4HWKA

Crystal structure of human sepiapterin reductase in complex with sulfapyridine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
GLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrahydrobiopterin biosynthesis as an off-target of sulfa drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/antibiotic
molecule keywords Sepiapterin reductase
total genus 91
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2012-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hwkA00
3NTRA 4GKVA 1C0KA 2O50A 5F1KA 3T7EA 2NU8A 4ESOA 2CMDA 3V8BA 3JQAA 3S55A 1VE9A 5FWNA 1DB3A 3UFXA 1I3LA 4RPGA 2ZJ1A 4L75A 4LMRA 1OMOA 2IXBA 1PL6A 4KDFA 4LW8A 5CDYA 4NR0A 5EMHA 1BW9B 5GZ3A 1SEPA 2D3TA 4FCCA 4GI2A 1E3IA 2IZZA 4OKIA 2EWMA 3O8QB 4B79A 1G0NA 2H9IA 2X9VA 3FR7A 2CDCA 3OETA 1E7QA 1SAYA 1E7RA 4A26A 1JWBB 3E9NA 4XDYA 3CKYA 2X58A 4GMFA 2DBQA 1YBAA 3C24A 3V5NA 3DBLB 5AXAA 2LDXA 1LSJA 4NDNE 2JAPA 2CSUA 4IDCA 1RM3A 2BF7A 3F4LA 4PCVA 1L7DA 1H2HA 4ALJA 3WXBA 4PG4A 3ZZNA 1Q2XA 1DLJA 3E9QA 3B70A 3ICCA 4LCEA 4NU5A 4R4JA 3H8VA 4II3A 3KSDO 5JYEA 2HK9A 2HJSA 1OFGA 4TZKA 1OBFO 4R9RA 3TJRA 3FWZA 1MG0A 2O23A 2YV2A 3WR5A 1U28A 1KIFA 4YBZA 3HB5X 3ZWOA 4FJ2A 4O5OA 3GHYA 3OFSA 1ZJZA 4WCFC 3D4NA 3FNEA 1YB4A 3LYLA 1Z45A 4LISA 1XQ6A 3E6AA 4QUKA 5LDGA 1LTHR 4WEQA 4NZ9A 1J5PA 1IHYA 2UYYA 4EUEA 2GDZA 1ONOA 5DDIP 1AN9A 3ROMA 3W4IA 2FR0A 3F6YA 4D44A 4D7AA 1NR7A 5A9SB 4KMSA 4CV1A 3UVEA 3JYLA 2RIRA 4JBGA 5J23A 1IPEA 2CFCA 2VHXA 1U3WA 4RVUA 3DDNA 4DPMA 2X0IA 1YWGO 3GOHA 3NTQA 5DBFA 4O6VA 4UUNA 1MA0A 2NADA 2R2GA 1PZHA 3SBOA 1UDCA 4CM4A 2OBNA 4OSPA 3PFFA 4OO3A 1QYXA 4I9HA 4XIJA 5JDCC 3NRCA 3IJRA 2Y05A 3GY0A 3GGGA 4N5LA 2YV1A 8LDHA 2BGKA 2BLLA 3ZU2A 1PR3A 1LUAA 1HDZA 3PYXA 2WE8A 4XJSA 1E0DA 5DULA 3RKUA 2NM0A 2GUGA 4NJMB 3ETEA 5JO0A 3JYOA 4WLFA 5BNFA 3ZI0A 4ZGWA 3PWSA 3QVSA 2X5OA 4YRDA 1RM4A 3C1AA 1LRKA 4D3DA 2V6FA 4BNIA 4CM5A 1KVRA 4KP7A 1ORRA 3ZW9A 3DOOA 4E12A 5TGDA 3WMXA 4E5KA 5G2OA 3UOGA 1M6HA 4IQGA 4F45A 3WIDA 3AFMA 3JQDA 5DNAA 3L6EA 4WOKA 4XX0A 4MVJP 5A03A 2E4AA 2HKIA 1D4FA 4I8XA 4WUVA 1HLPA 1JWAB 4JQCA 1JA9A 3JQFC 5H81A 2V6GA 4N5NA 4E6PA 1T25A 3SLKA 4CMEA 4OM8A 2PV7A 2EKLA 3R0IA 2BH9A 2JD1A 1BXKA 1GAEO 4I9UA 2FHSA 4CMBA 4YPOA 3FNFA 1MLDA 1Q7BA 5TRTA 3ABIA 2P4QA 4C4OA 4C7JA 5COQA 2EW8A 2E37A 3C7AA 4WKGA 1V0JA 2CF6A 3ITKA 3W6ZA 1R0SA 3GEMA 4FSHA 4ZA2A 2DBRA 2JL1A 2XF8A 3BMCB 3DBLA 5F5NA 4KDEA 3LT4A 5DCWA 4OXKA 3TZ6A 4EZBA 1N1GA 1ISGA 1LSSA 3RAJA 3ZNNA 4DIOA 3JQ7B 4BO2A 1RM5A 2BHLA 1C1XB 2VUUA 3VH3A 1HDYA 1FF9A 2ZTLA 2DC1A 4RZIA 4PN3A 4XGKA 5L4LA 3EAGA 4FDAA 1P9LA 4NMHA 3DO5A 3O8QA 5TT0A 3TN7A 3AM3A 2GZ2A 2OP0A 5A3VA 1ADFA 1X7HA 1VKOA 3HHPA 4OL9A 5CG1A 1E3SA 3RJ5A 1WLYA 4B8WA 2UUOA 3BA1A 3DB2A 4BV8A 4CM7A 4JBHA 3WS7A 3BTVA 4YQZA 4Z0HO 1KY4A 2C20A 5I7EA 2WTBA 2HRBA 2EF1A 4MIYA 4BO7A 2GN4A 1HDCA 4B3JA 4XQ9A 4P8RA 4BQRA 4R69A 3JD2A 1DIBA 1NVGA 3VPSA 3OA2A 3VOSA 4DREA 3BTUA 4MVJI 4BOYA 3KVOA 4E32A 4YJHA 4YB8A 3WMWA 3TQHA 4CMGA 3D1LA 4CQMD 1GV1A 1P0FA 3M6IA 3UGKA 1E1LA 4GGOA 4FS3A 4E30A 1KC1A 3PLNA 2BFOA 3ZV4A 3NKLA 4JNKA 3UXYA 1E5LA 1HYEA 2FMUA 2J5QA 1U4SA 4XCVA 3ONEA 5KVQA 1B8UA 3H9UA 3WSVA 3TZKA 3UUWA 3GVPA 4NPCA 1NVTA 1ZEMA 2W2KA 3INGA 5C7IO 4BB6A 1DIGA 3IIEA 2GYYA 3FSRA 4J91A 2F1KA 2NU7A 4GQAA 3HZZA 5ICMA 1YJ8A 1PU2A 1N5DA 3VHRA 5IF3A 1HWYA 1MUUA 4DBZA 1SB8A 2P5YA 3GFBA 1EVJA 4Q3AA 2OFPA 2HSDA 4WLUA 3L4SO 3R1IA 3VZSA 1WDKA 2NUAA 3WFIA 1WPQA 1CQIA 1X13A 3I6IA 5HM8A 2JKVA 5B4UA 3HDJA 3RUHA 4GKBA 1F14A 5AXCA 3W8EA 1NQAO 1YXMA 3AUSA 3D7LA 1C0IA 1BXZA 3BHIA 2VRCA 3NGLA 3VDQA 3E82A 1VRWA 3DXFA 5CDTA 2JHFA 3GZNA 2Q4BA 3GH3A 4EI2A 1WDLA 1K6IA 2NV6A 3VH2A 3ASVA 5TLSA 3NYWA 1KETA 2VTEA 1C1DA 4JJFA 1DIAA 2QX7A 3Q9NA 1P33A 3NX4A 3QA9A 2OXIA 1SNYA 3QE3A 3R3JA 3LLSA 3AI2A 3G1UA 1LDMA 1Q0LA 5CDUA 2I99A 4FJ0A 3RC9A 2A9FA 3NEPX 4FC7A 4LCJA 3V1YA 3GRKA 5A9RA 1D1TA 3DC2A 3WJAA 3FI9A 4IGFA 2BFMA 4CM4B 2B0JA 2FP4A 4LVUA 3ZH2A 4BO9A 3U9LA 5B4VA 4WNIA 1X0VA 1MG5A 4EJMA 1LLUA 1H6AA 1NVMB 3K96A 3P2OA 1ZIDA 5F3RA 3CEAA 3ZNPA 1NHWA 4TZTA 2P9CA 3H9JA 4G81A 4DLLA 4IIUA 7MDHA 3N74A 4I08A 2QZ9A 1R4MA 4DGSA 1EVYA 3I9MA 2JHGA 3KOUA 1RPNA 4LVCA 1BGVA 4UVEA 3GAZA 1XU7A 1F17A 4TRJA 2J3HA 1A9YA 4IUYA 5COBA 5L40A 1RYDA 4A10A 4P38A 2WD8A 1S6YA 1ZK2A 2C82A 4JP2A 4OXYA 2FSSA 2C0CA 2BGLA 1LBEA 3U0BA 3ZWBA 2O3RA 1DO8A 5L9AA 1EVZA 2YFQA 3ZV5A 5JXWA 1LNQA 4ZVVA 3O4RA 4D0SA 4YJGB 3VKVA 2ZCUA 2W2LA 1ZMOA 3EHEA 4O63O 2F00A 4RV9A 3I3OA 1CDOA 1PGPA 3WYBA 1R4MB 2EKQA 2FPGA 3ANLA 2ZTMA 4PLZA 1WXDA 1PGJA 4I5FA 2YV3A 4LSWA 1W73A 3A06A 2A4KA 1JVBA 1KS9A 3AU8A 4MVJA 3SX2A 4EUFA 4QT0A 1AXEA 4EITA 1TXGA 2O3TA 1GUZA 2WM3A 3HQ4O 3PDJA 5F21A 3TSCA 2Q45A 4ZQHA 5TJ9A 4CUZA 2GRAA 6ADHA 2XOXA 3D3WB 1P1HA 2QZZA 4J3FA 4N7RA 1DFHA 1QG6A 1MFPA 2NU6A 3ZNQA 4ROSA 4W99A 3EZLA 2OP1A 4TRRA 3ULKA 5IDYA 2EP5A 4LGVA 3GR6A 4Z0TA 4CL8A 1D8AA 5IZ4A 1MP0A 4DQUA 4L8VA 3KB6A 4GX1A 3GK3A 3JD4A 1JKJA 2PZMA 4CLDA 3KETA 4BGEA 1HE3A 4OMUA 3TWOA 2BD0A 4HV4A 4JIGA 5FEUA 3AFNA 1I32A 5IAAA 3PIIA 2YDYA 4ONEA 5CEJA 1P45A 2B36A 5L7WA 4UAGA 5GZ6A 3TFQA 2RH8A 