4HXIA

Crystal structure of klhl3/cul3 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
192
structure length
192
Chain Sequence
HMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESAAAAIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of KLHL3/Cul3 complex and implications of FHHt mutations in Cul3 binding
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Kelch-like protein 3
total genus 52
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4hxiA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 4hxiA01
2NN2A 3C6PA 1A68A 2IF5A 2P1PA 2VKPA 3BIMA 4ZOUA 4UYIA 4I6JC 5LLIB 5BXBA 3C6NA 3M52A 3HU6A 3ZTCB 4EOZA 2OVPA 4APFA 3M5BA 4W9JB 2NZ0B 1LDKD 2P1NA 4JTDB 3KVTA 4BKTB 2R9RB 1P22B 1QDVA 3ZKJB 1EOFA 1LQBB 2FNJC 4JTCB 4J8ZA 2IZVC 1R29A 5EUPA 3ZTDB 4CXTA 1FS2B 5BXDA 2ASSA 3WSOB 2P1OA 3L2OA 4B95B 2P1MA 4BGCA 5FTAA 4W9EB 3FKCA 1EXBE 4CP3A 5JH5B 3ZRCB 3MKSA 3OGKA 4W9HH 3ZUNB 2I2RA 1FS1B 3E4UA 2E32B 2OVRA 4HXIA 1FQVB 5DADA 3OGMA 4N9F5 4W9HB 4HS2A 1R2BA 4JTAB 4CXIA 3LBZA 1DSXA 4AWJB 5A6RA 4W9CB 4UIJA 5A15A 1HV2A 5H7GA 4B9KB 3LNMB 3B84A 1NEXA 1LM8C 1BUOA 4W9LB 3HQIA 4BKSB 4CRHA 2MA9C 5HZGC 5HYWB 2IHCA 3V7DA 5DAFA 1T1DA 2C9WC 4U2NA 3LUTB 4W9GB 1EODA 3DCGB 3HTMA 2A79B 4W9FB 3OHVA 5BXHA 3M4TA 4CXJA 1VCBB 3ZRFB 5BO4C 2Q81A 3ZNGB 4AJYC 5IBKA 2YY9A 4JGHC 2Z8HA 2E31B 3I3NA 3C6OA 3OHUA 1QDWA 4AP2A 2PPIA 1EOEA 2EQXA 4WQOC 3HVEB 2ASTA 1R28A 3DRZA 2OVQA 4W9KB 3M8VA 4W9DB 3GA1A 4W9IB 4U77A 4B9KE 2JZ3C 2VPKA 3HVEA 1CS3A 1S1GA 4U2MA 1NN7A 3OGLA 5H7HA 2P1QA
chains in the Genus database with same CATH superfamily
4KBQA 4BX9A 2VYIA 4GYYA 3PRZA 5G05J 3LXUX 2VJ8A 1WG0A 3NZSA 5ENRD 4I9EA 2OVPA 1E7UA 3M5BA 2ETCA 3LYAA 2R9RB 3ZPJA 4GTOA 5ANLA 5HI7A 4G23A 3D9PA 3SQVA 4XZ4A 3L2OA 4CP3A 1LF8A 1MJ0A 4U0SA 1MX4A 2X3MA 3CVPA 2E32B 4HB5A 2P9LG 3L13A 3RK6A 5G2NA 4F1PA 3FUIA 1SZAA 4LRZA 2VTBB 1DSXA 4HVBA 3SZ7A 5H7GA 4EZJA 3LVQE 5EX0A 3FUHA 3QWWA 3RRMB 1H6OA 4F3VA 4GTTA 2J9QA 3MV3B 3UT8A 3FUKA 2ZISA 4DX1A 2BF0X 3QK0A 3CVWA 2UWJG 4HI9A 4E85A 4IRUA 2YY9A 3SO8A 5FQ7A 3JQ0A 3SFZA 3SFXA 5LCWC 4ANWA 3CIAA 2X6KA 3HVEB 3R7RA 4LCTA 1YA0A 2WPVA 2OVQA 3TAXA 5DIZA 4W9KB 2ONDA 3GA1A 3I4GA 2WXIA 3ONLA 4KXKB 2OCCE 5G55A 2R2LA 2XQ0A 3SF4A 5M72A 2XCCA 1BI8B 5EKQD 5BXUA 5BXBA 4CDRA 5EYPF 1JCQA 3LJ3A 1O1RA 5AN8A 3L9TA 3Q78A 4ACLA 5ARGA 2EINE 3C98A 2OVFA 2XGSA 4TXQA 4OVVA 3L82A 4OVUA 3DSVA 2WXLA 3Q15A 2IO2C 4W9HH 2I2RA 4DX5D 4KVOA 3S2AA 1YMPA 4AEZC 4HRLA 3PNLB 4WWNA 3ZIMA 1MQSA 3CVQA 4W9CB 3OXFA 5AQ9A 2HM8A 3VLDA 4CT0A 3DWLG 4K5BA 2PZIA 5HZGC 3QKYA 1OWNA 1KLXA 3UM0A 2FEZA 2ZGGA 1HXIA 4U7EB 2X38A 4AOFA 4AY6A 3D9HA 1IQRA 5J90A 3ABME 3C3RA 5T8IA 2MRIA 1X5BA 4YDWA 4RVBA 2Z8HA 2A5EA 1NA3A 2E31B 1S63A 4MS6A 4PS7A 1DVPA 3OHUA 3V30A 1HG5A 3B13A 1NP7A 4C0MA 4H7XA 4NIKA 4HNAD 4W9IB 3HVEA 3ZW3A 1NN7A 3LJNA 4I2WA 1A68A 3ASFA 