4HWNA

Crystal structure of the second ig-c2 domain of human fc-receptor like a (fcrla), isoform 9 [nysgrc-005836]
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
94
structure length
85
Chain Sequence
b'FPAPILRAVPSAEPQAGSPMTLSCQTRLLFSFYKDGRIVQSRGLSSEFQIPTASEDHSGSYWCEAATEDNQVWKQSPQLEIRVQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fc receptor-like A
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of the second Ig-C2 domain of the human Fc-receptor like A, Isoform 9 [NYSGRC-005836]
rcsb
total genus 20
structure length 85
sequence length 94
ec nomenclature
pdb deposition date 2012-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hwnA00
4P2YA 3QFJA 1NMAH 1MRDH 4NN7C 4QCIB 3DRQB 2H2SC 1NGQL 1YN7A 3L3JA 1EFXD 3FQRA 1Y0LA 2DQHL 3GBNL 3NZ8A 5F8QC 4G8IB 5DD3H 4WU7A 5JPMB 2JTDA 1P2CB 1F4YL 3HZMA 4DFIA 4F8QA 2CIKB 4XVSL 4UBDC 4RA3A 4GFTB 1KV3A 1Q9KA 5LQBH 3V6FB 2Y72A 4HHAB 4G6AC 4AL8L 5GRWA 5CIPH 5ICYB 1PBYA 3VRIB 3KPRE 2FEEL 2VN4A 3V0AC 4GSDL 5I74B 3VMNA 1EXUB 5ID1A 3HMWH 2N4IA 1KYOJ 3TF7C 3QP3A 4BZ1H 4K3DL 2X89D 3UBXA 4DKEH 3IFNH 3BOVA 5JORA 1U36A 5SWSE 5LGHH 3LPWA 4OI7A 5C0NC 5L9DH 3OHXA 3FN9A 3TIDA 4X5XB 3U7WL 2A6IB 5HI4D 2P24A 3QEQD 3MBED 3QUXD 4TUJA 3DV4A 1S7TB 1CBVL 1DDHA 1RAMA 1MCOH 2I9TB 3MJ8A 4RRPA 3OXRB 3GMNA 4CDGC 1OGTB 4Y5YA 1S7TA 5F96L 1JZ2A 2D7OA 3NGBB 4FQHB 1N7ML 3SE4A 3VFRB 3LPGA 4WTZG 3GUTB 2XA8L 1WT5A 5MERB 5C7XL 4C57C 5F93C 3MRHB 3UJIH 3LEVH 1T1ZB 2ORBL 3U7YL 4K71C 3X14B 1OP3K 4JG1H 3RVTC 5CP3A 4NWTH 2DLTA 3C5JB 4UDTA 2Y5TA 1EUUA 1QRNB 1UZ8B 3CSBA 4JZJA 5CS7A 2HLFC 4PJXE 1C16A 5DUPL 1RJZB 4MJIB 3L3OB 1QFWL 1NBVH 1F58L 3KYOA 4G6AD 4KMLB 4KUCD 1R5VA 4G3YL 4P3DA 1MQKL 3MGTA 4ZPVA 2LFGA 4RFOL 5FKAB 1IEHA 2XQBL 5D4QA 5IEKB 4DZBA 3LS4H 5CD3A 3ARGD 4YBQD 1GVIA 4JDZA 1YY9C 4GQ9L 1D5BB 1T83A 5GS0D 4Z77A 1P4IL 4LLUB 5I8OH 1TZGH 3PABB 1R3LB 4GAYB 4FXKA 2Q8AL 5KVDH 2IBZX 2YUXA 5TQ0L 3RWFB 1NEZB 1RZJC 3EDFA 3MNZB 5B3JF 1RPQA 1AGDB 4PGCB 4JY4B 1J8HA 3HN3A 1FJ1B 1VENA 3L6FA 2Q7YB 4TQEL 3HMXH 3SOBL 3X12A 1UZ6E 1I85A 2UVFA 3MOAL 3NACL 3D39A 4OGZA 4R26L 1KTDB 5TE6L 4OTXH 4PJ5D 4AIXA 2HKHH 4L3CB 2UVEA 5AZEH 1JZ5A 1SY6L 3VXSD 3BYTA 4OCSL 4M9OA 4FQCL 1DUZB 4HAFA 1I1AA 4U1NB 1UJTA 2AK4A 3PGCB 4WI7A 3TJEL 4UT9H 4YK4B 4JDVB 4ZMAT 2EYRA 5DFVC 4XCEB 4G9FD 3ZHKA 2YZ8A 3BGFB 1T89A 4WTWA 4HX1B 3BWUC 5MEOB 4M1DH 4KQ3L 4P46D 3SKOA 1MREL 5MEPA 2R56L 2ZSVB 2ZUQB 1NCAH 5DMGD 2EXWC 2XTJD 1P4IH 3REVB 3RWDA 2OX5A 3QCTH 5I73C 4LVOB 3DSNA 1I9EA 4KTDL 3QHFL 4GRLB 4UNTA 4H8WC 2C5DC 4WU7B 2N7AA 2DIJA 5JPMA 4X9BA 1DQTA 5ADOH 4PRIA 1OD7A 4MAUL 1F3JA 5A2JH 1FAKT 2J3SA 1KTKE 1MEXL 2EE2A 5HGDB 1CK0L 4OGXL 2XQYK 3EFDH 3FFDB 4RA0C 5DHVH 2CD0A 4G8GB 1XR9A 3K81A 4EI5D 3P9LA 4TVPE 3QJHB 1S7SA 1J1XL 4HUWB 2ESVB 4PJ8C 5C0AB 3RTQA 2FD6L 5JA9A 5DYOB 2XTLA 1NGYB 5DGRA 3R1GL 1A02N 2UWEF 3S35X 3BPNB 1Z3GL 5F6HI 3KJ4B 5FHBH 1C08A 4N8CL 1K3IA 4TTDC 3CZFB 1JHTA 2NCMA 4ZPTB 2R9HC 4ENED 3BH9B 2XN9E 4NHCL 4U6HB 2HT3D 1ZGLB 1XR8A 4UV7H 1S7VB 3FRPG 4HWEH 5EN2B 4OSUH 5CD5D 2BMKA 2BVEA 2HFFA 4F7TB 2WWKO 1NGWB 2LAGB 4XP9L 4Y2DB 5DJZA 4NSKB 2FHFA 3P4OB 3P30H 5IM7A 3RAJL 4CU7A 3MRHA 3SDAB 3TJHC 2DQDH 3VFOA 1TNNA 2MQ0A 4IMLA 1AO7B 2WMPA 1BIHA 2F74B 4JFFD 4F58H 1ZT4A 4P49A 4O58H 4WW2B 1IGJB 4I0PC 3W2DH 1FLTX 2JJTA 4OCXL 4M3KB 2HTLD 1G9ML 1OGAA 1TJHH 4XWGH 4LLVB 4XGZA 5INCA 2K1MA 2HFTA 4PGEA 1WIUA 2A0LD 1BF2A 4XMPH 4O2FA 4DW2L 3FB8A 3LEXA 4XWOD 1IJ9A 1N8ZB 1WEJL 3S4SG 3SDCA 1AD9A 2GJ6B 3H9HA 3GJFA 5TFSH 4XHQA 5HHOA 5CHNA 1NUGA 4F7MA 5JPNB 2JB6B 3C08H 1KEGH 1OSPH 1RIVH 1BVLB 1QOKA 2VLJD 5HGBB 3TT1H 2IJ0C 5C9JB 1QRNE 1XF3B 4M1GH 3VRJB 4YHNA 4JFQB 4NPYB 1T1YB 3GMMB 4HLZG 4BK4A 3OJ2C 1NLBH 1N5AA 5IQ9A 3CVIH 1C5CL 3GSWB 1R3HA 1ZT1B 4YZFF 1MCRA 2A83A 1GAFL 3CK0L 1Q9OB 3B9AA 4KU1A 4NZRH 5CLTA 5C0BA 5J6GA 4ORZC 43C9B 4HD9A 5CIPA 4YAQB 1TTGA 4D0CB 3OKDB 1YMME 3E1F1 1NFDA 3HG1B 4P4KC 5E99H 4F2MA 4OLZL 4QCIA 4PJIA 2LVCA 5IIEB 5DJCA 3HPLA 4RMSA 2VLRA 4NZUL 4KK8D 4Y2DC 1L0YA 3QG6B 1WITA 1UEYA 4P2OA 2GK0B 1FBIH 3GBMH 3BE1L 2AEQL 5BOPA 3AY4C 1A2YB 2DQTL 3V4VL 4P59L 5ANMA 5GGVL 3N50A 1NFDE 1IC1A 1SBSH 4RFNB 5D7IB 2DI9A 2ERJB 2BSED 4S1RH 1UKSA 4DKFH 2RBLA 1ND0B 2DQDL 2IH3B 4KKBC 3MLYL 1HOCA 2I9LB 3CSYB 1ZLVK 5FK9A 5J06A 3G6AA 4WI3A 3MCLL 2NXZD 1ORSA 3QDMA 3Q5TA 3LS5H 3QPQD 1Y6MR 4QYOB 1NH6A 4LCCB 1BOGB 4GQPH 1VA9A 2YPLD 3H7BB 4DGYH 3AMLA 1E0OB 3ZKMD 5IB4A 1PQZA 1QD0A 3QQNA 5F1KC 3BEVB 4JQXC 4HIJA 3ILQD 3WD5L 3BISA 3JV6A 3BKYL 2UWEE 1E4WH 2OK0H 2ZG3A 3V9FA 2VDPH 4KFZC 1I3VA 4QKXB 1F6FB 4PLNC 2VXVL 1LK3L 2P43B 2PYED 3WEXA 1FYTA 4AEIH 3DX9B 1KIPB 3MLXH 5EPMB 1A1NB 1IAII 3O4LB 2QR0B 2UYLB 1UWXK 2EE3A 5DEZA 2VISB 4M8VA 3W2DL 1YMMA 5KTEL 4Y4KC 2R9HD 5FUCC 1OOAA 2FR4A 3MRJA 4BJLA 3P77B 4BUGA 2A9ML 3K3QA 4FOMA 2ED9A 2FR4B 1GXEA 2V9RA 2ZSWB 5A3IC 5D96B 2J88L 4UUJB 4L8DA 1JPSL 3O3AB 2VDMH 2FHCA 2FB4H 5FFLA 3HA0A 1PG7W 2HTKC 4KKAD 4X4XA 4LU5L 1P69B 4JRYD 4PRBB 5C0BD 1NCBH 3SJVD 4Z7NF 5HXMA 5HHME 2ZOKA 3QNYA 4LFHD 3VG9B 3VE0A 1A6UL 3QXTA 1MCHA 5JDJA 4LEOB 1EZVX 3GSRA 3O4OC 1A9BB 5FCUH 3T3ME 2NY4D 3EYVB 3VU2A 1YQVL 1OCWL 