3WTCA 2WD7A 1NNUA 2Z1NA 3PLRA 3WWYA 1YB5A 1UAGA 3S2IA 2YDXA 4QTZA 5EIOA 4CLOA 3FRJA 5HS6A 4Z3KA 2QG4A 2HAEA 2R00C 4PLVA 3RSHA 2IDZA 4UEKA 2YY7A 3JQ9C 3O26A 5GMOA 1HT0A 3L6DA 4IPTA 1R37A 1GUFA 3BYZA 5I9MA 2C59A 1I0ZA 3M1AA 3MTGA 4J9VA 4JJGA 4AJJA 2LDBA 4K1LA 1X7GA 2I6TA 3H3FA 4L73A 2HU2A 3INTA 3Q11A 3RFVA 1YQXA 1SPXA 5G0SA 4E31A 1VL8A 1DOHA 4TRMA 2VWGA 1BG6A 1T1RA 1HL3A 3ONFA 4HXYA 1NBOA 2O3JA 4LK3A 5A5FA 2OMEA 1QMGA 2VZ0A 4IM7A 2C5EA 4PLCA 4F3YA 3F3SA 5F1OA 1KVUA 4DL9A 1QR6A 3QIVA 1LRJA 3QWBA 4H16A 1UAYA 3GDGA 2H1SA 3AK4A 4PVCA 3ZHZA 1HEUA 1E3WB 3ZHYA 1KVQA 3JQEA 4HNGA 3ADOA 1HZZA 3JV7A 3H3JA 3U49A 1NFQA 1YL7A 4QO7A 2BELA 1VL0A 7ADHA 4R1SA 4WGGA 5FFFA 5B1YA 2FR8A 1R16A 1WWKA 4KQWA 4QO8A 4LMPA 2PKQP 2Q2QA 3TL2A 4JN6B 2DU8A 2ZJ0A 2JD2A 1DDOA 1KY5A 2PLAA 3I9NA 1KVTA 2QRJA 3QWAA 1NHGA 4BGUA 2EERA 3OEYA 4WNCA 1YL5A 1YE3A 4PG5A 2PZKA 3U3XA 1KEWA 1Q0HA 2P9GA 1XYGA 2YHIB 5TSDA 3R6DA 1DIHA 4CM8A 1BSVA 4R1UA 4YTEA 3I6QA 3CE6A 1MXFA 2ZYDA 4XKJA 3ZWCA 3KYDB 2Z95A 3MCVA 3QJ5A 3OEWA 1IULA 2PD4A 3U4IA 3ROKA 4YRAA 1N7GA 2Q2WA 3BXXA 3DBHB 4MOWA 3MEQA 1H6CA 4KQXA 4EDFA 2RHCA 4QFCA 2ZTVA 1RWBA 3F5QA 4AJNA 1Y8QB 4AICA 2CDAA 3C7CB 3WJ7A 1Z73A 3RIHA 1Q0QA 3I9LA 3IC5A 4L0QA 1ISIA 3OQ1A 3B6ZA 3WFJA 1HRDA 2EGGA 1EUDA 4AJ4A 1CERA 3PTZA 4IDGA 1IY8A 5BNIA 5KJFA 3TPCA 4XQEA 2JFHA 1JLLA 2VHYA 5L45A 1HKUA 1OI7A 1YQGA 3PHGA 4J9UE 2P68A 1AE1A 2J3KA 1U2DA 3GGPA 5A06A 3VPFA 1KEPA 3CH6A 3FPLA 5LDHA 3GAFA 4IMRA 4W9NC 2AW5A 1V3TA 1Z6ZA 1H9AA 3P2YA 4E5NA 4Y98A 3RC2A 2E6UX 3DQPA 4BIIA 1A7AA 3D4PA 4FFNA 4PLWA 4BKRA 1IYZA 4EUHA 4QXMA 1TI7A 1UR5A 5BSHA 3D3EA 2NNLD 2VTDA 5H83A 2Z5LA 4B4WA 5DZSA 3RKRA 3UCXA 4FFPA 4P4NA 4IY1A 3WGTA 4FFRA 3VZRA 3FTPA 3C7DB 4NK4A 3FWNA 1R0LA 4YJFB 4NBRA 1DJQA 1W8DA 3NV9A 3OSUA 2X5JO 1N7HA 2V6MA 3WGZA 3DFZA 1PGQA 1C1DB 1A4IA 4FFLA 4HY3A 4A7PA 3RD5A 4EGFA 1T2AA 1GZ4A 2Y0EA 3X2EA 5JAMA 5IXSA 3ZWAA 5F5LA 5KKCA 4FFOA 3ZNOA 1TA4A 3JD0A 1J0XO 4PLTA 2FPPA 3KYDA 4CJXA 4DPLA 1AHIA 1T2EA 3PJEA 3M1LA 3ITDA 3KUXA 4U5QA 3I9OA 3KLPX 1Q1NA 1F8GA 5JY1A 2PR2A 1PQPA 4KZPA 3RUAA 1I2CA 4RL6A 1NWCA 2VT2A 4XD2A 2B4RO 1UDBA 1Y6JA 2EEZA 2GGSA 1TLTA 4TSKA 3PZRA 4A73A 2CF5A 4J0FA 1NTOA 4DMMA 2CVQA 5BT9A 3DBRB 3NTOA 4RDHA 1VSVA 3U4CA 1P77A 5TNXA 3AUTA 2P91A 4FQ8A 3DZHA 3ZHXA 2EIHA 1PJTA 2OO5A 3GNSA 2X5KO 4PLHA 3AY6A 4JJIA 3HUDA 3KYCA 4ALKA 1ZVMA 3OHSX 2XAAA 4JX8A 3TZQA 4WLNA 2PD6A 3QLJA 4GLOA 3FBGA 4R3WA 4FN4A 3RUEA 3DTYA 3DR3A 1M75A 2HCTA 4EW6A 2EHDA 3G17A 4AG3A 3D0OA 2DBVO 4IDFA 4JGBA 1HXHA 3GMDA 1P1IA 2GF2A 2DFDA 1YS4A 1YBMA 2ZQYA 4ALMA 1ZK3A 4DYDA 5A4DA 1LJ8A 5IG2A 3L07A 4GBJA 4WEOA 5IN5A 2H63A 4ZQFA 4Z3DA 1DBVO 3H5AA 4INAA 4J1SA 4P4LA 5IJZA 1PJLA 1NP3A 1ADGA 5JO9A 4MP3A 4H15A 1W6UA 5CPBA 4K28A 4HFRA 4GSKA 3EVNA 2AQKA 2PY6A 3PJDA 4TKMA 2XXBA 1BWSA 3OP4A 2W98A 4IGEA 3A14A 1VJTA 4XYEA 5DBGA 4BO4A 5L7YA 1NWHA 1WW8A 1I2BA 3B1JA 4DMLA 1G0OA 1IL0A 1KBZA 1PWZA 4IJKA 3STHA 5DP2A 1A9ZA 2WEKA 4TVOA 1BMDA 1EE9A 5K6AA 1T4DA 4MIOA 1U5CA 1I2ZA 1W4ZA 2Y1FA 1GTMA 2Y99A 2YJZA 4Y6SA 1LXCA 2Q1WA 1FDTA 4BQPA 1GADO 3ZWWA 1SCUA 3L0DA 3CZMA 4XEHA 3NDJA 4M86A 3JQ8B 5THQA 3BMCA 4OXNA 1F12A 3ETGA 5FI5A 3IS3A 3MTJA 4BNZA 1GY8A 2AQHA 4RVSA 3PHLA 3EUWA 1JQBA 4BNHA 4G65A 1WMBA 4Z9FA 3K2EA 1MGOA 3Q9UA 3MWDB 1XEAA 3AOEA 1RM0A 5ENDA 5BSFA 5L53A 1I30A 4NU6A 4ALNA 3GGOA 2BGMA 1ZSNA 4M8SA 4Q39A 3VVBA 2WJPA 3C3XA 2D1YA 1C14A 4DBVO 3C85A 2VHWA 2O4CA 3E1KA 3V2HA 1HYGA 1P1KA 2CNBA 1GZ6A 3A4VA 2C29D 5L3ZA 4IS2A 5KVCA 4RO0A 3RI3A 1AXGA 4Y67A 4CV3A 1R66A 1QLJA 3S2EA 4ZRMA 1OOEA 3WQQA 1GR0A 3BMNA 4EYEA 2RBEA 5HBRA 4FBGA 1GEGA 1XKQA 3JYNA 2JAHA 2ZB7A 3KBOA 4ILKA 4R9SA 1OC4A 4J16A 3VTZA 3WGOA 1NQTA 4Z0PA 1XU9A 4OQYA 1I3KA 4J6FA 3RBVA 4HWKA 4PGFA 3U4DA 1O8CA 4BUCA 5T64A 1YB1A 1A72A 1M66A 3GUYA 4CLEA 3BIOA 3KYCB 2GLXA 1PTJA 1XQ1A 1XR3A 4NBTA 3UCFA 1E7YA 4QX6A 3RC7A 3QV1A 3VPGA 1F0YA 4RLSA 4BNNA 2OL4A 4O0LA 1NPDA 1W0CA 3JQFA 2VWPA 2AQ8A 1PR9A 2B5WA 3K2BA 3LT1A 2C7GA 4B7XA 4J49A 3VZPA 1TT7A 3LK7A 1PQWA 1NYTA 5C37A 1X14A 2E49A 2IODA 1GDHA 2AE1A 3PQDA 4UEJA 3E48A 2VOEA 4BMVA 1WZIA 2JCVA 3VZQA 1A5ZA 2FY8A 3F1KA 1ENOA 2EW2A 1HSOA 3BHMA 2DT5A 1EZ4A 4GPD1 4R68A 1JTVA 3IOYA 4XA8A 4D46A 4FIZA 3ZWMA 2FOIA 3SJUA 2NLOA 4NBVA 3RFXA 1HF3A 4K6CA 3HN7A 4AJOA 4W82A 1XSEA 3FF4A 1BVRA 1NQ5A 2PGDA 4NIMA 4BGIA 2O3QA 3QVXA 2NVBA 3SLGA 3HSKA 3ZU4A 3S2FA 1YQDA 4ND2A 3WG9A 3CXRA 4M89A 1WVGA 3PYLA 1P1RA 1FDSA 3NAQA 4FOOA 4QQRA 1SB9A 1Y1PA 1VM6A 5EN4A 2X0NA 5TIIA 1XELA 4UUPA 2CD9A 2Y66A 3ZHBA 2PZLA 5A1TA 3ZWXA 3MJCA 5DOVA 2NTVA 5F1PA 3L6OO 1ML3A 4B7CA 2PKQO 3P19A 4M55A 3KXDA 3GN2A 1UXGA 4BNXA 3AY7A 3SC4A 3WGGA 1X15A 5L4SA 1AUPA 2QQ5A 2DLDA 4RPHA 1GPDG 3ANMA 2ZK7A 4R1TA 2JD0A 4CMCA 1XCBA 2H5LA 3EDMA 4PLFA 2AEJA 3AU9A 1GU7A 1GQQA 4N18A 2WMDA 2Q2VA 4D3FA 4CM8B 3K9QO 5AOVA 4XYMA 5EQFA 2ET6A 4RJTA 1LQTA 1PX0A 4JP3A 4M87A 1M76A 1ZXBA 2VWHA 4XB2A 1I01A 2R6JA 3JQ9A 2ZTUA 1A4UA 4HKTA 2J3IA 3PHIA 3KV3O 4BNGA 4B3IA 2JFFA 4U8GA 2Y68A 1UZMA 2ZQZA 2YHUA 4WLEA 2DM6A 3K6JA 3LDHA 2X9NA 2VRCD 3DZIA 1PEDA 3QWHA 1XA0A 1B0AA 5U9CA 3ZWYA 4BNLA 3F46A 5JAZA 