB A;  2J0K A;  5AQS B;  1V6E A;  2WX0 A;  1Q1O A;  3B0A A;  1VCB A;  4HWD A;  1XQQ A;  3X0W A;  1YX6 B;  2L0F A;  2GMI C;  3ENE A;  3M3J A;  2JUO A;  1L2N A;  5EDS A;  3AU4 A;  3ZW3 A;  2BYE A;  4DHJ D;  2KKC A;  2L0T A;  2D10 A;  2MRP A;  4HJK A;  4P7I A;  2L00 B;  1A5R A;  5E6O A;  1V2Y A;  1S1Q B;  2FNJ B;  1V49 A;  4FUL A;  3A9J B;  3L08 A;  3L54 A;  4ICU A;  3DBH I;  4MGY E;  4NQL B;  1J0G A;  3QAQ A;  1JRU A;  2LRU A;  4EUT A;  4DK5 A;  3S2A A;  3DBS A;  4MGK E;  3O65 B;  2D07 B;  3A1Q A;  1LQB A;  2EKE C;  4ZRJ A;  4AWJ A;  3OJ3 A;  2LJ5 A;  3GOE A;  1J8C A;  5AQK B;  2BF8 B;  2WYQ A;  2ZJD A;  2IO1 B;  4KZC A;  3ZNI D;  3K9P B;  4K7W A;  1WMH B;  2O6V A;  4II2 B;  2CR5 A;  2MLB A;  2D2Q A;  2JZ3 B;  4IM0 A;  3X23 A;  3EEC A;  4TKN A;  3HHM A;  5AQV B;  2BGF A;  3U8Z A;  2FCM A;  2GBM A;  1GG3 A;  3KUZ A;  5AZH A;  3M62 B;  4FJY A;  3M95 A;  4BOZ B;  5LXI B;  2IY1 B;  3CMM B;  4ANW A;  3JSV B;  3ZTC A;  4KV2 A;  2GBN A;  3A1Q B;  2NVU I;  4PS3 A;  4PYU A;  3UIO B;  5JHA A;  1IP9 A;  5JHB A;  4K7S A;  2M8S A;  2K6Q A;  3JSV A;  4DWF A;  1EF5 A;  2JRH A;  2MP2 B;  2WX1 A;  1ZKH A;  1WMH A;  2O6V B;  2KLG A;  3NY5 A;  4ZYN A;  1G6J A;  1UH6 A;  2KJH B;  2CS4 A;  3SHQ A;  1BT0 A;  1WM2 A;  5KHQ A;  1D3Z A;  1GJZ A;  2N1V A;  3A9K A;  3VQI A;  1UBQ A;  2KN5 A;  5AQJ B;  3AI5 A;  4ASW C;  3KVF B;  4I6L B;  2GBJ A;  4GDK B;  1C3T A;  5GMV A;  2C7M B;  2KTR A;  2MBQ A;  3D32 A;  3ZRC A;  4LCD E;  2W9N A;  4KSK C;  2IY0 B;  4WJN A;  3TJP A;  4E74 A;  3ML8 A;  4GXB A;  3RUI B;  4M8M A;  2MBH A;  2G4S A;  2G3Q B;  1K8R B;  2KK8 A;  4K81 A;  2FIF A;  5J2R A;  1M94 A;  3CF6 E;  3SDL C;  5AZF A;  3SD5 A;  4XC2 A;  5CX3 A;  4DHZ B;  4KDI C;  1M7K A;  1WFY A;  4IWO A;  3NZU A;  2IZV B;  3QHT A;  3L16 A;  1WF9 A;  3QAR A;  2LWP A;  1KM7 A;  5HKH A;  2M0X A;  2KTR B;  4ANU A;  1TZ1 A;  3M3Z B;  4HCP B;  1IYF A;  1QZE A;  4JLC A;  4B9K A;  1T0Y A;  3U7D A;  1FXT B;  2PPH A;  3HM6 X;  2DYB A;  3A4S C;  3IG3 A;  5LXH A;  1HX1 B;  1E8Z A;  3BIN A;  1Z2M A;  4BOS C;  2JY6 A;  3ZDT A;  3M63 B;  4G11 A;  5TR5 A;  1M62 A;  2L8J A;  2ZNV C;  3I3T B;  4WWP A;  4BKG A;  3DOW A;  1Q5W B;  4LDT D;  1WXA A;  4MSM B;  3RCZ A;  3PRM B;  4GSW A;  4DBG A;  4BKS A;  3EFU A;  4AJY B;  2LRW A;  5DPT A;  2CHW A;  2KO3 A;  2FID A;  2DAJ A;  3IBE A;  3VUX A;  3IVF A;  4HPM B;  3RD2 A;  2AL6 A;  1V86 A;  5C1Z A;  1SGH A;  1GUA B;  2DYM A;  2AEH A;  3RZF A;  2WWZ A;  5AQI B;  1TTN A;  3B1L X;  3VTW A;  5J18 A;  1UGM A;  1UGO A;  3UQB A;  4ANX A;  2M4N A;  3V61 A;  5G2N A;  2V3S A;  2KWV B;  1V81 A;  3HK0 A;  4K7U A;  3L10 B;  3ZNH B;  3N30 A;  4JQW C;  2KD0 A;  1P3Q U;  3WA0 A;  5L95 C;  1NI2 A;  1LM8 B;  2LXA A;  3QA8 A;  3FZK B;  2ZEQ A;  3PVL A;  4FN2 A;  1I42 A;  2KFJ A;  3PZD A;  3QJZ A;  1I6Z A;  3U30 A;  2R2O A;  2Y5B B;  2BPS A;  2Z59 B;  2V4L A;  2DEN B;  3H6N A;  4KDL B;  3QIJ A;  3QQ8 B;  1TGZ B;  1PQS A;  2MSE D;  3QCA A;  4W9J A;  2NBU A;  3ZVV A;  4KVG B;  2LI5 A;  1WE6 A;  2IBI B;  4MJS B;  2AYO B;  2GOW A;  4PYZ A;  1MG8 A;  3VVW B;  2KAN A;  3UIP B;  3W1S C;  2C7H A;  2D11 A;  2KOX A;  4I6N B;  2DHZ A;  4M8N A;  3KUC B;  3WIM A;  2RGF A;  3HM3 A;  4MJS A;  2I1K A;  2JVC A;  2BKR B;  2KFK B;  2MW5 A;  4RM9 A;  1S3S G;  3KW5 B;  4GGQ A;  2CHX A;  4HWF A;  2KWC A;  2CU1 A;  2N7E A;  2KHW B;  2UYZ B;  3C0R B;  4LDT B;  2NS5 A;  2C9W B;  2ZNV B;  4F7Z A;  3RUL A;  2HD5 B;  4EOY A;  3MJW A;  3VH3 B;  3B08 A;  3PHW B;  2LVP A;  2LUE A;  3DVG X;  1WXV A;  1WRD B;  1RFA A;  1E90 A;  2CKH B;  3NS8 A;  3PPA A;  3UQA A;  4EZL A;  2GBR A;  3FZF B;  5AEK B;  2FUH B;  2K8B A;  2MX2 A;  4ICV A;  4BBN C;  3APF A;  4GU2 A;  4HWH A;  1P9D U;  4A3O A;  4W9F A;  5AQN B;  1OEY J;  3VFK A;  3VHT C;  1YIW A;  2KDE B;  4GIV A;  1AAR A;  1YJ1 A;  1Q0W B;  1WR1 A;  1WXM A;  3MHS D;  1V9J A;  2A4Z A;  1EF1 A;  4DDG D;  4FJV B;  2Z0D B;  1E8X A;  3P2B A;  4EZK A;  5CHF A;  3RT3 B;  2LGY A;  2C60 A;  3PHX B;  4G50 A;  2DZK A;  2DZJ A;  4KIK B;  5AQU B;  2BYF A;  2ZPN A;  3Q3J A;  2KDB A;  3OAW A;  4LJP B;  4TUU A;  3JYU A;  2NPT A;  3ZUN A;  2KTF A;  2K25 A;  3KYC D;  4GMV A;  1WXS A;  3KUD B;  3EHV A;  3VDZ A;  2CHZ A;  2V1Y A;  4NAW A;  1KLV A;  1UBI A;  2KWU B;  2MWS B;  4WQO B;  2EMS A;  3TIX A;  2JF5 A;  5KHO A;  1V5O A;  4FHJ A;  3RZW C;  2NPT B;  3K9O B;  1WX7 A;  2FCQ A;  3WAP A;  1KJT A;  4IM2 A;  5AZG A;  2FCN A;  2K8C A;  3QC8 B;  3WAL A;  4WWN A;  2REX A;  4NAW B;  1WYW B;  2XBB C;  4F8C B;  1UK5 A;  4WJQ A;  1OQY A;  1E5W A;  1R4M I;  3A9J A;  5C23 A;  2AL3 A;  4II3 B;  1WJ4 A;  2PE9 A;  4HDQ A;  2EMT A;  4TQ1 A;  5L83 A;  4W9E A;  3GZN I;  5AQG B;  2JPH A;  2KDF B;  3JVZ X;  3PT2 B;  3TMP B;  4JGH B;  4WAA A;  2FCS A;  2J7Q B;  1H4R A;  4AJW A;  2BWF A;  4FJZ A;  4W9H A;  3L0W B;  1V5T A;  4B95 A;  4B6W A;  1YQB A;  2GBK A;  2OJR A;  1VD2 A;  4JL9 A;  4W9G A;  1E7V A;  1WH3 A;  2IYD B;  3EC8 A;  3UGB B;  3V6C B;  4GB9 A;  4DHZ E;  4GOC A;  5AQT B;  2C5L C;  3DBR I;  1E8Y A;  3FZH B;  5D6J B;  3ZKJ C;  1EUV B;  1WIA A;  3IHP C;  2J0M A;  4WJO A;  5CTR C;  2MBE A;  1WZ0 A;  4N9F 4;  3H1U A;  3CSF A;  4BVU C;  2O6V D;  4AP4 C;  2RR9 A;  4DHJ B;  2N9X A;  2NBV B;  3ZLZ A;  2N9P C;  4JIO U;  2KMA A;  3H7S A;  3APC A;  4MDK E;  3L17 A;  4HCN B;  3ZRF A;  1WGH A;  3N3K B;  2HE7 A;  2ZVO A;  3PLU A;  2LGX A;  2PE6 B;  3TCA A;  3PTF C;  2YVC A;  1WE7 A;  2JZZ A;  3DVG Y;  1C1Y B;  3VTV A;  3BY4 B;  1P98 A;  4K1R B;  4MGI E;  1UD7 A;  4CHK A;  1L7Y A;  4YL8 A;  5CHW A;  1OEY A;  4MGZ E;  2OOB B;  2C7N B;  2BYV E;  1XD3 B;  2MA9 B;  3DVN V;  4W9K A;  5DPW A;  2LXC A;  1WJ6 A;  5AQO B;  3UF8 A;  1U4A A;  3WAN A;  2LVO A;  4EEW A;  1ISN A;  1RAX A;  2IO2 B;  2HTH A;  4HDO A;  