2EE9A 4JFOB 1CVRA 1EX0A 1U91A 3R4DA 4OGYL 1YEIH 3QISA 4KI1A 5IFJB 1OGAE 3L1OH 4NQED 1XF3A 3VRJA 2DOCA 3OKDA 4UQ3B 3CLEL 5CEZH 5KS9F 4MDIB 2IQ9L 3RWCA 5FM4A 2YK1L 4UQ2A 1MCDA 1J05A 2IPKA 4PJGA 4X6BA 1CR9H 2QSQA 3KPOA 1YDPB 2GJ6E 1FE8H 4JLRB 1W2KT 1U8PB 4HAGA 2GJ6A 5IHZA 1TLKA 2ADGA 3EYOA 5F7LB 1UACL 1ZT7A 3KDMB 1BFVL 5HI4C 3GK8H 4AIOA 1N4XH 2PW2B 4JQIH 4ZO8A 1OTUD 3ARFB 5IEHA 4RGNE 4PR5B 2DLHA 3DUHA 5EO9A 1D5ZA 2CLRB 4U4BA 1DQJB 5E7BA 3VXUE 2R56H 5F9OL 3IXAA 3S37L 3S97C 5BRZB 4EDWH 4FFZL 3I3BA 1Q94B 3C2SA 4JQVC 4BQ8A 4J23A 4Y5YC 5SWZB 2VNCA 3HZKA 3GSQA 4S1SH 4GMSL 4P5TB 2D03H 1DE4B 4W70A 1NANI 5FYJE 3WFDH 1QYGH 4XP1H 4EN3B 1WT5C 5GGTH 2IGFH 4X5WA 2DWEA 3T08A 1JF6A 2AAVA 4KXZH 3MJ7B 3D0VB 1MLCA 2ZUUA 2NLJA 4R4FL 1MCWM 3HFMH 3NIDE 2EDYA 2QKIB 2ZUYA 3CX5K 3S36X 2FX7L 2AJZB 4HKBA 5BZWA 2PCPA 1CT8A 3GIZH 1OVZA 1CLYH 4JZJC 5J1SC 3DWTA 1CQYA 3ARDD 8CGTA 5HDQL 2P5EB 2Z8VC 1B4RA 4P2OD 3TYFB 3WFCH 2EIDA 4I4WB 4F57L 3HZMB 4PJIF 1T1WB 2Q7NA 4W6YB 3NTCL 1Z9OA 3HUJB 4JRWA 1CGYA 1QSEE 3EO0A 4F7TA 4NQCA 3EYQD 5EBWA 4O5LH 3UXFA 5IVXE 1U8IB 2NTFB 5GZND 3H9SA 5GSVB 2GT9B 2DYPB 2IBBA 1BLNA 4K2UH 4F9LC 3CC5A 3H9SB 3HNTL 3VFVA 4KTDH 1ZEAL 4LSVL 3X13B 1BBDL 3FT2A 4OD3L 2FJGB 2QSVA 2X9WA 2YBRB 1N5YH 1ULVA 3EFFB 5F70A 3P30L 2HKFH 1NJ9A 5ICXB 5D7JA 1EMTH 1DBBL 4XNYH 4CNIA 4PJFB 3MMEB 1ZOXA 1J7VR 5F9JB 4GBXB 3MBEA 1IQWH 3IDNB 1FAIL 2QQLH 4M7LT 2GUOB 5IQ7H 5D7SL 5ICZA 2NY6D 5DK0B 4P46C 1JUFA 4TTDD 3BRFA 3VI3F 4ODBD 2MCPL 4M6ML 1WCBB 3FOMB 3FT4A 1HILB 4YHLH 4X6FA 1ZHKA 1H3PL 3FOMA 4WO4C 2H6PB 1JYVA 1L0XA 2FH8A 5FO7B 3LEYH 4I0CC 4KAQL 3VI3E 3MRPB 3TCLB 2QHRL 1MWAH 1NGXB 4P23C 1V7ML 3TCLA 3PXJA 4ZYKA 3T2OA 1NGPL 3OZ9H 3DECA 5H37G 3F7PC 1BIIB 4JKPH 2CPCA 5D7JB 3AAZB 1LDPH 4HZLA 5E00A 1AI1H 4NRYA 1VKXA 1CK0H 4Z7VF 1TQCC 5DO2D 3MREB 2DD8L 3U48A 1JNHB 3CFJA 5ICZB 4PBVC 4PJHF 3AFLA 3UC0L 3TO4C 3NCMA 2VZ1A 1N4XL 3T2QA 1I9JL 4PRID 2CK0L 2QADC 4TVPL 2N7BA 3S35H 2ZUSA 4KRPB 3VXQA 4LF3B 5KSBE 2DQIL 1GGBL 4HIEB 3ULVE 3QIWB 2D0GA 5I1GL 4TN9A 1I1YB 1FG9C 4JDZB 1MI5A 4LVHC 4MXQD 1MFAL 1KCKA 1VFUA 3AROA 4MB5A 2W9LA 3ARQA 4LQFL 1B0RA 1IGTB 2A77L 3ZDZF 5I8KL 5JO5A 3WV0A 3OKNB 5I1CL 1ZXQA 1CDIA 4WDIA 3VE0B 3OKYA 3LKPB 3MLUL 1T4KA 3O11B 2E6PA 1QNZL 3D3VE 2G5BA 2A6DA 3MX0A 2AK4D 1TTFA 2B5IC 5DDHA 3WXVH 3WD5H 3MJ9L 4OLXH 5CEZD 4FQQB 5A16A 3X14A 3SCMA 3D25B 5KVFL 5LGJB 5IW1B 4P5TA 3RFZC 1MWAB 4KI5F 3GGWB 4LCWE 4PJBE 2D7TH 1T7WA 1DLHB 2XWJA 3HPJA 4WI8A 5MI0B 4JFDE 3S3SA 4M61A 4LPCA 5ISZD 1H8OA 4FABH 1U6AH 3C6LC 2ZSWA 4JO3H 4KDVA 1FC2D 2OLDA 3HNTH 3HNSL 3OB0K 3KYMA 1RHHA 5IHZB 2ITDA 3UPRB 4O5LL 4HW6A 3U30B 1K5NA 4JY6B 5FYLD 2A74B 3JTTA 4R0LC 5EPMA 1D5ZB 2CLRA 5A40E 5IGXH 2OL3H 2X9XA 4HUMB 4XTRD 4MD0A 1MAKA 1QFWH 1RMFH 2IMMA 2VR5A 4LSRL 1YC8A 4I9WE 3BP4B 1IC5L 1H5BB 4ODTH 1PG7X 1CD0A 3BFOA 1MJ7L 4S1DD 5HI5C 1XF5B 2WK2A 4X4ZA 1RJYA 4NO5B 3OR7A 4MYWB 2A1WL 1I9RH 5D2LA 4LP5A 2VXSH 2X44D 2Z8SA 1JPTL 5D7LE 5CEYB 3UDWC 3NPZB 1QSFE 3MZTA 1RD6A 1YN7B 3DBXA 2VSCA 1J5OH 4YO0A 5EWIH 4PRBA 1OQOA 5TE4L 3FMGH 5K9JL 4PG9B 2EYTA 4AIZA 5DJYB 3A0OA 3KYKH 1AD0A 4KMTH 5AYUH 1G7QB 1KIRA 2DQCL 1LE5B 1FNEA 1YEGH 4M6NL 2DQIH 1U2CA 1KCRH 3VD5A 3BZ4B 3FL7A 4L8BA 5CD5C 3L5WA 1F8TL 4PJ7E 4P2OC 3TM6A 1I9JH 5FO9B 1X5HA 3D18A 1FL5A 5EBGA 2VDRH 2GK0A 2VE6A 4NQEB 5HI5D 32C2B 2VISA 4MQTB 4JZOB 4HS6B 3NA9L 3TH2T 3OKOA 4XP6L 3T8XA 3S4SB 4Y8AA 3UZVB 1FGVL 5IG7A 1S9KC 2BZDA 1CXIA 1TMCB 4ZXBD 3WKML 3VXUB 5DJCB 3ARED 4WENB 5M7QA 3O6KL 3P4MA 3CDGB 3BO8B 4JE4B 2I26N 2EO9A 4ONFH 3VH8G 2AW2A 1V7MH 3QYCA 2AK1L 5DJAA 4HXBL 5C0CE 1FFPB 2O5ZH 1DUYB 2WZPD 2DQGL 5F1IB 3VXPA 3T0VA 4I5BA 1H0DB 5B4MC 4PG9A 4EVNA 2XZQL 1BBJA 1MHCB 3MRIB 3D1MC 2W9DL 5FGSA 5LJYH 3TVMA 4ORGB 3T8XB 4NP4L 1UC6A 4OF7A 1BVLA 1CICC 3GKZA 1GPOL 2X89A 4MA8H 1Y18A 3V7AE 3W0WE 1MJ8H 5BVJA 5F3HB 5D8JL 1WFUA 2P45B 2P42B 2FWOB 5ILTL 3ZE0F 5DURD 3IAGC 5E8OB 1J0HA 4X7SH 4YXKH 4M02A 3H9SE 5HHXL 4M8QB 4L3EB 4MHHI 1IGJA 4U6VL 1KT2B 1H9VA 1OT1A 5I8EA 1CXHA 1RZIA 3WS3A 1DSFL 4ORGA 1G1CA 3HPLB 2WSKA 4TOYH 5KN5A 5T1LD 1ZLSL 1G0XA 4I77L 3WFCL 4EVNB 3VH8B 5DT1H 3W82A 4R4BA 5GS0H 4OFVA 4NKQB 3NFSH 1RZJL 3HE6D 4G6ML 4N5ED 1LK2A 1XF5A 3ILQC 1AR2A 2OJEB 1TPXB 1KCRL 4XZUA 2FX7H 2V17L 4KZDH 3GBLA 4JHBA 3QDMB 3STBA 3KYKL 2HFGH 4ESKA 2YN3A 5I1KH 1XIWD 4ZFZB 2G5RA 4ZTOL 1INQB 2PO6B 2NZ9C 3MSPA 4G9FA 1GZQB 3CXDL 3PHSA 1K9TA 2BVQA 1NGPH 4X9GA 4OLVL 2XPGB 3LS5L 2VIRB 1S7SB 4HUWA 5FKPA 3QO0A 4JG0H 1IM9A 4WFGE 3GM8A 4UT7H 1PQZB 5E8DL 4HXBH 2ADJA 1M7DB 5ALBL 3PWPB 4Y5XA 4MJ4A 3CX2A 3FB8B 4BKLB 4LMQE 4ZODA 4MS8C 4RQQA 5GGRB 2DKMA 1CU4L 3RGVC 4QRSB 4PJ5A 5H35A 5J1AB 3QDGE 1JRHH 4K07A 5DGQA 5HJ3A 2VLRD 3L3DB 5EC1A 3V4VH 2R23B 4Q9QH 5IW6B 4KUCF 5C9KA 3ECBA 3IJHA 4RBPK 4FQIH 5F6IB 5HHPA 5GGTA 4MCYA 3GSNA 4HGWA 3GRWA 3O45B 2VTFA 1FORL 4ODUA 3Q48A 4PD4J 2DKUA 2Z91B 3QUZD 2L7UA 3VFSB 3VG0L 4LSSH 5GJSL 4WW1A 1K2DA 4JZNB 4YDJB 4A2MA 3EW3B 2J5LB 3T65B 1FPTH 2EDOA 5E99L 5HVHC 4KHXL 2DD8H 4LCCC 5DRZB 3C8DA 2A73B 5L88H 1U8MA 4YO0B 5CSGA 3D6GA 4RX4D 3UTTA 4F7CA 3GGWA 1HHGB 3IDYB 2IPTH 1XR8B 2GYSA 3ZE2F 1GAFH 1QSED 3TN0D 3TBSB 3NTCH 