3WLFA 3PI7A 3VTFA 1K6JA 2HMWA 1UZLA 3B20A 4WLVA 4K26A 4R51A 4WCFB 1EFLA 3DFUA 5DCUA 1U4OA 1R4NA 4GVXA 5FF9A 4YDRA 3G79A 4LSMA 5A5EA 4WK6A 3CIFA 2OUIA 2DKNA 2GR9A 4CLRB 1HE5A 3ZWNA 1IB6A 1DAOA 4R5HA 4ND3A 4YAKA 1PGOA 3QWIA 2X1HA 4BO6A 3VAZA 1IE3A 4ZICA 1BVUA 2A92A 1V3VA 2O7SA 4L4SA 5JW6A 3DAGA 1E7WA 2PA3A 5GZ1A 3GG9A 2NVUA 5CHEA 2V7PA 4J7UA 4J4HA 5A3JA 3PYMA 4HNHA 1VSUA 3IP3A 3Q3CA 4B7UA 1G6KA 4ND1A 1UXKA 2IZ1A 3MWEB 4QECA 5LC1A 4CODB 5IFLA 1NFRA 5JPIA 4JK3A 4KUHA 1N8KA 3DMYA 4WPGA 3HADA 1E92A 1OC2A 1LI4A 3LLVA 4ZD6A 1ISMA 3JQ8A 4MKXA 5IZCA 3ZV6A 4BVAA 2B69A 2PKRA 3WBBA 1KERA 3JCZA 4ALLA 4CUKA 3JQBC 3RJ9A 4CLRA 1IHXA 3RBXA 1DEHA 1X7DA 3QVWA 1B14A 4IXWA 2C7VA 3HJAA 3OMLA 4IQ8A 2I3GA 2A94A 3L4BC 5HTOA 1P44A 2G1UA 4D3SA 1C0PA 1UDAA 4YA6A 5U4QA 3IDSA 3NDRA 3NT2A 4I5EA 4YT8A 3L9XA 3PFWO 4OSOA 1UP7A 1FDUA 4MVJD 4FOSA 2CVZA 3BMQB 5HRUA 4ZJUA 3DHEA 4KUEA 1I24A 1PZFA 4RPLA 1PJQA 3CTMA 1KEVA 4BKPA 3GMSA 1FDWA 1TT5A 4DTIA 1YDWA 2E48A 4X54A 1DHRA 1VLLA 5B12A 2NVUB 3FN4A 2FZEA 4HFJA 2C5AA 4QFDA 1I36A 1I3MA 1LSUA 1P1FA 4W7IA 3UICA 2EP7A 2O4UX 5KJ1A 1ZK1A 3PPIA 3PHJA 1YGYA 4ZU3A 5JAQA 4E0BA 3Q1LA 1T24A 5I9LA 4H3VA 2EJVA 3OH8A 2POQX 1NXQA 5I8ZA 1LSOA 3DMTC 3BMOB 1DLIA 3I83A 3PZBA 4CMEC 2VHVA 3ASUA 1HDXA 2D4AA 4FR5A 3OA0A 5ES3A 1U8FO 4Q3BA 3ZV3A 2VT3A 1U2GA 4BNUA 1C0LA 2AMFA 2VN8A 4RORA 1JAXA 1DRWA 4FB5A 5GY7A 1LU9A 4YJGA 3H9QA 4EBFA 1PJ3A 2X8LA 2NACA 3RBZA 1JU9A 1T2FA 2VUTA 4DC0A 3EK2A 1QV7A 1Y7TA 2JFGA 3GVIA 1PJSA 1NPTO 5TQVA 5ER6A 3DHNA 5JDIA 3KHUA 4MVJG 4BNVA 4JROA 3KSZO 3D3WA 3FTNA 4ZQEA 5U1PA 5JMWA 2Y1OA 2HMVA 4S1VA 1V9LA 2FSVA 2X0JA 1YOVA 3PEFA 2J3JA 4LRSB 2HQ1A 3TDKA 3MJVA 1ONNA 3BAZA 2O7QA 4YAIA 3HFGA 1V3UA 4DIBA 2GPTA 5DP1A 4Z9YA 5G0UA 5K0ZA 1UUFA 3GPIA 4GMGA 4AJHA 3OJEA 3D4OA 3ZW8A 1YL6A 3H4VA 4XYBA 2Q49A 4RZHA 3PDUA 2VOJA 3JQGB 1HDGO 3DZFA 4RQUA 1QLHA 1CRWG 1ZSVA 4EJ6A 2D5AA 1X1TA 4NK5A 2GSDA 2BFPA 2QRKA 1JKFA 4M49A 5FI3A 2I67A 4D79A 1U7TA 1CQJA 1JW9B 1I3NA 1QYVA 4HADA 1RJWA 4PLYA 5BNTA 4M54A 3WB9A 1I33A 3JQGA 2ILTA 4RVGA 2VHZA 4OH1A 3MJEA 5IN4A 1O95A 1PJ2A 2CZCA 3E18A 4HFNA 4W7HA 3C8MA 4KTVE 2WE7A 3K73O 2WSBA 1TB4A 3LZ6A 1H93A 3IMFA 4U0JA 1ADCA 3PJGA 1E1MA 1LLDA 4UULA 4DVJA 4DQVA 5BR7A 3BZUA 1PZGA 9LDBA 3OM9A 3MOGA 2BKAA 2E82A 5L4NA 4I5GA 5ILOA 4GGPA 1ZK4A 4GL4A 1DC5A 3GHHA 2GN9A 2PZJA 4J1NA 4RF3A 5KVVA 4MO2A 5DN9A 2WYWA 3GPDG 3NT5A 4GX0A 1XWFA 4CR7A 1P1JA 3UKOA 2PNFA 2VZ8A 1Y8QA 3AOEC 4ZN6A 1DFIA 2Y0DA 3H65A 2Y1GA 3S1LA 3JQAB 3H2SA 4AJEA 2YQ5A 3L9WA 4RDIA 1H9BA 3ORFA 4XB1A 2NWQA 3C1TA 3LT2A 4URFA 1HDOA 2W90A 2EKPA 3ZWVA 3RUIA 2AG5A 4B4OA 2YW9A 4DRYA 4ZQBA 1K3TA 2DTEA 4MP8A 1I10A 4HFMA 1BTOA 4ND5A 4GLLA 3DZKA 4IJVA 1U8XX 4CM9D 5DF1A 2X6TA 5T57A 1EUZA 5TX7A 1R6DA 4RPKA 1GL3A 2HLPA 3CINA 1PS0A 2DVMA 3GT0A 3W4JA 4E2ZA 3FCOA 1EBFA 4PLPA 4XYGA 1YVEI 3H7AA 2G5CA 2DTDA 3A9WA 1QYDA 2EXXA 3DHYA 4K6FA 3ENNA 1AHHA 4U0KA 2GASA 1Z7BA 3PK0A 4E3ZA 2ZATA 4PFJA 1CIVA 4CMHA 3QVTA 4XJTA 1U5AA 4ALIA 3I23A 4CMAA 4NHEA 1D7OA 1M67A 4OJNA 4YCAA 4IQ0A 2Q1SA 3LC7O 1SEVA 4PG7A 4CMIA 5CG2A 5AQ1A 4HBGA 3Q6IA 4IZIA 4R01A 5JC8A 3HDHA 4MKZA 3RQSA 3WYEA 1E77A 1MC5A 4BNYA 4A2CA 4RF2A 1IZ0A 4EEXA 1SOWA 4YAEA 3I1JA 2Q99A 4DYVA 1HYHA 2I5PO 5EQDA 1NPYA 3OIGA 3GQVA 5JFOA 4RPJA 4EEZA 3TF5A 2O3SA 1GUYA 3DONA 5A02A 4HX5A 3EY4A 3ZDFA 2DTXA 3UCEA 1Z82A 3K92A 5EL0A 4WOJA 5JY6A 1DRUA 4PG8A 5EESA 2Y1DA 5KJ6A 3G49A 1VI2A 2VYNA 4AJ1A 3AY3A 3AOGA 9LDTA 1N92A 1O9BA 4YYZA 1OAAA 4PRLA 3KEOA 1N1EA 4NFYA 3RWBA 4YT5A 1KOLA 4XWYA 3GEDA 4C7KA 2NTJA 4OYRA 2QRLA 3VVCA 2HK7A 1GEEA 1NAHA 2V6BA 4D42A 1DFGA 3JQBA 5TS3A 3T4EA 1ISHA 3LQFA 4PVDA 1I5RA 3U62A 6LDHA 3NDIA 3GEGA 4CM6A 1HLDA 3NGXA 4XRGA 4J4TA 4XZ3A 1BXGB 4L9RA 1EK6A 4XR4A 2EGHA 4YAGA 3HE3A 5BSGA 1XHLA 3PHHA 2P2SA 2FN7A 3VH1A 1F06A 5L7TA 4J1TA 5FYDA 2VYND 4CV0A 1ZZEA 1PGNA 2NTNA 2X86A 1PL7A 1WNTA 3W4KA 3EZYA 3ICPA 2QIOA 2B83A 1Y9EA 2FR1A 1ADBA 2HJRA 3WWZA 1AGNA 1GQYA 3QW2A 3RC1A 1ARZA 3SXPA 2C2XA 3WICA 4XDZA 3MOIA 1LEHA 5L51A 4P22A 5KWEA 4Q3DA 1J49A 2PK3A 3QVOA 1CWUA 3AJRA 2J8ZA 1KC3A 1ONPA 2YUTA 4TKLA 1PSDA 4DC1A 3PJFA 1UJMA 5T6BA 3IUPA 4BNJA 4R41A 4CQMB 4WASA 4DQXA 5C3MA 2B37A 3OECA 3U5TA 1C3VA 4B4UA 4TRNA 3AWDA 1ZCJA 5CFZA 3E9MA 3WGYA 4GWKA 3FPCA 3G1TA 3WSWA 4F6CA 3Q0EA 3TZHA 1QV6A 2JJYA 5MGBA 3PVZA 3EYWA 4CUJA 1NASA 2R00A 5EJ2A 3OJ0A 5T5QA 4BMNA 1MC4A 2AE2A 2ZB4A 3RUDA 2IEBA 3JQ6A 2Y1EA 3JD3A 4XGIA 2YQ4A 1Z74A 3E5MA 1O6ZA 4W9NA 4U7WA 2JCXA 3H2ZA 4OHUA 3OIDA 3AUUA 2I76A 1K89A 3RUCA 2P4HX 3OF2A 4RQTA 2O2YA 4B3HA 3WGHA 1VPDA 1Z75A 3H9GA 3LC1O 1EDOA 1XGKA 4M1QA 2GZ1A 3DOJA 3R3SA 3KO8A 3N58A 4IDAA 4OAQA 3PQEA 1EQUA 1Y5RA 4TQGA 3A1NA 4QSMA 4TVBA 1MXHA 3WQSB 1GFSA 1LC3A 4WE3A 4Y6RA 5JAIA 1E7SA 2IE0A 5IDWA 1N2SA 5IZCC 2GERA 5COAA 4PLGA 2VNAA 5I9NA 2HK8A 1Y8RB 1K6XA 2ZB8A 1ZUD1 3JQCA 1UH5A 2Q46A 2WWRA 5KJCA 3H9EO 4HUJA 2OZPA 4R5MA 1DHTA 5AVOA 5A04A 3I9JA 4TROA 2X9GA 1GCUA 3DL2A 2BRUA 4DXHA 5CP8A 1ISJA 4JBIA 1O5IA 2B4TO 5JSFA 2A35A 4FGWA 4W6ZA 3GUCA 1BDMA 4II2A 3E8XA 4L4XA 3WQRA 3DOCA 4CLXA 3E03A 2J6IA 1UZNA 2QW8A 5LCXA 4RVDA 1UP4A 