4HX0A

Crystal structure of a putative nucleotidyltransferase (tm1012) from thermotoga maritima at 1.87 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
HHHHHMIRPEYLRVLRKIYDRLKNEKVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIFSEFVSKKVRFSSTEKICSHFGELIIDGIKVEIMGDIRKRLEDGTWEDPVDLNKYKRFVETHGMKIPVLSLEYEYQAYLKLGRVEKAETLRKWLNER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative nucleotidyltransferase with two MPD molecules in the active site.
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Putative nucleotidyltransferase TM1012
total genus 51
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2012-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4hx0A00
2EWRA 5CFTA 4WQKA 5CFUA 5CFSA 4FO1A 4HX0A 4XJEA 4WH5A 2FCLA 4WQLA
chains in the Genus database with same CATH superfamily
2B51A 3RJJA 7ICJA 4KLGA 4UAZA 2PFPA 4WH5A 3MCRA 1ZQCA 3WFRE 3OUYB 5J29A 4PH5A 9ICTA 5D61A 1ZQRA 8ICJA 2PXIA 4X4OA 5J2FA 3JPRA 5CA7A 4KLDA 1VJ7A 5IIKA 5CR0A 4I2BA 4O5KA 3EF2A 4FH5A 3JPPA 4RQ7A 4O68A 4IQWA 4I27A 4LZDA 4XUSA 1R89A 5DBAA 1ZQZA 4Z6CA 2GWSA 3TFRA 2BCRA 4KLSA 5J0OA 4UB5A 3RJIA 8ICNA 4NKTA 4MFCA 4UB2A 3CK6A 1XSNA 4WC6A 4IG8A 4R66A 1TFYA 5CFTA 9ICRA 1KDHA 4KM5A 1ZQEA 3C2MA 5DKWA 8ICBA 4JWMA 3OVBA 3UPQA 5DEDA 1ZQNA 5HC9A 5J2AA 4PGQA 4K98A 4K8VA 5J0YA 2ZHBA 8ICGA 8ICXA 1WOTA 1ZQYA 4WCWA 5BOLA 4K4IA 3ISBA 4S3NA 4YCXA 1XSPA 3HJ4A 4QZGA 4RWQA 1UEVA 4LEWA 8ICTA 4M47A 5HRFA 4LEZA 4QZ8A 5IINA 4NY8A 4ATBA 3OVAA 3B0YA 9ICPA 2RFFA 4F5RA 7ICNA 3RJFA 3JCFA 3JYYA 4QZFA 4NXZA 3MGIA 4LEYA 4PPXA 7ICOA 2IHOA 4RQ4A 1JN3A 3MDAA 5CFSA 4I2FA 7ICKA 4K9BA 4RWOA 4KLLA 1ZQOA 4M04A 3RJGA 5CB1A 4I2CA 4XA5A 1UEUA 4PHEA 4K97A 3AQKA 2VANA 4K4HA 4FHXA 1ZQWA 4NLZA 2PBEA 4FH3A 9ICGA 2FMQA 4HX0A 4WC0A 2O5AA 4FHYA 4X4VA 5J2IA 7ICVA 1ZQLA 2IHMA 2HN2A 9ICXA 2GA9D 4RPYA 5IIIA 2O1PA 4X4UA 4YD2A 2M2VA 4RQ8A 7ICFA 4E80A 2BBHA 1MIVA 4I0UA 5HRKA 4QZIA 5IIJA 1MIYA 3PMLA 9ICQA 2B56A 9ICHA 4NXUA 4M9LA 5IIOA 4OAGA 4RPXA 3JPSA 3JZ0A 4WC5A 8ICLA 7ICMA 9ICJA 1BPXA 3UPSA 