4TVPD 4K8RH 4MXWL 2BDNL 5CHNB 1S9WA 2OYPA 1BVZA 2HN7A 3PQYA 4ZS6C 2IADB 1WCBA 3LOWA 4OF0A 2NW3B 1A1OA 1WC7A 2QQKL 4HCRA 1YEKH 4R26H 1FZKB 3LHPH 4XPBL 2RAMA 1GC1C 2A74A 5E1AB 4MZ3A 2F74A 3JXAA 4GKZA 3Q0HA 3OR6B 4GW5B 1F4AA 5IB5B 2J8UF 1CFSA 2X4OA 1C8PA 4N0YL 1EPFA 2YUVA 4HPOL 1D5BA 4I0PA 1YEHL 4D0DA 5C0AA 1L6XA 4NFCA 4Q9RL 2KDGA 4BSWA 4NC0B 2BY0A 1BQLH 1RZKL 3O6LL 3VFWB 1MNUL 1OAQH 3S9DB 2VABB 5C6WH 1D6EA 1A7PH 3BGFC 4L9LA 4XXDA 5FO7A 4KJYB 5T1KA 4HX1A 1D9KB 3SGDI 1A64A 2NXYB 1T5WB 3BKCH 3RBSA 3SY0B 1NBVL 2ZNXA 5I9QC 1U8OA 3BPNC 3ZMRA 3FCTA 4A6YA 3W0WA 4HIHA 4UAOC 3DO7A 4UINH 4WO4A 2JCCA 5DUBA 1NGXA 4O4YH 4GRLC 3HRZA 3PV6A 4WO4B 2X4OB 3MJ9H 4OLXL 4PLJD 5DQDL 3LRSA 5DD3L 4CNIB 2Y6SD 2FDBP 4YXHH 1IGTA 3MRCA 3VFVB 4X4YB 3SDYL 4F9PC 1NGQH 3I9GL 2YD4A 3ZYIA 3MV9E 5HY9A 3WN5C 4G6JL 4H8WH 5EZOH 5IT2L 1LO4H 4HKZA 3T4AB 3T1WA 5T1DL 4OGXH 4NRYB 1I1AB 4PJ8B 1UZ6F 3TESA 3BZEB 2LABA 5HYJE 3F62A 5MEQB 3UBXB 1S9WB 4UOW1 5D1QB 5F9WC 3HNVH 4NQCB 3LPFA 4LLUA 3RVUC 4Z77B 5DUBB 3H9YA 3AC0A 4NO3A 4QHUA 4RFEA 2Z0BA 5DJDB 5L0QB 1BFSA 2R0LL 1AHWA 3AY4A 1GZPA 4OLUH 3OX8A 3O2DL 3SDXB 4HHAA 1JPSH 3UJTH 1PX4A 3I6KB 3BN3B 3RI5F 1GIGH 4G8GE 5DRWA 1YEGL 4M6NH 1DZBA 2MOVA 3KWWB 2CLZB 1FO0B 1K8IA 3MRMA 4X6DB 2P8MB 5C0BE 1CXFA 4OCRH 1KENH 4OV5B 4L3CA 2F53B 3MXWL 4QHLB 3GMLA 3WNNA 3MJ6A 1MI5D 1KTLA 4G8EB 3LCYA 1FVEB 4YK4C 3MACL 3TT1L 1DBAL 2F8XC 1H3PH 1IAOB 2GW5A 3QUZC 4Z0BH 4W81A 4KAQH 3BPLB 4NZTL 5IQ7L 5FKPB 1GOGA 5KG9B 2O5XH 1RUQL 5KS9B 3H6JA 3QUMH 3C6LA 2MCPH 4GO6B 3WHXB 3PABA 4AENA 4G7YH 5SWZA 2HVJA 5I1DA 1JWUA 4QRSA 4UZGA 4JY5L 5D5MA 5KVDL 2Q8AH 3F7RA 4DGYL 4I9WD 4M7LH 5EORL 3MYZA 1CF8H 4JFOA 4Z78B 5GS0C 3ARRA 3IAPA 4R0LA 5AUMB 5ESVA 1TQBC 3MRJB 1RV6X 4OZHF 1N5YL 5F3BA 4GS7C 3ROOB 2IBZY 3L5XL 4JN2B 1BBDH 1S9XA 4HLJA 3VXMB 4E0RA 3EGSB 1C5DA 3BH8A 4WI5A 4CJ1A 2UYLA 3SGKA 4LLYB 3ARBD 2F58L 5F7EL 1ROWA 2P5EA 5EUKA 2GY7B 3SE9L 1P9MA 4QXUH 3CFBA 1DVFB 1G9NH 1AGFA 3WFHB 4QF1A 2NY1B 4FFVC 5FYJD 5I1AA 5GS2D 4JO2H 1EBAA 4U7KA 3PDGA 4WNQB 5T1LB 1EJ6A 3KS0J 5FHAH 2BVPA 4HULB 3UDWA 4QRUB 2CKBB 3W5MA 1T7VA 3JBG7 5TF0A 1CLZH 4LNVA 1Z2KA 4XRCB 3LDBB 4Q74A 4BKLA 2VQTA 5C8JB 5KANI 3DGCR 5C0JB 3S34L 4KZEH 4LHJB 4XHJD 4HS3A 5AG9A 3QDMD 2Z93A 1NGZA 1CG9B 1QZ1A 2NW2A 4WV1B 1YMMB 2RFXA 4FQXD 5KZCD 5I8CA 2L7JA 4PRDA 4KV5E 2PO6D 4GRWB 1CFQA 1PZUB 4FQJL 2E27H 3IGAB 4TSCL 1JNLL 5ESAB 1G7HB 2AXJA 3VW3L 4HUUA 3C5SA 2DRUA 4JKMA 2H1PH 3V4PH 5GHWH 5C6TL 2AJYH 4RCAA 4UQ2B 3JV5A 4NQXA 3LQAL 1UH4A 4P59H 3EYSH 4NN6C 5GJSH 1KXQE 1ADQA 1D5IL 1ZLSH 3CH1A 4Y19D 4AQOA 1JE6A 1UB6B 2H32B 43CAA 2VLRB 5HPOA 4NKIL 5B38A 2ZCHL 4JFED 2YK1H 4OZ4A 3I75A 5CKGA 3AS3A 5I2IB 1CR9L 2V7HA 4X7EC 4AEIL 3X3GL 2JIXA 5SX4H 4ACPA 3BIBX 3W9EA 1ZGLM 4X7SL 3ESUF 3MRIA 5KW9L 4P9MH 1KFAL 2ZWLT 5JW4Q 2XZCL 1QR4A 3IF1A 1UVQA 3G6AB 2V2XB 2IAMA 3MRNA 1R3HB 4HIXL 4CBPA 4JM2B 1WBXB 1BJ1H 3D39E 3RBGA 3SQBA 4BM7A 1DFBH 1OTUC 5ALCH 3BSZL 4J1UB 4PJCA 1BM3H 1BQSA 4RIRA 3CXDH 5FB8A 3UX9B 4JANB 2OS7A 3S5LB 1SY6A 3ARWA 1H8NA 5EZIH 2XY2A 4UT6L 3V0WL 5EOCL 4M6OH 3FHQA 2BHUA 3BZ4A 2PNDA 4LDLB 5C0JA 4G6MH 3RY4A 4JVWA 4PJDF 4ZOEA 1AIFA 1YEDB 4PLOB 3QZWG 4J4PD 5IQ9B 4XXCA 1XGQA 4JPKL 3JTSB 4BFIB 4JFFA 2Z4QB 5TQ2L 3WIIH 5HVWA 4N8VG 1F5WA 5I1GH 1NCTA 1O0VA 4NQSA 3T3PF 1CFNA 5IM7B 3SBWA 3SQOH 1NFDB 3WJJA 2X09A 3OR7B 2G75A 1HINL 3VXPB 5FCSH 5CJBA 1S9XB 4WI9A 1YYLH 3SDCB 2CDFA 1GGIH 1QVOB 2YUWA 1OWRM 3HB3C 2P49B 1NC2B 3D3VD 4XAWL 4XVTL 4UOJA 4JR9L 2NXYD 1CF8L 3LB6C 5SX5K 1OAUH 5E2WL 5C0GA 3KPQB 3KPMA 4Y8DC 1VEMA 5F1NB 3VCLB 3HAEH 1E6JL 3CZFA 4XPTL 5ALCL 5EIIB 4FFYL 5EBLA 2VQ1B 3GMRA 3E3QC 4AIZB 4JFDD 1BM3L 5H94B 3QQ4A 1M4KA 4NRXA 3Q6GH 1LEGA 2A2QT 2VDKH 3WNMA 3DSFL 4NQCE 4P9ML 1R3JB 4JPVL 4MXQC 3D9AL 1KTRL 4HEPG 1XGRA 4M7JL 4LRNH 2APWA 5JW4N 4IRJA 4Y16D 1C7SA 4WIQA 1LP9B 4BZ2H 1TPXC 2D3VA 3AM8C 2XZCH 2M26A 1N6VA 2R2HB 1RU9L 4QLRA 4U0RC 4DW2H 5INDA 3F6IA 3DARA 4DQOH 5IV2B 5HGAA 1CE1H 4WW2F 5E5MB 3KPLA 3C6SA 5D1QD 4FZ8H 1D5IH 1TJIL 4WNQA 5T1LA 1LILA 5FYKH 4LPWA 4CMMB 5KVEL 3IXTA 5ITBL 1BJ8A 3OAUL 3RIAK 5I76B 4OF8A 1IFHH 4HMCA 1PJ9A 2VLLA 2EICA 4PGDB 1V3LA 1G0DA 5H2BA 3GJFB 1K6QH 1I8KB 4MNQE 4NJAL 3QQ4B 1IGMH 3PWJA 1JF1B 1J1OL 2D7QA 2E27L 5FO8A 3CU1A 2WWMC 4D3CH 1E28B 2X7LB 3OGCA 2P8LA 5DRNB 2F53D 3V79C 3BSZH 2NY6C 5BXFB 4G6FB 3S36H 3TFKD 1RK1A 3EYFB 4IRSB 1MIML 4C56D 3VGDA 1NL0L 1YEKL 1IAIH 4X9IA 4WUUE 1ZTXL 4I3RH 5HY9B 5E24E 1SJEB 3LKOB 4YE4H 3QUXC 4WI4A 2QQLL 2XWJB 2WP3O 3T2PA 1NEZA 3MXWH 3GDBA 4LDEB 1HI6B 5C0IB 3EJJX 4HBCH 3CFIC 2V9TA 2R8SL 4XMLL 4L9LC 4XI5C 4PREA 5GZNC 2PW1B 3BH9A 4HXAH 2VB5A 5CD3B 4MXVE 3FO1A 2MPAH 2VLKD 4FG6D 1NJ9B 5ICXA 3U9UA 1U3JA 3FRUA 2UY7A 5JZ7D 5HHNB 1YNLL 5GS1A 1QO3A 1NGWA 3MRPA 1CQKA 3D39B 2J5LC 4YNYB 1E27A 2EECA 3VFTB 3IT8D 1R3IL 4MJIE 3FFDA 2NY2C 3MMEA 1E4XL 4PRPE 1CG9A 1JP5A 1TCMA 1YMHA 2NW2B 3C2AH 5LXGL 4LASL 2X40A 4F9PA 3CVHB 4P57A 3VA6A 2GUOA 4DKDC 4Q9QL 4QRQA 1T21B 4HUVB 4I3SH 3W0WD 3NN8A 2D7TL 4JREC 4MWFA 4LGRB 2CUMA 2BNQE 1F13A 5FAAA 3F12A 4YGVA 2QTEA 3L3IB 1P7KA 5GSVA 2HT3C 5H8DA 1FFOA 5E8DH 2ZJSL 4LQFH 4GLRI 3VFGL 4Y7MA 1JGEB 1KPRA 