1FK8A 3SVTA 5JYDA 4F46A 4KUGA 3K31A 3HB4X 4UEOA 3PWKA 1TT5B 1NM5A 4BKUA 1LLCA 1ZXLA 1DSSG 1PS9A 2ZB3A 2YZ7A 2WYVA 3IP1A 2VZ9A 5EPOA 5IXYA 3UF0A 3EMKA 1S7CA 1IUKA 3GN1A 4KWHA 1D1SA 3KLMX 1LA2A 3PP8A 1SZJG 3ETDA 4BNKA 4MIEA 3GZNB 4AL4A 1DC3A 2OOSA 3TNLA 5TJHA 3K5PA 1VC2A 3AM4A 5K9ZA 2SCUA 5AXDA 1Y81A 2AHRA 3ZU3A 1EK5A 3S2GA 1PQUA 2GNAA 5JCJD 2HDHA 4PG6A 2YHIA 3OQ6A 2YYYA 1U1IA 3MJSA 3WBFA 1YBVA 4R16A 4KOAA 2DPHA 3LSYA 1VKNA 4B8ZA 4Y8VA 1E6EA 3G0OA 4OOFA 1WDMA 2NU9A 1PJBA 1ULUA 1Y5MA 2NQTA 1XDWA 3GA0A 3GG2A 3GNTA 1X1EA 1PJCA 5EERA 3Q2KA 3I5MA 1E5QA 1GYQA 2W2KB 5HS4A 3JSAA 5KIAA 3PWZA 1ZEJA 3KRTA 3HDYA 4Z6KA 4YWJA 2DQ4A 2J5KA 1XIVA 3UAGA 3V1TC 4E4YA 3B1KA 3O38A 3GZ4A 1Q7CA 2Q50A 4WLOA 5JCXA 1U7HA 2X23A 1Z7EA 2I9PA 2OORA 1FXSA 4CLOB 1NAIA 3JQ7A 4Q3EA 1EMDA 1WAMA 3G3EA 3RROA 5AXBA 4R1NA 4FJ1A 2EJWA 3GFGA 1DAPA 3K30A 1VJ1A 1JKIA 3OICA 1ZFNA 5IDQA 4KTTE 3TFOA 1LDBA 3ENKA 2P9EA 4RF4A 1LLQA 3DZGA 3WX0A 1MX3A 4AJLA 5ITVA 3IQDB 4BO1A 2O3UA 5DOZA 1FJHA 2PWZA 5G4LA 5G0VA 2AEFA 2HRZA 3MJ4A 4AJPA 1QRRA 4UUOA 5H82A 4A27A 3EC7A 4CPDA 1MB4A 2CDBA 3TZCA 3CMCO 1JAYA 1WZEA 3CZRA 1ZJYA 2Q1TA 4E2YA 2WDZA 4OKNA 2CY0A 4J7XA 1YONA 1HZJA 2PGJA 3DBVO 3B1FA 1BHSA 1D3AA 1U3TA 3W8DA 1LDGA 3RVDA 3UHAA 3OJFA 5JE8A 1CETA 1HDRA 2JCYA 3NT4A 3UW3A 3TRIA 1R4NB 3ONDA 3MZ0A 3PIDA 1P0CA 1HE2A 3FD8A 3VC7A 4YVFA 3C1OA 4N54A 2UAGA 1JVSA 4ITUA 4PZDA 5JCJA 1TEHA 4R3NA 3LF2A 3QQPA 3PGXA 3D5QA 4RCVA 3PGJA 2NVWA 1MFZA 1VL6A 4D43A 2AEMA 4KWIA 4LN1A 3IKVA 1CJCA 2PTGA 4WCDA 4DIFA 1KVSA 3AW9A 3UH1A 1B8PA 3EVTA 4MVJM 1LRLA 3FHLA 4JLWA 4P4GA 4ZQGA 4GX5A 3H5NA 2W2LD 1XG5A 3OIFA 4UVIA 2TMDA 3OJLA 4UVGA 4CV2A 4IS3A 2ZIZA 4IZHA 3CSDA 5CPFA 2G17A 4CQLA 4CQLB 1E7MA 1O89A 5C7OO 2QHXA 4I1IA 2HUNA 3ZU5A 2XXJA 1HTBA 1B3BA 2ZYAA 1N9GA 3FNGA 2EV9A 4IJUA 2VYVD 2FPIA 4BNFA 3M2PA 2NSDA 1U3UA 4GVLA 4L74A 5C5IA 4B4VA 4UVHA 1E6WA 3VPHA 1X0XA 1B8VA 4BNTA 2OGUA 2H6EA 4J90A 2O48X 3GNQA 1PWXA 4FD3A 4BNWA 3ROPA 4CQMA 1EEHA 4J4BA 4YJFA 4EJ0A 2G0TA 4MINA 1GV0A 1SBYA 4G5HA 3HNPA 5TT1A 4OGWA 2VCYA 3RFTA 4YR9A 4BB5A 4BO8A 1LX6A 1U3VA 3QHAA 4J2OA 3GVHA 1E3EA 2RAFA 4CMKA 4IINA 4CMJA 2BI8A 2DAPA 2IEDA 4U6SA 5KVSA 3PXXA 4CM1A 1GQ2A 1N9GB 2UVDA 4WECA 3LU1A 4FC6A 4BL5A 1UXHA 2DUUA 4K9DA 4YT4A 2HO5A 4IDEA 3BHJA 4GSLA 3BMNB 1P74A 2B35A 2RCYA 5G0WA 3SC6A 1PZEA 3I52A 3HFSA 4NJOA 3U4HA 5I7SA 1QYWA 1B15A 3CUKA 4XRRA 2G82A 3AI1A 1HETA 4E5YA 1T2CA 3U09A 2X0RA 2XPCA 5JDIC 1V35A 3RU7A 1SC6A 3WNQA 1FDVA 8ADHA 3RU9A 3OQBA 4UUMA 4IIVA 1PJ4A 3P7MA 3ZWPA 2C07A 3CMMA 1BW9A 3HN2A 3JTMA 4DA9A 5DT9A 5JLAA 1O0SA 4AJIA 4E13A 1PS8A 4IDBA 4FFMA 4RGBA 3WIEA 1J4AA 3HDQA 1ISFA 1GZ3A 2AG8A 2GO1A 3LF1A 3LT0A 3PQFA 4NFHA 2UDPA 4MDHA 1EQ2A 3DMTA 1ULSA 2NQ8A 2O2SA 1E3JA 4BGVA 5ICSA 1CYDA 1YDEA 3D5TA 1E3WA 3COSA 3WDSA 5ADHA 1BDBA 3MJTA 2IYOA 3PRJA 2BFAA 1QSGA 4JXKA 4Y6PA 5IDXA 5ILGA 2HMSA 1DPGA 1EUCA 4ZRNA 1V8BA 1NX6A 4BO3A 5KOIA 1IZ9A 1R0KA 1ZK0A 2DFVA 1H0KA 2FZWA 1UXJA 5G4KA 1H94A 4AJ2A 2B5VA 1QYCA 1KEUA 1QP8A 3NJ8A 1EBUA 1YJQA 2IXAA 4PZEA 1G1AA 1GPJA 2BMAA 4OQZA 4CM9A 1T26A 4MJLA 4YXFA 3VDRA 2GCGA 4BO5A 2HMUA 3IL2A 2Y67A 4IJWA 1PIWA 1T1SA 3EGOA 1LQUA 3KM0A 5CEEA 5ITWA 1XLTA 2Q4EA 2VUSA 5C7LO 3OBBA 4J43A 4BHTA 3H5RA 3DAPA 5JDCA 1LDEA 1GCOA 3Q2IA 1ENYA 3RUFA 1PL8A 5CEFA 4N5MA 4D41A 1NQOA 2C2YA 5TC4A 1H6DA 4XYLA 2Z1MA 1ENPA 2Q1UA 4JCOA 5G0TA 2IRWA 4NH4A 1MV8A 1O94A 2UV8A 4YJHB 3HG7A 1CF2O 3WYCA 5JBIA 3TOXA 5I7FA 3JQAD 1GD1O 2I3AA 1LC0A 1Q7GA 1NFFA 1E1KA 4TMFA 2I66A 3ST7A 3DAFA 5A9TA 2CUKA 1F8FA 4ND4A 4YAJA 3V2GA 4RLHA 4NNJA 4L4RA 3K8ZA 2HMTA 4UVDA 5EINA 1DJNA 1H6BA 2D0IA 4LRTB 4MVJE 4RF5A 4L76A 1HSZA 3DBRA 3WGQA 3QSGA 1ZKMA 3IKTA 4OOEA 5G4KB 1RYEA 1J6UA 4D45A 1B16A 2P5UA 3FR8A 3GVCA 5KKAA 4YEDA 4BO0A 3ADPA 1TVEA 1SO8A 1H5QA 3QWFA 4PIVA 2PD3A 2X22A 3W1VA 3E5RA 4CL3A 1T2DA 4Y9DA 4CR8A 2QYSA 4AVYA 5CDSA 4FGSA 1HE4A 4J2HA 1OZAA 1ZBQA 2WD7B 4IBOA 3DTTA 1SMKA 3D64A 1IPFA 5I8WA 4GH5A 1JDJA 2TMGA 3RCBA 4DLBA 3GLQA 3QY9A 4WCFA 1EE2A 1BRMA 2W4QA 1ZMTA 4E2WA 1YRLA 2PFGA 3SEFA 2D8AA 4XQCA 3TOZA 3NJ4A 5JNLA 2PGLA 1QORA 3GRPA 5KTKA 2PH5A 1B26A 2VNSA 3BTOA 4BKOA 2D5CA 4AJKA 3FNHA 1NR1A 3O03A 2ZKLA 4H7PA 5BSEA 3W8FA 4NFSA 4DPKA 3GDOA 2Y93A 4YJDA 4DUPA 1E6UA 5ENVA 3T7CA 4QEDA 2ZCVA 2D2IA 3JYPA 4RVFA 4R54A 2UUPA 4Z9XA 2AXQA 5ER9A 3WOHA 3ZCXA 1QXSA 3UN1A 3V1UA 1UXIA 2EG9A 1T4BA 1WMAA 5B4TA 3I4FA 3WTBA 1ZSYA 2OBYA 1ZO8A 3ON5A 1DC6A 4YQYA 5A9SA 1K5HA 1B3RA 1DIRA 1V6AA 2FWMX 1FMCA 4I5DA 3V2UA 5L95A 5T8KC 4CR6A 2RH4A 4NI5A 2DPGA 2C54A 1Y8RA 4NJMA 2PH3A 4W4TA 3GDFA 4AFNA 4IMPA 4YT2A 5BQFA 1RKXA 3M2TA 4XR9A 5KCZA 1ZH8A 5HWSA 4MVJF 3CPSA 2BI7A 1Y9AA 3F1LA 4MP6A 1EVIA 3DZBA 4E2XA 2I65A 5JMPA 4XQGA 4S3MA 5AYVA 4GAEA 4DWVA 4IXTA 1P3DA 4F6LA 4YRBA 2Y1CA 3VKUA 4J1QA 3GF4A 1WP4A 3WNVA 3KEQA 1M6WA 4BKQA 5CAEA 1ZW1A 4E5PA 3DWFA 2OHXA 3F9IA 1A7KA 1IOLA 3F47A 3L4BA 1YKFA 3DZJA 4CLHA 2WYUA 1DRVA 4HP8A 4NG5A 4U6QA 3EW7A 4GX2A 4XIYA 2DUWA 3OJOA 4NBUA 2GZ3A 1R15A 4BS9A 1EFKA 1ZNQO 3AI3A 3IAHA 4WJZA 1YOVB 4BV9A 4Q3CA 4CM3A 1P31A 1ENZA 3IUSA 1KYQA 3I9KA 3KYBA 2RHRA 2W8ZA 3AUAA 3KZVA 