3UQ2A 4Z6EA 4NXWA 1FA0A 5DBCA 3NYBA 1ZQTA 2DR5A 2HHPA 4FHVA 3L9DA 4QZCA 1MQ3A 9ICFA 4I2DA 4K99A 4DOCA 3OV7A 9ICAA 4O5EA 9ICEA 3ERCC 4O67A 5J0QA 1ZJNA 4GXIA 4OAHA 4TUSA 7ICQA 5D46A 9ICWA 8ICYA 4AT8B 4OAFA 3LK9A 3MBYA 4EBJA 1ZQVA 1ZJMA 4XQ8A 1ZQUA 1TVAA 4TUPA 7ICSA 4EP7A 5HREA 4Z6FA 5HRGA 4GXKA 3TFSA 3H38A 2DR7A 4KLUA 4WQLA 3H37A 5J2GA 4R64A 1YLQA 4YN4A 3C66A 4M0AA 7ICTA 3MDCA 5B3PA 4WOYA 2M2UA 1R8BA 3WFQE 3ISDA 1BPBA 5EOZA 2I9GA 4TURA 4RQ3A 4QZEA 4RT3A 8ICKA 4I2JA 2ZH5A 5B3QA 1ZQIA 4UBBA 4JLZA 4NXVA 9ICSA 1BPEA 4ATBB 4AT7B 3RJEA 9ICNA 7ICGA 4WC1A 7ICEA 1ZQHA 5J2EA 4KLOA 3AUOA 1MQ2A 9ICKA 2ZH2A 4AT9B 4DOAA 1RPLA 8ICWA 3UXPA 2FMSA 2ISOA 4FHWA 2ZH9A 3B0XA 3NVOA 4QZHA 3JPTA 7ICLA 4RT2A 5DECA 4PGXA 4M9GA 5J2DA 4UBCA 1MIWA 1JMSA 4WBYA 4MFFA 4YMMA 1HUZA 1ZQQA 2ZH6A 3V7KA 5IIMA 1ZQBA 1XSLA 4UD5A 4P4OA 4KLQA 4X4PA 4M5DA 3AQMA 3HWTA 3H39A 4F5NA 4WQKA 1VFGA 4KLHA 4F5OA 1F5AA 4WC7A 2B4VA 3GDXA 5CWRA 2ZH3A 3RH6A 4I2EA 4KLEA 8ICRA 4XQ7A 3PHZA 3JPQA 1BPZA 3UXOA 4X4QA 5D63A 2EWRA 4GXJA 4MFAA 4E8FA 4K9AA 3RH5A 2DR9A 4RPZA 5DDYA 4QZ9A 4FHPA 1ZQXA 2BCVA 1PX5A 4MF8A 9ICVA 4WC2A 3OUYA 2ZHAA 2W9MA 5J0PA 1ZQGA 4E7XA 1GPJA 1NOMA 5D62A 4EBKA 5HRIA 3C2KA 4I28A 5JTGA 4FO6A 2BCUA 2M2TA 1ZQAA 4RQ0A 9ICLA 8ICZA 4O9MA 4O69A 3V72A 4NKUA 5HR9A 3H3AA 5DB9A 3AU6A 3NKUA 4UB3A 4MKPA 5DB7A 4X4NA 4AT7A 2DVIA 4JWNA 9ICIA 1Q78A 4O5CA 8ICUA 5J0XA 1JAJA 5IILA 4M9NA 4RQ1A 4I2GA 1BPYA 7ICIA 7ICUA 8ICPA 4PGYA 8ICOA 1ZQKA 3OVSA 8ICCA 2ISPA 2ZH4A 5J0RA 8ICFA 1TV9A 4EEDA 2BPFA 5HRDA 4P2HA 4RQ5A 4OAIZ 4P4MA 4QZDA 1KEJA 5HRHA 4M9JA 2ID1A 5TZVA 3JPOA 9ICOA 4NLKA 3HJ1A 5CHEA 8ICEA 5J0WA 4KB6A 5DBBA 9ICUA 4RQ2A 4AT8A 8ICVA 4NXTA 4QZBA 3WFSC 8ICMA 4PHAA 4LZGA 1HUOA 4RWPA 1UETA 4NM2A 4XRHA 5HRBA 4EGWA 5F2VO 4NXXA 5J0UA 2GAFD 5BOMA 4I2IA 5CHGA 2ZH1A 1R8AA 4WC4A 5DDMA 5DB8A 4WBZA 4X0BA 1RZTA 7ICRA 3K75D 4YMOA 3HX0A 1TFWA 5HHHA 3V7JA 2BCQA 3AQLA 9ICBA 4RQ6A 1JQRA 4MF2A 5J2JA 2FCLA 3PMNA 2DRAA 3RJKA 3UXNA 8ICIA 5BPCA 2DRBA 3ER9B 4Z6DA 3C5FA 1R8CA 4X4RA 3MGHA 4IQUA 4JLXA 1V4AA 