1A6UH 1B3JA 4NO0B 4YQXH 5D5ME 4HZLB 3HC4L 4X5WB 1KIQB 4HKJA 1NDMA 3T0XA 1OF2A 3VXRE 4NHUB 2XA3A 2OL3L 4WVRA 4JN2A 1MEXH 3MROA 5TGBB 5JOPD 3HR6A 3RY6A 3BZFA 3EOAA 1EDQA 1FRGL 2J8UE 2YA0A 2BOBB 3MOBH 4JFHE 5C86A 2FH6A 1SYVA 3ZTNL 4DJMA 1HILA 1I1CA 4HFUL 4JZNA 3MLSL 1KN4H 3OAUH 4KJYA 4NNXB 5T1KB 4KKLC 5JW5A 2XACC 4YUEL 1UKQA 4HJ0C 4FQJH 4MJ5B 1A9EA 4FQ1L 1BFOA 1T80A 5KTEH 3GKWH 3ARZA 4EI5A 3DVIA 4HWBH 2EXWD 2XTJC 4PB9H 5A2LH 5SV4A 5I18L 2VLMD 2EYSB 4PJ9C 1T1ZA 1UJ3C 3BQUC 3G5XB 1OAYH 4L4VE 4HK0B 1ODAA 1P4BL 3OMZA 3QIBD 2NNAB 3FO0L 1CICA 4PV8B 4QTHA 4YIQB 5BZDB 4JM2F 1FNGA 2EDQA 5HGGS 3S37X 1OCWH 5DHXB 3CUPB 3MRLB 1CIUA 5KAQG 3MV8D 2FNBA 3CFEB 1EXUA 1J10A 5E9DA 1BVKA 5D9SA 1FDLH 1HHJA 3EYVA 5J3HD 3WO3B 3B9DA 4OV5A 5EUOF 5TFSL 4LHUD 1P84J 3ZKXB 4OLYL 5FHAL 1IC5H 3FQNB 5E5UB 1BAFL 5C0AE 4TPRH 5JORB 5BO1H 5DQ9B 3MV7D 1OAZH 4HWBL 4NDMB 2CXKA 5ESQA 3D85D 3O6FB 3Q5OA 5F9OH 3S37H 4X98A 3TYGH 3UCRA 1NBYB 5BCAA 3OX8B 4RWYH 4BFGA 3RNQB 3Q6FB 1WZKA 2BSSB 1V7NH 5BZDA 3IXAB 5I0ZA 4HF5L 3KAAA 3B3IB 3L3IA 3GSVB 2Y9RT 4DVRH 3ULUD 5I1EL 1FG2A 2PW2A 1EHXA 1UH2A 3C9NB 3TBTB 1KIQA 4HKJB 5D5MB 4N0YH 4YIQA 3IDUA 2C1OA 4LLAA 1GSMA 1KPRB 4NZDA 1I3RA 4QO1A 3SJVA 1FBIL 3GBML 2VDQH 3HI1A 5IW6A 3EYQC 1G9MC 1HHJB 4M7ZC 1CLYL 1KB5A 2XKNA 1AQDB 4C4KT 1TENA 1NC4D 1G7IA 1LO4L 5C07A 4YNYA 1B90A 1MCJA 2WIIB 4CAGA 2NY5L 4ZNEA 3LKSA 1CE6B 5DF0A 1HYSD 2Q87A 2ADJB 3WKNA 2DI8A 5I1HH 1DQDH 3JWDH 5AYQA 4Y19E 4NZRL 5F96H 1DEDA 4JO1H 4DZ8B 2PTUA 3M17B 4J8RB 2PW1A 1IKFH 1UM4L 2IEPA 2MKWA 2XRAL 4S11A 4X8JA 4PBXA 3ULSA 2ZUWA 1LO0L 1T6WA 1D5MA 5CJXC 5D2NC 5CJOL 3DNKA 1ZLUK 1U58A 3FTGB 2WBJA 1ADQL 2BNUB 2ZUTA 4S1RL 1NCDL 5KW9H 4ODWB 2IALB 2H9GB 3EOAB 1FC1A 4OAWA 2F54B 1G84A 4GKNB 4Y1AE 2W9EL 1IFHL 4U2YA 1A6ZA 1G6RB 4KDWA 4KQ3H 3B9EA 4OUUB 4QHNA 4LCCA 3S3PA 5GRYA 3INUL 4N68A 4XBEL 4O2CB 1JGUL 4PLJC 1YQ2A 2VO5A 2PTTB 5IHUL 2IANB 4U6VH 3GSUB 4UV4L 4LARH 2B2XL 4Y89A 5HHXH 3H7BA 5EIVA 1HOCB 3CSYA 2NY5C 3O3AA 3PJSB 4LRNL 1MWAL 1BJ1J 3ZKXC 3SDDA 4ONGL 2OM5A 4H8WL 4Z0BL 1EBPA 5EZOL 1XGUA 2GHWB 3AXLA 4KPHL 1MFDL 4EIZC 2MMXA 1YYML 3L5WB 5JIKA 3U2SB 3FO0H 3B2VL 4Z7WE 5D8JH 3O3EB 1NEUA 4NT6B 1E28A 2VDKL 5FYKU 1U93A 4URTB 1HH9B 5DD5H 3DI2B 1N3NA 2AXFA 4V1DB 3EKCA 4MCZB 1R5IB 4Z7UE 5EBMA 4ZD3L 1YNKL 2KKQA 4NWUH 3NZHH 4PJ5E 1IT9H 3S34H 4JFQA 1GHFH 4MA3B 4G6FD 4WW1B 3H0TB 4LU5H 2OTUA 4MVBD 2APVA 1RHFA 5B21A 1VHPA 4YHOL 4PRAA 2OCFD 1A7RH 1J12A 3FAXA 3FOLB 3SDXF 3F7YA 2J88H 1SYSA 4UNVA 5IFAH 5IB4B 3A6OA 4JO2L 4CU6A 1P7QA 1XFPA 2VJXA 3MLTB 1QBAA 4JGMA 5HGBA 2XTJE 1YUHB 1KJVB 1RIUH 2CKBH 5I1EH 3KPMB 3KPQA 4NNYA 2BSRA 3PE9A 5CSZB 3EYSL 4UNUA 4YHNB 5ADOL 3A6BH 4YE4L 4GG8B 3HC0A 3RZCC 1A7NH 3IDGA 32C2A 3E6HA 4K9EH 1LEGB 4PUBH 3WFEH 1S7XB 4JPVH 1R24B 1HCVA 1I8KA 1GZQA 1U8NA 3L7FB 1P5UA 3RKPA 3BD5A 3HE7D 2XFXA 3WL9B 2UZIL 4CDHA 3ZSTA 1X5FA 2EDWA 5CSBA 4HPYL 5JUEH 5D72H 3B8SA 4U1KB 1T22B 4ZFOB 3T4YB 3QEQB 1A8JH 1QHPA 4Y0GA 1WFTA 4LLVA 4IMLB 3OPZL 3KPSE 5FYJU 2J8UA 2PO6C 1MJUH 1QEWB 1R3IH 5BW7A 2PXYD 4LAQH 2G75B 5C2UB 3QFDA 4NM4H 2AEPH 1BX2A 4IMKA 3E6FB 3QFDB 3GI8L 2YEZA 3QWOA 5CEYA 1PAMA 4EQ2A 3D85A 2OTWA 4UDUA 3ALPA 1AHWC 4BK5A 4OD2A 3BP6B 1SEBA 3KJ6H 1W8OA 4MNGE 1L9NA 5HVFB 3W9DB 4AT6B 3EDKA 1RIUL 3X3FH 5FYKL 2R8SH 4EDXB 2YD7A 1IQWL 5IBLD 5C0FA 4Y88A 2B1AL 2W9EH 2NX5E 1U8NB 3L7FA 4ZOBA 1GJIA 3N06B 1LP9A 2I27N 3V8OA 4QWWC 1F8TH 4KI5E 5T33H 1A7RL 4L4VB 4OLUL 1CFNB 3SDDB 1F2XK 2P47B 5HVHB 2AXHA 4PGEB 1S9YA 4RAUA 3NZHL 5DD1L 4B0MM 3VFUA 3FQXA 2OR8A 3QH3B 2JJUA 2X6MA 3I75B 4KZEL 1E4KA 3CFKA 3KHQA 1BEYH 1ZA3A 2X4TA 2X42A 4NN6B 3TC9A 1J0ZA 1RURL 3U46A 1T03L 1HKLH 5TPWH 4LLMB 2XZQH 4GG6A 2ORBH 3U7YH 1F4XH 1JBJA 3P4OA 1GGIL 5E56A 1NSNL 1QFWM 3N1MC 5L2JA 1UADC 1OW0A 2EEBA 4UIKH 2BRQA 1IVLA 2B20A 4XMPL 4PRAB 1PFCA 1S7XA 1IKNC 4LHUB 3RWGB 4HIIB 2DQTH 1N3NB 4KKCC 2EEDA 3C60A 3O0RL 1CBVH 4R90H 5AAWA 2YC1A 2CUHA 2P5WA 3QEQE 5T1MB 3X11A 3QCVH 1IQDA 1IILE 2W0KA 3O9WA 4XCNB 4TNVF 1ETZA 5L9DL 1X5YA 3BMVA 2MJWA 1P9MC 4JFXB 1KB5B 5HGDA 5J8OA 1FZOB 4F37F 2D31A 3O6FD 5L8KB 1Z9MA 4OLEA 3DXAB 3VXSA 3UJTL 4Y5VB 3GJEB 3QHZL 4JN1H 4RGOH 4S0SD 3DJ9A 4MD4A 1GYAA 4HCRL 4KI5C 4RWYL 2GJJA 3OPZH 3Q1SH 4GLRH 3L6FB 4Z7UB 3QR2A 1UA6H 1JL8A 4C4KO 1H3WM 3LY6A 1NPUA 2MCG1 1YNTB 3OTTA 5AG8A 5MEOA 3ZLQC 1KC5L 3T0ED 4R96B 2O5XL 4JFYB 1JJUA 3QO1B 5T1DH 1QQDA 5IMLB 2IQAB 2V2XA 4Q0XL 3WYRA 2BCKB 3UPAA 2EDEA 5ITFA 3L3HA 5IKCB 5AZEL 3GM0A 5MP6L 4X6CA 2MFNA 4PJAB 5CJ5A 4NZTH 1CE6A 4X7CC 4DK6A 4M6MH 4IDLA 3BD3A 1R5VB 1XT5A 4POUB 4LKXA 4XMKH 1X6NA 2EO1A 2F54E 3M17A 5SWZE 4JM4L 1QFPA 3BESR 3IETA 2K9UA 3NOIA 4HFUH 1DQQB 3BGAA 4G5ZL 4DVRL 4PGCA 3MNZA 4JEGB 2WP3T 3VXOB 5E8EB 3QAZB 5IHLB 1OGTA 3L5XH 5BV7H 2Y36L 1UACH 3IJSB 5J12C 3RVWC 1KPUA 4O02L 4Z6AT 4JFEE 4PRDB 4OB5H 3HRPA 5EORH 4FZ8L 2C1OB 3B6SB 5KSAB 3KNBB 2YHGA 5F7DB 5K9JH 1I7ZA 4FQQA 2Z93B 5A16B 3DLQR 4LPVA 5KSUB 2BERA 3TIEB 3EGSA 5CEZL 3MUGA 4L3AA 3KJ6L 2ZCLL 3B83A 4WRLA 2HH0H 4NUGH 3MUGB 4ZAKC 2F15A 3OKMB 4V1DE 1OSPL 1FVEA 5E95B 4XCFH 3UO1L 4OTXL 4E0RB 1IEAA 2WV3A 2ZJSH 4GOSA 4EBQL 2CDEB 3HFML 3I02B 2EKJA 1IEAB 5MP6H 5I1CH 