4G2NA 5B37A 2DBZA 5HA5A 1H2BA 2VWQA 3VH4A 1ID1A 4FW8A 1DXYA 4O59O 2CVOA 4IDDA 5KNLA 4NBWA 2IZ0A 5JS6A 3O9ZA 4D0RA 5MDHA 2VQ3A 5KJEA 3I4CA 3L77A 2GN8A 2AA3A 3VPXA 5JC1A 1YO6A 4MKRA 3F5SA 4TWRA 4A5OA 3ANNA 2X7HA 3DBHA 3IJPA 4Q9NA 1K2WA 3BTSA 4A0SA 5T67A 3QRWA 2AQIA 5THKA 1A71A 3WGIA 5T8KA 5I7VA 4NQZA 2VRBA 3BMOA 1A27A 1VJ0A 4PRKA 1UP6A 3HWRA 1GYRA 4BMSA 4MPDA 3AM5A 1L7EA 5CDGA 4E21A 2YFHA 4FPXA 1BXGA 1M2WA 1R12A 5DBIA 3RASA 5TF4A 3DEYX 3N7UA 3WLEA 4YACA 3GC6A 4CMIB 3P5SA 3JYQA 1QKIA 3H6KA 3TL3A 2GN6A 3INRA 1I8TA 3ZN2A 1E3LA 1K0UA 2B4QA 3KSUA 2Y0CA 2G76A 3NUGA 4E5MA 4ZHSA 4J0EA 4XGNA 2IYPA 4DLAA 3SJ7A 2GD1O 2D59A 2Q3EA 4PZCA 3F4BA 4OIMA 3ROQA 2VYVA 3KTDA 4GWGA 3BMQA 4ID9A 2QYTA 4MVJH 2V65A 2J5RA 1CEQA 1B2LA 4I9NA 3QP9A 4RVHA 1E1NA 3LC2O 3T4XA 1SOVA 1DC4A 1YH3A 1U9JA 2X4GA 3S8MA 3ZGYA 4E33A 5A05A 1B7GO 2ZYGA 1C1XA 3FBTA 4Q3NA 4A03A 1L1FA 1JN0A 4J7CA 3W6UA 4UREA 3JD1A 1EDZA 1LDNA 1LDYA 3LVFO 3A28A 5DCYA 5K6AC 1GYPA 2FRDA 3X2FA 4BNMA 4O1MA 3GVXA
chains in the Genus database with same CATH superfamily
5REQA 4HNVA 5F1KA 3QBJA 1U2EA 2ZZKA 1XLTC 4CCYA 1QRDA 2PDAA 1PK7A 3OZSA 3JQAA 2VG8A 2JLYA 1H0HA 3A6GA 3RU2A 5C8YB 1RMQA 1B1CA 5CD9A 2IXTA 5DMXA 4DM7A 2WDPA 3SHFA 1YQEA 3VQTA 4W7SA 3FHTA 5CDYA 3NJRA 4NR0A 2FW7A 3CN7A 3U7FB 1SEPA 2D3TA 2J0VA 5FWXB 1TTQB 1T0JB 1NUTA 2QX9A 4Y0NA 3QPDA 4R2KA 1RI4A 4YRFA 1E3IA 4U7HA 1CF4A 2B61A 4YC7A 2AXEA 4Q0MA 3NBUA 4FYHA 1MABA 1R4AA 1RKVA 3KQTA 4RQBA 1S8OA 1AKUA 1SXJC 3DAOA 3IRUA 3L4EA 4Y0AA 1G63A 3FUWA 5G53C 2IHNA 2WHPB 4JBYA 3GLIA 1J7KA 3OETA 1PK9A 3ACCA 3QYPA 4M9UA 3Q4GA 4MYCA 3NANA 4A26A 3LCMA 2VC2B 3CCCA 4X71A 1JWBB 5JS7A 1W36D 1LVHA 2CNOA 5BV2P 2EX4A 1GT91 1HTTA 1VCMA 3PDCA 3TCNA 1XD2A 1I2DA 2Q9BA 3TW6A 5F9MA 4MUNA 2LDXA 4GMXA 4NDNE 1AMNA 2JH3A 3AZQA 3GFPA 4G1EB 5CIWA 2RKOA 5FNVB 3KBBA 2KBFA 3OHPA 3NBFA 3WXBA 5B1EA 1TQ6A 1XE3A 3AKCA 2YZKA 1OLXB 2J09A 3SHTA 1Y82A 4Q34A 1IEWA 5IUKC 4LCEA 4NU5A 2B1GA 4X7BA 1NT4A 1QTRA 2F9MA 3PUYA 1B73A 1DV2A 1C9JA 2OG2A 3Q7EA 2AJCA 5DGCA 2ZIVB 3NHMA 2HJSA 2MSDB 2NUBA 1AKQA 4IIHA 4BJ1A 3UPTA 2VQEB 2VBGA 3W3ZB 1DG1G 5EHIA 4ZI7F 1OBFO 5KYYB 1PE0A 5FDFA 1X2BA 4FSXA 3J80A 2YV2A 4HLNA 3GPBA 1C4WA 5HMMA 1U28A 4LOHA 3M33A 1O95C 3FKQA 4H7KA 3BC1A 6CHYA 1WV1A 4I0WB 1SG6A 5CLQA 3FLMA 1SY7A 2CXHA 2OHGA 4MB6A 1YB4A 4LISA 4QYXA 1P91A 1XQ6A 1JSZA 3E6AA 5CXXA 4ZAZA 1V7PC 4QDTA 4WEQA 4EUEA 1Y1RA 2UYYA 2ZBRA 3E0XA 2ZYSA 1AN9A 2IA5A 1LPAB 1NZJA 5DDIP 2RDMA 1FYXA 5GJWC 1NR7A 3ROMA 1XXHA 3NTLA 4O4IB 1MX5A 3UVEA 4V1CB 4DR4B 4RA9B 1EXNA 5ITSA 2BGJA 3OZVA 4BASA 1L7AA 3TGPA 4RVUA 3NH6A 3DDNA 3LCCA 1BJTA 4DPMA 1YACA 4JLVA 2X0IA 1M3SA 3GOHA 5DBFA 4UUNA 1K68A 1QVRA 1QG2A 3H87A 2RGAA 2AFHA 4FYVA 1R3UA 1R50A 2P11A 2YWEA 1E5TA 1QF7A 4G84A 4PWZA 1QYXA 2G09A 3NV7A 5GV8A 2Q5LA 3NRCA 2E18A 3IJRA 4MQMA 1RZUA 4D0NA 1FZQA 3K8QA 1RWKA 3GY0A 1AKRA 4MQLA 4QNNA 3LJKA 5DHFA 3L1IA 5FL3A 2YWGA 3K4HA 2BGKA 2BLLA 4K3UA 2X41A 2E4VA 1R6TA 3RHTA 4H4EA 2WE8A 4KZKA 2P6PA 4DRXA 4YRZA 3L01A 2VNIA 1H2YA 2QIPA 3LOQA 4JL6A 4LOKA 4PSDA 1O4WA 5CGQB 3JYOA 4RELA 2V55B 5BNFA 3SIPA 2FCRA 3BRCA 1SKUA 3ZI0A 2X5OA 5FBWB 1B6GA 2C3MA 1RJ9B 4D3DA 4ARUA 2F43B 4EFLA 1LPMA 2CHEA 4BNIA 1KVRA 4A1OA 2C3YA 3MM4A 1ECCA 5TGDA 3RSCA 2HBYA 4E5KA 1C7JA 2GEKA 2E5LB 3GJ7A 4MVYA 4F45A 1RPTA 4O2BB 4GPTA 3L6EA 1ZGGA 4JXJA 5EMMA 1AKEA 1P3JA 1KI4A 2D1QA 3NIGB 3OURA 2WF9A 5DGDA 3SZMA 5LD2C 1BE1A 5A03A 3CC8A 4XOUA 3HV0A 3TLKA 1Z0AA 4JQCA 4ERXA 4N3AA 4N5NA 1T25A 1QIDA 3PQ2A 4OM8A 1XQWA 3R0IA 2O7RA 2OCGA 1XRNA 2A30A 3UMJA 2HDWA 1P2DA 3IPXA 3WV4A 1GAEO 1UMCB 1M2GA 4I9UA 2PL9A 2UZ1B 5IWCA 2FHSA 1MLDA 3DDZX 5CX1B 3R3HA 1HLGA 6YASA 3ABIA 1LBIA 2P4QA 4PHHA 1NG9A 5COQA 2EW8A 2E37A 3MMZA 5CJ2A 4PYOA 5ERXA 4L8FA 4RY8A 4CQNA 4A8PA 2TS1A 3BMCB 5TMPA 4KDEA 3RSFA 3M6LA 4EZBA 1N1GA 1ISGA 1VGQA 3AG5A 3EPPA 4R8RA 3RAJA 2FVXA 3AHIA 1KP3A 3OQVA 4DIOA 4BZWA 4F56A 2ZRHA 1V6CA 1O94C 4BO2A 2ZR7A 5BY2A 2C84A 1C1XB 1W19A 3VH3A 4KLAA 1FF9A 4RZIA 5HKAA 3EAGA 3C6BA 5JSHA 1P9LA 2XHZA 3G2QA 5I01A 3TN7A 2G7MC 1EHIA 4MCAA 2OP0A 1CV2A 5D6OA 2IIBA 5A3VA 5LP6A 1P0MA 3D2AA 4XLLA 2QVYX 4AW9A 3ZD7A 3B3GA 3IOEA 3G13A 1BS9A 4J75A 5EZYF 1E3SA 5C31A 1WLYA 3RJ5A 5CG1A 5LL6P 1NJ6A 2OZEA 2X77A 1G42A 2WB4A 2XY4A 3BA1A 1DXOA 3WHIA 4CM7A 5A1JA 4OK5A 5BNWA 4JGGA 4Z0HO 5BPFA 1EESA 4WD3A 4MIYA 4MDEA 4BLUA 1PFKA 1I6KA 2NO9A 1HDCA 1EE1A 1K4MA 1NVAA 2PMFA 3UTCA 4BQRA 3IQXA 1GO2A 5KYNA 4MRMB 1L5YA 4QPZA 5JTUA 5F9FA 1ULZA 3DLPX 4XPZA 1OV6A 1VTKA 4LJYA 3OA2A 4B3GA 5J5CA 1IN8A 1MJ5A 4ZTUB 4MVJI 4PPQA 3AHHA 4O3FA 3FKSA 4BOYA 4EATA 4RNDB 4D3ZA 1KRXA 2ZSUA 4PN7A 1ZGJA 2J7PD 2XEXA 3VC1A 4RTSA 3D1LA 1GV1A 2NSYA 3UGKA 3D3NA 4PBTA 4J7AA 4ABYA 2CMKA 3DEKA 2C9YA 5A4FS 4E30A 1ATIA 1KC1A 3SDZA 3LO5A 2BFOA 4JNKA 4WQMA 1V41E 1PKXA 1U8UA 1E5LA 1NIPA 2FMUA 4QBKA 4XCVA 1ORDA 2YOFA 3ZQ4A 5JAHA 4H27A 4JOBA 1JIJA 4ZV4A 3NUQA 1CDEA 4M8KA 3SZGA 3UUWA 5ADWA 4NPCA 3B9QA 4DR3B 2HJGA 3OFJA 2W2KA 3INGA 3WLJA 2WJ3A 2JARA 3CUSA 4HWTA 2HBQA 2Q5JA 4S12A 1I9GA 1PW7A 1JFTA 2BM9A 2NU7A 1NC1A 1P7YA 3SXUA 4D6YA 1VP9A 1YJ8A 3EODA 3R6GA 1PU2A 