3Q47B 2VGXB 4J7WA 4RG9A 3FTVA 4B8CB 4HOUA 2XZDG 4PS3A 3UIOC 4CDMA 4XI9A 2A5UA 4KMOA 2DBAA 2OV8A 4Y6WA 3DSSA 2R05A 5LX8A 2VQ2A 1QDVA 3O48A 4A3VA 4GTPA 1UJKA 3GZ1A 3ONKA 4ZGCA 4ILHB 4JTCB 3PNTB 3CVYA 4B0ZA 2X6JA 4TXPA 5CRVA 3CHSA 3F6QA 4BTAA 4BESA 4JA9A 3FKCA 2XGMA 3G2UA 3B7TA 3D9NA 2GRMA 3KSLA 4UUCA 3DXKG 3AU5A 4DX7D 3E4BA 4DX2A 4IYPA 3W9FA 4WNDA 1O1SA 5G04C 3VTYA 1QNFA 1JCRA 5C2YA 3ZYQA 3ZEFA 3T8KA 5BW8C 2ETBA 3RO2A 2R5SA 3VLEA 1B89A 4A3TA 2LUHA 4C48B 3GW4A 4BWRA 2F8YA 3IHVA 3QJZA 4LERA 2A79B 3SGHA 4EECA 5A7DB 3ZRFB 2RKKA 2Q81A 2UY1B 1OWOA 2VSOE 3ASNE 3UMVA 4DLQA 4KT6B 3NOGD 1QYMA 4B93B 3UT4A 3PDNA 1S0PA 3ZN3A 4HQDA 3ZU7B 1R28A 3O4ZA 2GW1A 3KSQA 1PAQA 3G2WA 1E96B 3MX3A 1AP7A 2YQ8A 1D9SA 3CHOA 4GMLA 3BIMA 3DXMG 1D8EA 2VSXE 3EU9A 3UIPC 3M52A 4U8HA 4APFA 2NZ0B 2P1NA 2RFAA 4FU3A 3VLFA 1ZU2A 2VGEA 2FNJC 3RAUA 1R29A 5EUPA 1G3NB 3V2OA 3Q7AA 3FTUA 3OGKA 2IOLA 3MCXA 3GZ2A 4O1PA 3ZKJA 1H0AA 1EDUA 2LXLA 1Z3XA 1H6PA 2VGXA 1U2VG 3CQGB 1JUQA 4APOA 5KWDA 5IY5E 1OUVA 1YCSB 1HV2A 1ZB1A 3L22A 3DSWA 3IBEA 4XKCA 1UN8A 1TNBA 3BUAA 1OY3D 4WUYA 2F8XK 4N3BA 1DCEA 1TNOA 4Q94A 4GYOA 4GYWA 3LUTB 4OAVB 5A6CA 3MYVA 1SW6A 3PE3A 1TJCA 3M4TA 5E75A 2DWZA 4HI8A 1FT1A 1HO8A 2IQCA 3AG3E 3ABLE 5FZRA 2OEWA 3DPDA 3B7BA 4AP2A 5BXOA 3UM3A 1H2TC 3EDTB 2L6BA 2OEVA 3L6AA 4U77A 3V31A 1CS3A 4U2MA 2P1QA 2LSVA 4J8SA 2L0TB 3KEZA 3PUJA 1UJJA 4V3IA 3EUVA 4GCNA 1XGWA 3FU6A 1RW2A 3ZYLA 4LNUD 4UI9J 5HS0A 4BKTB 3LY8A 1E90A 4JPSA 4FP7A 2IZVC 5B1AE 4NQ0A 1H6KA 3B95A 3LEWA 2VTBA 4BGCA 5JH5B 1EXBE 4NRHB 4O1OA 3E4UA 2OVRA 3SBSA 3DPYA 1EPUA 4HS2A 4JTAB 1HS6A 2KM4A 3V79K 2GRPB 3FU0A 4I2ZA 2VSNA 3C3OA 4B9KB 2P9IG 2WXHA 1LM8C 5D0OD 1BI7B 4M7CA 1INZA 4YY8A 1EODA 2WXNA 4UWFA 4W9FB 3BEEA 3ZRHA 4N5CA 5D66A 5LOZA 4GTQA 1N4QA 4XX5A 2H6FA 5BV0A 4EZKA 4N5QA 4L7TA 2C0LA 3X2QE 3TXNA 3I3NA 2L9BA 4RLYA 4UI9C 3C6OA 3QAQA 3IEGA 4BY6A 1TNYA 4G1TA 4AM9A 3U66A 1DNPA 2P9PG 5A23A 3VTXA 3TWUA 2PQNA 3FP3A 2DIWA 1L5JA 2KXPC 2ZU6B 2IONA 1N4SA 4JTDB 3KVTA 4GTMA 3EIJA 3ENEA 2WXKA 3T5VA 3BG1B 2ZXWE 4CXTA 4K0RA 1OT8A 5C1DA 2HR2A 3JYSA 3R9AB 3EJNA 4N3CA 2KC7A 3JUIA 5ENNA 1SA5A 4W9RA 1PC2A 1TN8A 3L16A 5CMYA 1N9AA 5KJNA 3S7DA 3TJPA 3ZHEB 5CEAA 3UM1A 3TWQA 1LD7A 1K8KG 4IN3B 4H7YA 3ESKA 1NEXA 4M3OA 5T3RA 1H2VC 2VGYA 2IU1A 1KT0A 4BKSB 5HYWB 1IHGA 2C0MA 3D9OA 5BNWA 3FH5A 3IXEA 1MZCA 2UY1A 5BXHA 4ZFHA 3CLJA 5KNHD 3RIBA 4AJYC 2CFUA 4F53A 1TYQG 2LAIA 3FH8A 4B94A 1K3ZD 4BX8A 3CEQA 4UWLA 3E34A 4CCAA 3DRZA 3R7QA 4F1SA 3PUKA 3AG4E 5AAOA 2AXZA 2FBNA 2YINA 3D9MA 5AJLA 1QZ2A 2VKPA 2EIJE 1NA0A 1LTXA 3EIQC 3NB2A 2AXVA 2AVPA 3UUXA 3C6NA 3ZTCB 3AU4A 2XZTG 3AAAC 2E0IA 3LS8A 3ASDA 2ILRA 3TWVA 1ELWA 2WXFA 5KJKA 4BTBA 5JJTA 3IV0A 4YNDA 1D8DA 2P1OA 2J4DA 1YYHA 1E8XA 2MHKA 4W9EB 4GAAA 3MEKA 1WDYA 5BUZA 3OGMA 3LY7A 3UPVA 4UQXA 1HU3A 3HXEA 5BPPA 3P1UA 2FULA 3S7FA 4N2SA 3UM2A 3LNMB 