2HN1A 3ISCA 4M9HA 4NLNA 3RH4A 3AQNA 1Q79A 4R65A 4LT6A 1ZQMA 4N7RA 3PNCA 7ICHA 4X4TA 5J0SA 3V7LA 9ICCA 3AU2A 4X4SA 4DOBA 4I2AA 4LVSA 8ICSA 1ZQSA 1NO5A 2IUBA 2M2WA 3WFPA 4I2HA 4PHPA 5HHIA 2ZH7A 2P66A 9ICMA 4KLFA 4KLIA 5HRLA 4EEBA 2PFQA 5J0TA 4UAWA 2NRKA 4TUQA 4IQTA 1ZQPA 5J2KA 8ICAA 4I29A 2BBJA 4R63A 3HW8A 4O6AA 5J2HA 4K96A 2ZH8A 2BCSA 5CP2A 5DB6A 4P4PA 1BPDA 4X5VA 4K4GA 3K7DA 4KLJA 1ZQJA 2FMPA 4UAYA 4AT9A 4UD4A 3HIYA 4KLMA 4EV6A 3RJHA 3NWIA 4DO9A 5CJ7A 4F5QA 8ICHA 3WFOA 5CFUA 7ICPA 2BPCA 3C18A 4M2YA 4QZAA 8ICQA 2BE3A 4UB4A 2Q66A 4FO1A 3OWGA 4X0AA 3UQ0A 1KNYA 1ZQDA 5J2BA 4NM1A 2DR8A 4F5PA 4YD1A 4PHDA 2BPGA 5D49A 3JPNA 3C2LA 4XJEA 4UB1A 1OU5A 4LEVA 4YMNA 2PFNA 4RWNA 3LQCB 2PFOA 5J2CA 4IQVA 4WC3A 3ER8C 5D4BA 3OGUA 3C5GA 4KLTA 1ZQFA
chains in the Genus database with same CATH topology
2B51A 5B3PA 3K7DA 4NXTA 5D62A 4WH5A 2FCLA 3MCRA 4K97A 3PHZA 4K98A 2B56A 4LEWA 5D63A 4NXUA 2EWRA 5D61A 4OAGA 4OAHA 4K9AA 4OAFA 4O69A 4NXXA 4XJEA 4LEZA 2GAFD 5B3QA 3ER9B 4LEVA 4OAIZ 4JLZA 4NXWA 3NKUA 4NXVA 5CFTA 5CFUA 4MKPA 4O6AA 4JLXA 4HX0A 4KM5A 4LEYA 4WQLA 4K96A 4K99A 4N7RA 2IHOA 3EF2A 3ER8C 4WQKA 5CHEA 3ERCC 4O67A 5CFSA 4FO1A 3OWGA 4K9BA 4O68A 4KB6A 2B4VA 4K8VA 1GPJA 4WOYA 2GA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWR A;  5CFT A;  4WQK A;  5CFU A;  5CFS A;  4FO1 A;  4HX0 A;  4XJE A;  4WH5 A;  2FCL A;  4WQL A; 
#chains in the Genus database with same CATH topology
 2B51 A;  3RJJ A;  7ICJ A;  4KLG A;  4UAZ A;  2PFP A;  4WH5 A;  3MCR A;  1ZQC A;  3WFR E;  3OUY B;  5J29 A;  4PH5 A;  9ICT A;  5D61 A;  1ZQR A;  8ICJ A;  2PXI A;  4X4O A;  5J2F A;  3JPR A;  5CA7 A;  4KLD A;  1VJ7 A;  5IIK A;  5CR0 A;  4I2B A;  4O5K A;  3EF2 A;  4FH5 A;  3JPP A;  4RQ7 A;  4O68 A;  4IQW A;  4I27 A;  4LZD A;  4XUS A;  1R89 A;  5DBA A;  1ZQZ A;  4Z6C A;  2GWS A;  3TFR A;  2BCR A;  4KLS A;  5J0O A;  4UB5 A;  3RJI A;  8ICN A;  4NKT A;  4MFC A;  4UB2 A;  3CK6 A;  1XSN A;  4WC6 A;  4IG8 A;  4R66 A;  1TFY A;  5CFT A;  9ICR A;  1KDH A;  4KM5 A;  1ZQE A;  3C2M A;  