1N5DA 5HJ2A 5IF3A 1Y6QA 1VXOA 1Q77A 3I5AA 4DM3A 2C7QA 1SB8A 4Q7QA 2QN7A 1EVJA 2WSMA 2NSHA 2WWTA 3R1IA 1EGVB 1QAMA 1YR1A 3OJCA 3QX9A 2CNWD 3WFIA 3I6IA 1BOFA 5GJCA 4QG7A 3PGLA 2BH2A 1N8NA 4MTLA 3HDJA 4KQIA 1OBCA 4UHDA 4D5GA 3P5BA 5IUNC 1ZPDA 1E62A 2JPDA 3EQZA 3OPVA 5AXCA 5IVDA 3AUSA 3R75A 2JANA 1C0IA 2AV6A 2QT9A 2ZJ6A 3BHIA 3RF7A 3RG8A 1G3IA 3ABSB 4MWTA 4EY7A 3HXLA 3QLEA 2Q4BA 4JLBA 4FNAA 5DGXA 1J2YA 4Y2QA 4MAFA 4DZTA 2NV6A 3C5VA 2CLDX 3KVNA 2P65A 2RBGA 3ASVA 3MHPA 4KR0A 5TLSA 2ZJ5A 3JR3A 1IQUA 1QHYA 3D59A 3OAAD 4S1TA 1NUHA 2QI9F 5E9JA 1AKVA 1QGUB 5JVDF 2QX7A 3D6UA 4G85A 5B2ZA 5KAPA 3BIXA 4MV9A 1X42A 3G5UA 4L5JA 4F12A 5LD2B 3NMUF 4ZYXA 1SNYA 3QE3A 5FOTA 1WBJB 3PRHA 2WMYA 3RWMB 1IZYA 3ZDXB 5DGIA 4QZVA 5DBOA 1LDMA 4MYRA 2GRUA 2GX6A 1THTA 1ZIXA 2C2WA 2A9FA 4FC7A 4FJ0A 5BYJA 4BVHA 1MT3A 1RRFA 3BKWA 1OX5A 2BHNA 2FFHA 1I9CA 2QV7A 3G8YA 1G3UA 3WJAA 1GPNA 4JUIA 2G4CA 1KYTA 2FP4A 1JBKA 3IUJA 3R7DA 4DG9A 3U9LA 4NYIR 5C5CA 3THWA 4FGUA 4TVKA 4OJTA 4EJMA 3MS7A 3K96A 4FD2A 4G26A 5HZMA 1ZIDA 4M0PA 1KY3A 5B6IA 2BBSA 2LGJA 3D9QX 5CBKA 1RE0A 3PF8A 4YCLA 2K87A 4DB4A 4KO1S 4D4LA 2P9CA 3H9JA 4HGYA 3DWIA 4P7GA 4MTCA 2HA7A 3F7OA 2NZ2A 2YC2C 4DGSA 3TMAA 3I9MA 1BVYF 4L5BA 2WVJA 1Y7IA 2GF9A 2TMYA 3FHOA 3KOUA 2C4VA 4GYWA 4P31A 4TMKA 3TYXA 1JI3A 1BGVA 1CEXA 5BOVA 1CFZA 2B3TA 4B87A 2KI5A 1UWLA 3BS4A 2ZRCA 3PEWA 1F17A 1US8A 3EVAA 3HJBA 1E94E 2J3HA 3FKJA 4IUYA 4YUYA 1R74A 1RYDA 1EUDB 4TYWA 3I2FA 3PQ4A 2C82A 2R8OA 1RI2A 3A2NA 4JP2A 5IKPA 3H2HA 4YDQA 1HNXB 3ZWBA 5L9AA 1EVZA 4S1PA 4LX0A 4X6LA 3ZV5A 2PUVA 2TECE 4RIGA 3RVMA 4OCZA 4AP6A 4D0SA 1R8SA 6PFKA 4YJGB 4HVAA 1B6TA 4XLTA 4PONA 3LY7A 3EXEB 1UQTA 2FFAA 2I0FA 2GLTA 2PWAA 1QIJA 3B13B 4W5WA 3WYBA 3VFDA 3AV0B 3B3AA 3TQRA 4IIJB 2NYRA 3CVOA 4RHYA 4I1UA 5EP2A 2ZTMA 1U98A 1QH0A 4BMYA 3MGCA 2O57A 4HSEA 5AVQA 1LTQA 2H31A 1ICIA 1DADA 2CXOA 2J9FA 3E1GA 3JALA 4G1CA 3A06A 4KXQA 4R2XA 3SZRA 4MVJA 3U3DA 1ZHHA 2Q8NA 3EGDB 5FTLA 1E2EA 3A25A 3EBPA 4OLJA 4QT0A 1SUIA 2ZFUA 4W5HA 4WAUA 1AXEA 2AJTA 4IWYA 4YY3B 1N2CB 2ZS7A 1TXGA 2ESRA 1SCDA 3C7KA 3PDJA 4CEIB 3GAMA 1NTRA 6ADHA 5EP4A 1MAVA 4C01A 5BYAA 1P1HA 3M70A 4N9QA 1G4AE 1IWBB 2XX3A 5IJ0A 1KQGA 5E1OA 4FW9A 4N6OA 1TM1E 2Q9AA 1CFJA 2YR0A 2C77A 4ROSA 4W99A 4QAJA 2OP1A 4EG8A 3ULKA 1KO8A 4B81A 4YUWA 3GYGA 4OLBA 4FGZA 3GR6A 4LGVA 5NLLA 3ZDYB 4E5VA 3K6SA 3F5FA 1N1MA 1SBTA 1MP0A 2IWRA 2ZIEA 4CIXA 1GAXA 2QTBA 1XTVA 2X1MA 1YMVA 1CU1A 3GK3A 3PUIA 4IRXA 5AIBA 1KZHA 1DCTA 3MLEA 2I4IA 3IURA 4JIGA 4RM2A 2MINB 4EB6B 3AFNA 5HOQA 3SZ3A 1LNZA 3CXUA 2I87A 2OFWA 4D4HA 5IAAA 2ZYVX 3EFEA 3HKDB 1D6JA 2YDYA 4OU5A 3BB1A 3ZJ4A 5CEJA 3R0VA 4KPUA 3WTCA 4CRWB 1G8SA 3D43A 1NNUA 3H6HA 3MIIA 4TMWA 2Z1NA 3DW3X 3KL2A 2I7CA 3I64A 3PLRA 3WWYA 2ZE8A 2G5TA 1UAGA 4KFUA 4RZQA 3RF6A 2YDXA 3T61A 1UK6A 4ZVQA 4RHFA 3W6PA 3UK0A 3B53X 4C7OA 5JOQA 2IS2A 3UXHA 1YTUA 2C3PA 2W83A 2I2CA 4OHOA 3E5HA 2AB0A 3JQRA 5GMOA 4LJ5A 3L6DA 2Q5QA 2OHFA 1R37A 3H8JA 4IPTA 4UCQA 4UPDA 2NVOA 1YI1A 4L3OA 5ABPA 1KEKA 1DX4A 2C59A 3M1AA 1HK7A 4JJGA 1ZU4A 3LP8A 1C9DB 4NAVA 4I50F 2I6TA 2W2OA 4FS8A 1T6XA 3PTLA 4JI6B 3A4NA 1P7WA 3Q11A 3LPMA 4H60A 3RFVA 4OV6B 3UFXB 1YQXA 3Q0TA 3W2TA 2ECQA 3VU8A 1SPXA 1JEOA 1RLTA 1T2VA 3C97A 4X8MA 1Y1LA 4F6RA 1V8DA 1WB9A 5LQRA 1OX4A 2A57A 2QUJA 3DTVA 2VWGA 3I04A 4TRMA 3RTCA 3S1AA 4DXDA 1KWKA 3I61A 1HL3A 3ONFA 1DARA 3D7SA 3TTSA 3LPCA 1QMGA 1P19A 2N46A 5TPZD 3KJXA 2M6LA 2C5EA 4ZOLF 3DL0A 1OD6A 2LD4A 1DXHA 1SCUB 3IBSA 1IQRA 1H22A 3UT0A 5KYXB 2P6RA 3ZHZA 4RENA 1HEUA 2XUFA 3ZOZA 4COKA 4E1AA 2VYFA 5GV7A 5IASA 5LU8A 4ZYWA 2P5SA 1RC1A 2DWCA 1YL7A 3OZTA 3NYIA 5FA5A 1USVA 4HRVA 5EUMA 2O1WA 4CDNA 3E22B 1PNQA 3LUKA 4R1SA 4U3JB 2XEDA 1R16A 1ZIOA 3GBSA 2H4HA 5SY4A 1O57A 1PEYA 4GC5A 4KQWA 4RXUA 4LMPA 1JT2A 2CYCA 2Q2QA 4HAWA 3ADCA 3FUVA 3OOEA 3QPBA 4Q3OA 5SYAA 5A7HA 1G66A 4FCVA 4C07A 3C3PA 1MTZA 1TQDA 4BGUA 3KDPA 3K7EA 2EERA 3O84A 3FYSA 2ZUWA 3SEQA 1UKEA 1RPJA 1VPVA 4NE7A 4NYJQ 4CTJA 2QG6A 5A4KA 5BN4A 2IPLA 1UKYA 1QTQA 4JOSA 2DOKA 2DUJA 3U3XA 1BE0A 1OVMA 2ZTSA 2A0YA 1R5OA 4MROA 1BROA 5FWYA 1Y9DA 3LCUA 3I1FA 5B53A 1CULC 1CS0A 2QRGA 2YYZA 1QDEA 4QUHA 1WUKS 5CIYA 1G59A 1Y1KE 2EYQA 1YTLA 5CT9A 5E4FA 4UZSA 3SFVA 2YTZA 3EGDA 1V16B 2XECA 3LZCA 4Q4DA 4C7VA 3HXQA 3MOSA 5HZHA 1BE8A 4YTEA 1NATA 3CE6A 4XKJA 4GO1A 3ZWCA 4F8JA 5C32A 1P2GA 3HP1A 4X7PA 4BN5A 3MCVA 3QJ5A 2ZJ2A 4UCXA 3HPQA 1D03A 3ZK8A 1J70A 4FYIA 4BTEA 4QM6A 4YH1A 1EWQA 2D7DA 1QFSA 3VR1A 1TF5A 3C45A 4KK3A 4EKIA 4LF9B 4BEJA 1WHSB 3H18A 5AOBA 1H6CA 2Z56A 4KQXA 5TQ0B 4A6EA 4ZEWA 4KN9S 2V96A 1Y3AA 2CLOB 3C7CB 4FHEA 4G0PA 4WKOA 1NUAA 1I1NA 2WFLA 3RIHA 3WO0A 2QN6A 4DCSA 2QDXA 3QITA 5FWDA 3RRMA 4Q3LA 4L0QA 4UZEA 3TRKA 2R1UA 3AEQB 3LQYA 4H1UA 3WFJA 4MITA 4QDZA 4E13A 4BEWA 1HRDA 1SHUX 1SIUA 4IDNA 1TGVA 1CERA 2PGAA 4AJ4A 2PAAA 1KI8A 3PTZA 2FSHA 2RCNA 4UUBA 2LE0A 1UADA 2ECPA 3ZIAA 1H05A 3A4YA 3HY4A 3EDRA 4KKXB 1OI7A 1J8FA 3N0TA 4C4RA 4PBRA 4QYIB 2P68A 2PMCA 5H5JA 3UPUA 4NF2A 1AE1A 3C41J 5CVVA 4H59A 4PU0A 3QF4A 3R9XA 3VPFA 4WBNF 5CW1A 3CH6A 3JALB 4CVNA 2VUIB 2YMPA 1TVCA 3Q2OA 5LDHA 2A5DA 2BFWA 3UAOA 