5CHV C;  5LLI A;  3VH4 B;  4BKT A;  3FZL B;  2JT4 B;  2DAF A;  3KH0 A;  2KMC A;  4WJP A;  3H9D A;  4MEL A;  3PSE B;  3A33 B;  1WX9 A;  3DQV A;  2HJ8 A;  1LFD A;  3LDZ E;  4X57 B;  3T8M A;  3T9L A;  1WR6 E;  2L3Z A;  2DX5 B;  2MQJ A;  2KZR A;  2LZ6 A;  4FHK A;  4W9L A;  2KJ6 A;  4E3C A;  3ML9 A;  2K39 A;  2KNB A;  3VAW A;  4KZ0 A;  2N9E B;  3UIN B;  5AQF B;  2JWZ A;  2KVR A;  1GC7 A;  1SE9 A;  5FR6 A;  2JRI B;  3TL5 A;  2UWQ A;  4DDI D;  1Y8R C;  2MBO A;  1RRB A;  4IG7 B;  2D9D A;  4W9I A;  1WGR A;  4A3P A;  4FAD A;  3V60 A;  3ALB A;  1WI0 A;  3W1Y A;  2KX3 A;  2LGD A;  3OJ4 B;  5IA7 A;  1OGW A;  3PGE A;  4MH0 E;  2R2Q A;  4HK2 A;  4FA6 A;  2A5U A;  4CO7 A;  4BBN F;  2K8H A;  2ZPY A;  2N1W A;  2I1J A;  3ONS A;  4RM8 A;  4HWC A;  1P1A A;  4PS7 A;  2XEW A;  3PLV A;  5G55 A;  4IM3 A;  1WY8 A;  2K1F A;  1J19 A;  1NDD A;  3Q3F A;  2B3A A;  1TBE A;  1E8W A;  1XT9 B;  1F9J A;  2M1M A;  2YLM A;  3ZNG C;  2MCN B;  5JH5 C;  3VXW A;  4GDL A;  4FBJ B;  1X1M A;  5DCN A;  2DZM A;  1WM3 A;  4MSQ B;  3V62 A;  3ZIM A;  4URK A;  3LJ3 A;  3AUL A;  1WJN A;  4DXA B;  1RLF A;  2Z0E B;  4IC7 B;  2ZVN A;  3H7P B;  1WX8 A;  2L7R A;  3PRZ A;  2NCN A;  4E71 A;  1NBF C;  5AQH B;  1WJU A;  1GC6 A;  2VRR B;  3DPD A;  1V80 A;  1YD8 U;  3VTU A;  1OTR B;  3A9K B;  3PRE A;  5AQL B;  4TQ0 A;  5AQM B;  1HE8 A;  2FAZ A;  4EKU A;  2ZZP B;  2KLC A;  1UEL A;  2D3G A;  3FZM B;  4W9D A;  2ZCC A;  3WAM A;  4GDK A;  3NHE B;  3DBL I;  1R4N I;  1WGY A;  3PS6 A;  2DYO A;  3R7R A;  1KOT A;  5AQQ B;  2KFK A;  3DDC B;  4W9C A;  5DPS A;  2KC2 A;  5D7G A;  3RYT A;  2KQS A;  3DCG A;  4NPN A;  2BWE S;  4M0W B;  4NY0 A;  4OVV A;  5BO4 B;  4NJ7 A;  5E6N A;  1CMX B;  4AUQ C;  4MM3 A;  2M17 A;  2LVQ A;  3LDQ B;  1P0R A;  2MBB B;  3DVN U;  2K6D B;  4AOF A;  3APD A;  2RPQ A;  4I6P A;  3PRP B;  1IPG A;  2PJH A;  2KJR A;  1T7S A;  4NNJ B;  4HWI B;  5D94 A;  3NOB A;  3ZNZ B;  2RD0 A;  2L76 A;  2ZCB A;  4GN1 A;  4NQK E;  4BFR A;  2DZI A;  4XX5 A;  2G45 B;  3R66 C;  4J6I A;  3ZO5 B;  3MTN B;  2KDI A;  2NBW B;  4HLE A;  3R3M A;  3L13 A;  4IWP A;  1UZX B;  3KYD D;  4ZDV A;  2J0J A;  2NR2 A;  2G4D B;  4A20 A;  1H8C A;  3VUW A;  4IW0 A;  3AU5 A;  3A8Y C;  1EO6 A;  1WGD A;  4GDL B;  2XK5 A;  4LJO B;  3WAO A;  3SU8 X;  3VUY A;  2LAS A;  4ZRK A;  4CYE A;  1WZ3 A;  2BKF A;  2WDT B;  5E6P A;  2KX0 A;  3NZS A;  2L05 A;  1Z5S B;  4TV3 A;  3TBL D;  2JXX A;  4EFO A;  3H7P A;  4PS8 A;  2PEA A;  4ZRI A;  3A4R A;  1I35 A;  4OVU A;  2QHO A;  3QK0 A;  5J17 A;  3ZDM C;  3OLM D;  1ZW7 A;  3CST A;  5JZE B;  2N4F A;  4HPL B;  2LD9 A;  3ECI A;  3V6E B; 
#chains in the Genus database with same CATH topology
 3T8O A;  2OLT A;  4IWQ A;  2CXL A;  2XSB A;  2N7D A;  2WDQ A;  5AQP B;  5L3C B;  2VH1 A;  3EUB 2;  4RMA A;  2I6H A;  2VK9 A;  3CK6 A;  1SIF A;  3R7Q A;  1NAF A;  2IO3 B;  1YX5 B;  4EZJ A;  2X38 A;  2MP2 A;  5HXE A;  2IDY A;  4FLH A;  1WGG A;  4YSX B;  2CPT A;  4KSL C;  4QH5 A;  1E7U A;  2M6B A;  4ANV A;  3RKO A;  1KF6 A;  2JQK A;  1GNU A;  1ZGU B;  1JWM D;  3RPF C;  4HVB A;  2VKJ A;  2J0K A;  4XDC A;  1T0S C;  1MG4 A;  5IUX A;  3B0A A;  1VCB A;  2RDH A;  4HWD A;  1TS2 A;  1XQQ A;  2GMI C;  3X0W A;  3KV4 A;  2X9X A;  5F5W A;  3U7Z A;  4ZI7 E;  1F1H A;  2UXN B;  2MJE A;  3AU4 A;  1HEZ E;  4P16 A;  4IGU A;  2KKC A;  4P7I A;  2GK9 A;  2L00 B;  4UF0 A;  3ZCI A;  4AKI A;  1V49 A;  3E08 A;  3L54 A;  3DBH I;  3QAQ A;  1FMW A;  2VZK B;  2E2A A;  1JQ4 A;  2X9Y A;  3S2A A;  4OHJ A;  4BAY B;  1NWM X;  1LQB A;  5HEO A;  5LGU B;  4AWJ A;  3GOE A;  2BF8 B;  2WYQ A;  2ZJD A;  2IO1 B;  4KZC A;  5BMG A;  4C00 A;  1G73 A;  4X1K E;  1MIY A;  2MLB A;  5T8I A;  2JZ3 B;  3HA4 A;  4O4I E;  5HG2 A;  2ES0 A;  4IDI A;  3DTO A;  5AUI A;  1WRI A;  2BQQ A;  3IAM 1;  1ZDX A;  2FCM A;  5AZH A;  3M62 B;  4AQ7 A;  3K3Q C;  5LXI B;  2IY1 B;  3CMM B;  4U74 A;  1IGD A;  3AEE B;  3ZTC A;  2GBN A;  2V6Y A;  2HDE A;  1W9R A;  3I9W A;  1KFY A;  4HE8 A;  4K7S A;  3JSV A;  3J9X 1;  3WAJ A;  4RNA A;  4DWF A;  3AN1 A;  4UEL A;  4ACF A;  2O6V B;  1QLB A;  5ADX L;  2KJH B;  2CS4 A;  3VQI A;  1XDO A;  3E9S A;  2MJD A;  3KVF B;  3RHW A;  3AEG A;  5IWA T;  2C7M B;  4YWG G;  4KX6 A;  5GMV A;  1AJ3 A;  2IY0 B;  4UVC B;  3UTK A;  3TEX A;  2BS3 A;  2SAK A;  4PK1 A;  4HFH A;  2JYT A;  5IOI A;  2QIL A;  1LRZ A;  1M94 A;  3CF6 E;  4ASK A;  1TT5 B;  5H6Q B;  3SD5 A;  4XC2 A;  4AS1 A;  2LGS A;  3Q69 A;  4ZRP A;  1FNW A;  1WFY A;  3EAM A;  2MPK A;  3R6N A;  3VR9 A;  2LWP A;  1KM7 A;  2XTL A;  2KTR B;  1TZ1 A;  1CUN A;  1C76 A;  2LHE A;  2HPL A;  1QZE A;  1L5P A;  1QT9 A;  2VB6 A;  1T0Y A;  2PPH A;  3U7D A;  1VCS A;  5HXR A;  3RFZ B;  3MAC A;  3IG3 A;  3V5U A;  5LXH A;  2Q9Q A;  1UCU A;  3HKE E;  4G11 A;  2AQ1 B;  3AE6 A;  2V1D B;  3DHH C;  4WBN E;  2L8J A;  4O4L E;  4GYR A;  1ZUD 2;  4BKG A;  2Y5C A;  5F8P A;  4KHZ F;  3PRM B;  3EFU A;  2HN2 A;  2CHW A;  5D3I B;  2FID A;  3DWM A;  3ETR A;  1NEK B;  3VUX A;  5HXH A;  3RD2 A;  4B3T T;  4TUY E;  1FD6 A;  2AL6 A;  3HUI A;  5LA6 E;  5CB4 E;  3N1Z C;  1GUA B;  4US8 A;  3GN5 A;  2WWZ A;  5J18 A;  4HEA A;  3EAB A;  3TSS A;  2ZM2 A;  1UGO A;  2M4N A;  3MC8 A;  5G2N A;  2DNX A;  3AXJ A;  1L0V A;  2KWV B;  4JX1 C;  4YTP A;  3ZT7 A;  3HK0 A;  4BA9 A;  4K7U A;  3CIR B;  1SXT A;  2ZLY A;  2V4I B;  4DXG A;  1LM8 B;  2WDR A;  1YQ4 B;  3UU4 A;  3NS1 A;  4LNF A;  1KEY A;  3U78 A;  4JWU C;  1I6Z A;  3U30 A;  2R2O A;  2Z59 B;  2DEN B;  3B2F A;  3C98 B;  3ZVV A;  1XWM A;  1VCT A;  5MPO A;  2NBU A;  3AM9 A;  1WE6 A;  3P4Q A;  2IBI B;  1HA5 A;  3RYH E;  3VRA A;  3SRZ A;  3I9Y A;  5L3F B;  3SFD A;  2R6G F;  5F3J A;  3JAD A;  3Q14 C;  4QAY A;  1TY2 A;  3NRZ A;  3WIM A;  4PJL A;  2I1K A;  4QH4 A;  4RM9 A;  4IE6 A;  4A56 A;  4GGQ A;  4JI6 T;  2CHX A;  