2BVPB 1MOEA 2WLYA 1U92A 4LARL 4QGTA 3RNQA 4RFEB 1ZLWH 4L8SA 1UCTA 1FFOB 2YZ1A 5JOEA 3T0AA 4RAVA 3ZYJA 2CGRL 2R0WL 5DFWH 4U6YA 4GJTB 4PJFE 1B2WH 4EN3A 3HI1B 3TNNA 3CLFL 4LHUG 1X5IA 3QQ9D 4QHKI 1HH6A 2JKXA 1TQBB 2J4WL 2Y06L 1I3RB 1ZANL 4WEMB 4OI8A 2DL2A 1G6VK 3ROOA 5LGKA 5E8NA 2D9QB 3KR3H 4R4NC 2Y7QA 4NNXA 2C7UB 3GB7A 5DD6A 4YC2B 1TZIB 1YEHH 4HWZB 4NJ9L 5FOBA 2BOBA 2H26A 3JVGA 1FFNA 4XX1E 4HG4K 5DEGB 4Q9RH 2BVYA 5DJ8A 1J5OL 3LEVL 5CBAA 4U1HB 1Z5LA 1N59B 2VITA 3E8UL 1T89C 4K3EL 4NRZA 2HJFA 4OQ1A 4EI5B 1IL1A 4Y4FB 2NYYD 35C8H 5DMKB 5B3JE 3BPOB 2ESVD 1T2QH 4WDIB 4ZUVA 5DWUL 4ONOA 2C1PB 1YQVH 2GSIB 3I3DA 4U1JB 2D7NA 1KELH 4UT6H 3V0WH 4F33A 1GHFL 3I2CL 5D70H 4NWUL 4IBLT 1I3GL 1D6VL 5CJXA 4FQLL 4S1SL 2CIKA 4EUPH 3H42L 3BZEA 2AJ3B 3EO1B 2QL1A 1S7WB 4QRQB 4MX7A 1FNFA 3C2AL 4K8RD 2DMBA 5B22A 5JNYA 3OR6A 5J12B 2HKFL 1J0JA 3S6CA 2CR6A 5BV7C 2ICWJ 4KUZL 1NLDH 2HG5B 4JDTH 2VABA 1JZ3A 5KVMC 3QFJB 8FABB 1S7QA 2H3NB 3F12B 1UG9A 2DQGH 4EIGB 4HKZB 3T4AA 3ZHLA 5BV7L 4HUXA 4LOUD 5KOVC 1WBYB 3KYAA 2ATKA 4WHTA 2B1HL 1FFQA 4X9HA 5T33L 2FLBT 4G5ZH 1GL4B 5GIRA 3FO2B 1F90H 1I4FB 1QSFA 1EEZB 1OTSC 3CPLA 1HDMA 3M1BA 1LD9A 5D1QA 4TULH 4B7LA 4MQ7A 3SKMB 1JYWA 3RVTD 1CGTA 1DSFH 3OG6B 2FJFA 1AC0A 1QFUL 1EERB 1A6AB 3OGCB 2EDKA 3E2HB 4JPIB 3ZE2E 3LQAH 3DO3A 3D5OF 3MLRH 3HMXA 1A1NA 1IGCH 3U30C 4XCFL 4LL9A 4YDJA 1W8NA 2AQ1A 3RPKA 3TVMD 4OT1L 1MJUL 2FECL 1KLUA 4B53A 4ZDHB 1CZ8H 4OF5A 4WW2C 3IDNA 2BNRD 1Y6KR 5C0BB 2APBA 4PB0H 5L8LB 3TBWA 5I18H 5D7SH 5CJQL 2F53E 4ZFGH 2Q76B 4YPGB 1HSAA 3D69B 1KEML 3S88H 3CFKB 4UINL 3HB3D 3C09B 1VGEH 1JPGA 1Z9SA 1LNUA 2VERN 3DX8B 4GW4A 5FXCH 4HUVA 3QXVA 1QEWA 3P0YL 4ZUTB 4EUPB 3HHRB 5A43C 3ARFA 1N6UA 2HFGL 2ZNWA 3MCLH 5AD0A 3SDCC 4D9QE 2I07A 5GGQL 3NCBB 1D6EB 2FATH 3C8KB 2FB4L 3O2DH 1BLNB 4HGKC 5DC4B 4M6AA 5GS0L 4EDXA 2XXMB 1MJJB 3HG1D 4K9EL 2VLLB 1QACA 3VDAA 4YDLC 4I2XA 2NY2D 1LDPL 5DUPH 3UTSB 2DTSA 3RVVC 1CE1L 4LVNC 4KK6C 1L9MA 3G04B 1A22B 3MNWA 2PR4H 1RU9H 2QHRH 3HR5B 1TVBA 3C87A 1QLFA 5IJKA 1JVKA 4UMGA 3RWIB 3H3PL 3MLTA 3T04D 3AREA 2RCSH 5GGQH 4DGIL 3LN5A 2FRGP 5E08L 4UT7L 5I17B 1DL7L 3T65A 2OTWB 4Q0XH 2D4FA 1E4WL 3WUWG 4FABL 3VWKA 1MIMH 2PO6A 2Q3AA 1IE5A 2DBJA 2IMNA 3VWKB 3G5YA 1IGYA 3CFDA 4QRPB 5E1HB 2NXZB 3EO9L 5BVPL 1OAZL 1R24A 4RISL 4ISVA 2LTQB 3PHOA 4Y2DA 2DWDB 2VZTA 4G7YL 5H94A 3D2UD 3T0EB 5EBLB 3BIKB 5FYKE 1FYTE 1A6TB 2EDRA 1J1OH 1WJ3A 4U1KA 4U49A 4Y2OA 4AH2A 1U8QA 1HIMH 1JPTH 4KWUA 4JN1L 3OKEB 1N2RA 2X7LA 4V1DA 3O2WH 1LE9B 1CGSL 2QSCL 4PJEF 2R1YA 4LKCB 1H15B 1OY3B 3RY6C 3FB7B 5HVGB 2VLKA 3QRGL 1CWVA 2P5ED 1I8MB 1S7RB 2CDFB 2H32H 4U1GC 4L4VA 4WEUD 5IHUH 3D69A 2PR4L 2C3GA 1TVHB 3OF6A 3S5LA 2XPGA 1HHIA 2B2XH 3C60D 1FE8L 5I73B 5I66B 4I1NB 3DX6B 5GHWL 1AFVH 1UWXH 2GAZA 1P7QB 3QRFM 1HCFX 2R2EB 2QQKH 3NA9H 1UJ3A 3BQUA 1P5VA 5D93B 4HIJB 4AT6A 4PD4K 2BC4A 4OKVB 1CGSH 2QSCH 4I2XE 3P40A 3DVNA 4MDJB 3BP6A 5EOCH 3ZKMC 1UM6H 1MSPA 4FZEH 5FM5O 2IGFL 4U6XB 3MRGB 3RGVD 3WFDL 2DQCH 1D7FA 5HYEA 2WBJB 4KRMB 1W72B 2V5MA 3BT2H 4NQSB 1OARL 1XGQB 5BS0E 2NY6B 5DJZB 3L9RB 5EBMB 1G9NC 1OPGH 1OW0C 3QPXL 4X5LA 4J1UA 4NJAH 3GRWH 1ONQB 4M7KH 4Y4KA 1NCUA 1UWGH 3STLB 1T22A 3WNKA 4Z7WF 1Z3GH 3QI9A 2CR3A 4L1HA 4PJ7A 2R2BB 5D7LD 1REIA 2XWBA 5DMGC 1RZKC 3ZE1F 3WFEL 4ONGH 1F2QA 1T66D 4YX2H 3BO8A 4Y1AD 4HWZA 1UWEL 2AK1H 3GMPB 3M45A 3B3IA 4I3SL 5C09D 5H37H 3RA7H 4RIRB 4L4TA 3EJZD 5TDNB 5FB8B 1WBYA 5BMFH 5HBBA 5I8EB 1R3KA 4NBZB 3QULB 1VADA 3LN4B 5JXAL 1FP5A 4CVUA 4LSRH 4NQDA 4NJ9H 1GC1L 1U58B 1CGXA 3T09A 1AC6A 2VL5B 1FJ1A 3BKCL 1LDSA 3NFNA 4P5MA 1F4WL 2X4RB 1FLRL 2VDRL 4PRIB 3KXFB 5D2LE 3ESVF 3LSOA 3O8XA 2OK0L 1NMBL 3BN9D 2R2CA 5F3HA 3NAAL 1B2WL 2QADD 5HDLA 2FGWH 3QIWD 5BRZD 4HWUA 5E9DB 1UKTA 3QXWA 3HAEB 5D71L 1T1YA 4M93B 1MJ8L 1EFQA 3DBXB 4RISH 2GQHA 2GCYA 4XVSH 4NWTL 5FA3B 5I1KL 4P5TD 4YBLC 4XB7A 1G7IB 3TZVA 3QJFA 5BO1L 1H3UA 5L2KD 4XCEA 4KZDL 3IDJA 3UO1H 4JPWH 1IGIH 5IBTL 2YPKA 4NKMA 1VB9A 3O3EA 3RRQA 4AENB 1BWMA 4E41D 5IMMA 1MCKA 4Z7VE 2GFBB 5DK2A 3QXDA 1LE9A 4U05A 2WBJC 4ONFL 3MACH 4NOBA 4RMUA 2OQJA 2YMXH 4P2OB 5CKAA 5E4EB 1JMXA 5TQ2H 3BIKA 3BW9B 5K59F 4I18C 1B0GB 3LKQB 5TJWK 3BPCA 3QHTC 1KENL 1NDGA 3BZFB 1YEEH 1GIGL 2VXVH 4OM0L 3N0PB 1HH6B 4P9HC 2P8PA 1EVUA 5HHQA 1V3MA 3MFGB 2O5YL 2BJML 2Y23A 4PGBA 1CD9B 4KKLD 1JI1A 2W65B 4XPHL 1V7NL 1NUNB 5F9AC 3G9VA 4U3CA 5GGSA 1U92B 5JO5B 4X83A 3UTQA 4ZAKA 3M07A 2ITCB 3CFBB 2A6KB 2J6EA 4M1DL 1OP3H 2VWEE 5CEXB 4ZPTA 1AHWB 1WTLA 3K80A 4GBXD 3TN0C 4FQCH 3CLEH 4QTHB 4Z7QF 3QDGA 1I3GH 2IPUK 2W0PA 3ZL4H 3WXVL 5D70L 1RHHB 2HRLA 3VXOA 2V5SA 4M7JH 5KSUA 3QUYC 1MJJA 1CN4A 2EXYC 3QG7H 5B8CA 1C1EL 1D3CA 5F1OB 3ARUA 1IEBA 1JNHA 4PJEA 5JW5B 2PETA 4HMEA 1IC4L 4G8EA 4RNRA 2D03L 5JQ6L 3ALXA 4TULL 3Q5YA 2IH1A 3S7GA 2DQJH 5DJ6B 1MFAH 4Z5RB 3SPVB 3O8XD 2D2OA 4QXUL 4Y4HA 2NX5D 3MFFA 3P11H 1WVZA 5EOTB 4MJ5A 3NIDF 2B7DT 3LN9A 2APFA 2Y36H 5JIHA 1I7UA 2I24N 4X6EA 2R69L 1DQLL 3MA9H 5F6HJ 1XAUA 4KY1L 3LKPA 3O11A 4UAOB 1CFVH 1T5WA 4NNPH 4KRPD 4K7PY 1JGDA 3HAEG 3QCVL 2BP3A 4HBCL 5HYSA 3OKNA 1BZ9B 1URLA 2P8MA 4TSBL 2CO6B 5L8JB 1DANU 1J8HE 5ISZE 2X1PA 1BZ7A 4OQTL 1QFWI 3EZJB 