5DKW A;  8ICB A;  4JWM A;  3OVB A;  3UPQ A;  5DED A;  1ZQN A;  5HC9 A;  5J2A A;  4PGQ A;  4K98 A;  4K8V A;  5J0Y A;  2ZHB A;  8ICG A;  8ICX A;  1WOT A;  1ZQY A;  4WCW A;  5BOL A;  4K4I A;  3ISB A;  4S3N A;  4YCX A;  1XSP A;  3HJ4 A;  4QZG A;  4RWQ A;  1UEV A;  4LEW A;  8ICT A;  4M47 A;  5HRF A;  4LEZ A;  4QZ8 A;  5IIN A;  4NY8 A;  4ATB A;  3OVA A;  3B0Y A;  9ICP A;  2RFF A;  4F5R A;  7ICN A;  3RJF A;  3JCF A;  3JYY A;  4QZF A;  4NXZ A;  3MGI A;  4LEY A;  4PPX A;  7ICO A;  2IHO A;  4RQ4 A;  1JN3 A;  3MDA A;  5CFS A;  4I2F A;  7ICK A;  4K9B A;  4RWO A;  4KLL A;  1ZQO A;  4M04 A;  3RJG A;  5CB1 A;  4I2C A;  4XA5 A;  1UEU A;  4PHE A;  4K97 A;  3AQK A;  2VAN A;  4K4H A;  4FHX A;  1ZQW A;  4NLZ A;  2PBE A;  4FH3 A;  9ICG A;  2FMQ A;  4HX0 A;  4WC0 A;  2O5A A;  4FHY A;  4X4V A;  5J2I A;  7ICV A;  1ZQL A;  2IHM A;  2HN2 A;  9ICX A;  2GA9 D;  4RPY A;  5III A;  2O1P A;  4X4U A;  4YD2 A;  2M2V A;  4RQ8 A;  7ICF A;  4E80 A;  2BBH A;  1MIV A;  4I0U A;  5HRK A;  4QZI A;  5IIJ A;  1MIY A;  3PML A;  9ICQ A;  2B56 A;  9ICH A;  4NXU A;  4M9L A;  5IIO A;  4OAG A;  4RPX A;  3JPS A;  3JZ0 A;  4WC5 A;  8ICL A;  7ICM A;  9ICJ A;  1BPX A;  3UPS A;  3UQ2 A;  4Z6E A;  4NXW A;  1FA0 A;  5DBC A;  3NYB A;  1ZQT A;  2DR5 A;  2HHP A;  4FHV A;  3L9D A;  4QZC A;  1MQ3 A;  9ICF A;  4I2D A;  4K99 A;  4DOC A;  3OV7 A;  9ICA A;  4O5E A;  9ICE A;  3ERC C;  4O67 A;  5J0Q A;  1ZJN A;  4GXI A;  4OAH A;  4TUS A;  7ICQ A;  5D46 A;  9ICW A;  8ICY A;  4AT8 B;  4OAF A;  3LK9 A;  3MBY A;  4EBJ A;  1ZQV A;  1ZJM A;  4XQ8 A;  1ZQU A;  1TVA A;  4TUP A;  7ICS A;  4EP7 A;  5HRE A;  4Z6F A;  5HRG A;  4GXK A;  3TFS A;  3H38 A;  2DR7 A;  4KLU A;  4WQL A;  3H37 A;  5J2G A;  4R64 A;  1YLQ A;  4YN4 A;  3C66 A;  4M0A A;  7ICT A;  3MDC A;  5B3P A;  4WOY A;  2M2U A;  1R8B A;  3WFQ E;  3ISD A;  1BPB A;  5EOZ A;  2I9G A;  4TUR A;  4RQ3 A;  4QZE A;  4RT3 A;  8ICK A;  4I2J A;  2ZH5 A;  5B3Q A;  1ZQI A;  4UBB A;  4JLZ A;  4NXV A;  9ICS A;  1BPE A;  4ATB B;  4AT7 B;  3RJE A;  9ICN A;  