4ZHP A;  1E0Z A;  2CU1 A;  3ONJ A;  5FMN A;  2C9W B;  4LFA T;  1SHZ C;  4ZOL E;  1XCT L;  2RPA A;  3VH3 B;  2YU2 A;  4DV1 T;  1RFA A;  2WXH A;  1EU4 A;  1QOA A;  2M19 A;  2LSY A;  1FEH A;  1GQE A;  2KQ4 X;  2TSS A;  4JI2 T;  2KIN B;  1AW7 A;  1HZ5 A;  1KRH A;  4WWM A;  5AEK B;  3LK2 B;  3MC0 B;  2IJ0 A;  3Q3M C;  4PK5 A;  5C3J A;  3APF A;  4GU2 A;  3PJA A;  2E9X A;  2L1A A;  4K3B A;  3CPZ A;  4KUM B;  2J4X A;  4GIV A;  4U33 A;  2QVA A;  1YJ1 A;  1Q0W B;  1NEK A;  3C64 A;  4K3C A;  2ZW0 A;  2UXB T;  2WXR A;  1EM7 A;  4DUZ T;  1KFY B;  2CLY B;  4QHO A;  1J7B A;  3N9N A;  4FJV B;  3C4Z A;  3P2B A;  1AWD A;  1HS7 A;  4KGS A;  2X0H A;  2LGY A;  3C8Y A;  3IT4 B;  2BBJ A;  4OYJ A;  4BAX A;  2ZPN A;  3Q3J A;  3OAW A;  4TUU A;  3ZUN A;  3JYU A;  2KTF A;  2K25 A;  1G8X A;  4YJ2 E;  1XXG A;  2W3R A;  3ZJ1 A;  3KYC D;  1KLV A;  2V1Y A;  3N2G E;  1MJD A;  1D1B A;  4U2Z A;  2MYS A;  2EMS A;  1I4P A;  2NPT B;  2OV9 A;  1S35 A;  3KBU A;  4TSS A;  1KJT A;  5LBM A;  1MMA A;  2YK0 A;  3QC8 B;  4XGA B;  1EZ3 A;  3TLS A;  3AA7 B;  2NW9 A;  2REX A;  1J5W A;  4NAW B;  3ESL A;  4US9 A;  3JCF A;  2D0U A;  1E5W A;  3JAE A;  4DR3 T;  4EYU A;  1R4M I;  3L8R A;  2BBC A;  2XNA C;  2UXC T;  3A9J A;  4II3 B;  3ZYY X;  1F0Z A;  4HDQ A;  4LF5 T;  2X0Y A;  5L83 A;  3AED A;  3NVZ A;  3J7Y q;  3VU7 H;  3JVZ X;  2JPH A;  2KDF B;  3UU3 A;  4I50 E;  2J7Q B;  1C78 A;  2Y48 B;  1IJ6 A;  3P4R A;  5EE1 A;  4B95 A;  4HKA A;  4GK5 E;  2CXF A;  1FEW A;  1RFK A;  3PO0 A;  3ZN0 B;  4JL9 A;  1PGB A;  4TWF A;  1WH3 A;  3EC8 A;  3UGB B;  3V6C B;  4GOC A;  3BII D;  3FZH B;  5JDF A;  3DBR B;  5IYZ E;  5CTR C;  2XM1 A;  2MBE A;  3CSF A;  1YKH B;  2E9X B;  2N9D A;  4DV6 T;  3ZSS A;  4WAF A;  3RNE C;  2QDF A;  2KMA A;  4HCN B;  1XNQ T;  5EK4 A;  3NZQ A;  3R2I A;  2E8I A;  1XF5 L;  3W5U B;  3LK3 B;  3VTV A;  3ZMT B;  2LOS A;  4MGI E;  4QX7 B;  1C77 A;  4HFE A;  4TV8 E;  3AA6 B;  4ILU A;  3T1Y T;  4MGZ E;  2BYV E;  3DVN V;  1QQR A;  4O1N A;  5DPW A;  2WXJ A;  4PK6 A;  1U4A A;  3WAN A;  1T0Q C;  1VLB A;  2ONQ A;  1FMA D;  4LF7 T;  4EEW A;  5CFB A;  1ISN A;  3WI3 A;  2HTH A;  5LLI A;  3VH4 B;  4BKT A;  2IDO B;  4AKR B;  3H9D A;  4MEL A;  3PSE B;  3RQU A;  5HXC A;  4X57 B;  2K9A A;  2L3Z A;  2DX5 B;  4N6E B;  3RPU A;  4W9L A;  2H7O A;  2LZ6 A;  4FHK A;  5HEJ A;  3B2G A;  3VRA B;  2K39 A;  1Z0P A;  1R4M B;  2XQ3 A;  3DJB A;  1SE9 A;  1WR0 A;  2WXL A;  3TL5 A;  5LOV E;  3T3O A;  1TKY A;  3ZPO A;  2NWB A;  2D3B A;  3P42 A;  3P4P A;  4FAD A;  1WGK A;  2KT9 A;  3ALB A;  3NRX A;  3IA3 A;  4M02 A;  4MM3 B;  1QF6 A;  2LGD A;  3OJ4 B;  3PGE A;  1L0V B;  2IC6 A;  4BBN F;  3TLU A;  1TS3 A;  3ONS A;  4RM8 A;  3A5X A;  5LHH B;  1ZPS A;  5G55 A;  4KX6 B;  1J19 A;  3UFG A;  4JEH B;  2B3A A;  4CI2 B;  3FIL A;  4RGM A;  3UUM A;  2M1M A;  2YLM A;  5JH5 C;  4IT4 A;  4X66 T;  3VXW A;  2VH2 A;  3ZIM A;  1R8I A;  5HEH A;  1WM3 A;  5JRE A;  3QUJ A;  4JYA T;  1WJN A;  2ZVN A;  2WP9 A;  2BS2 B;  3PRZ A;  3P4S A;  3NBX X;  1W0B A;  5L2L A;  4AKG A;  2B1E A;  5AQH B;  2XPK A;  3A9K B;  3PRE A;  2K5B B;  3GP7 A;  2NW7 A;  3N9Y C;  5JRC B;  2UU7 A;  4QKN A;  1YQ3 A;  2XQ8 A;  2NR4 A;  4P1C C;  3SR6 A;  2A9U A;  1UEL A;  3ZKR A;  4W9D A;  3FXD B;  4GDK A;  3NHE B;  2LSG A;  3PS6 A;  4GOU A;  2WU2 A;  2LM2 A;  2N7J A;  4B3S T;  2BWE S;  3CIR A;  1QOF A;  2WQY B;  4NJ7 A;  5E6N A;  1XLO A;  3BQL A;  2DL1 A;  1OQQ A;  2LHD A;  2P9B A;  3CX6 B;  3KFW X;  1P0R A;  2JYE A;  3DVN U;  4CXW A;  3APD A;  2MJ3 A;  3RKG A;  1VDV A;  5D94 A;  1T7S A;  3NOB A;  2CJO A;  2XAJ B;  4UIG A;  1FXI A;  4J6I A;  2W54 A;  2H7V C;  3AE4 A;  1QIL A;  1UZX B;  4ZDV A;  4YSY A;  2J0J A;  2V26 A;  5C2T A;  1H8C A;  4GDL B;  3WAO A;  4EAH A;  2LAS A;  1FPY A;  4OHF A;  5E6P A;  2KX0 A;  2QA7 A;  2JXX A;  4EFO A;  3RYI E;  2V6Y B;  4C91 A;  4ZRI A;  5ABF A;  1ZV4 X;  3A4R A;  2J62 A;  4RGT A;  1I35 A;  2J53 A;  1HNW T;  5JR9 C;  5J17 A;  1KK7 A;  1ZW7 A;  2X66 A;  2N4F A;  2QIE B;  2L9Q A;  4HPL B;  4XYC A;  3LG7 A;  3ZYK A;  2JRK A;  3Q3O C;  3JW0 X;  2O2V B;  4DR5 T;  1SE2 A;  1TZO A;  4LML A;  5CA1 E;  5HI1 A;  3CVR A;  5LBQ B;  1IGC A;  4WWO A;  2VL8 A;  5IAA C;  2O2V A;  3KVA A;  1F2R I;  4FI5 A;  2XQ9 A;  3LSV A;  2KQ7 A;  3BVG A;  1BR4 A;  2BS4 A;  4PJM A;  2IO0 B;  1LKX A;  3Q8E A;  2ASQ A;  2FJA A;  4X5T A;  3N32 A;  1B9R A;  3F57 A;  4G0N B;  2YDS A;  3EDV A;  5JR9 A;  2AWT A;  1AYF A;  2BS4 B;  4WBO A;  5ABE A;  2AQ2 B;  2BS2 A;  4P0B A;  2WP9 B;  2E6X A;  3B13 A;  1I94 T;  2FUP A;  4P1B C;  2XK5 B;  4H9O C;  2MHJ A;  3ZST A;  1B1Z A;  2WXP A;  3H37 A;  3N1X C;  4QH1 A;  5EDS A;  3SFE B;  3ZW3 A;  5FKY A;  5C8Y E;  2FBW A;  2L0T A;  2VAS A;  2NW8 A;  2WXI A;  5E6O A;  1V2Y A;  2W82 A;  2WDV A;  1S1Q B;  3DBH B;  3L08 A;  4ICU A;  3TEY A;  1WYC A;  3DBS A;  3VRB B;  3MXZ A;  3GE3 C;  2UUB T;  4O4H E;  4ZRJ A;  2BVL A;  1J8C A;  2LJ5 A;  5C2T B;  3ZC0 A;  2O6V A;  3CWZ B;  4II2 B;  4J2C A;  5BMV E;  4OK0 A;  2K24 A;  1IJ5 A;  4DV3 T;  2JQ9 A;  1ZXH A;  4TKN A;  4WIP A;  2W0G A;  2ACX A;  2EHO C;  2LGI A;  2Q9Q C;  2WS3 A;  1MMG A;  1GG3 A;  1PFD A;  3I9V 1;  2VQE T;  3KUZ A;  1P7E A;  2VVS A;  2GI9 A;  1ZKE A;  1JRO A;  3SEB A;  4NPP A;  1MIV A;  4Z8X A;  3JSV B;  2NP9 A;  3VR8 B;  2BG9 B;  3WAK A;  3A1Q B;  4PS3 A;  4PYU A;  3UIO B;  2Z8L A;  2LHR A;  1IP9 A;  5JHB A;  5DJQ C;  2HHH T;  2M8S A;  1QUU A;  5FXW A;  4DR4 T;  1EF5 A;  2ACZ A;  2WX1 A;  3LXF A;  4EYY R;  3AE6 B;  4ZYN A;  1G6J A;  3AE5 B;  1WM2 A;  2N1V A;  3A9K A;  4JBW F;  4HFV A;  1VR9 A;  4I6L B;  2KTR A;  3OWE B;  3P4S B;  3ZJV A;  4YSX A;  4GXB A;  3NRY A;  4M8M A;  3QB5 K;  2KK8 A;  2W55 A;  4K81 A;  3HVZ A;  3BQK A;  3SDL C;  5AZF A;  1H7C A;  4EB6 E;  2YKS A;  3NZU A;  