4PJFA 1KCUH 4ZO6A 2HA1A 3DPBA 3S3JA 1WWWX 4YLQT 3SPVA 3NPSC 4CN4A 1ZVSA 2CDGA 1A1MA 5FHBL 1NL0H 5GS3A 3BXNA 5ETUB 4RDQF 4PY8J 3KPNB 3PWNA 4NQEE 5SWQB 3AMKA 1P1ZA 5DTFB 1A3QA 2EZ0D 1IGIL 2NY3D 5D6CA 3H8NA 4IMKC 5DA4A 2H3NA 1QBBA 1S7QB 2VYRE 1DQML 4MA7H 3VDBA 1SJEA 1GPOH 3EHBC 4MA8L 4QRPD 4HDIB 1TJHL 1KC5H 4LOUC 5CBEA 3GJEA 4EXKA 4TSBH 2V2WA 4FXLA 3UYRH 4FFZH 3HE6A 4DKEL 1MIEL 4Y16C 4NIKB 3BP5A 1UA6L 1F3DJ 4WFHD 5DD0L 3J7HA 3NH7L 1U3ZA 4KHXH 3U9UB 1ZMYA 1RQ5A 5IF0B 3FCTB 3VXTB 4AZ8A 2F5AH 5DSCA 1U9KA 4NO2B 4PTUA 5HPMA 3VGAB 4JJHA 3BX7C 2NTFA 3BDYL 1AKJD 1QSFD 4JO3L 4GKSA 5LCVL 4K2UL 4AMKL 1MQKH 4CADA 5T3ZE 4QRRA 2FJHB 3C5ZB 2DLFH 4HXAL 4UTBL 1KPVA 2AJUH 2I60H 3ULUF 4XCCH 3GIVB 3QDJA 2EYRB 4OSUL 2B39A 5C0EA 5C6PB 3K2UL 3WLBB 3RPIB 4CUCA 3TPKA 4XMKL 1T7XA 3PGCA 4CMMA 3D0LA 4RWHA 4OCNC 1WQVT 4XCYB 1FL6B 5J9PA 3JV0A 4W4OC 4XXDB 2V2TB 2WAHA 3ES6B 5C2BH 3MRKA 3BN9C 1INDH 1EGJA 1MFBL 2DQHH 3KPLB 1A6VH 4MJ2A 5DRZA 2JELH 2DM7A 5C70A 4Z18A 4IIQB 3W39B 4LAQL 1DBAH 3WUWA 3T1FB 4YFLF 1JGVL 2EKSA 2WQRA 1WWBX 1OAYL 2ZKHL 2K3TA 4R7DA 2AJVH 1K8DA 3PWLB 3KYNB 3RGVB 5H2BB 4HGWB 1NCCL 3BGMB 4HUNB 4Y19A 4O4YL 1J8HB 4GG6E 4OLWL 2DTMH 4L29A 4JR9H 1EMTL 5HDOA 4PIRF 3MNVB 1QPXA 1YYLL 4BZ1L 2DMCA 1M7IA 4PY8I 3F6LA 4RFNC 3QPQC 5CZKA 3JTSA 4BFIA 1TCRB 1JZ7A 3IRZA 4Y1AB 1K2DB 5F7MC 5FV2A 2GITA 1U8HB 2P5WE 3QEQA 5C09B 3T3MF 3WIFA 5JQHC 3O3DA 2P7TA 3SKJH 3RU8L 5J7CC 4HJJH 4X7FC 3EUUA 2DDQH 1T0MA 1KG0B 3B5TA 3X3FL 4OM1H 4NQDE 1QLEH 5GRUL 3C09C 4UILL 4U3HA 5HGHB 1DQJA 4R2GD 1KBGH 3WHE0 5E6YA 5DC0A 1G9EA 4MNQB 1Q94A 1LK3H 5I30H 3G5VA 3H7LA 1ZTXH 4I3RL 3D9AH 3WDJA 4ELKA 1CICD 3BKYH 5K9KA 3O9WD 3ARSA 2J12B 5CAYB 2GTZA 5I71B 4UB0L 4C55A 3UTSA 1QSEB 4MXWH 3EYFA 2HP4A 2R4RH 3GZKA 4MMXC 1J9CT 4ZTOH 4QEGA 4JLRA 4YHIA 4MSWA 3WNOA 5J89A 2ED8A 3NAAH 3WO4B 3LQZB 5I8OL 3V52H 3AU1A 4L3EA 4M8QA 1DBML 2VUYA 1TTUA 4ODHH 1BD2D 5CMAA 1U3HB 4KVCH 4G3YH 3EYOB 4EUPA 4ZUTA 1J1XH 1I8IB 5ACMA 5DURB 4R2GC 2IPUG 1U8PA 3NCYP 2VN7A 4PGDA 5ITBH 4IRJD 3QUKB 1AIFB 4J6RH 3IKCB 3BWAA 3QO1A 3O45A 4MDIA 3RWCB 4PFEA 4D8PA 4OCXH 5EA0L 1GGBH 2RIKA 3IDIB 4DOHE 2CO7B 1M71A 1CFQB 2BY2A 4QYOA 3SDAC 3O81A 1CTOA 3GBNH 4WFGD 4YBHA 5KSBA 4PRHD 3P4MB 1Q9LA 2WINA 3L3GA 1YEIL 2OZ4A 1XGPB 3ZYZA 2EIZB 1HSBA 3VFNB 4E42B 4KMTL 5AYUL 3WDHA 4QOKD 4XTRC 1T03H 1KJ2B 2Z92A 4NQXB 2W38A 2BDNH 1X4ZA 5GRVK 4BH7A 2IC2A 5EZJB 1MUJA 1BOGA 1YNKH 2VIRA 5DVMA 4QT5A 3BJLA 5EWIL 5LGHL 4Y4KD 4JFXA 1MRFH 1T04A 1J1PH 2F8VA 4XH2A 1S8DB 3PWUA 5HYJA 4GH7B 4MD5A 4NQDB 3WEXB 3SO3C 1A6TA 3QDAA 1WCQA 3SGEI 3TZVD 1PKQA 5HYFA 5HSFA 2NY0C 3VCLA 3N85H 1EO8L 4A6YL 3L9RA 3M8OH 1AR1D 3K1KC 4P3CL 4P5KA 3C8HA 1VPOH 3BWAB 1HHHA 3IKCA 4E5XB 3MQIA 2CLVA 4C56A 3IDIA 1B0WA 1XF1A 2OJEA 1RUKL 3EO1A 4ELKB 2KQNA 4GKNA 1JGUH 2AJXL 4OZGE 1N26A 3CDGA 3O6MH 4G8FA 5CWSB 3V5KB 2LU4A 4F58L 5C3LD 2GAZB 3F7QA 5LBSL 4RAUB 1JTPA 5MHSD 1HHKB 1A7PL 3MOQA 2MQCA 1XF2A 1RVFH 4UB0H 1M05A 1I9IH 1DBMH 4XH2B 5HHOE 4Y5VC 2AKRB 5EU4B 3TZVC 1HQRB 4J3SA 4JKLA 2FECI 5DS8A 3KYNA 4XBPB 4PG2C 4PJBB 3RGVA 1TJGL 3HCVB 4U1IB 3QIUC 3TO2B 2XV6B 1T20A 3C8KA 5I30L 2PTVA 2PXYA 1JV5B 3B9KC 3SEPA 4ZD3H 1X5KA 5DJYA 1MHHB 3OKOB 4I8DA 2Y25A 4JG1L 1DLFH 1AXIB 4LCYB 4X80L 5I8CB 1CIDA 3D2UA 2GEEA 1Q9LB 4HK0A 1NMCB 4M1GL 5HDQH 4AG4H 2OR9L 2XKNB 4XVTH 1ZE3C 5C7XH 3LB6D 1DVFC 4YHIB 4PUBL 4L8BB 5J3HC 1U42A 3GIZL 1C5BL 3DV6A 4RMVA 3SKJL 3IS0X 3V6OA 4QRTB 1X4XA 5CJ8A 3GSOB 2NY3B 1JCKA 2GTZB 3MRNB 2IAMB 3E6FA 3NACH 2YD6A 1KPVB 4OCRL 4H88L 2X4NB 4HZAA 5EOCJ 3SO3B 4WUKL 5D6DA 4L5FL 1DLHA 4BQCA 4YH6A 3ARDA 3RIFF 15C8L 2CK2A 3VXNB 4C83B 4NZUH 4NKDB 4JREB 1XZ0A 1OLLA 2BVTA 2DAVA 4JFZL 1EJOL 4XNMB 4H20L 1QSFB 3L95B 1AQKH 3DRTB 5E6IB 3TN0A 2Y06H 5HYJD 5D7IE 1AXTL 1RJLA 3KNBA 3NCFB 5F7DA 2NY1D 1B0RB 4WGVB 2LAAA 4P23D 4OFIA 3HR5A 1PSKH 2C3VB 5IMKB 4WW2A 4KROC 3UTZB 4IRSC 3RDTD 5F7KC 2RQ8A 3QUMA 3ILPB 5SWQA 1CU4H 3K74B 1I1YA 1OGAB 3MNVA 2A9NL 4ZQKA 3PNWA 1BD2A 1NGYA 3DX8A 3C6LB 1PD6A 1T2JA 2ZCKL 2EYSA 5T5FH 3U0PA 2CKNA 4LQ1A 1VEOA 4JG0L 5I75B 5J4MA 5HHOB 3FOLA 3LEYL 4WWID 4APQD 4G9FE 3TBWB 1N8ZA 3I9GH 1MFEL 3RIAF 1BPVA 3FKUS 3WNPA 3OKKB 2A77H 2X4QA 2ZCLH 4DCQA 5LCVH 3PL6C 4P2RA 1MCLA 3KPTA 1NCBL 3QQ3B 2C1PA 2F5AL 4NO2A 4PTUB 2UUDH 3SCMB 4GRLA 3ARGC 4NQCD 4X6EB 3P73B 4GKSB 1M7XA 3IDMB 3MUHL 1QSZA 2A38A 3U4BL 3HRZB 3PV6B 4X6CB 3CFCH 4L4TE 5DSCB 3GI9L 3HG1E 3JTTB 1TZGL 4KTYA 5IJKC 1AJ7L 2CXGA 4GUPB 4U33A 1GGCL 3B43A 3EFFA 1U6AL 4OM0H 2R0ZH 5K9OA 3QIWC 3CVHH 5EUOA 3RTQB 2O26U 5KSBF 2ZUXA 2KZ1B 5EOTA 1JYNA 2JJSA 4GBXA 1SM3L 4IIQA 4RX4A 2HN7B 4O51B 2DICA 4EQ3A 4OCYH 4OLYH 2JB5L 1HXMB 2D4DA 1MI5B 5ANME 1LD9B 4ALAH 3OJDA 5KVGH 3RHWK 1L4IA 2YSSA 3WHXA 3PDOA 3ALWA 3P2TA 1KTDA 3ISWA 3BPOC 1KCVL 2JJVA 5DDHB 4Y16A 1FVDA 4S1QL 4FXGB 4J3OC 5GQBA 4OZGB 1FCCA 4S1DC 1CGWA 4GMSH 4K3GA 3KPPB 1YY8A 1RMFL 2E7BA 4E9LA 4DKAA 5GRZA 5FYKD 1FYTD 1R0AH 1MLCB 1A1MB 4XP1L 3LQAC 2PUQT 5CP7B 2GIYA 2UV3A 4LSPH 2R39A 3VRLE 1Z5LB 4X8XA 5D1ZD 4EJ1C 2B0SL 4D94A 4PRNB 5BV7B 4D0DB 5DJ6A 4OD3H 2IH1B 1ZKAA 3SO5A 4P2CG 3QHZH 4RGOL 4ODSH 1BD2B 3QUXB 1MY7A 3KYOB 3FHAA 1OTTC 3CSGA 1FORH 