4UWGA 4MKTA 3EU5A 4GMRA 4UI9K 5AARA 1BU9A 4YDOA 3DCGB 3FU5A 3FTWA 3LY9A 2EIME 2M63A 5ENSD 5BO4C 3KAEA 3HYMB 3SNXA 3B7UX 5AIJA 3ZNGB 4FLBA 2XRYA 5CEDB 4CDNA 1OCOE 1K1AA 3MA5A 1Q2ZA 2L0IA 3E37A 2ETAA 2H6GA 3Q4AB 3PVLA 3DRXA 1NL4A 1JWGA 2JZ3C 3C6PA 4JHRA 5JHBA 3RKVA 3PZDA 1EF1C 3SY2A 4UYIA 1SA4A 1FVFA 3BU8A 1FPPA 1A17A 2C2LA 4NACA 4TUUA 2XEHA 4ATZD 3ZKJB 2B0OE 4I43A 3TG4A 4JEUA 2X6HA 2R17C 3ZXSA 4N3AA 3CHPA 1FS1B 1V54E 1KZOA 4K03A 4RG6A 1SZ9A 4JVSA 3LBZA 3D9JA 5A6RA 2LO6A 3MKQA 2F37A 4CRHA 3GYZA 3B7SA 4EQFA 2WXGA 4U2NA 1TNUA 3UT7A 4HOSA 4Q96A 2IF4A 4MRUA 1HF8A 4J6IA 4B89A 3TG5A 1KPSB 5FWQA 3LVRE 4GPKA 3HXDA 4GZ5A 4PS8A 5BV1A 2NYJA 4U07A 3AS4A 2I1JA 5H7HA 3ZFWA 3FTSA 1SQMA 5AQAA 3FY4A 1N54A 4IULA 5EIDA 4DI3A 5FQ4A 4E6HA 1FT2A 1EOFA 3URZA 1LD8A 3CK7A 3C72A 5HKPA 2LNIA 3RRUA 2YNQA 3TXMA 4GMJA 3FEXA 3G2SA 4R7LA 4L2LA 3NZUA 1WY6A 3OXGA 4A63B 3FULA 4A55A 1FQVB 1OWLA 3ZUVB 1IKND 3MV2B 4W9HB 5JJ7A 1XNFA 5HRYA 3RJVA 4GZ3A 1A5EA 3P2BA 2EILE 1TN6A 3B84A 3RSEG 1SVXA 3FUMA 2CHWA 4UWHA 3HIZA 2MA9C 1N4PA 2EIKE 2Y3AA 3DSTA 4CRWA 4G11A 3CSTA 4W9GB 2GRQB 2J4BA 2KCLA 2BEDA 2IFUA 4LEUA 3SI5A 4P29A 4LSZE 3DRAA 3WG7E 4I1MA 1MX6A 3SBTB 2J49A 3L17A 3PEUB 3CHQA 3FWVA 4AIFA 4G24A 3GZSA 1BD8A 2Y4UA 3M8VA 2P9SG 4W9DB 2GGFA 2XPYA 5E76A 3KEAA 3PEVB 3IKOB 4GTSA 4RSYA 3SHFA 4ANVA 5KCMA 4KVMA 2NC9A 4YDEA 4JC8A 3DSUA 2RD0A 3E32A 3JQ1A 5FZQA 3JXIA 2KCVA 4BT8A 1IYGA 4W9JB 1JWFA 4TUMA 2BKGA 3E30A 4G2VA 5B3SE 1QBQA 2IEJA 3Q5MA 5EN5D 1DC2A 4WAFA 2I2OA 3EHNA 3TWRA 5FTAA 4JXTA 4PDXA 3DBSA 2I9CA 2QZAA 4L2YA 3J5PA 2MOWA 3SFYA 2DVWA 3L54A 1U3DA 5DBKA 4UQYA 3UI2A 2PM7A 2WXJA 1BUOA 2FF4A 2NSZA 2WQ6A 3PZ1A 5ITZF 3PZ3A 4ILGA 3QWPA 3ULQA 3ZHEA 4DUIA 4FJZA 1V55E 4MBGA 4AVXA 4GU5A 2GRLA 3FUFA 4ME2A 3NOCD 4N39A 1VCBB 4F6RD 3TWWA 4QQIA 2LAHA 3OAWA 2PL2A 1NZNA 3OXLA 5CERB 4EZLA 5G04J 4XKBA 4HRMB 4URKA 2DZNA 4GTRA 4JB8P 2DYSE 2J08A 3PH0C 1KZPA 4U0UA 4JL0A 5FINA 5FJYA 2AXUA 1NFIE 4J8EA 1MHQA 3OTNA 2WXRA 3CKBA 4EHMA 2YHEA 4PUCA 4LG6A 1N95A 3HU6A 5D2MC 2HE0A 1FVHA 4WWPA 4WNFA 5EIBE 3T8MA 3KD7A 4J8YA 1EYHA 4L23A 3PREA 3APFA 2H6IA 2WB2A 4GTVA 4C0EA 2QC9A 4J8FA 4EBAA 4NURA 4I9CA 3QARA 1JCSA 3MKSA 3ASOE 4EPZA 2ZGDA 3ZXPA 3TGOA 1ELKA 4J8DA 3DSXA 4GCOA 1Y6IA 2QY7A 1H19A 2P2CP 4U63A 3N71A 4AXHA 4ABNA 3PE4A 2IHCA 4U8VD 5T4YA 3EHQA 4GB9A 5LCWJ 5D0QD 4QFVA 2AJAA 3FUJA 2JLBA 4FLHA 1KT1A 4JGHC 3FU3A 2Y1LE 3FHEA 3DEPA 4KYOB 3U9WA 3RRNB 2QYUA 4JW1A 4ATGA 2E2EA 1Z5SC 2EQXA 3TWTA 3IHYA 4DPRA 1HE8A 3Q7FA 4I6EA 1TJFA 3EHMA 5ENQD 2NN2A 5EILA 3NAWA 2IF5A 3NBNB 4ZOUA 2IO3C 2KZTA 5FQ8A 4FC8A 5CBNA 1HX8A 4EOZA 3CVUA 3FUEA 3AJIA 1OXJA 1LDKD 3AG1E 2WXOA 3MKRA 4MLPA 3ESLA 4DI4A 3RO3A 4FJYA 4J8ZA 2DYRE 3CSFA 3C5RA 4BERA 3FUNA 4YVQC 3WSOB 5KBAA 2P1MA 3ZUNB 5KJLA 2J09A 4HXIA 2CG2A 5G05C 1Y8MA 2P58C 1R2BA 3CK8A 4HFGA 2P9UG 2LSUA 3B7RL 2L6JA 5FZSA 5CECB 3FDHA 