3TPZA 2P79A 4M7RA 4QODA 1Z6ZA 1O6CA 1O87A 1POXA 1XZIA 4DEVA 3O9VA 3BE4A 2ATXA 4Q9IA 5ALLA 4ZT4A 1WSDA 3DQPA 4PZLA 3ROFA 1SK9A 3LA8A 3D4PA 4KBFA 4U2EA 1DJPA 5AM2A 3QKUA 4EUHA 4QXMA 5B3KA 1UR5A 1TM7E 1THZA 2FZ4A 1ZN8A 5ERGB 2ECKA 4D8XA 3KQNA 2O8DA 4YMUA 3DGEC 3ND9A 5DYGA 2RGNA 5HF5A 1Q3KA 1H66A 5K20A 3TIGA 3ZKAA 1CP3A 1L7RA 3GRZA 3QW4B 4QYMA 4P4NA 4Q1BA 4IY1A 3UCXA 2VTBB 5K8UA 4DCJA 1QIFA 2WYOA 3D6HA 1H69A 4UJ3A 1E4OA 1YCGA 3LAWA 4HB3A 1GNLA 3IT3A 3R7WA 5KDLA 5CVTA 4YJFB 3TW8A 3FSGA 1DJQA 3NS7A 2SNIE 1A04A 1JLSA 4ZEVA 4QUJA 4ZO8A 2BM1A 5H16A 2GWHA 3AXTA 3ONWA 2V6MA 3RSGA 1RTKA 2AOUB 1JU4A 1PGQA 2AUNA 2ZUDA 3GGJA 1PR4A 3RLFA 4HUQA 4L08A 3ZHOA 1GARA 1K8RA 1V8FA 2Y0EA 3F67A 4OB7A 5FH9A 4N40A 2BEWB 1J56A 2F1RA 3G8BA 3QU4A 1Q1QA 5TPZA 4Q4CA 3THWB 2QDKA 1QUEA 1RI5A 1U1FA 3JD0A 4OYYA 3ORRA 4PLTA 4UHFA 5I3CA 4TM7A 1E3MA 4DPLA 4MW1A 3KKMA 1T2EA 3UENA 4V0ME 4FX5A 3FY4A 2HK6A 2XUQA 3PJEA 1L7PA 5IMSA 1G16A 3EH1A 1Q1NA 2X0EA 1FQKA 1ESDA 4D3XA 3QF4B 3R9XB 3T95A 2PR2A 1OHHA 1PQPA 3P9ZA 4WOPA 5BOSB 3RAEC 2R96A 1NWCA 1X1CA 3QMVA 4TN5A 1V11A 4XD2A 3OZBA 5AJWA 1D0SA 1UDBA 3UEOA 4EL0A 1GNPA 1THMA 4BXOA 2FX5A 1CB7A 2GGSA 4JLJA 2ZSEA 3RRBA 3K1AB 2Q8PA 1RBMA 1STOA 5KWVA 1XTTA 4BE4A 3HABA 4AYXA 4K40A 4QJBA 5KQRA 1VLQA 1E9CA 2VDUE 4DMMA 2FGKA 2XVAA 2ACEA 1P77A 1IHPA 1WMEA 1ECFA 4FQ8A 3DZHA 4J29A 4EF5A 1PJTA 2X2PA 1Y8CA 4QVGA 2UXDB 3CCFA 4PLHA 1V9CA 4WZAB 3AL0C 3HUDA 1B0PA 4ALKA 3BXEA 1RRCA 4LNHA 1R1DA 4PGHA 4DJAA 4NNOA 4BFYA 2YVQA 3FBGA 1D2HA 3L49A 1JJVA 5AM1A 5J40A 5KB3A 4RS4A 4EHNA 3M4JA 2ZREA 5ALRA 4JJ7A 1M75A 2GN2A 2HCTA 1O7JA 2TRSB 3RIMA 1XFAA 2HSWA 2PVPA 3QFFA 4KGXA 4AG3A 3LVRE 5JECA 2K6GA 4IDFA 2B7LA 4JGBA 4LVNA 1NI4B 1XRSB 2OWDA 3GMDA 3UGQA 4X64B 1M0EA 2DFDA 1YS4A 1YBMA 4DYDA 2NZWA 1XTUA 2HV9A 2PZEA 3BJMA 3MFQA 3M8KA 5EGNA 4L22A 2V6IA 3L07A 4RZUA 1CCWA 3FZQA 4GBJA 5EJGA 3MXOA 5EYPB 2YL2A 2NVUB 5IK2A 3D02A 3R7NA 5BSKA 3BICA 5LPNA 5IJZA 1NP3A 1S2OA 2VLBA 4HDRB 1X1QA 4MP3A 2OD7A 3UGTA 3KKEA 3BREA 5CPBA 4EBBA 4K28A 4BECA 4EYOA 3OM0A 3GDWA 1T3ZA 1RVDA 2Q29A 3IEVA 3EVNA 1Q1BA 4DE5A 2PY6A 4D9EA 1FMLA 4NMXB 4B74A 2XXBA 2H48A 1ONSA 2XZTA 3W2IA 4CL0A 3PXUA 2FOXA 3OP4A 2W98A 1GGEA 3A14A 4IGEA 4BO4A 5J4HA 2Q2NA 1SC9A 2Y2UA 3H6GA 3M81A 5AHOA 5AI9A 1JG2A 2EFEB 3LKBA 5FB3A 3ZHCA 4CCYB 3RC8A 2ZJ7A 1W35A 3OT1B 1E6CA 1IL0A 1BC5A 1TQ8A 3EFHA 4TVOA 5ALQA 2G3YA 2X13A 3QYFA 5BMOA 4E08A 4DC9A 3C3CA 1UBSB 3TQOA 3VU9A 3BE8A 3PFKA 4JKYA 4N7JA 3TLYA 2Q1WA 3H4MA 3ILHA 4DNOA 3U4MA 4TV9F 1F9AA 3UT5A 1R27A 3ZWWA 2FEAA 2VPIA 3Q7RA 3L0DA 4G0XA 4K1XA 2WIGA 3BN3A 4I6EA 2YIVX 1H3FA 4XEUA 2X7XA 1FPMA 3BMCA 1DQPA 4HQRA 4IHJF 4QPPA 4YX9A 1FFWA 1Z25A 2IGBA 4U7GA 4ENVA 1F12A 2NPOA 1CW2B 1Z3IX 2GCIA 3JY6A 5AHRA 1EGQA 4V24A 4RZSA 4FM9A 4NZPA 1JQBA 3CX7A 1OJ7A 3I62A 1G9SA 1YAJA 2XYRA 5CX4A 2R4TA 3MWDB 2JI7A 3AOEA 3TG2A 2WF7A 5AK6A 5ENDA 3ZDRA 1ECLA 4M6WA 1U1GA 2G07A 2HR1A 4JLMA 2ENWA 3N0WA 3FLAA 1ZSNA 2H5EA 4M8SA 3LBNA 1C3LA 2JLVA 3C3XA 5K51A 2B94A 2Q28A 3TR5A 2PL5A 4RGVA 4RPIA 3V7WA 1JECA 4MGEA 1QF6A 2YWXA 4FXOA 4BVJA 3C85A 2W00A 3AXSA 1NC3A 2AR9A 4XX0B 2GM9A 2RI0A 1U6KA 1P1KA 3LMKA 1GZ6A 1RR6A 2C29D 2J3LA 3N86A 4O25A 4DF3A 5KVCA 1XXHE 3DKKA 1AXGA 3QU5A 1IY2A 5EJAA 2IPMA 2O2DA 1YHZA 1OOEA 3LA6A 2PLNA 2QE7D 1YZGA 2QSYA 4V0QA 1CUCA 1GEGA 1X87A 2XQJA 3ACBA 1WY5A 4TXJA 4J16A 1LBHA 3ZEAA 4Q7KA 4XTCS 4RUKA 3RYHB 3EC1A 2ZXEA 4FHFA 4IICA 4M9ZA 4NLLA 3TTTA 1XAIA 2CLSA 4L8YA 1EFVB 5CM9C 4PGFA 1O8CA 5T64A 3GUYA 1M66A 3VX4A 4F4FA 3BXHA 3KYCB 2RK3A 2PT9A 3JWPA 1PTJA 2WKWA 3O4IA 3PITA 4NCAA 2E6KA 2G67A 2LKCA 3IEPA 4RLFA 1L8QA 3DMGA 2EZUA 4GI3A 1W0CA 2P6MA 1JH8A 3JQFA 4HYEA 3LT1A 3VZPA 5KHLB 1CQJB 3LK7A 3GBPA 1NYTA 4C20A 1VOTA 2XBLA 1MB0A 2JJ2A 3COYA 1GSAA 2IODA 1GTJ1 1AUXA 5CLLA 5AK0A 5CVUA 1I6LA 2B3DA 5FFMA 1VA5A 3VZQA 2QW0X 3AZPA 3RJMA 4BUZA 4DV2B 1JNYA 1FUEA 4EMTA 2AWNA 1U9IA 1ENOA 1HSOA 1ODTC 1N5OX 3CBGA 3W04A 4NEGA 5AESA 1W1UA 5L3SB 1S01A 4AUMA 1BS2A 1JTVA 3N28A 5G3YA 3C4JA 3GFQA 5KNCH 4AMGA 5EWMA 4I81A 4U8HA 5BRJA 1CR6A 3IODA 1IZ8A 2W71A 2JLZA 5KTYA 4WN3A 1Q1EA 1QE5A 4AMVA 3FF4A 4J1SA 3STWA 2ZANA 1R0WA 3F6EX 1LPBB 2O3QA 2PSDA 5L3SA 3QVXA 4WL0A 5EXEA 5DI3B 2WUFA 3ROTA 2I4OA 3ZU4A 1FMFA 3S2FA 1YQDA 5TY0A 3W9BA 1UBRS 3B6JA 3WG9A 3O8CA 1CY0A 3IXLA 1XEFA 5DKFA 4HZUB 1YE8A 1DCKA 1VLZA 2BF4A 4TKVB 3NAQA 5LQJA 1IEXA 4GR5A 1UPTA 4DNXA 5TIIA 1KO5A 4UUPA 3KS9A 1RU3A 2Y66A 3ZHBA 1V1MB 1W5SA 2F6RA 2PZLA 2QRQA 1DBWA 2XVZA 2KSQA 3HY6A 1OWPA 1QG0A 3LPNA 1NNI1 5F1PA 4TLBA 4E2FA 1ML3A 4B7CA 1N6LA 4O4LF 1MENA 1ODSA 3DE4X 3P19A 3PFBA 4HMQA 4LNUA 1FP2A 1L5RA 4YWHA 1C5KA 2BMEA 1E66A 3T7DA 2IH5A 3M5DA 1G21A 4K9NA 3KXDA 3WGLA 5ALZA 1MT0A 1DRKA 2FFBA 1ZOLA 2W9XA 4MWOA 3A11A 2ZI6A 3DAHA 4Y2YA 3AHFA 2ZIFA 5L4SA 4NVRA 3OMWA 1MO3A 1GPDG 2M6RA 1SD1A 2ZK7A 3ANMA 4R1TA 5I3ZA 1UMBA 1XCBA 5ECYA 1OFHA 2LBPA 2AEJA 3TG8A 2XXAA 1OILA 5CB8A 3H99A 4ZPXA 4F72A 3OU7A 1FRVA 5LZ4A 2VS1A 3AERB 4CM8B 4E94A 2PKYX 4KACA 1CX9B 4XYMA 4LRXA 2ET6A 1Z26A 5CJJA 3C0KA 1PX0A 4EY5A 1FNSA 4ZDIA 5LJLA 2WF6A 1NONA 2H1VA 1SVIA 3G2PA 4MKHA 4XB2A 