5DK0A 4RQQB 5GGVH 5GGSB 2VZSA 3ZT7A 3VG0H 1C12B 1OTTD 4PJXB 3TWCH 3IJSA 4YDLB 1QFOA 2Q7YA 1BP3B 3PGFH 3DMMC 4N0UB 1AP2A 2R15A 1FQ9C 3UROR 3CSPA 4QNPE 1QR1A 4FFWD 1EEUA 3H3BC 4JRXE 4WTXA 1G7JB 4HV8A 4FFWC 4X6CE 3CH8A 4CL7A 4EBQH 3UJIL 5J13C 1QRND 2HAZA 1TZIA 3J8F7 3O4OB 3PNWB 5DVOA 2NR6C 1KCSH 1VSCA 5EH1A 3DUUB 1JTTA 3SDYH 4YHLL 2A9NH 4KKBD 3SE8H 5GSRA 5IEKA 5JR1L 5E5MA 3B5HA 3MOAH 1OSZB 3NBNA 4FA8A 1NLBL 4HSQA 5F21B 5FECB 1RJZA 1YMMD 4P2RB 4NDMA 3HUJE 4FQXB 1OB1A 4NQDD 4EOWL 2PYEA 1XZ0B 1Y6NR 4YFLI 3TZVB 3FFCD 5BOZG 1HHKA 5FV1L 5AEAA 3C08L 1Y0LB 1RJCA 4K7PH 1W0YT 5TDOA 4PYGA 1I9RL 3DX7B 3MGAA 1KT2A 4NKDA 5EC1B 2COQA 3MJ8B 2AV1B 2FIKB 4HJ0D 5DHYB 4PJ5B 3O8XC 1BQUA 4FQHA 3VFRA 5EIIA 2NMSA 1NBQA 2XOTA 2C3VA 2Y5TB 3MRDB 3QNYB 4Z0XB 5KVGL 5JOPE 3AVEA 1H3XA 4NFDA 4K3JH 4QXTB 5FDWA 3ECBB 3IJHB 5HHPB 5D5MF 3VMPA 4AYFA 4LGSB 4ZUWA 4YHML 4JM2C 3VFGH 1FGNL 3QJFB 1CFSB 1MHEB 1CFBA 4GKOA 2Y5EA 3VJ6A 3DV6B 1II4E 4G9FB 4KHTL 4D9LL 1KJ2L 4RMTA 2V7NB 4XNZB 4FRWA 4ZFOL 4ZFZA 2M8XA 4UUJA 3PWPA 4F8TA 4NM4L 4YXHL 2A6KA 5ILTH 1ZHBB 1S8DA 3PWUB 1BBJB 5DFTA 2XTJB 1IM9B 1H3TA 1AXSB 5DZNA 1RVFL 3ZKQD 2ADFL 4XZUB 4GRLD 1Q8MA 4ODVL 1DFBL 4M4RA 2YRLA 3SHSA 1NDMB 5DJ2A 5FYJH 1YEDA 2CLVB 4IRSD 3RDTC 3THMH 4C56B 2V5TA 5IMLA 2D0FA 5DA0B 1CFTA 3TA3A 3DX9A 4NGHH 2ATPB 2ENSA 4MNHA 3HZKB 5D2LF 3ZTJH 4G8GD 1FLRH 1PEZA 3WJLC 5ICYA 2EDTA 1RUKH 1U91B 4ZS7L 1F58H 3NCEB 3X17A 1UWEH 4R9HA 4XNUL 4YDKH 4JGJA 2JK5A 5DT1L 4ZUSA 5FK9B 5L7XH 4XMLH 4WFFE 2AJXH 2DM3A 3KDMA 1B88A 1OAXL 5EZJA 1S3KL 2DQFA 1UB5A 4CW1B 4MNGA 4D9RD 5KN5B 2AXGB 5IVXB 4BFBD 2GKIA 1V3JA 2D31B 3R8QA 2AI0L 4YX2L 2R23A 2XWBB 1IM3B 1NSNH 4X4XB 1BECA 4TSCH 1U8QB 1RK0A 4XAKD 1IM3A 4DEPC 3JV4B 5L2KA 3UAJC 1VGKB 4H5SB 2FYYB 1A4KB 1JV5A 3SDCD 4N0RA 1NAMB 1WWCA 5HHMD 1NC2D 3D3VB 2VE6B 4NQEA 5HYJB 3RQ3A 5DS8B 5CFHA 1CFTB 3TA3B 3N9GL 1HQ4A 3NABL 4XXCC 2EIZA 1OAKH 2C3HA 5DQJB 1MRCL 1KIPA 4MJ6A 1YECH 4HQQL 4JVUA 3RDTB 3OGOE 1NAKL 1F6LL 1ZWIB 1OGAD 4ZTPL 1G7PA 2OI9B 4PJCE 3C6LD 2WINB 1K4DA 1FNSL 2VDML 2XN9D 1ZHBA 5HI3D 2XWTA 5L7XL 4E41A 5HHOD 2FX9L 2Z8RA 5CIPB 4L4TB 5TDNA 1K4CB 3CXHK 5LWYL 4LPYA 3WIFB 1RUAL 3VD7A 1WEJH 4ODHL 1A2YA 3EJZC 5T3XE 2J6EH 3QAZC 3V5HB 2FO4A 2IQ9H 1FGVH 3THML 1CTNA 3L1OL 5IGXL 1G7QA 1KIRB 3G08B 2BVUA 4OGYH 4WUUD 3G6JF 5EU6D 1ZVHA 2X1QA 3FQWA 1SVZA 4HS6A 4PJEE 2AV7A 4XPGL 1ZEAH 4LSVH 3ZDYF 2MTPA 3B9KA 1DN2A 4KRLB 5MEND 1WSST 5LGJA 4I2XB 5KSBB 5HTSA 5FGBC 1TETH 2A6DB 1SQ2N 1A4JB 4FTVA 4MNGB 2FWOA 4R97C 1DVFA 4P4RA 1KJ2H 1QSEA 3CVIL 4E42A 1IKFL 1OB1B 1IAOA 4XNXH 1N6QH 2DJUA 5GPRA 1INEH 3JWOC 3FB5A 4CVZB 1UJ3B 1KTLB 3BQUB 1NCWH 1JIBA 2GI7A 3MXVL 4WHYH 3W39A 3QG6A 2BXYA 2EC9T 1WBZA 2VLJE 3ZKSD 1LVEA 5CILH 4MLSA 5E08H 3DX6A 3MV8B 5EO0A 5EN2A 2VH5L 1YJDH 2A1WH 3P0VL 1I85C 1XCQB 1EO5A 2E6QA 4HIEA 3G5YB 4QRPA 4Q58C 3ORJA 1PX3A 2Y1VA 2G5BB 3OQ3B 4MQ7B 4OFKA 3SKMA 2P5WD 3U7WH 3WN5B 4R3SA 3VI4F 4WFHE 4RGNC 2AV7B 4QTIH 1L6ZA 1JWSA 2GY5A 3RHWF 3DYOA 1M7IB 1I1AC 2BNQD 1A5FL 5K9KB 4KDTA 3OKEA 3P4NB 3GSUA 1VGEL 2YPLB 1RULH 5D1ZB 1FZMA 2Z31D 1PZ5A 2AJYL 3GJFH 3MRKB 4NC1C 4OLZH 5IROA 2I5YL 5IW3A 2CK0H 4TVPH 1ES0A 5IIEA 3SN6N 3MV11 4YDIH 4IHOB 1IT9L 2J4WH 4QHLA 4KK8C 4LEXH 3HNVL 5C0EB 5KS9A 4LNRB 1F45A 1GGTA 2YN5A 3I50H 3H9HB 3OL2A 7CGTA 1N0XL 4X6FB 1A9EB 2AEWA 1LE5A 1S5HA 3PP3H 3TJEH 5TE4H 1RZFL 1KF9B 5KVFH 2BVOB 3FZUD 3WUZA 4X8JB 4N1CA 4XP4L 3FQUB 4HGMA 3U36A 5HGHA 4GAFB 2JCCB 1A6AA 1UEMA 4DKFL 3T2NH 3IDXH 3PP4H 4U1LA 2O5ZL 5L6YL 1S78C 5GZOC 4JFPA 3ULVH 1FAIH 25C8L 5I1JL 1YZZA 1XF4A 1RUML 1JFQH 3B8YA 3V4UH 5MEQA 1YY8B 1WWAX 4ODSL 3B2UD 4HWBA 5F9WB 3K1DA 4XP5L 2DLFL 4UTBH 4P2RD 4U1HA 3OSKA 4AMKH 1T7ZA 3QIWA 2YD2A 2PYEE 3MV8E 2AXGA 5E94B 3ARGB 3CU7A 3DUSB 1HXMA 4M43H 4H0HB 3MOBL 3LKNA 3LRSB 3TP4A 4LCIL 1XGUB 4IM8A 3H2WA 5T1KD 3NCYS 1FZJB 1RIHH 4HH8A 2HT2D 3RUGE 3H42H 2DBLH 1UM4H 4IOFC 3UTOA 1PW3A 4R8WL 3DHJA 5DWUH 4JY5H 4ODWA 3BXNB 5ETUA 4ELMB 3MLXL 3V5DA 1TQCB 3AAZA 3HPJB 2DDQL 1MH5A 2UUDK 5J6HA 4B7IA 2V5YA 3C5ZC 2P46B 1T1XB 2VXUH 5HYQB 1FIGH 4YR6B 1W0WB 5HDBF 5DR5H 3FO9B 4F3FB 2KQMA 4HH9A 5IHBA 2HMID 2ICCA 4XC1H 4BSWB 4U2ZA 3CJJA 3EDJA 2H6PA 3K8MA 4ODTL 3VWJC 3HTLX 5TE7H 3SY0A 3REVA 3RWDB 5GIRB 2Q8BH 4ZSOE 4PR5A 2IPTL 3KR3L 4XWGL 1S7UA 5ADPL 3EFDL 4PS4L 5HYSB 2FSEA 3MV7B 4PJ9A 4YWGH 2HRPH 5EZLB 3DV4B 2NY4C 4OLWH 2DM2A 4UI2A 4JY4A 2JCCE 5IF0A 4JQIL 5EBWB 1EEYA 1CL7L 1ZA6B 4U6YB 4X6DF 3UTPD 4J3VA 3QEUB 2CDGB 2EE6A 3GUTA 4TUKL 4FMFA 4IOIA 4L3EE 1IARB 3MLVL 4K8RC 3KLHD 4G7VL 4MXVF 3ULVL 3NPSB 5IVXF 2IFGA 1A6VL 1LEKB 4M1CD 2Y7QB 5EU3B 2NY1C 4P4KA 4HG4J 4F7CB 3U82B 4OZIE 3HZYB 3MA7B 4UV7L 1Q72L 3KPNA 1GOFA 3PWNB 5F7FA 4PJIE 2OJZH 3BKJH 1RZFH 1MVUB 1F4YH 3LRGA 3B2UC 1WICA 1NMAL 4GXVH 3HI6L 2VXTH 2W65A 2VC2L 3JSSA 2FZ3B 3MLUH 3KPOB 4KXZI 5IB3B 5IT2H 1ORQA 3MGTB 4XVJH 3GSVA 1JPST 3U0WH 1E4XI 4WU5A 4FQ2L 1MRDL 4LCIH 5JZ7C 3UYOD 3L5IA 3HE7B 3Q6FA 3O2VH 4TUKH 3MV8A 2DYPD 4LBEB 1AQKL 1BWWA 1KPUB 4S10A 5ESVB 5FCUL 3F58H 3R0MA 2OTPA 3PWVB 5FUZH 3RX7A 2FBOJ 3MUZ1 1QYGL 4NKOB 2CMRH 3CDCA 4M3JA 4P3WA 4LSPL 1JN6A 4ZSOA 2Z91A 4O02H 1MCQA 2WM0A 4O9HH 4F7PA 