3S7BA 4C9BB 4WWOA 1Z6TA 3QNKA 3ML8A 4HRNA 4CT4A 3AG2E 1OWPA 5CRUA 1S70B 3T9KA 2QYJA 5BT1A 3U64A 2AWIA 3ZGQA 2FI7A 4CXJA 4AY5A 2DZOA 2PM6A 1N4RA 5IBKA 1X81A 5AQBA 3PS6A 4BFRA 3FTYA 1NI1A 4XIFA 3ZNGA 3HRAA 3UKUG 4FULA 3UTMA 4GA0A 2PPIA 1EOEA 4WQOC 3MZLB 2CG3A 3LCAA 3DRYA 3OGLA 2V4HC 2YHCA 2P1PA 2HO1A 5JJ6A 2DCPA 2NXPA 4ZHBA 4WNGA 3CHMA 3MJWA 3I4RB 1E7VA 2LXMA 5AYWD 3S7JA 5LFAA 3HXBA 2KCKA 3Q79A 5CBOA 1K1BA 4PH4B 3ULYA 2Y4TA 2P9NG 3D9KA 1HZ4A 3FUDA 5BXDA 2ASSA 1H2UA 4B95B 3BQOA 4GZ6A 2OVBA 3QDNA 3ZRCB 4N2QA 1N94A 5EX3A 1N0RA 4JD2G 2WXQA 4CYMD 4TXRA 3D3MA 1Z3YA 2KATA 2BKKB 1ELRA 2XHEA 4L1BA 4U8YD 4CXIA 3CVXA 4G26A 4Z68A 4UQZA 4OAUC 5KJMA 2R03A 2XS1A 3CGHA 1T1DA 3LKUA 2C9WC 1TNZA 4HBDA 3OHVA 3FH7A 3K9IA 4U95D 3FTZA 3L08A 4LNBA 4RQIA 3UQ3A 2KZTB 2JEKA 1IHBA 4HOTA 3UKRG 3NF1A 3RU0A 4BETA 2V5QC 5FT9A 1QDWA 1TN7A 3HXFA 4AV7A 4TV3A 2MYOA 4HLLA 4XEIG 5HQ8A 4BEPA 4JA7A 4A1GA 4JEHA 3G2VA 1IQUA 5KNGA 4ANXA 2B6CA 5AQ7A 1WM5A 2IOSA 2VSYA 3CV0A 1WAO1 2XEVA 3D9IA 4GZDA 4JHJA 2X6FA 3U4TA 4G8KA 4EBAG 5ENOD 1P22B 1LQBB 4FADA 3MGBA 3TWXA 4ACKA 3ZTDB 3UX4A 3JCKC 5ENTD 3Q75A 3QWVA 5J08A 2J8SD 3I5PA 4BSXA 4DX6D 2A4ZA 2GRNB 4Y6CA 3ZYKA 1E8WA 2R59A 4I6GA 4LUNU 3KS2A 4JZYA 4WNEA 5A15A 2I6HA 3C3QA 2F0YA 5EDSA 4O6FA 1PY1A 3Q9NC 3T5XA 4CEMA 1N11A 5H7PA 1BLXB 1S64A 3HTMA 4K5CA 3FFLA 2R02A 3Q73A 3PZ2A 5B1BE 3U3WA 2FO1E 2XRZA 3AS8A 2WMNA 4L9PA 3PZ4A 1TR4A 4O60A 5ANRA 1UN9A 4CZ2D 4GPMA 3ASGA 3CR3A 2PNNA 2XENA 3ISMC 4G8LA 2ASTA 1MX2A 3APDA 3E33A 3JXJA 3LPZA 3DEOA 1P5QA 4OYSA 2WQ7A 2V4LA 1VDYA 3ZVVA 2AW6A 2H6HA 1S1GA 2V0PA 4KZCA 4CGWA 2GROB 1ZBPA 1IXVA 2KBXA 4X8QA 2XS8A 4CGVA 3D9LA 2XPZA 3ASHA 3FTXA 4G25A 1UOHA 4ILIA 4B8AA 2ZIRA 3EHRA 4XI0A 3UINC 3V2XA 4GZCA 4U04A 4A1SA 2V5FA 1O1TA 1O5MA 2XPIA 1U3CA 2RG8A 4LNGA 4ANUA 5AENA 1GW6A 2X6IA 2RFMA 3AS5A 5JHAA 4DRXE 3R9MA 3HDXA 3BG0B 5DADA 3HHMA 4N9F5 2Q7FA 3QOUA 2XEEA 4UIJA 4XE0A 2Y0BG 3TL5A 5JA4D 2OOEA 2WVIA 4W9LB 1OWMA 3QC1A 5ARFA 2HYZA 5DAFA 3V7DA 1HG2A 3HXCA 4BT9A 5FQ6A 3CQCB 4DLOA 4U0ZA 5FTPA 1JPLA 3LDZA 3ULEG 4FA6A 4GA1A 1N52A 4DJAA 2WMOA 4YDYA 5ENPD 3UXGA 2P9KG 3ML9A 4I1AA 3WXXA 3JUEA 2BTDA 1TEZA 4B9KE 1E8ZA 3TWSA 2QFCA 1OCCE 3CVVA 1MYOA 1W3BA 1E8YA 1HH8A 3HG0D 4HOQA 4I6JC 1N0QA 5LLIB 2CHXA 3APCA 2BUGA 4I17A 4DK5A 4K5AB 2JABA 2GRRB 2WQHA 1FS2B 3Q49B 4D10C 1BPOA 4Q69A 2XCBA 1FCHA 4JHKA 3MKQB 5AJDA 3ABKE 3ZYMA 3CK9A 1QQEA 1OCRE 3CKCA 4J0UA 4I1OB 2I1KA 1HFAA 3J5QB 5FIOA 1RZ4A 4AWJB 3CHRA 3CVLA 4F7AA 2CHZA 5LP0A 4FHJA 2J07A 3HQIA 1DCQA 3Q9UC 2WXMA 4AJWA 3W9GA 1OCZE 5CCMA 2CFZA 2WM9A 5CCLA 3FEYA 4HLEA 2XGOA 4UWKA 3QB2A 2WXPA 3NQPA 2IY0C 5JMND 3CVNA 4I6JA 5EYLA 4YVOA 1UW4B 1UG3A 4GA2A 2V8SE 2PQRA 4U96D 4HORA 3SD5A 5CMWA 4BSZB 4FHKA 2FO7A 2Y69E 4TRQA 1AWCB 2IJGX 5CHEE 2VPKA 4KZ0A 3G2TA
chains in the Genus database with same CATH topology