3U4QA 2IITA 2R7NA 1XDZA 2V7WA 3P0FA 4MS3B 1WM1A 5AO9A 4HGQA 4WXHA 4B3IA 3HXTA 4U8GA 4DVGA 1GUDA 2NUPA 4BMXA 3KHSA 4WLEA 3BF7A 2I2DA 3I2GA 2DM6A 3PNOA 1XEWX 2X9NA 2YWDA 1N57A 4N9WA 4H1WA 1FX1A 1HBJA 5DYTA 1E0JA 1FLNA 3CQ9A 3WB2A 2R8RA 1PEDA 1ST2A 4X44A 4B71A 1GRCA 3F46A 3IFSA 4GP6A 1QK4A 3BWYA 1K6JA 2VCHA 4RK6A 2IYWA 4K8RB 4UNRA 4U3JA 2QRVB 1MZVA 4HEJA 4WCFB 4LJ6A 1MC1A 2R87A 2DR0A 3L7IA 4U02A 5FLKA 3GFSA 3H5TA 5LZ7A 4C43A 5CH8A 1V48A 4CKYA 2FMTA 2YYAA 3ZK9A 5K03A 3BIFA 3NVMB 4MW7A 3NOOA 1Q7EA 4WDQA 4TWBA 2DKNA 1YJXA 2GR9A 2WA1A 1VHQA 1FS6A 1M7HA 4HDAA 3ZWNA 1IB6A 5LKRA 1DAOA 1VJCA 3CUUA 4YAKA 4OHCA 4V0SA 3ID6C 4A36A 4X1KA 3WB0A 2EQ5A 1H8ED 3IEIA 4WK0B 3PD7A 1IE3A 4DMKA 1DU4A 4FUTA 4KQEA 4MR9A 1TVKA 5FI1B 2O7SA 3FUUA 3SF8B 1E9AA 4L4SA 4CG3A 1DKLA 3FGZA 3MWEA 3GG9A 3P9KA 2V7PA 1IUNA 2B8NA 1YNOA 4HYYA 2QU8A 3N2IA 1VHWA 4J7UA 4TTQA 5CM8B 3O4JA 4J4HA 3TX2A 5JR3A 1DVRA 4G07A 3I6ZA 4HNHA 2F8TA 1VSUA 3ZZMA 4B7UA 1RWVA 2UZAA 3EQ7A 2IZ1A 3MWEB 4QECA 3THXB 3CW8X 3LVQE 4YO7A 5JPIA 4C0HA 3DMYA 5LZ9A 4D8VA 1E92A 1UANA 4FDVA 5IFKA 3A32A 1PTJC 2KX7A 4RADA 3WAJA 2C98A 2FJUA 2QS9A 4X20B 4ZD6A 2P35A 5D87A 2Q0QA 3M6MD 2D5IA 4S0ZA 1DAHA 3LWZA 3BSFA 2EW1A 5JS1A 1JF8A 4ZMSA 2Z8YA 3KSBC 1ECGA 3QE9Y 1KERA 2HGSA 4Q1CA 2HT6A 3JQBC 3RBXA 1DEHA 2FXVA 3T3DA 1OH5A 1NMEA 3QVWA 5CT4A 3FX2A 4YP7A 1QPZA 1XX6A 4EVSA 3HJAA 3OMLA 4MUKA 4IQ8A 1A9QA 1V8ZA 2A94A 3L4BC 2GZAA 3GIDA 4KPUB 5L3RA 2QL5A 3MXTA 3QJYA 3EIEA 1UDAA 2Y8EA 4D3SA 2LTAA 5U4QA 1EWYA 4UCFA 2DXIA 3KAQA 3PFWO 1UP7A 4X6UA 4LF4B 3KVVA 2VPYA 5HRUA 1SA0A 2OBMA 3DHEA 4KUEA 1SIOA 3O4FA 4HEQA 3BK1A 4E88A 4YJ2F 1PZFA 2FSFA 1KEVA 4BKPA 3GMSA 2VNKA 2H06A 3AUYA 4DTIA 2HJVA 3Q88A 4DSNA 4ZOQI 1OHHD 4BCCA 3BH0A 2BT4A 1CR1A 3FN4A 3ZZ0A 3PD1A 3FTEA 1WUJS 3W2GA 4HFJA 3KQUA 1I36A 1LSUA 2N42A 4LOAA 4W7IA 3UICA 3DCJA 5B64A 3IO3A 1VMIA 1WMSA 1K9VF 3V8VA 1DQYA 3PPIA 3A6KA 3EGEA 5JEEA 5I9LA 1FYWA 2E7ZA 4UMDA 4LVOA 5BN1A 2DCMA 1WVMA 3CO5A 1NXQA 1PYDA 3RGWS 1F60A 5EJ9A 1ZX1A 2WJ6A 4KGDA 1AHNA 1WU7A 1FNNA 1G2IA 3DMTC 2FW1A 1DLIA 3LQ1A 3FOFC 2IQ5A 3PZBA 4OQMA 2VHVA 3R7SA 4CMEC 1XPUA 1U8FO 5EQJB 3S6JA 2IXDA 4OHRA 2OBBA 2VT3A 5JI2E 3AJDA 2BTQB 2AMFA 2C83A 2RAVA 3TH5A 2VN8A 4G4JA 3VTKA 4IAOA 3ROZA 5C2JB 4ZAFA 3AI7A 2GHRA 3P32A 1VIAA 3ANTA 1LU9A 3O92A 1LJLA 4LK2A 5EIEA 2C9BA 4EBFA 1PJ3A 3RBZA 3ECAA 2VUTA 2Z3VA 4QBTA 1KSHA 1MOQA 3CLKA 1ETHA 2NZUG 3TL6A 1PJSA 3QE0A 1RWQA 5ER6A 2DFNA 2O5EA 1HO3A 2R7AA 3AEYA 3QLUA 3O8OA 4KBYA 5KYVA 2C2OA 1U63A 3AKDA 5FTWA 3D3WA 4R83A 4LXHA 2A9PA 2PSSA 4FFBA 4LXUA 5U1PA 3L6CA 2F62A 2Y1OA 3TRDA 3SYRA 4YRTA 1U0NA 1JS1X 4LHXA 3DEFA 4BV2A 2CLIB 3Q72A 2OVFA 4S1VA 5JBNA 1UFRA 3LP5A 2FSVA 4PCAA 2X0JA 4C21A 4FHZA 4M1SA 2HQ1A 1V5GA 3RS2A 2Q6KA 4MPTA 2XYHA 3BAZA 2BMDA 4O1HA 4FHDA 4KRFA 4IIEA 4YLGA 3GD7A 1JA0A 5CYGA 3TXXA 1NSYA 5DW3A 3W90A 3C3JA 4P08A 3D8SA 4DZZA 3GPIA 4N0DA 1Z4PX 3B51X 1KU0A 2PX3A 4C1BA 1YL6A 2HLHA 2I3ZA 2W6JD 1CEYA 1ZU5A 3H4VA 4XYBA 2FP4B 1Z2CA 1JSRA 2C0QA 3JQGB 3PDUA 1JLLB 3KLOA 1HDGO 1ZUHA 3A1DA 3GJ6A 2B82A 1CRWG 1Q0RA 1ZSVA 3N7TA 4EJ6A 4DQKA 1X1TA 2GSDA 4Q9AA 2W4MA 2BFPA 1MN6A 3PDHA 1IN7A 2BSXA 3UYLA 2QNRA 1P5JA 4KDRA 1WHTB 4QPJC 1CQJA 3PNBA 1MA3A 1QYVA 2P6OA 1NURA 4P34A 1VE5A 2EZ9A 4F4CA 1MVNA 3TIFA 5HDQA 3GXBA 5DU2A 1XZCA 3K0HA 5IN4A 3QKTA 5EUQB 4JC0A 1E9VA 1O95A 1G8AA 1PJ2A 2FWJA 5FLYA 2WHXA 3E18A 4W8GA 3N5CA 1FFEA 2EBUA 2OCBA 3HZRA 1KZ4A 1HDEA 2P0AA 4PNEA 4Y2JA 2W6NA 3Q98A 3LZ6A 1R6BX 4AT1A 2F2TA 1J2JA 1U0LA 2CZGA 3IMFA 4UTZA 3PJGA 1XKLA 4EGQA 4YXWA 4FYMA 2IXFA 4U7DA 4UULA 3D1JA 4DVJA 4DQVA 4UTXA 1C9EA 2XE8A 3BZUA 5JT1A 2UZ0A 3OM9A 4JLPA 2JNWA 4NBSA 4DR7B 1XTRA 4B7ZA 3I5UA 1Y48E 4YRSA 1IRIA 2VPWA 3S40A 2XYGA 3G5LA 2R6R1 1IHUA 3V1LA 5BN4B 1TZKA 4GL4A 2OA0A 3KP1A 3PPVA 1DC5A 4RSRA 4YP5A 5EKXA 3ZVRA 5A0TA 2PZJA 4RF3A 4KQ1A 3MTDA 3DG9A 3MJRA 3NT5A 4GX0A 4IWNA 1P1JA 3CVXA 3BFVA 1JFFB 4OAOA 4OHVA 3TQIA 1Y8QA 1G5QA 4F3NA 4ZN6A 3H65A 2BAGA 3JQAB 4NNPA 3GD5A 4H7JA 4AO8A 1XEWY 1EWRA 3ORFA 3PR3A 2O8BA 1DDGA 1FFCA 2DGDA 2NWQA 5DHTA 3PC6A 2W90A 1OE0A 4Q4HA 4B4OA 2F4NA 2JAXA 3T0FA 5T4BA 4JLAA 1DX6A 3TOSA 4MGYR 4DDKA 3A36A 4HAVA 5E4JA 3DZKA 1H2RS 4M0LA 1WEHA 4ARAA 3N05A 1CLUA 3NFRA 4OA5A 1T8SA 1IBKB 3C43A 4WK4B 4IKPA 1EUZA 1A98A 1AQYA 1ULBA 3I39X 1N2EA 2HWKA 3Q3GE 4ETMA 3OO1A 5AKJA 3ZE6A 1PS0A 1TKBA 3NAMA 2BR5A 4P36A 3O7MA 4LRWA 1KPHA 1X2EA 4Y9TA 2HF7A 4J8PA 3S1AB 1U2ZA 4EHDA 2D0OB 5LYJB 3GEIA 4Z4QA 3TE7A 2HFKA 2OM6A 3IRVA 3GJ3A 2Q62A 1WQ1R 1YVEI 4XYGA 1NLZA 3BKXA 4X6XA 2HM7A 3DFMA 1DUSA 1QQ6A 3U1TA 1Z7BA 5FRDA 1JB1A 2CXTA 1CG6A 3NW9A 2ZATA 1U0SY 5CVJA 3C6KA 1CIVA 1UFVA 3DDOA 5KQSA 1WZ2A 1LBQA 4KGZA 3I23A 3HR4A 4OJNA 4BZQA 821PA 1XO1A 3FTDA 2Q1SA 3E22A 5TARA 3LUDA 2Y9MB 1SEVA 3T41A 2E3JA 2IYUA 3P9RA 3QTBA 3T38A 4CMIA 4F96A 1RQ2A 4MXDA 5EY5B 2W6ZA 3AVVA 3HDHA 2P3QA 3BL8A 3QEJA 3RQSA 1MC5A 4A8JA 4A2CA 3GDHA 3S1SA 1C4XA 2J0QA 4QEZA 4D0LB 4BYMA 2O19A 3MGBA 4ZP1A 4BFUA 4YJ2A 3N75A 1RLUA 2H51A 3B78A 4AG6A 5JJKA 1HYHA 3EJ6A 2IT1A 1NPYA 1IVNA 1QU3A 1ZMXA 4P32A 4YMSA 1TU3A 5JFOA 1IC6A 3Q7PA 5JSZA 1GUYA 1OLUA