7ICG A;  4WC1 A;  7ICE A;  1ZQH A;  5J2E A;  4KLO A;  3AUO A;  1MQ2 A;  9ICK A;  2ZH2 A;  4AT9 B;  4DOA A;  1RPL A;  8ICW A;  3UXP A;  2FMS A;  2ISO A;  4FHW A;  2ZH9 A;  3B0X A;  3NVO A;  4QZH A;  3JPT A;  7ICL A;  4RT2 A;  5DEC A;  4PGX A;  4M9G A;  5J2D A;  4UBC A;  1MIW A;  1JMS A;  4WBY A;  4MFF A;  4YMM A;  1HUZ A;  1ZQQ A;  2ZH6 A;  3V7K A;  5IIM A;  1ZQB A;  1XSL A;  4UD5 A;  4P4O A;  4KLQ A;  4X4P A;  4M5D A;  3AQM A;  3HWT A;  3H39 A;  4F5N A;  4WQK A;  1VFG A;  4KLH A;  4F5O A;  1F5A A;  4WC7 A;  2B4V A;  3GDX A;  5CWR A;  2ZH3 A;  3RH6 A;  4I2E A;  4KLE A;  8ICR A;  4XQ7 A;  3PHZ A;  3JPQ A;  1BPZ A;  3UXO A;  4X4Q A;  5D63 A;  2EWR A;  4GXJ A;  4MFA A;  4E8F A;  4K9A A;  3RH5 A;  2DR9 A;  4RPZ A;  5DDY A;  4QZ9 A;  4FHP A;  1ZQX A;  2BCV A;  1PX5 A;  4MF8 A;  9ICV A;  4WC2 A;  3OUY A;  2ZHA A;  2W9M A;  5J0P A;  1ZQG A;  4E7X A;  1GPJ A;  1NOM A;  5D62 A;  4EBK A;  5HRI A;  3C2K A;  4I28 A;  5JTG A;  4FO6 A;  2BCU A;  2M2T A;  1ZQA A;  4RQ0 A;  9ICL A;  8ICZ A;  4O9M A;  4O69 A;  3V72 A;  4NKU A;  5HR9 A;  3H3A A;  5DB9 A;  3AU6 A;  3NKU A;  4UB3 A;  4MKP A;  5DB7 A;  4X4N A;  4AT7 A;  2DVI A;  4JWN A;  9ICI A;  1Q78 A;  4O5C A;  8ICU A;  5J0X A;  1JAJ A;  5IIL A;  4M9N A;  4RQ1 A;  4I2G A;  1BPY A;  7ICI A;  7ICU A;  8ICP A;  4PGY A;  8ICO A;  1ZQK A;  3OVS A;  8ICC A;  2ISP A;  2ZH4 A;  5J0R A;  8ICF A;  1TV9 A;  4EED A;  2BPF A;  5HRD A;  4P2H A;  4RQ5 A;  4OAI Z;  4P4M A;  4QZD A;  1KEJ A;  5HRH A;  4M9J A;  2ID1 A;  5TZV A;  3JPO A;  9ICO A;  4NLK A;  3HJ1 A;  5CHE A;  8ICE A;  5J0W A;  4KB6 A;  5DBB A;  9ICU A;  4RQ2 A;  4AT8 A;  8ICV A;  4NXT A;  4QZB A;  3WFS C;  8ICM A;  4PHA A;  4LZG A;  1HUO A;  4RWP A;  1UET A;  4NM2 A;  4XRH A;  5HRB A;  4EGW A;  5F2V O;  4NXX A;  5J0U A;  2GAF D;  5BOM A;  4I2I A;  5CHG A;  2ZH1 A;  1R8A A;  4WC4 A;  5DDM A;  5DB8 A;  4WBZ A;  4X0B A;  1RZT A;  7ICR A;  3K75 D;  4YMO A;  3HX0 A;  1TFW A;  5HHH A;  3V7J A;  2BCQ A;  3AQL A;  9ICB A;  4RQ6 A;  1JQR A;  4MF2 