3P1M A;  3L16 A;  3QAR A;  2PG8 A;  2MTQ A;  2KT7 A;  3TEZ A;  4QXH B;  1SB3 C;  5HKH A;  1ET9 A;  2I38 A;  4ANU A;  3M3Z B;  2L83 A;  3KWV A;  3AEF A;  2WGS A;  3HM6 X;  3AMZ A;  4YHH T;  3PE0 A;  1E2A A;  1MMD A;  4BOS C;  3M63 B;  4NXN T;  4P09 A;  4IDP A;  1JWS D;  2K48 A;  2JSV X;  1TJE A;  3SFE A;  2ZNV C;  3I3T B;  4WWP A;  3PZ8 A;  3DOW A;  1WXA A;  4MSM B;  1FCL A;  4MH8 A;  4DBG A;  3I5J C;  4AJY B;  4DV4 T;  5DPT A;  1WCR A;  4OZB A;  2KO3 A;  1OED B;  3RNF C;  3IVF A;  4HPM B;  2BG9 C;  3UU5 A;  2WNM A;  5LJM A;  2AEH A;  3RZF A;  3W5V B;  5AQI B;  3B1L X;  2K3U A;  4AIS A;  4COF A;  3V61 A;  2KDM A;  3NVO A;  4A9A A;  2HPJ A;  3RMK C;  5L3E B;  5E0O A;  4HGA A;  3N30 A;  1JWA D;  4JQW C;  4ZZB A;  2WSS V;  5L95 C;  2LXA A;  1T6B X;  4IIJ E;  2CBI A;  3FZK B;  1ET6 A;  3PVL A;  2CJN A;  3PZD A;  2WMN A;  3OJA A;  2H88 B;  4KDL B;  1TGZ B;  1PQS A;  3QCA A;  4KVG B;  2LI5 A;  4M01 A;  3ZGZ A;  2EHO D;  1KF6 B;  4DV7 T;  4LF6 T;  2X9H A;  2GOW A;  4PYZ A;  3N2O A;  3VVW B;  2DWG A;  1TY0 A;  5J0Z A;  2C0S A;  3AEA A;  2D11 A;  3KUC B;  1KNR A;  4MJS A;  3OG5 A;  2XY8 B;  2KFK B;  2PVO D;  4N59 A;  3W2D A;  3RNG C;  1ZP0 A;  4FJO A;  3OYZ A;  2QGS A;  3AE1 B;  4M0W A;  2JQQ A;  5HFY A;  1FM0 D;  1JNR A;  4TN7 B;  2ZNV B;  4CI1 B;  2HD5 B;  3RUL A;  1ENF A;  3HKD E;  2FBW B;  1CHU A;  3OBV E;  3Q5D A;  1SIJ A;  2LVP A;  3B08 A;  3N5L A;  3SWH A;  2CKH B;  3UQA A;  3TLV A;  1ZEE A;  1SE3 A;  1QSD A;  4B3R T;  1P9D U;  5FY7 A;  3RI7 C;  4L23 A;  2XAQ B;  1D6E C;  1YIW A;  1SJE D;  2KDE B;  2D3C A;  1WR1 A;  1N6Z A;  1I4G A;  5LGN B;  1JW9 D;  4EXT A;  4YXD A;  3I0Q A;  1V9J A;  4Z90 A;  1R4N B;  2BDE A;  1D4B A;  4O8S A;  3PUR A;  4DR6 T;  3RT3 B;  1OED A;  1W09 A;  2CA5 A;  2WAU A;  4EV6 A;  3UT5 E;  2W66 A;  2BYT A;  4EZ4 A;  4S0R A;  4KIK B;  2BG9 A;  5AQU B;  2BYF A;  1MNE A;  1L0X B;  4LJP B;  5HXS A;  2NPT A;  3CML A;  1JRP A;  3AAI A;  4Z91 A;  4NAW A;  4WQO B;  5H92 C;  3TIX A;  2DWK A;  2WM9 A;  4FHJ A;  3RZW C;  3K9O B;  1V1P A;  3WAP A;  3VRB A;  3AE7 B;  3O1J A;  4JLE A;  3NVW A;  2J42 A;  3WAL A;  3KDS E;  1DOX A;  2BT6 A;  1T0R C;  2KMM A;  3UUN A;  4Q25 A;  3UU8 A;  3ZMZ B;  3QB5 A;  2AE9 A;  3GZN B;  1LVF A;  3O4X E;  5AQG B;  4QX8 B;  3PT2 B;  4KBM B;  4C4V B;  3ZN1 B;  2FCS A;  2SEB D;  4PT5 A;  2YEV C;  4W9H A;  4PW8 A;  1V5T A;  3L0W B;  1IAP A;  4OX9 T;  2IIU A;  1I4Q A;  4B6W A;  1YQB A;  2JMH A;  2OJR A;  4ZI2 D;  1VD2 A;  4W9G A;  1IBM T;  3MFG A;  2BKN A;  5AQT B;  3AEB B;  5D6J B;  2XQ6 A;  2WWV A;  1UX4 A;  1WZ0 A;  1ACC A;  3H1U A;  3PUG A;  2O6V D;  2OA5 A;  4AP4 C;  3O1I A;  2RR9 A;  5JR9 B;  4C7Z A;  1XNR T;  3ZLZ A;  2N9P C;  4X62 T;  2CCQ A;  2WCA A;  3NJT A;  3APC A;  3DWG C;  2ZVO A;  2LGX A;  1HCI A;  2LEK A;  4ZI2 C;  3DVG Y;  5D3D A;  3FBZ A;  3BY4 B;  1FRD A;  4O2A E;  3HVD A;  2CM0 A;  1UD7 A;  4YL8 A;  4EGW A;  3Q5X A;  1BML C;  1OEY A;  1WSP A;  3JC6 C;  5CHW A;  3AEG B;  3Q5E A;  4YTN B;  5FXZ A;  3UUL A;  4IL4 A;  4A97 A;  2WXF A;  2G0U A;  2OHF A;  2LOP A;  4HRS A;  1PUT A;  2OED A;  3HRD D;  2V7L A;  3R2T A;  3OKQ A;  1XCQ L;  4RCO A;  2IO2 B;  2V3P A;  4HFI A;  1FIQ A;  2INN E;  3PUZ F;  2WDR B;  5L4E A;  3C4X A;  2DAF A;  3KH0 A;  4NAM A;  4RGN A;  2ZM8 A;  2PBI A;  4IDN A;  5JDH A;  4TX5 A;  1V1P B;  3A33 B;  1YN5 A;  1KNP A;  2HJ8 A;  2Y3A A;  1XLQ A;  4LNK A;  4X20 E;  1LFD A;  3LDZ E;  5M4Y A;  3T9L A;  2INP E;  2YOE A;  3JC6 D;  2MQJ A;  2PMV A;  4B3M T;  3VAW A;  4PK4 A;  2KNB A;  4KZ0 A;  1D0Y A;  2N9E B;  3UIN B;  3E56 A;  1C9F A;  1KLU D;  2KVR A;  1GB1 A;  3P4P B;  4TZ4 C;  1FRR A;  4DDI D;  5LMN T;  2MBO A;  4P6V F;  1X79 A;  3RN9 C;  4KP3 C;  4A3P A;  4L9I A;  3W1Y A;  2CHN A;  4MH0 E;  4I4T E;  1SA0 E;  1C4A A;  2XAG B;  2G1E A;  1UF0 A;  1SUM B;  1HTJ F;  2K8H A;  2W62 A;  3IEE A;  3M65 A;  2I1J A;  1NEN B;  2N1W A;  2ZPY A;  3Q6B A;  2V5D A;  2HN1 A;  4CZZ B;  3AH7 A;  2JU6 X;  4L2Y A;  3S4U A;  1E8W A;  2I0M A;  2YDQ A;  2VUR A;  4FBJ B;  5DCN A;  3ZJU A;  3P7I A;  3LJ3 A;  1I4R A;  3Q2A C;  1GAQ B;  3AUL A;  4YXD B;  3C51 A;  3AEB A;  3R8B A;  1RLF A;  3H7P B;  5J1G A;  4A98 A;  1XLP A;  3IHR A;  5HAX A;  3ZT6 A;  4IOI E;  2KZ7 B;  1SSN A;  4OZC A;  1VZ8 A;  1WJU A;  3AV8 A;  2BKP A;  3DPD A;  2X0L B;  1V80 A;  4BJN A;  2CHO A;  5ABH A;  4RH6 A;  4TQ0 A;  5AQM B;  2LKG A;  3AEE A;  2HH7 A;  2ZZP B;  1WWT A;  4ZS3 A;  4ILA A;  3FZM B;  4AKL A;  3H8H A;  4IDQ A;  2XAS B;  3RC8 A;  1Y01 A;  3Q8B A;  1F2R C;  3DBL I;  3N9L A;  3RX6 A;  4L5G A;  1Y64 B;  4H63 H;  1GB4 A;  2KC2 A;  1UWX A;  5D7G A;  3RYT A;  1IBL T;  4NPN A;  4YSY B;  4YFS A;  5LXT E;  4OVV A;  4JV5 T;  2CLY C;  1STE A;  3E0Z A;  5JDL A;  4AUQ C;  2IC9 A;  4MM3 A;  4I55 E;  1E7P B;  4MAL A;  2EEL A;  3ABV A;  3FC4 A;  5L3B B;  4I6P A;  3PRP B;  2INC C;  1IPG A;  3ZNZ B;  2JQR B;  4HWI B;  5ETW A;  4GN1 A;  4BFR A;  4XX5 A;  3AE2 A;  2G45 B;  2X9W A;  2CWY A;  1EU3 A;  1VRA B;  2J47 A;  4HLE A;  3L13 A;  4YT0 A;  4YLH A;  3AE2 B;  4LFB T;  4ZZC A;  2G4D B;  4A20 A;  4REZ A;  5ABG A;  5LHI B;  3AU5 A;  1WGD A;  2Y6X A;  1NEN A;  4LJO B;  3SU8 X;  3VUY A;  3F31 A;  3P4W A;  4CYE A;  2H3R A;  2BKF A;  2IPK D;  3NZS A;  2L05 A;  4LMK A;  2VKD A;  1GOZ A;  2HTM E;  3MA9 A;  4ZHQ E;  4TV3 A;  1BR0 A;  3VR8 A;  3IXS A;  2E9X D;  5LCY A;  3RH3 A;  2QHO A;  3QK0 A;  4QXB B;  3DHI C;  2CWO A;  1ESF A;  2Q5W D;  2LD9 A;  1TKE A;  3V6E B;  4XDD A;  4IUM B;  4XZ4 A;  3PV1 A;  1E6E B;  1OWA A;  4DBR A;  2PLP A;  3ZJT A;  1EWC A;  4WQM A;  5BYS A;  3HIZ A;  1OFF A;  2YIN A;  3V05 A;  2UUA T;  2KWD A;  1UUR A;  5FVL A;  2XSA A;  2RSU A;  2PFV A;  1T72 A;  2WDQ B;  2K5P A;  4BKS D;  2E5L T;  1L4Z B;  1R7S A;  3AE9 A;  