4KBQA 4BX9A 2VYIA 4GYYA 3ZFWA 2HO1A 2LSVA 3FTSA 2P1PA 4J8SA 3PRZA 5JJ6A 2DCPA 2L0TB 3KEZA 2NXPA 3PUJA 1UJJA 5G05J 4V3IA 1SQMA 4GCNA 4WNGA 3CHMA 3MJWA 3LXUX 1XGWA 3FU6A 3ZYLA 2VJ8A 3I4RB 3NZSA 1E7VA 5AYWD 4I9EA 2OVPA 3FY4A 1E7UA 3S7JA 3M5BA 1N54A 5LFAA 4IULA 2KCKA 3LYAA 4UI9J 4PH4B 4BKTB 2R9RB 2Y4TA 3LY8A 5FQ4A 1E90A 4DI3A 4E6HA 4JPSA 1EOFA 3URZA 4FP7A 5ANLA 3CK7A 3D9KA 5HI7A 3ZPJA 2LNIA 4G23A 3D9PA 2IZVC 3RRUA 2YNQA 4XZ4A 1HZ4A 3TXMA 4GMJA 4NQ0A 1H6KA 3FEXA 3FUDA 2ASSA 5BXDA 3LEWA 2VTBA 3L2OA 1H2UA 4B95B 4BGCA 4GZ6A 5JH5B 1EXBE 4CP3A 1LF8A 2OVBA 3QDNA 2X3MA 3G2SA 4NRHB 4R7LA 4U0SA 4N2QA 3ZRCB 4L2LA 5EX3A 3CVPA 1WY6A 3NZUA 3OXGA 2E32B 3FULA 4A55A 3E4UA 2OVRA 2WXQA 3L13A 5G2NA 3RK6A 3SBSA 3FUIA 3D3MA 1FQVB 1Z3YA 2KATA 1SZAA 1OWLA 1EPUA 1ELRA 3MV2B 4W9HB 4HS2A 5JJ7A 4JTAB 1HS6A 2KM4A 1XNFA 2XHEA 4LRZA 4L1BA 2VTBB 3RJVA 4CXIA 3FU0A 4GZ3A 4I2ZA 1DSXA 3P2BA 3CVXA 4HVBA 3SZ7A 5H7GA 2VSNA 4G26A 4B9KB 4EZJA 3B84A 4UQZA 2WXHA 1LM8C 3LVQE 5EX0A 3FUHA 3FUMA 2CHWA 3QWWA 4UWHA 3HIZA 2MA9C 5D0OD 2Y3AA 3RRMB 5KJMA 4F3VA 3CGHA 1T1DA 1INZA 4YY8A 3LKUA 4CRWA 4G11A 3CSTA 2C9WC 2J9QA 4W9GB 1EODA 2WXNA 3MV3B 3UT8A 4UWFA 2J4BA 3FUKA 4W9FB 2KCLA 3OHVA 3BEEA 2BF0X 3FH7A 3K9IA 3ZRHA 3QK0A 3CVWA 2IFUA 2UWJG 4LEUA 4N5CA 4E85A 3FTZA 5LOZA 4P29A 4IRUA 3SI5A 2YY9A 4XX5A 5BV0A 3L08A 4EZKA 3UQ3A 2KZTB 2JEKA 3JQ0A 4I1MA 4L7TA 5FQ7A 3SFZA 4HOTA 2C0LA 3TXNA 3NF1A 3I3NA 2L9BA 3SBTB 3RU0A 4UI9C 2J49A 5FT9A 3C6OA 3QAQA 5LCWC 1QDWA 3L17A 3PEUB 3CHQA 4AV7A 3FWVA 4AIFA 3CIAA 2X6KA 3HVEB 3IEGA 4G24A 4LCTA 3R7RA 4ANWA 4BY6A 1YA0A 3GZSA 2WPVA 2OVQA 2Y4UA 4TV3A 5DIZA 4G1TA 2ONDA 3TAXA 3M8VA 5HQ8A 2GGFA 3GA1A 4W9DB 4JA7A 4AM9A 2XPYA 3I4GA 5E76A 3U66A 2WXIA 3ONLA 4KXKB 4A1GA 1DNPA 5G55A 5A23A 3PEVB 4JEHA 3IKOB 4RSYA 3VTXA 3G2VA 3SHFA 1IQUA 4ANVA 4ANXA 2PQNA 2XQ0A 3SF4A 1WM5A 2IOSA 3FP3A 2DIWA 5KCMA 2XCCA 5M72A 2VSYA 3CV0A 4KVMA 5EKQD 2NC9A 1L5JA 1WAO1 2XEVA 4JC8A 5BXBA 3D9IA 4CDRA 2RD0A 3JQ1A 5FZQA 2KCVA 4GZDA 4BT8A 4JHJA 2X6FA 2ZU6B 3LJ3A 3U4TA 1IYGA 4W9JB 2IONA 4EBAG 4JTDB 1JWFA 3KVTA 1P22B 3EIJA 4G2VA 4ACLA 5ARGA 1LQBB 3C98A 4FADA 3ENEA 3MGBA 2OVFA 2WXKA 4ACKA 3Q5MA 3T5VA 2XGSA 4OVVA 3BG1B 3UX4A 3ZTDB 4CXTA 4K0RA 4OVUA 4WAFA 2I2OA 5C1DA 3JCKC 3EHNA 2HR2A 2WXLA 5FTAA 3JYSA 3R9AB 3Q15A 4JXTA 3QWVA 3EJNA 4N3CA 4W9HH 4PDXA 3DBSA 2KC7A 3JUIA 2I2RA 5J08A 5ENNA 2I9CA 4L2YA 4KVOA 3S2AA 4AEZC 3PNLB 4W9RA 1PC2A 4WWNA 3I5PA 3L16A 4BSXA 2MOWA 5CMYA 3ZIMA 2A4ZA 5KJNA 3L54A 3S7DA 1U3DA 4Y6CA 4UQYA 5DBKA 1E8WA 2R59A 4I6GA 1MQSA 3TJPA 4LUNU 3CVQA 3ZHEB 3KS2A 4JZYA 2PM7A 4WNEA 4W9CB 2I6HA 5A15A 4IN3B 2WXJA 3OXFA 4O6FA 4H7YA 5EDSA 3ESKA 1NEXA 4M3OA 5T3RA 2FF4A 1H2VC 2HM8A 1PY1A 2VGYA 3VLDA 4CT0A 1BUOA 2NSZA 2IU1A 1KT0A 2PZIA 3T5XA 2WQ6A 4BKSB 5HZGC 5HYWB 3QKYA 4ILGA 1IHGA 2C0MA 3D9OA 4CEMA 5BNWA 3QWPA 1OWNA 3ULQA 3FH5A 3ZHEA 1KLXA 2FEZA 4FJZA 1HXIA 