A;  5J2J A;  2FCL A;  3PMN A;  2DRA A;  3RJK A;  3UXN A;  8ICI A;  5BPC A;  2DRB A;  3ER9 B;  4Z6D A;  3C5F A;  1R8C A;  4X4R A;  3MGH A;  4IQU A;  4JLX A;  1V4A A;  2HN1 A;  3ISC A;  4M9H A;  4NLN A;  3RH4 A;  3AQN A;  1Q79 A;  4R65 A;  4LT6 A;  1ZQM A;  4N7R A;  3PNC A;  7ICH A;  4X4T A;  5J0S A;  3V7L A;  9ICC A;  3AU2 A;  4X4S A;  4DOB A;  4I2A A;  4LVS A;  8ICS A;  1ZQS A;  1NO5 A;  2IUB A;  2M2W A;  3WFP A;  4I2H A;  4PHP A;  5HHI A;  2ZH7 A;  2P66 A;  9ICM A;  4KLF A;  4KLI A;  5HRL A;  4EEB A;  2PFQ A;  5J0T A;  4UAW A;  2NRK A;  4TUQ A;  4IQT A;  1ZQP A;  5J2K A;  8ICA A;  4I29 A;  2BBJ A;  4R63 A;  3HW8 A;  4O6A A;  5J2H A;  4K96 A;  2ZH8 A;  2BCS A;  5CP2 A;  5DB6 A;  4P4P A;  1BPD A;  4X5V A;  4K4G A;  3K7D A;  4KLJ A;  1ZQJ A;  2FMP A;  4UAY A;  4AT9 A;  4UD4 A;  3HIY A;  4KLM A;  4EV6 A;  3RJH A;  3NWI A;  4DO9 A;  5CJ7 A;  4F5Q A;  8ICH A;  3WFO A;  5CFU A;  7ICP A;  2BPC A;  3C18 A;  4M2Y A;  4QZA A;  8ICQ A;  2BE3 A;  4UB4 A;  2Q66 A;  4FO1 A;  3OWG A;  4X0A A;  3UQ0 A;  1KNY A;  1ZQD A;  5J2B A;  4NM1 A;  2DR8 A;  4F5P A;  4YD1 A;  4PHD A;  2BPG A;  5D49 A;  3JPN A;  3C2L A;  4XJE A;  4UB1 A;  1OU5 A;  4LEV A;  4YMN A;  2PFN A;  4RWN A;  3LQC B;  2PFO A;  5J2C A;  4IQV A;  4WC3 A;  3ER8 C;  5D4B A;  3OGU A;  3C5G A;  4KLT A;  1ZQF A; 
#chains in the Genus database with same CATH homology
 2B51 A;  5B3P A;  3K7D A;  4NXT A;  5D62 A;  4WH5 A;  2FCL A;  3MCR A;  4K97 A;  3PHZ A;  4K98 A;  2B56 A;  4LEW A;  5D63 A;  4NXU A;  2EWR A;  5D61 A;  4OAG A;  4OAH A;  4K9A A;  4OAF A;  4O69 A;  4NXX A;  4XJE A;  4LEZ A;  2GAF D;  5B3Q A;  3ER9 B;  4LEV A;  4OAI Z;  4JLZ A;  4NXW A;  3NKU A;  4NXV A;  5CFT A;  5CFU A;  4MKP A;  4O6A A;  4JLX A;  4HX0 A;  4KM5 A;  4LEY A;  4WQL A;  4K96 A;  4K99 A;  4N7R A;  2IHO A;  3EF2 A;  3ER8 C;  4WQK A;  5CHE A;  3ERC C;  4O67 A;  5CFS A;  4FO1 A;  3OWG A;  4K9B A;  4O68 A;  4KB6 A;  2B4V A;  4K8V A;  1GPJ A;  4WOY A;  2GA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...