2WXN A;  2K3W A;  4CN4 A;  4HXD A;  2FUG 1;  2LMC A;  3PZ7 A;  5DPR A;  2V7J A;  3W1S A;  3RGL A;  2XQ7 A;  5L4H A;  4G3X B;  3AVR A;  3ZTD A;  3IFW B;  3T3N A;  3MJX A;  4F1S A;  4ILC A;  1I4H A;  1V8C A;  1XDP A;  5AQS B;  1V6E A;  3QK6 A;  3ENE A;  2L0F A;  2JUO A;  1L2N A;  1FFV A;  4EED A;  3X1D A;  3P63 A;  2BYE A;  4DHJ D;  3NUH B;  4I0U A;  4MLK A;  2MRP A;  4HJK A;  1SBB B;  3A9J B;  3PUY F;  1OED C;  1XMO T;  2V0G A;  3N9P A;  2LRU A;  3SFD B;  2QJL A;  1YNT E;  4MGK E;  2D07 B;  3A1Q A;  2EKE C;  4XZC A;  2LSK A;  2W2U A;  3OJ3 A;  5AQK B;  2HJ1 A;  1JWB D;  3K9P B;  5FVK A;  2XM2 A;  3P50 A;  4U7Y A;  3PU3 A;  5FY1 A;  2CR5 A;  2D2Q A;  4IM0 A;  2N0S B;  1D5M C;  2OJW A;  3EEC A;  3FKY A;  5EZY E;  3H3M A;  2KYW A;  3IBP A;  4UF0 B;  2H89 A;  2WXO A;  3ZXR A;  3PUA A;  1VZ7 A;  5AFU L;  4FJY A;  2JQH A;  3QC9 A;  4KV2 A;  3PV0 F;  4EIW A;  2L3L A;  5I4D A;  1BR2 A;  4OYK A;  2PTF A;  2W61 A;  2JRH A;  2MP2 B;  3ANW B;  4YSZ B;  1ZKH A;  2LKH A;  1WMH A;  2KLG A;  3NY5 A;  1Q10 A;  1MHX A;  1UH6 A;  5KHQ A;  2RA1 A;  1UBQ A;  2KN5 A;  5AQJ B;  4IE7 A;  3AI5 A;  3AXJ B;  4ASW C;  2GBJ A;  1C3T A;  3D32 A;  3ZRC A;  3ZJ2 A;  3TJP A;  4KSK C;  4E74 A;  4JI7 T;  3RUI B;  3VHL A;  1U5P A;  1K8R B;  2DLB A;  1HZ6 A;  2JX5 A;  3HL6 A;  4PJJ A;  1N62 A;  2E9X C;  2N2N A;  3EGR A;  5CX3 A;  4DHZ B;  3BYY B;  4KDI C;  5JDN A;  2Q9Q D;  3AAE B;  4IWO A;  1AN8 A;  3V5S A;  3LYY A;  1WF9 A;  4UVA B;  2M0X A;  4ZEY A;  3LB8 C;  4HEA 1;  2DWQ A;  1IYF A;  2LHN A;  3ZXV A;  2XQ4 A;  1FXT B;  3A4S C;  1E8Z A;  2XUE A;  1Z2M A;  5TR5 A;  1M62 A;  1XEE A;  4RF0 A;  5E6J A;  3RCZ A;  4YJ3 E;  2M6I A;  2L32 A;  1FMV A;  3B57 A;  4HFC A;  2NTT A;  4TV9 E;  2IHR 1;  2QMT A;  2LRW A;  4DVD A;  4BKS A;  4C4V A;  3AE4 B;  2DAJ A;  2BKO A;  4EE2 A;  4ZHO A;  4HKQ A;  4UV9 B;  4AQY T;  3VTW A;  4HKZ E;  2J52 A;  1UGM A;  4PFO A;  3UQB A;  5C3J B;  2KXP B;  1UWM A;  1V81 A;  1VOM A;  5HCJ A;  1DU2 A;  2D2S A;  4AKH A;  3JAF A;  3N20 C;  3ZNH B;  2LT3 A;  2KD0 A;  2LM9 A;  3K8P C;  1P3Q U;  1D1C A;  4UVB B;  4CQI A;  4X64 T;  2ZEQ A;  3QA8 A;  5LG4 A;  4FN2 A;  2KFJ A;  1WR6 A;  3PUX F;  4U31 A;  4CQN A;  2V4L A;  1RWS A;  4JI0 T;  1HF8 A;  4H2A A;  4W9J A;  3AEA B;  1KNZ A;  1N34 T;  5KDM C;  4ARI A;  3PUW F;  5FL1 A;  2WXK A;  1EWY C;  3KWL A;  1MIW A;  2KWH A;  1N61 A;  1SE4 A;  1HNX T;  4C80 A;  2C7H A;  4ZRQ A;  2N9L A;  3C19 A;  1TS4 A;  2RGF A;  3HM3 A;  1HNZ T;  3P4Q B;  3RNC C;  2BB5 A;  2JVC A;  2MW5 A;  4KKJ A;  1D1A A;  1S3S G;  4WNK A;  2I2Y A;  4O4J E;  4LNO A;  2N7E A;  2KHW B;  4E7S A;  4IDZ A;  3C0R B;  4ISS A;  4K0U A;  2NS5 A;  3UQ4 A;  4YY3 T;  5LB7 B;  4PFP A;  4WH4 A;  3ABV B;  3PHW B;  2LUE A;  1WXV A;  3GS2 A;  5JTG A;  1W0A A;  1E90 A;  3NS8 A;  1N5W A;  4EZL A;  4XWW A;  4IE5 A;  2GBR A;  3FZF B;  1A70 A;  2K8B A;  1BXT A;  4L1B A;  4BBN C;  2PTL A;  3UUX B;  4W9F A;  5AQN B;  2VL0 A;  3VFK A;  3VHT C;  4AQF C;  3RYF E;  3KV6 A;  3N9O A;  1AAR A;  1Z8U A;  5JH7 E;  1WXM A;  3MHS D;  5IHY A;  3BQI A;  1MFW A;  1EF1 A;  1I4X A;  4DR1 T;  4RFB A;  4DDG D;  4AI6 A;  1IZN B;  2KLQ A;  2Z0D B;  2KSR A;  3F2E A;  1E8X A;  5CHF A;  1CK1 A;  3PDY A;  3PHX B;  1P7F A;  5G5G A;  1UGJ A;  5EK3 A;  3RIA A;  2DZK A;  1MHH E;  4DBQ A;  1HG2 A;  1C79 A;  3TEW A;  1L6V A;  3Q8F A;  5G5H A;  3HKB E;  4GMV A;  3NWI A;  3KUD B;  3EHV A;  5HHD G;  2MWS B;  2KWU B;  4MT5 A;  2PVG C;  4LMJ A;  5KHO A;  3VR9 B;  1WX7 A;  3Q2M A;  4IE4 A;  2FCQ A;  5HEG A;  3B9J A;  1ZOY A;  5AZG A;  2FCN A;  2K8C A;  2Z6E A;  2ZM0 A;  3P8C D;  4WWN A;  2XQY A;  2WZI A;  5LYJ E;  2XBB C;  4HPP A;  1OQY A;  5C23 A;  1WXQ A;  2R61 A;  1YXR A;  2MAW A;  1PDX A;  1WJ4 A;  2A72 A;  2EMT A;  3NKZ A;  3AE3 A;  4MHC A;  2JJ9 A;  2W63 A;  2WZH A;  2V3N A;  4W9E A;  2JWU A;  3SOL A;  3VKH A;  3HI2 A;  4B0M A;  4JGH B;  5FXX A;  5FR3 A;  2V7K A;  4WAA A;  4DR2 T;  4U7I A;  2F4V T;  2IGD A;  3N2K E;  4UV8 B;  5LNK 1;  5L47 A;  3ZEF B;  3TKL B;  4ADZ A;  4H9R C;  3L09 A;  4KMC A;  4YTM A;  2VZK D;  4UR9 A;  4XBF B;  2G9H D;  3U4E G;  4WUR A;  3DBR I;  2KWI B;  3PUQ A;  5EE3 A;  1EUV B;  2AQ3 B;  2WLB A;  4WJO A;  4YTM B;  5FK9 C;  5FP3 A;  1MI0 A;  3UI3 A;  3AVS A;  5KX5 E;  4GKK T;  2IML A;  5FL0 A;  5H6R B;  3H7S A;  2BBH A;  3LFM A;  4MDK E;  4A5X A;  3ZRF A;  3PLU A;  2J4G A;  3PTF C;  5AUK A;  2JZZ A;  1C1Y B;  4YTN A;  3K3O A;  4K1R B;  1FJG T;  4CHK A;  4G2A A;  2XAH B;  2OOB B;  2C7N B;  1XD3 B;  1OED E;  4ANJ A;  2CE7 A;  1ZHC A;  2LXC A;  1WJ6 A;  5AQO B;  5FKA C;  1FIO A;  1BUI C;  2V9H A;  3UF8 A;  3P4R B;  1MMN A;  2H88 A;  2LVO A;  4HDO A;  4JEU B;  2GRI A;  3Q3N C;  3IF8 B;  2JT4 B;  1ZOY B;  3AED B;  1IBX B;  1HR0 T;  5LNK A;  5BMH A;  1YQ3 B;  1T5X D;  4XWT A;  2CBJ A;  1DOI A;  2XZE A;  1DGJ A;  5L3G B;  3T8M A;  3OTO T;  1O3X A;  1N60 A;  1YD8 G;  4ZS2 A;  5FYM A;  2KZR A;  2M56 B;  4CXY A;  3AE3 B;  1LVK A;  4E3C A;  1DOY A;  1L4D B;  3ML9 A;  1J5E T;  2X51 A;  4EEB A;  3ETU A;  1YQ4 A;  1GC7 A;  3DBL B;  2D0T A;  3TUO A;  1Y8R C;  4DUY T;  4RF1 A;  4W9I A;  2MOZ A;  1UUS A;  2XHE B;  1WGR A;  3NVY A;  3V60 A;  1UX5 A;  4I43 B;  3W9C B;  1WI0 A;  1VJK A;  4GK0 E;  2KX3 A;  5TSS A;  2V7I A;  4HK2 A;  4FA6 A;  3FIL B;  3RIU C;  1F77 A;  4GKJ T;  3NZP A;  2WU5 B;  1N33 T;  1CJE A;  3U52 E;  1YW0 A;  3GN5 B;  4NUV A;  1SEB D;  1P1A A;  4PS7 A;  3E22 E;  2XEW A;  3PLV A;  3MK7 C;  1YOV B;  4R3D A;  2VKH A;  3L3P A;  1XT9 B;  3K1S A;  1F9J A;  4LF9 T;  1U4Q A;  1XMQ T;  4GDL A;  1XLN A;  3V62 A;  2VQF T;  2Y8D A;  3PU8 A;  1C4P A;  1D0Z A;  1ZE3 D;  2Z0E B;  4IC7 B;  2NTX A;  4A90 A;  1YKE B;  2NCN A;  4E71 A;  2NTY A;  1ROE A;  4G63 A;  2VRR B;  1GC6 A;  4UDU C;  