3HTMA 4AVXA 4GU5A 2GRLA 2UY1A 2X38A 3FUFA 5BXHA 4ME2A 3ZYKA 4N39A 3CLJA 4AOFA 1VCBB 4AY6A 3RIBA 3FFLA 4AJYC 2LAHA 1IQRA 3OAWA 5J90A 2PL2A 1NZNA 2CFUA 3OXLA 5T8IA 3U3WA 2MRIA 1X5BA 4RVBA 2XRZA 3AS8A 4F53A 2Z8HA 1NA3A 2WMNA 2E31B 4MS6A 4EZLA 2LAIA 5G04J 5ANRA 3FH8A 4B94A 1UN9A 1DVPA 4PS7A 3OHUA 3ASGA 4XKBA 3CR3A 4URKA 1HG5A 3CEQA 4BX8A 3B13A 4UWLA 1NP7A 2ASTA 4C0MA 4CCAA 3APDA 3R7QA 4H7XA 4F1SA 3DRZA 3LPZA 2J08A 3PH0C 3PUKA 1P5QA 4OYSA 4W9IB 4U0UA 2WQ7A 2V4LA 2AXZA 3HVEA 1VDYA 2FBNA 4JL0A 3ZVVA 5FJYA 2AW6A 2YINA 3ZW3A 1S1GA 1NN7A 2AXUA 4J8EA 3D9MA 1MHQA 2V0PA 3OTNA 5AJLA 2WXRA 1QZ2A 4I2WA 3ASFA 4KZCA 1A68A 4CGWA 3Q47B 1ZBPA 2VKPA 2VGXB 4RG9A 1NA0A 3EIQC 3CKBA 3FTVA 4B8CB 4HOUA 4CGVA 3D9LA 2YHEA 4PUCA 4PS3A 2XPZA 2AXVA 2AVPA 3UUXA 4XI9A 4CDMA 3C6NA 2A5UA 3ASHA 3FTXA 4KMOA 2DBAA 3HU6A 3ZTCB 4G25A 4ILIA 3AU4A 1FVHA 4WWPA 4B8AA 2E0IA 2OV8A 4XI0A 4Y6WA 4GZCA 3LS8A 4U04A 4WNFA 4A1SA 2V5FA 3ASDA 5LX8A 3T8MA 2VQ2A 3KD7A 3O48A 1EYHA 4A3VA 1QDVA 2ILRA 4L23A 1ELWA 1UJKA 2WXFA 3GZ1A 3ONKA 4BTBA 3PREA 3APFA 4ILHB 5KJKA 5JJTA 4JTCB 4ZGCA 2XPIA 1U3CA 3PNTB 2RG8A 2WB2A 3IV0A 4ANUA 3CVYA 5AENA 4B0ZA 2X6JA 3CHSA 4YNDA 1GW6A 2X6IA 4C0EA 4BTAA 2P1OA 4J8FA 4EBAA 2J4DA 4NURA 4I9CA 3QARA 1E8XA 2MHKA 4JA9A 3FKCA 4W9EB 2XGMA 4GAAA 3AS5A 3MKSA 3G2UA 4EPZA 3B7TA 5JHAA 3MEKA 3HDXA 3BG0B 5DADA 5BUZA 3D9NA 2GRMA 3LY7A 3OGMA 3UPVA 3HHMA 3TGOA 1ELKA 4UQXA 4N9F5 3AU5A 1HU3A 2Q7FA 3E4BA 3QOUA 4J8DA 5BPPA 4IYPA 4WNDA 3P1UA 4GCOA 4UIJA 1Y6IA 4XE0A 2FULA 3S7FA 4N2SA 3TL5A 2QY7A 5G04C 3VTYA 1QNFA 1H19A 2OOEA 2WVIA 4U63A 4UWGA 3LNMB 3N71A 4W9LB 1OWMA 5C2YA 4MKTA 4AXHA 3ZYQA 4ABNA 3ZEFA 3QC1A 3PE4A 5BW8C 2IHCA 2R5SA 4UI9K 2HYZA 1B89A 5ARFA 5T4YA 3RO2A 1HG2A 3VLEA 5DAFA 3V7DA 4A3TA 4GB9A 5LCWJ 4BT9A 3GW4A 5D0QD 4BWRA 4QFVA 3DCGB 3FU5A 3IHVA 3QJZA 4LERA 3FTWA 2A79B 3SGHA 5FQ6A 3LY9A 4EECA 2M63A 5A7DB 3CQCB 3FUJA 3KAEA 3HYMB 3ZRFB 5BO4C 2Q81A 2JLBA 3B7UX 2UY1B 1OWOA 2VSOE 4FLBA 3SNXA 4DLOA 2XRYA 4U0ZA 5AIJA 3ZNGB 5FTPA 4FLHA 1KT1A 1JPLA 3FU3A 3LDZA 4CDNA 4JGHC 3FHEA 3U9WA 4KYOB 3UMVA 4DLQA 3MA5A 3RRNB 4JW1A 4KT6B 2L0IA 4FA6A 3UT4A 4GA1A 3PDNA 4ATGA 2E2EA 1N52A 4DJAA 2EQXA 1S0PA 3ZN3A 2WMOA 1R28A 3O4ZA 2GW1A 3Q4AB 3PVLA 3ML9A 3IHYA 4I1AA 4DPRA 3DRXA 1PAQA 1HE8A 3WXXA 1TEZA 2BTDA 3G2WA 4B9KE 1JWGA 4I6EA 2JZ3C 1E8ZA 1TJFA 2QFCA 3EHMA 1E96B 3MX3A 3CVVA 1W3BA 2YQ8A 2NN2A 3CHOA 3C6PA 4JHRA 5JHBA 3RKVA 1E8YA 3PZDA 2IF5A 1HH8A 4GMLA 1EF1C 3BIMA 4ZOUA 4HOQA 2KZTA 4UYIA 4I6JC 5FQ8A 5LLIB 4FC8A 2VSXE 1HX8A 2CHXA 1FVFA 3APCA 3M52A 4U8HA 4EOZA 3CVUA 3FUEA 4APFA 2C2LA 1A17A 2NZ0B 1LDKD 2P1NA 2BUGA 4NACA 4I17A 4TUUA 4DK5A 4FU3A 2WXOA 3MKRA 3VLFA 1ZU2A 4MLPA 3ZKJB 3ESLA 4I43A 3TG4A 2FNJC 4DI4A 3RO3A 4FJYA 4J8ZA 4JEUA 3CSFA 1R29A 5EUPA 2X6HA 2R17C 2WQHA 3FUNA 1FS2B 3ZXSA 3Q49B 3FTUA 4N3AA 4YVQC 3WSOB 2P1MA 4D10C 1BPOA 4Q69A 