1YEEL 2OMNA 4K3DH 4YHPA 3BIAX 3SKNA 5DLML 4Y4HB 1R3JA 1OT2A 2E5EA 5CGYC 3WS3B 1I8LC 1I7ZB 2BJMH 2YR3A 4N0FA 4P4KB 5EU3A 4NM8H 3SKNB 2P8PB 1J05B 1RUPH 3BKML 5KJRH 1WK0A 4I77H 4FN0A 2BVQB 4JQXA 2X4SA 2F54D 1P84K 4MD4B 3O2VL 4MS8D 3JUYA 4F7EB 2ADGB 4KKNA 4L8CA 5C0GB 3QIUD 4ZFFA 4LKXB 2VXQL 4MLIA 4ERSL 3WE6A 3UTQB 4P2QD 4L4JA 4GRMA 2IBGA 1TZHB 2IAND 1NC2A 4WFED 3RVXC 1Y18B 4DTGL 2QLVB 5KS9E 3V7MA 4PJAF 1N6QL 4NKMB 2CJUL 2EH7L 5D2NA 3WXWL 1KIUA 4R6UA 2B4CL 2BCKA 1ED3A 1INQA 4N0CC 5IB1A 5IR1B 2GJZA 4LHUA 4ZOAA 4P5KB 4JQVA 4FXGA 5E5RB 4PP1D 4XPFL 4PJ9D 3TT3H 1G7PB 2HT2C 3IFPB 4KJWD 3D0VA 2CRIA 4LCUA 2XN9A 4Q6YA 1CL7H 1DJSA 2J8OA 4MJ6B 5TQ0H 5ITFB 3WJLA 5T3ZD 1LHZA 2DKSA 2UZIH 5D6DC 3ARDC 4KJPC 12E8L 4J7RA 3L3KB 3SDDC 2Q6WA 3L3JB 2DI7A 2P1YA 1HINH 2R4SL 1RZJH 4G80B 2WUBL 3GMPA 3U0TB 4YGVB 4QHMA 1FL5B 1MHHA 2H8PB 2X4PB 5CILL 1ND0A 2IH3A 1C7TA 3MRGA 3KLDA 1LO2L 5I76A 2X1XR 5GS1B 2C4FU 1WBXA 5JW3L 1FO0H 1KJ3H 4PRIE 1MF2H 2VLJA 1H15A 3HE7C 3QPXH 3VGEA 1JRHL 1CI5A 4PJGB 4X6BB 3QHFH 4YXKL 3V2AR 3DXAD 3C6SB 3OKLA 1E6OH 5CCKH 1N5AB 3ULVD 3QI9B 2Z31B 3FQTB 4XWOC 2LE9A 3QH3A 3TH4T 4PJDE 5INDB 1KUMA 4RAHA 3K8LA 5I16B 1EH9A 2ZPKH 5CMAB 4HIIA 1S9YB 5ACLA 1I7RB 2DQUH 2IG2L 3N1QC 4OLVH 5IVZA 3VFWA 3AU1B 3QWRA 1LEIA 3MV7E 3MBEC 1A7QH 4X99B 2LTQC 4LSQH 1BX2B 2VMFA 5DMIH 4IDJL 1NCNA 4J3WA 4P9HH 1WIPA 1UQSA 1CLOL 1IZJA 4NRXB 1IGML 4PLKC 5L88L 1IRAY 4KI5D 4OKVA 1W0VA 3U46B 2R0KH 1K6QL 4P5MB 1CDYA 2F19L 3ARGA 2C4XA 1I1RA 1KJMA 1R3KB 2OXGA 4P23A 1K5NB 4GAJL 1RZ8A 2A9MH 3VFOB 1NFDF 2A6JA 1TVHA 4TQEH 1KNOA 1P6AB 5L6YH 1AGEA 4TOYL 1NGZB 1WV7T 4H26B 5C0CA 3T2NL 1MUJB 3INUH 1PZ5B 3TO4B 4JCLA 2DQEL 1MAML 2XI9A 4PJ7B 3RUGB 4JRXD 4XNQA 3WNLA 2P7TB 4DOHB 1VFOA 3P4NA 3BD4A 5FGBA 2ARJB 3QWOB 5K33A 2W07A 4O58L 1OM3H 1NC4A 5FYLE 3RKDC 3LVEA 4NFBA 4PP1C 2CRMA 4I0KA 4FQXC 4LVHB 1A0QH 1MCWW 5CZXC 1ZGLA 1MCNA 3PG2A 5CJOH 1A14H 4P99A 4XC3L 2EIEA 2C26A 3BPLC 3SDDD 5T3XL 1DL7H 3DVFA 4F9LA 4OD2B 5J11B 1VACA 2HJLB 1AR1C 3QZWB 2JLLA 4HWEL 1EEQA 3H3KA 4QRTA 5IJVB 1AGCB 3WL9A 3Q2CA 4BQBA 4MA3A 1TNMA 1MAMH 1U95A 3FFCE 1JTOA 3R1GH 4MCZA 5IVOA 1F6AA 5BQ7B 3CNKA 4MQSB 2CRZA 4B5EA 3GFUA 4KKCD 4N8CH 4PJDB 2F9BT 2DMKA 3BDBA 4MAYA 4QWWD 2FCBA 4P46A 4JJ5B 5IFHL 4P5TC 3VXQB 5TF1L 3WFBH 2AKRA 4QHNB 4ODXA 3UEZA 2FEDD 1ZV5A 3FO2A 3WIHA 5JOFB 3O6KH 2DLIA 3LEXB 4LIQE 4YJZL 1VACB 3RPIA 5IROC 3WKMH 4AM0B 2VQ1A 3GMRB 5MEPB 2ICEB 1KGCD 2NXZC 1XCQA 2C3XA 4OZIB 3QNXA 3W11C 4M48H 5JA8B 1I7TA 3IFLL 2Q86B 1PLGL 4GSDH 2I07B 4NQUA 4JHAL 4CGTA 2IWGA 3VXME 2Z4QA 2BHZA 2N1KA 2Z31A 3FQTA 2G60L 2F5BH 4D9LH 3TCXA 5SWZD 3TO4A 4JKPL 4QOKA 4KPHH 4WEBL 1HQ4B 3ZKNC 4G6KL 2CLZA 4XPGH 1I7RA 5FF6B 4EN3D 3VMOA 3BYYA 4CADB 5FUOH 2KPNA 4FHBD 3P9MB 2CH8A 3K4AA 3GSWA 3IAQA 4OJFH 1FDLL 1RZGA 1TVBB 3R06A 1KEGL 3LZFL 3TPUA 2BFVL 2ENYA 1P1ZB 5DTFA 2HKHL 2YD1A 6CGTA 1K3ZA 3UBXG 4NQVA 3HE6B 3AS1A 4PGJA 1QHOA 3OJDB 5C8JA 2FJFB 4HMDA 2AEQH 2WANA 1JGLH 2LU7A 4HDIA 4JHWH 1IAMA 4O51A 1EEZA 3CPLB 3U0TA 4MA1B 4D9RE 1X5XA 3RNKA 2C7UA 1CS6A 1KOAA 2O93L 4YUEH 5DJ0B 2OTUB 4PJGF 2BSTA 1F3JB 2E8ZA 3H9SD 3I84A 3BUTA 2P5EE 4QGYA 1ZVSB 4Y4HD 1AGFB 3WFHA 2ATPA 4JM2A 5DMIL 3Q3GA 4JO1L 3NVQA 4P4KD 4DK3A 1L0QA 4GQ9H 1JUFB 4NUJA 4WGWB 4ZG1A 5CBAB 5JNYB 2R0LH 1UVQB 1ZWIA 3U0WL 1KCLA 4IS6A 2X4UA 4RSVA 1XH3B 4XVUC 2AJSL 1CT8B 2XKSA 2VXTL 2H26B 2EDNA 3C5SB 5BS0A 5FKAA 3QCUL 1AO7E 2OJZL 4ZUUB 1MPAL 4P2QB 2HJFB 1HNGA 3CXHJ 4K3JL 2V7NA 1N59A 2MWCA 2X05A 1A4KA 1ZAGA 2GSIA 3RWHA 5D2NB 3HI5H 1S7VA 4G6JH 4G43B 2HVJB 4G7VH 5I1DB 5DMKA 2AABH 4JO4H 4OBRA 3PGDA 3TA3C 1A21A 4DZ8A 3ZT5A 4DN4H 5TE6H 1RUPL 12E8H 3TVMC 5HD8C 4FP8L 4NBXB 3BP5B 4KJPD 3RVUD 1A6ZB 3IGAA 4PJ9B 2RGSA 5MERA 1EGJL 4LFHG 4F7PB 3LKSB 5HD8D 1CDGA 3ILPA 4MA1C 4MVBC 4NN5C 1DN0A 2JIXD 3B4NA 1L7TH 4RGMC 5DHVB 4EI6B 4ZAKB 3FFCA 3GMLB 4MZ2A 5FYJL 4HF5H 2A6IA 1OL0A 1C16B 5I1IH 4PRPB 1DBKH 3U4EB 2NLJB 3O41B 1HXYB 4G43A 2AQ2A 3O41A 4YHKH 4J8RA 1PG7L 3B9VA 3S96A 4WFFD 2VITB 3K2MC 4X7TA 1GCFA 4WI2A 4DTGH 1MVUA 1MFBH 2ITCA 2BY1A 4IRZH 3RVXD 4L8CB 4PJBF 5ISZA 3T77B 1R5WA 3OG4B 4XP4H 3GSRB 3UYPA 1JGDB 1FZJA 1A3LL 3QCUH 4Y5YB 1LEKA 4UT9L 2EDBA 2OQJB 2ZOKB 4MHHG 4L29B 3PGFL 4Y4FD 4HS8L 1WAAE 2NPLX 2AK4B 3BRDA 4PP2A 4NM8L 3VXRB 4BH8A 4CU8A 1FFNB 4RGMB 2ZZUT 5E8PA 1X5AA 2X70A 2WBWB 2W60B 4XPHH 5C0DA 3NGBC 1CXKA 1I8LA 2W60A 4OIIL 2O5YH 4L8SB 2ARJQ 2VKWA 3P77A 5LVEA 3IFNL 3MV9B 5F44A 3T77A 5ISZB 1GRWA 4RGND 1FL3A 4GXUM 2DF3A 4QTIL 4IDJH 1EEYB 1ZA6A 1L7IL 2CSPA 3HMWL 4YXLH 3QO0B 1GOHA 2QR0A 4EZMA 2Z35A 4Y5XC 3LH2H 4N0UA 2OMBA 2DQUL 1R3LA 2IG2H 4GAYA 2XZAH 1MAJA 1F11B 3KWWA 3T0WA 3K8KA 4H25A 4QRRB 4KK9C 1CLCA 3C60B 5B39B 2UWEB 5T3XD 4KK9D 4NKOA 3HAEA 4OKDA 1E6OL 1OSZA 4KTEH 1QFHA 1EO7A 2BSTB 2VAJA 4D9QD 4JRXB 5EU6E 2VSDA 3FJTA 4LAJH 3OKMA 2OP4H 1T0PB 2DB8A 1N0XH 1HE7A 4EKXA 3FRPA 1W72L 2V2WB 3U7AA 4G9DB 2NY0D 4DN3L 3K46A 3IU3A 4OI9A 1A6PA 4Z7WA 1CL7I 3Q1SL 1DQQA 3LMJL 4GRWF 1Q1JH 5KBNC 5DQDH 1EVTC 1CGUA 3SDXA 1T5XB 2R69H 1EHLH 1VADB 3LN4A 1MCOL 4NN7B 4YHKL 1QR1B 4DAGL 5MENA 3GSNL 5GGTL 1EIBA 1MCPH 5JHLH 4N5EC 5GGUA 4AEFA 1IC7L 1VESA 2ICWA 3EJYC