3NVV A;  4BZA A;  1RYJ A;  1OTR B;  3VTU A;  4KHP T;  2ON8 A;  5BYQ A;  5AQL B;  4JWS C;  1HE8 A;  2FAZ A;  3AE5 A;  1CQV A;  3ZMU B;  2RDB C;  3BK2 A;  4EKU A;  3EI0 A;  2EKI A;  2KLC A;  2D3G A;  3DHG C;  1MND A;  3WAM A;  2ZCC A;  1NI3 A;  3U3I A;  2LFI A;  2C5J A;  2DLR A;  1J7A A;  5DPS A;  4X1I E;  1WRD A;  2KQS A;  2BS3 B;  2A2F X;  2IND C;  2ODV A;  4ILB A;  5DAB A;  5BO4 B;  1E7P A;  4NIQ A;  2CXD A;  2PJQ A;  4A55 A;  2NTS A;  2Y5P A;  5JRC A;  2JPF A;  4AOF A;  2RPQ A;  5LG3 A;  2LRK A;  1V97 A;  2KJR A;  4M1P A;  2WB5 A;  4PNI A;  2L76 A;  2RD0 A;  4DID B;  5IO9 A;  4NQK E;  4LFC T;  3CWI A;  2DZI A;  2AX5 A;  2RDG A;  3EUH A;  4U2Y A;  1M4V A;  4MBQ A;  2KDI A;  3Q5W A;  2QRX A;  3UU6 A;  2V8S V;  2W67 A;  3LBX A;  4GIW A;  4IE0 A;  2IAK A;  3VUW A;  3NZ3 A;  4UEM A;  1EO6 A;  1L6U A;  2XK5 A;  3BK1 A;  2KVZ A;  3UQ7 A;  3BYT B;  4ZRK A;  1WZ3 A;  1N63 A;  5J2U E;  2WDT B;  1Z5S B;  2NMQ A;  3TBL D;  1RM6 C;  2BVC A;  3H7P A;  1L0Y B;  4OVU A;  3ZLI A;  1QKZ A;  4IL9 A;  2JZP A;  3FAH A;  3OLM D;  2UXX B;  3CST A;  2WQY A;  1NYR A;  5D2M B;  4KIK A;  4MEM A;  2KXJ A;  3DP7 A;  4WW0 A;  5EE9 A;  4NJ6 A;  4IST A;  3B5M A;  5AQR B;  2FJE A;  3KQ4 A;  2V7M A;  2WU2 B;  3QWZ B;  5JXV A;  1LXD A;  1IBK T;  2KC1 A;  2LLY A;  2ACZ B;  3QX1 A;  1SF0 A;  4X65 T;  3AXC A;  4UXN B;  3RI5 A;  2FJB A;  2KN4 A;  4LF8 T;  3ZT5 A;  3EFC A;  3RIF A;  4MAC A;  2WX0 A;  1Q1O A;  3PUS A;  1MVK A;  2L8K A;  1YX6 B;  3M3J A;  2N1G A;  3N9M A;  4RGO S;  3VKG A;  1HQR D;  3HR0 A;  3UUB A;  4EZH A;  3D0T A;  2D10 A;  3KVB A;  2WS3 B;  1A5R A;  2LUM A;  4LK0 M;  2FNJ B;  4FUL A;  4N78 D;  4EOZ B;  3RLF F;  1TKG A;  4DO0 A;  2B76 A;  2BVM A;  2EHO A;  3A7M A;  3TLT A;  4MGY E;  1JRU A;  4NQL B;  2ZM6 T;  1J0G A;  2X8X X;  2FJD A;  2D3A A;  4EUT A;  4DK5 A;  2X67 A;  3O65 B;  1ZDV A;  2B76 B;  1IUE A;  3ONL C;  2WDV B;  3ZNI D;  5IKC M;  2IUB A;  4HJG E;  4K7W A;  1WMH B;  4FXC A;  4LF4 T;  3X23 A;  4HRO A;  3HHM A;  4LTU A;  5AQV B;  2JXT A;  4IHJ E;  2BGF A;  2LSJ A;  3U8Z A;  2GBM A;  3J9C A;  5FXV A;  3V3X A;  3AEC A;  2XJ7 A;  3ANW A;  4YSZ A;  3M95 A;  4BOZ B;  2DHR A;  3CQX C;  3Q9D A;  4ANW A;  1J1J A;  2WBL A;  3H3A A;  1CZP A;  1WYG A;  2PW9 A;  4OVZ A;  3PTR B;  2NVU I;  4CN1 A;  5JHA A;  1IBX A;  2RPV A;  2K6Q A;  2QSD A;  5GXG B;  1FNU A;  2ZMA A;  1V9D A;  5LP6 E;  4M00 A;  2A3D A;  2LJL A;  5HWY A;  2LE8 A;  1BT0 A;  3SHQ A;  3UFE A;  1D3Z A;  1GJZ A;  5TAO A;  1FCC C;  5IP4 D;  1KTK A;  4IDO A;  3RF1 A;  3EDU A;  4GDK B;  2MBQ A;  4LCD E;  2W9N A;  2WXG A;  3EA6 A;  4WJN A;  2WXM A;  5A1L A;  3ML8 A;  2MBH A;  2C5I T;  2G4S A;  4JI3 T;  2G3Q B;  3FB2 A;  3AB3 B;  2FIF A;  4DR7 T;  5J2R A;  5LJN A;  4LLG M;  4TNV A;  3G06 A;  3MKD A;  1JWU D;  1S94 A;  1NYQ A;  5BYR A;  1M7K A;  2LEH A;  1T8B A;  2M67 A;  3I0O A;  2IZV B;  5BMI A;  1JCK B;  4AQG A;  5EK2 A;  2BG9 E;  1Y56 A;  3QHT A;  3MP9 A;  4X1Y E;  3RQW A;  4HCP B;  4JLC A;  4IKG A;  4CI3 B;  4B9K A;  1FXA A;  2WY2 A;  1VZ6 A;  4QWN B;  2DYB A;  3KBT A;  1HX1 B;  1B7T A;  2W4X A;  3BIN A;  2JY6 A;  2UXD T;  4JI4 T;  3ZDT A;  3BK9 A;  4P1N A;  5FY0 A;  2KAJ A;  2DBY A;  3ZCJ A;  2GLS A;  4GSW A;  1JNZ A;  1Q5W B;  4LDT D;  4C56 C;  4TMA B;  2VWA A;  3WCQ A;  3PUV F;  3GMI A;  5HYA A;  3KLS X;  1KH0 A;  2D5G A;  5KMG P;  3IBE A;  5JVD E;  4LNN A;  2WU5 A;  2YU1 A;  4MFR A;  1LGR A;  1V86 A;  5C1Z A;  1SGH A;  2DYM A;  4AIU A;  2UU9 T;  4S17 A;  2C5K T;  4B0E A;  1TTN A;  3ZQ4 A;  1SE7 A;  4ANX A;  2V3S A;  4F6R C;  5CGM A;  2M0A A;  2ZW1 A;  4U3C A;  2BTE A;  3ZMS B;  3L10 B;  3WA0 A;  4H63 V;  1NI2 A;  1OXZ A;  4ITK A;  4D2K A;  4IRE A;  2CMR A;  1UNS A;  1FO4 A;  1I42 A;  3RC3 A;  3QJZ A;  5L3D B;  1ZP0 B;  5LMU T;  2BPS A;  2Y5B B;  3H6N A;  4ZOH C;  3QIJ A;  1K52 A;  4NUU A;  1TIF A;  3QQ8 B;  2MSE D;  2YEP F;  4DMV A;  5ABF B;  1WFD A;  4MJS B;  3C50 A;  1QLB B;  2AYO B;  3MHZ A;  1I7H A;  5IN7 A;  1MG8 A;  2KAN A;  2V5C A;  4DV5 T;  3AEF B;  3UIP B;  3W1S C;  2KOX A;  4I6N B;  2BZB A;  2DHZ A;  4M8N A;  2LRL A;  3PJA J;  4QXC B;  2UUC T;  5KXJ A;  2K9X A;  4C7Y A;  2BKR B;  2X68 A;  3KW5 B;  3O1H A;  4ZXL A;  3BVM A;  1T3Q A;  2CU3 A;  3ZC1 A;  4HWF A;  2IGG A;  2KWC A;  1NVI D;  1FNV A;  2UYZ B;  4LDT B;  2EHO B;  3RRC A;  3KIN B;  4NJC A;  2CRB A;  4F7Z A;  4U72 A;  4AQF A;  1TS5 A;  5HEU A;  4EOY A;  3MJW A;  1GPX A;  5LHG B;  3RRW A;  1QOG A;  3DVG X;  1WRD B;  4H9S E;  1VRB A;  3PPA A;  4Q2J A;  4B6X A;  4OZA A;  4CN6 A;  2FUH B;  3FHN A;  2MX2 A;  4ICV A;  4H9N C;  4NZL B;  2BB6 A;  4HWH A;  4A3O A;  2ICI A;  1OEY J;  3NG0 A;  2Q9Q B;  3ONX A;  4PAG A;  2D5U A;  4DQO C;  1V1O A;  4DMW A;  1US7 B;  3AE8 A;  3RNA C;  2A4Z A;  2I59 A;  5JDQ A;  4A6Q A;  1N36 T;  1SJH D;  4HN9 A;  1C4C A;  1T98 A;  1E9M A;  4A8X C;  4DXF A;  4EZK A;  2E3T A;  2N9K A;  3Q8A A;  3OVU A;  4G50 A;  2C60 A;  3R84 B;  2QC8 A;  3AA0 B;  2DZJ A;  2QYW A;  4HFD A;  4BJM A;  3GE8 C;  4KKI A;  2DCF A;  3CX8 B;  2KDB A;  3EVY A;  1WXS A;  3VDZ A;  2XN9 C;  2CHZ A;  1UBI A;  4H9Q C;  1ZXI A;  4TWD A;  1V5O A;  2JF5 A;  3I1A A;  3T1H T;  3EHZ A;  4O2B E;  4P0A A;  4IM2 A;  3AE9 B;  5CJ5 A;  3OYX A;  1JAL A;  2NOX A;  2E5V A;  1WYW B;  4F8C B;  1UK5 A;  3C4W A;  1K51 A;  4WJQ A;  1YN4 A;  2JIW A;  2AL3 A;  2FE8 A;  2SPC A;  1XZY A;  2VKO A;  4TWH A;  3KV5 A;  4WZX A;  2PE9 A;  4JUY A;  1QOB A;  4TQ1 A;  4TNW A;  2XQ5 A;  3AA1 B;  3GZN I;  1BR1 A;  3TMP B;  5JQG E;  4XE0 A;  1H4R A;  4AJW A;  1HG5 A;  2BWF A;  4FJZ A;  3MC9 A;  3TLW A;  2ODU A;  1JML A;  3O9X A;  1HTO A;  2GBK A;  1E1H B;  4L0R A;  4ZYS A;  1E7V A;  1KLG D;  2IYD B;  4DHZ E;  4GB9 A;  3GWH A;  2C5L C;  4YT0 B;  3ZKJ C;  1E8Y A;  1PYW D;  