2XCBA 1FCHA 2IOLA 3CHPA 3MCXA 3OGKA 3GZ2A 3ZUNB 4JHKA 1FS1B 5KJLA 3MKQB 2J09A 4HXIA 1H0AA 1EDUA 4K03A 5AJDA 3ZYMA 2CG2A 5G05C 1Z3XA 3CK9A 1QQEA 1Y8MA 4RG6A 2VGXA 1SZ9A 3CQGB 1JUQA 2P58C 3CKCA 4JVSA 1R2BA 4J0UA 4APOA 4I1OB 2I1KA 3CK8A 4HFGA 1HFAA 3LBZA 4AWJB 3D9JA 2LSUA 3CHRA 5A6RA 1OUVA 3B7RL 3CVLA 4F7AA 1HV2A 3L22A 2CHZA 5LP0A 2L6JA 5FZSA 2LO6A 3MKQA 3IBEA 4FHJA 2J07A 4XKCA 1UN8A 3FDHA 3S7BA 4C9BB 4WUYA 3HQIA 4WWOA 1Z6TA 4CRHA 4W9KB 3QNKA 3GYZA 3B7SA 3ML8A 4N3BA 4CT4A 4EQFA 2WXMA 2WXGA 1OWPA 4Q94A 4AJWA 5CCMA 4GYOA 4GYWA 4U2NA 3LUTB 2CFZA 5A6CA 3MYVA 5BT1A 2WM9A 5CCLA 3FEYA 3PE3A 1TJCA 4HLEA 3M4TA 5E75A 3UT7A 3U64A 2AWIA 2XGOA 4UWKA 2FI7A 1HO8A 3ZGQA 4HOSA 4CXJA 3QB2A 4AY5A 2PM6A 4Q96A 2IF4A 2WXPA 2IQCA 4MRUA 3NQPA 5IBKA 1HF8A 5FZRA 3PS6A 4J6IA 4BFRA 3CVNA 3TG5A 4B89A 3FTYA 4I6JA 4XIFA 4YVOA 1UW4B 1UG3A 3DPDA 4GA2A 5FWQA 2V8SE 3LVRE 2PQRA 4FULA 4AP2A 4GPKA 4GA0A 4HORA 2PPIA 1H2TC 1EOEA 3SD5A 3EDTB 4GZ5A 4PS8A 5BV1A 5CMWA 4WQOC 4FHKA 2FO7A 3L6AA 3MZLB 4TRQA 4U77A 2IJGX 4U07A 5CHEE 2VPKA 1CS3A 2CG3A 4KZ0A 3LCAA 4U2MA 3DRYA 3AS4A 2I1JA 3OGLA 5H7HA 2YHCA 2P1QA 3G2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN2 A;  3C6P A;  1A68 A;  2IF5 A;  2P1P A;  2VKP A;  3BIM A;  4ZOU A;  4UYI A;  4I6J C;  5LLI B;  5BXB A;  3C6N A;  3M52 A;  3HU6 A;  3ZTC B;  4EOZ A;  2OVP A;  4APF A;  3M5B A;  4W9J B;  2NZ0 B;  1LDK D;  2P1N A;  4JTD B;  3KVT A;  4BKT B;  2R9R B;  1P22 B;  1QDV A;  3ZKJ B;  1EOF A;  1LQB B;  2FNJ C;  4JTC B;  4J8Z A;  2IZV C;  1R29 A;  5EUP A;  3ZTD B;  4CXT A;  1FS2 B;  5BXD A;  2ASS A;  3WSO B;  2P1O A;  3L2O A;  4B95 B;  2P1M A;  4BGC A;  5FTA A;  4W9E B;  3FKC A;  1EXB E;  4CP3 A;  5JH5 B;  3ZRC B;  3MKS A;  3OGK A;  4W9H H;  3ZUN B;  2I2R A;  1FS1 B;  3E4U A;  2E32 B;  2OVR A;  4HXI A;  1FQV B;  5DAD A;  3OGM A;  4N9F 5;  4W9H B;  4HS2 A;  1R2B A;  4JTA B;  4CXI A;  3LBZ A;  1DSX A;  4AWJ B;  5A6R A;  4W9C B;  4UIJ A;  5A15 A;  1HV2 A;  5H7G A;  4B9K B;  3LNM B;  3B84 A;  1NEX A;  1LM8 C;  1BUO A;  4W9L B;  3HQI A;  4BKS B;  4CRH A;  2MA9 C;  5HZG C;  5HYW B;  2IHC A;  3V7D A;  5DAF A;  1T1D A;  2C9W C;  4U2N A;  3LUT B;  4W9G B;  1EOD A;  3DCG B;  3HTM A;  2A79 B;  4W9F B;  3OHV A;  5BXH A;  3M4T A;  4CXJ A;  1VCB B;  3ZRF B;  5BO4 C;  2Q81 A;  3ZNG B;  4AJY C;  5IBK A;  2YY9 A;  4JGH C;  2Z8H A;  2E31 B;  3I3N A;  3C6O A;  3OHU A;  1QDW A;  4AP2 A;  2PPI A;  1EOE A;  2EQX A;  4WQO C;  3HVE B;  2AST A;  1R28 A;  3DRZ A;  2OVQ A;  4W9K B;  3M8V A;  4W9D B;  3GA1 A;  4W9I B;  4U77 A;  4B9K E;  2JZ3 C;  2VPK A;  3HVE A;  1CS3 A;  1S1G A;  4U2M A;  1NN7 A;  3OGL A;  5H7H A;  2P1Q A; 
#chains in the Genus database with same CATH topology