5J2T E;  1N5X A;  3GB1 A;  3IHP C;  1WIA A;  2J0M A;  1YN3 A;  1X9B A;  4N9F 4;  4BVU C;  3BWU D;  3U2S C;  4DHJ B;  1OQR A;  3CKD A;  2N9X A;  2NBV B;  2IW5 B;  3I57 A;  3MJ5 A;  2W3S A;  4JIO U;  4E7Z A;  3L17 A;  1E10 A;  5HCM A;  1WGH A;  3N3K B;  2HE7 A;  4H9P C;  4YHJ A;  2PE6 B;  3TCA A;  2YVC A;  1WE7 A;  3KV9 A;  1PGX A;  4OFZ A;  2XAF B;  2RP4 A;  2DI4 A;  3LK4 2;  4PJN A;  1P98 A;  1D0X A;  4N58 A;  2RMM A;  5JDG A;  1L7Y A;  2MA9 B;  3BVZ A;  1N32 T;  4W9K A;  1TYG B;  3AE7 A;  4JE3 B;  3IT6 B;  2W00 A;  4CXX A;  2KND A;  5JDM A;  4K0K T;  1RAX A;  5CHV C;  2PKO A;  4DV2 T;  2GB1 A;  4JPS A;  3FZL B;  3ZYL A;  4F8H A;  2KMC A;  4WJP A;  3CQG B;  4AXP A;  2KAC A;  3RIU A;  5LGT B;  1K50 A;  1WX9 A;  3DQV A;  2K0P A;  4KGT A;  1WR6 E;  3LBX B;  2WWU A;  4JI8 T;  2H89 B;  3RNB C;  4ARC A;  4ZI3 D;  2PIA A;  2CEA A;  2KJ6 A;  3IAS 1;  3N1Y C;  3BZD B;  5AQF B;  1YMH E;  2JWZ A;  3HKC E;  5H8Y E;  5FR6 A;  2JRI B;  2UWQ A;  2YEP B;  3K3N A;  1RRB A;  4IG7 B;  2D9D A;  3ZYM A;  3RYC E;  2JMK A;  5IA7 A;  2V6X A;  1OGW A;  2R2Q A;  2BW2 A;  2K22 A;  2A5U A;  4CO7 A;  1MPE A;  3O13 A;  3W15 B;  4HWC A;  4HFB A;  2QCZ A;  4IM3 A;  1PGA A;  1WY8 A;  2K1F A;  1NDD A;  3Q3F A;  4JI1 T;  1TBE A;  4GLS C;  3ZNG C;  2MCN B;  3CX7 B;  1X1M A;  1F52 A;  2DZM A;  4MSQ B;  4KGR A;  4URK A;  3FXE B;  3I63 C;  4DXA B;  3Q8C A;  4HTE A;  4XAX B;  2LJI A;  3FBL A;  5FNV E;  3GA8 A;  3QNU A;  1WX8 A;  2L7R A;  2YN6 A;  1DYQ A;  1NBF C;  2XQA A;  1YJI A;  4DND A;  2IGH A;  4C90 A;  2VVN A;  1YD8 U;  3AEC B;  1HX8 A;  3QOF A;  1HXY D;  1J7C A;  2MH7 A;  4ZI3 C;  2AXD S;  1WLX A;  2WXQ A;  1R4N I;  1WGY A;  2WMO A;  2DYO A;  3R7R A;  2MBG A;  4USA A;  1KOT A;  5AQQ B;  2KFK A;  3DDC B;  2MEK A;  4W9C A;  1WYB A;  4YTP B;  3DCG A;  5CA0 E;  3AE1 A;  4M0W B;  4NY0 A;  4GYS A;  4NXM T;  1XO3 A;  1UUP A;  1CMX B;  3L4P A;  1K53 A;  2M17 A;  2LVQ A;  3LDQ B;  2MBB B;  5DQW A;  3AAA B;  2K6D B;  4LNI A;  2L52 A;  2PJH A;  4NNJ B;  3L39 A;  1HTQ A;  2ZCB A;  3MZK B;  3R66 C;  3N9Q A;  3ZO5 B;  3AE8 B;  4DV0 T;  2J1D G;  5BR8 T;  2NBW B;  3MTN B;  3R3M A;  4IWP A;  3KYD D;  4ERR A;  3ETV A;  3CQC B;  3URY A;  2KMF A;  2NR2 A;  3OPC A;  1FFU A;  4V1A v;  4IW0 A;  3A8Y C;  3AB5 A;  4JI5 T;  2WHI A;  2LSI A;  4OW0 A;  5GON E;  1D5Z C;  5EE0 A;  1LO5 D;  4KI0 F;  2YDR A;  1YJJ A;  2PEA A;  4PS8 A;  2DNF A;  3LJC A;  5DQV A;  3ZMV B;  4J3O D;  3ZDM C;  5HWX A;  2QEJ C;  5JZE B;  1D5X C;  4WYV A;  3SS1 A;  1HFA A;  3ECI A; 
#chains in the Genus database with same CATH homology
 3JW0 X;  2O2V B;  5D2M B;  4IWQ A;  4IUM B;  2N7D A;  4KIK A;  4RMA A;  5AQP B;  4MEM A;  4XZ4 A;  2KXJ A;  3PV1 A;  4WWO A;  5IAA C;  4NJ6 A;  1SIF A;  2O2V A;  3HIZ A;  3R7Q A;  5AQR B;  2IO3 B;  2KQ7 A;  3QWZ B;  1YX5 B;  1LXD A;  4EZJ A;  2RSU A;  2KC1 A;  2MP2 A;  2IO0 B;  3QX1 A;  4BKS D;  2ASQ A;  3AXC A;  3N32 A;  4FLH A;  1WGG A;  4G0N B;  4HXD A;  4KSL C;  5DPR A;  2AWT A;  1E7U A;  3W1S A;  4ANV A;  4G3X B;  3ZTD A;  3IFW B;  4F1S A;  1GNU A;  1ZGU B;  2XK5 B;  4HVB A;  2J0K A;  5AQS B;  1V6E A;  2WX0 A;  1Q1O A;  3B0A A;  1VCB A;  4HWD A;  1XQQ A;  3X0W A;  1YX6 B;  2L0F A;  2GMI C;  3ENE A;  3M3J A;  2JUO A;  1L2N A;  5EDS A;  3AU4 A;  3ZW3 A;  2BYE A;  4DHJ D;  2KKC A;  2L0T A;  2D10 A;  2MRP A;  4HJK A;  4P7I A;  2L00 B;  1A5R A;  5E6O A;  1V2Y A;  1S1Q B;  2FNJ B;  1V49 A;  4FUL A;  3A9J B;  3L08 A;  3L54 A;  4ICU A;  3DBH I;  4MGY E;  4NQL B;  1J0G A;  3QAQ A;  1JRU A;  2LRU A;  4EUT A;  4DK5 A;  3S2A A;  3DBS A;  4MGK E;  3O65 B;  2D07 B;  3A1Q A;  1LQB A;  2EKE C;  4ZRJ A;  4AWJ A;  3OJ3 A;  2LJ5 A;  3GOE A;  1J8C A;  5AQK B;  2BF8 B;  2WYQ A;  2ZJD A;  2IO1 B;  4KZC A;  3ZNI D;  3K9P B;  4K7W A;  1WMH B;  2O6V A;  4II2 B;  2CR5 A;  2MLB A;  2D2Q A;  2JZ3 B;  4IM0 A;  3X23 A;  3EEC A;  4TKN A;  3HHM A;  5AQV B;  2BGF A;  3U8Z A;  2FCM A;  2GBM A;  1GG3 A;  3KUZ A;  5AZH A;  3M62 B;  4FJY A;  3M95 A;  4BOZ B;  5LXI B;  2IY1 B;  3CMM B;  4ANW A;  3JSV B;  3ZTC A;  4KV2 A;  2GBN A;  3A1Q B;  2NVU I;  4PS3 A;  4PYU A;  3UIO B;  5JHA A;  1IP9 A;  5JHB A;  4K7S A;  2M8S A;  2K6Q A;  3JSV A;  4DWF A;  1EF5 A;  2JRH A;  2MP2 B;  2WX1 A;  1ZKH A;  1WMH A;  2O6V B;  2KLG A;  3NY5 A;  4ZYN A;  1G6J A;  1UH6 A;  2KJH B;  2CS4 A;  3SHQ A;  1BT0 A;  1WM2 A;  5KHQ A;  1D3Z A;  1GJZ A;  2N1V A;  3A9K A;  3VQI A;  1UBQ A;  2KN5 A;  5AQJ B;  3AI5 A;  4ASW C;  3KVF B;  4I6L B;  2GBJ A;  4GDK B;  1C3T A;  5GMV A;  2C7M B;  2KTR A;  2MBQ A;  3D32 A;  3ZRC A;  4LCD E;  2W9N A;  4KSK C;  2IY0 B;  4WJN A;  3TJP A;  4E74 A;  3ML8 A;  4GXB A;  3RUI B;  4M8M A;  2MBH A;  2G4S A;  2G3Q B;  1K8R B;  2KK8 A;  4K81 A;  2FIF A;  5J2R A;  1M94 A;  3CF6 E;  3SDL C;  5AZF A;  3SD5 A;  4XC2 A;  5CX3 A;  4DHZ B;  4KDI C;  1M7K A;  1WFY A;  4IWO A;  3NZU A;  2IZV B;  3QHT A;  3L16 A;  1WF9 A;  3QAR A;  2LWP A;  1KM7 A;  5HKH A;  2M0X A;  2KTR B;  4ANU A;  1TZ1 A;  3M3Z B;  4HCP B;  1IYF A;  1QZE A;  4JLC A;  4B9K A;  1T0Y A;  3U7D A;  1FXT B;  2PPH A;  3HM6 X;  2DYB A;  3A4S C;  3IG3 A;  5LXH A;  1HX1 B;  1E8Z A;  3BIN A;  1Z2M A;  4BOS C;  2JY6 A;  3ZDT A;  3M63 B;  4G11 A;  5TR5 A;  1M62 A;  2L8J A;  2ZNV C;  3I3T B;  4WWP A;  4BKG A;  3DOW A;  1Q5W B;  4LDT D;  1WXA A;  4MSM B;  3RCZ A;  3PRM B;  4GSW A;  4DBG A;  4BKS A;  3EFU A;  4AJY B;  2LRW A;  5DPT A;  2CHW A;  2KO3 A;  2FID A;  2DAJ A;  3IBE A;  3VUX A;  3IVF A;  4HPM B;  3RD2 A;  2AL6 A;  1V86 A;  5C1Z A;  1SGH A;  1GUA B;  2DYM A;  2AEH A;  3RZF A;  2WWZ A;  5AQI B;  1TTN A;  3B1L X;  3VTW A;  5J18 A;  1UGM A;  1UGO A;  3UQB A;  4ANX A;  2M4N A;  3V61 A;  5G2N A;  2V3S A;  2KWV B;  1V81 A;  3HK0 A;  4K7U A;  3L10 B;  3ZNH B;  3N30 A;  4JQW C;  2KD0 A;  1P3Q U;  3WA0 A;  5L95 C;  1NI2 A;  1LM8 B;  2LXA A;  3QA8 A;  3FZK B;  2ZEQ A;  3PVL A;  4FN2 A;  1I42 A;  2KFJ A;  3PZD A;  3QJZ A;  1I6Z A;  3U30 A;  2R2O A;  2Y5B B;  2BPS A;  2Z59 B;  2V4L A;  2DEN B;  3H6N A;  4KDL B;  3QIJ A;  3QQ8 B;  1TGZ B;  1PQS A;  2MSE D;  3QCA A;  4W9J A;  2NBU A;  3ZVV A;  4KVG B;  2LI5 A;  1WE6 A;  2IBI B;  4MJS B;  2AYO B;  2GOW A;  4PYZ A;  1MG8 A;  3VVW B;  2KAN A;  3UIP B;  3W1S C;  2C7H A;  2D11 A;  2KOX A;  4I6N B;  2DHZ A;  4M8N A;  3KUC B;  3WIM A;  2RGF A;  3HM3 A;  4MJS A;  2I1K A;  2JVC A;  2BKR B;  2KFK B;  2MW5 A;  4RM9 A;  1S3S G;  3KW5 B;  4GGQ A;  2CHX A;  4HWF A;  2KWC A;  2CU1 A;  2N7E A;  2KHW B;  2UYZ B;  3C0R B;  4LDT B;  2NS5 A;  2C9W B;  2ZNV B;  4F7Z A;  3RUL A;  2HD5 B;  4EOY A;  3MJW A;  3VH3 B;  3B08 A;  3PHW B;  2LVP A;  2LUE A;  3DVG X;  1WXV A;  1WRD B;  1RFA A;  1E90 A;  2CKH B;  3NS8 A;  3PPA A;  3UQA A;  4EZL A;  2GBR A;  3FZF B;  5AEK B;  2FUH B;  2K8B A;  2MX2 A;  4ICV A;  4BBN C;  3APF A;  4GU2 A;  4HWH A;  1P9D U;  4A3O A;  4W9F A;  5AQN B;  1OEY J;  3VFK A;  3VHT C;  1YIW A;  2KDE B;  4GIV A;  1AAR A;  1YJ1 A;  1Q0W B;  1WR1 A;  1WXM A;  3MHS D;  1V9J A;  2A4Z A;  1EF1 A;  4DDG D;  4FJV B;  2Z0D B;  1E8X A;  3P2B A;  4EZK A;  5CHF A;  3RT3 B;  2LGY A;  2C60 A;  3PHX B;  4G50 A;  2DZK A;  2DZJ A;  4KIK B;  5AQU B;  2BYF A;  2ZPN A;  3Q3J A;  2KDB A;  3OAW A;  4LJP B;  4TUU A;  3JYU A;  2NPT A;  3ZUN A;  2KTF A;  2K25 A;  3KYC D;  4GMV A;  1WXS A;  3KUD B;  3EHV A;  3VDZ A;  2CHZ A;  2V1Y A;  4NAW A;  1KLV A;  1UBI A;  2KWU B;  2MWS B;  4WQO B;  2EMS A;  3TIX A;  2JF5 A;  5KHO A;  1V5O A;  4FHJ A;  3RZW C;  2NPT B;  3K9O B;  1WX7 A;  2FCQ A;  3WAP A;  1KJT A;  4IM2 A;  5AZG A;  2FCN A;  2K8C A;  3QC8 B;  3WAL A;  4WWN A;  2REX A;  4NAW B;  1WYW B;  2XBB C;  4F8C B;  1UK5 A;  4WJQ A;  1OQY A;  1E5W A;  1R4M I;  3A9J A;  5C23 A;  2AL3 A;  4II3 B;  1WJ4 A;  2PE9 A;  4HDQ A;  2EMT A;  4TQ1 A;  5L83 A;  4W9E A;  3GZN I;  5AQG B;  2JPH A;  2KDF B;  3JVZ X;  3PT2 B;  3TMP B;  4JGH B;  4WAA A;  2FCS A;  2J7Q B;  1H4R A;  4AJW A;  2BWF A;  4FJZ A;  4W9H A;  3L0W B;  1V5T A;  4B95 A;  4B6W A;  1YQB A;  2GBK A;  2OJR A;  1VD2 A;  4JL9 A;  4W9G A;  1E7V A;  1WH3 A;  2IYD B;  3EC8 A;  3UGB B;  3V6C B;  4GB9 A;  4DHZ E;  4GOC A;  5AQT B;  2C5L C;  3DBR I;  1E8Y A;  3FZH B;  5D6J B;  3ZKJ C;  1EUV B;  1WIA A;  3IHP C;  2J0M A;  4WJO A;  5CTR C;  2MBE A;  1WZ0 A;  4N9F 4;  3H1U A;  3CSF A;  4BVU C;  2O6V D;  4AP4 C;  2RR9 A;  4DHJ B;  2N9X A;  2NBV B;  3ZLZ A;  2N9P C;  4JIO U;  2KMA A;  3H7S A;  3APC A;  4MDK E;  3L17 A;  4HCN B;  3ZRF A;  1WGH A;  3N3K B;  2HE7 A;  2ZVO A;  3PLU A;  2LGX A;  2PE6 B;  3TCA A;  3PTF C;  2YVC A;  1WE7 A;  2JZZ A;  3DVG Y;  1C1Y B;  3VTV A;  3BY4 B;  1P98 A;  4K1R B;  4MGI E;  1UD7 A;  4CHK A;  1L7Y A;  4YL8 A;  5CHW A;  1OEY A;  4MGZ E;  2OOB B;  2C7N B;  2BYV E;  1XD3 B;  2MA9 B;  3DVN V;  4W9K A;  5DPW A;  2LXC A;  1WJ6 A;  5AQO B;  3UF8 A;  1U4A A;  3WAN A;  2LVO A;  4EEW A;  1ISN A;  1RAX A;  2IO2 B;  2HTH A;  4HDO A;  5CHV C;  5LLI A;  3VH4 B;  4BKT A;  3FZL B;  2JT4 B;  2DAF A;  3KH0 A;  2KMC A;  4WJP A;  3H9D A;  4MEL A;  3PSE B;  3A33 B;  1WX9 A;  3DQV A;  2HJ8 A;  1LFD A;  3LDZ E;  4X57 B;  3T8M A;  3T9L A;  1WR6 E;  2L3Z A;  2DX5 B;  2MQJ A;  2KZR A;  2LZ6 A;  4FHK A;  4W9L A;  2KJ6 A;  4E3C A;  3ML9 A;  2K39 A;  2KNB A;  3VAW A;  4KZ0 A;  2N9E B;  3UIN B;  5AQF B;  2JWZ A;  2KVR A;  1GC7 A;  1SE9 A;  5FR6 A;  2JRI B;  3TL5 A;  2UWQ A;  4DDI D;  1Y8R C;  2MBO A;  1RRB A;  4IG7 B;  2D9D A;  4W9I A;  1WGR A;  4A3P A;  4FAD A;  3V60 A;  3ALB A;  1WI0 A;  3W1Y A;  2KX3 A;  2LGD A;  3OJ4 B;  5IA7 A;  1OGW A;  3PGE A;  4MH0 E;  2R2Q A;  4HK2 A;  4FA6 A;  2A5U A;  4CO7 A;  4BBN F;  2K8H A;  2ZPY A;  2N1W A;  2I1J A;  3ONS A;  4RM8 A;  4HWC A;  1P1A A;  4PS7 A;  2XEW A;  3PLV A;  5G55 A;  4IM3 A;  1WY8 A;  2K1F A;  1J19 A;  1NDD A;  3Q3F A;  2B3A A;  1TBE A;  1E8W A;  1XT9 B;  1F9J A;  2M1M A;  2YLM A;  3ZNG C;  2MCN B;  5JH5 C;  3VXW A;  4GDL A;  4FBJ B;  1X1M A;  5DCN A;  2DZM A;  1WM3 A;  4MSQ B;  3V62 A;  3ZIM A;  4URK A;  3LJ3 A;  3AUL A;  1WJN A;  4DXA B;  1RLF A;  2Z0E B;  4IC7 B;  2ZVN A;  3H7P B;  1WX8 A;  2L7R A;  3PRZ A;  2NCN A;  4E71 A;  1NBF C;  5AQH B;  1WJU A;  1GC6 A;  2VRR B;  3DPD A;  1V80 A;  1YD8 U;  3VTU A;  1OTR B;  3A9K B;  3PRE A;  5AQL B;  4TQ0 A;  5AQM B;  1HE8 A;  2FAZ A;  4EKU A;  2ZZP B;  2KLC A;  1UEL A;  2D3G A;  3FZM B;  4W9D A;  2ZCC A;  3WAM A;  4GDK A;  3NHE B;  3DBL I;  1R4N I;  1WGY A;  3PS6 A;  2DYO A;  3R7R A;  1KOT A;  5AQQ B;  2KFK A;  3DDC B;  4W9C A;  5DPS A;  2KC2 A;  5D7G A;  3RYT A;  2KQS A;  3DCG A;  4NPN A;  2BWE S;  4M0W B;  4NY0 A;  4OVV A;  5BO4 B;  4NJ7 A;  5E6N A;  1CMX B;  4AUQ C;  4MM3 A;  2M17 A;  2LVQ A;  3LDQ B;  1P0R A;  2MBB B;  3DVN U;  2K6D B;  4AOF A;  3APD A;  2RPQ A;  4I6P A;  3PRP B;  1IPG A;  2PJH A;  2KJR A;  1T7S A;  4NNJ B;  4HWI B;  5D94 A;  3NOB A;  3ZNZ B;  2RD0 A;  2L76 A;  2ZCB A;  4GN1 A;  4NQK E;  4BFR A;  2DZI A;  4XX5 A;  2G45 B;  3R66 C;  4J6I A;  3ZO5 B;  3MTN B;  2KDI A;  2NBW B;  4HLE A;  3R3M A;  3L13 A;  4IWP A;  1UZX B;  3KYD D;  4ZDV A;  2J0J A;  2NR2 A;  2G4D B;  4A20 A;  1H8C A;  3VUW A;  4IW0 A;  3AU5 A;  3A8Y C;  1EO6 A;  1WGD A;  4GDL B;  2XK5 A;  4LJO B;  3WAO A;  3SU8 X;  3VUY A;  2LAS A;  4ZRK A;  4CYE A;  1WZ3 A;  2BKF A;  2WDT B;  5E6P A;  2KX0 A;  3NZS A;  2L05 A;  1Z5S B;  4TV3 A;  3TBL D;  2JXX A;  4EFO A;  3H7P A;  4PS8 A;  2PEA A;  4ZRI A;  3A4R A;  1I35 A;  4OVU A;  2QHO A;  3QK0 A;  5J17 A;  3ZDM C;  3OLM D;  1ZW7 A;  3CST A;  5JZE B;  2N4F A;  4HPL B;  2LD9 A;  3ECI A;  3V6E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...