 4KBQ A;  4BX9 A;  2VYI A;  4GYY A;  3PRZ A;  5G05 J;  3LXU X;  2VJ8 A;  1WG0 A;  3NZS A;  5ENR D;  4I9E A;  2OVP A;  1E7U A;  3M5B A;  2ETC A;  3LYA A;  2R9R B;  3ZPJ A;  4GTO A;  5ANL A;  5HI7 A;  4G23 A;  3D9P A;  3SQV A;  4XZ4 A;  3L2O A;  4CP3 A;  1LF8 A;  1MJ0 A;  4U0S A;  1MX4 A;  2X3M A;  3CVP A;  2E32 B;  4HB5 A;  2P9L G;  3L13 A;  3RK6 A;  5G2N A;  4F1P A;  3FUI A;  1SZA A;  4LRZ A;  2VTB B;  1DSX A;  4HVB A;  3SZ7 A;  5H7G A;  4EZJ A;  3LVQ E;  5EX0 A;  3FUH A;  3QWW A;  3RRM B;  1H6O A;  4F3V A;  4GTT A;  2J9Q A;  3MV3 B;  3UT8 A;  3FUK A;  2ZIS A;  4DX1 A;  2BF0 X;  3QK0 A;  3CVW A;  2UWJ G;  4HI9 A;  4E85 A;  4IRU A;  2YY9 A;  3SO8 A;  5FQ7 A;  3JQ0 A;  3SFZ A;  3SFX A;  5LCW C;  4ANW A;  3CIA A;  2X6K A;  3HVE B;  3R7R A;  4LCT A;  1YA0 A;  2WPV A;  2OVQ A;  3TAX A;  5DIZ A;  4W9K B;  2OND A;  3GA1 A;  3I4G A;  2WXI A;  3ONL A;  4KXK B;  2OCC E;  5G55 A;  2R2L A;  2XQ0 A;  3SF4 A;  5M72 A;  2XCC A;  1BI8 B;  5EKQ D;  5BXU A;  5BXB A;  4CDR A;  5EYP F;  1JCQ A;  3LJ3 A;  1O1R A;  5AN8 A;  3L9T A;  3Q78 A;  4ACL A;  5ARG A;  2EIN E;  3C98 A;  2OVF A;  2XGS A;  4TXQ A;  4OVV A;  3L82 A;  4OVU A;  3DSV A;  2WXL A;  3Q15 A;  2IO2 C;  4W9H H;  2I2R A;  4DX5 D;  4KVO A;  3S2A A;  1YMP A;  4AEZ C;  4HRL A;  3PNL B;  4WWN A;  3ZIM A;  1MQS A;  3CVQ A;  4W9C B;  3OXF A;  5AQ9 A;  2HM8 A;  3VLD A;  4CT0 A;  3DWL G;  4K5B A;  2PZI A;  5HZG C;  3QKY A;  1OWN A;  1KLX A;  3UM0 A;  2FEZ A;  2ZGG A;  1HXI A;  4U7E B;  2X38 A;  4AOF A;  4AY6 A;  3D9H A;  1IQR A;  5J90 A;  3ABM E;  3C3R A;  5T8I A;  2MRI A;  1X5B A;  4YDW A;  4RVB A;  2Z8H A;  2A5E A;  1NA3 A;  2E31 B;  1S63 A;  4MS6 A;  4PS7 A;  1DVP A;  3OHU A;  3V30 A;  1HG5 A;  3B13 A;  1NP7 A;  4C0M A;  4H7X A;  4NIK A;  4HNA D;  4W9I B;  3HVE A;  3ZW3 A;  1NN7 A;  3LJN A;  4I2W A;  1A68 A;  3ASF A;  3Q47 B;  2VGX B;  4J7W A;  4RG9 A;  3FTV A;  4B8C B;  4HOU A;  2XZD G;  4PS3 A;  3UIO C;  4CDM A;  4XI9 A;  2A5U A;  4KMO A;  2DBA A;  2OV8 A;  4Y6W A;  3DSS A;  2R05 A;  5LX8 A;  2VQ2 A;  1QDV A;  3O48 A;  4A3V A;  4GTP A;  1UJK A;  3GZ1 A;  3ONK A;  4ZGC A;  4ILH B;  4JTC B;  3PNT B;  3CVY A;  4B0Z A;  2X6J A;  4TXP A;  5CRV A;  3CHS A;  3F6Q A;  4BTA A;  4BES A;  4JA9 A;  3FKC A;  2XGM A;  3G2U A;  3B7T A;  3D9N A;  2GRM A;  3KSL A;  4UUC A;  3DXK G;  3AU5 A;  4DX7 D;  3E4B A;  4DX2 A;  4IYP A;  3W9F A;  4WND A;  1O1S A;  5G04 C;  3VTY A;  1QNF A;  1JCR A;  5C2Y A;  3ZYQ A;  3ZEF A;  3T8K A;  5BW8 C;  2ETB A;  3RO2 A;  2R5S A;  3VLE A;  1B89 A;  4A3T A;  2LUH A;  4C48 B;  3GW4 A;  4BWR A;  2F8Y A;  3IHV A;  3QJZ A;  4LER A;  2A79 B;  3SGH A;  4EEC A;  5A7D B;  3ZRF B;  2RKK A;  2Q81 A;  2UY1 B;  1OWO A;  2VSO E;  3ASN E;  3UMV A;  4DLQ A;  4KT6 B;  3NOG D;  1QYM A;  4B93 B;  3UT4 A;  3PDN A;  1S0P A;  3ZN3 A;  4HQD A;  3ZU7 B;  1R28 A;  3O4Z A;  2GW1 A;  3KSQ A;  1PAQ A;  3G2W A;  1E96 B;  3MX3 A;  1AP7 A;  2YQ8 A;  1D9S A;  3CHO A;  4GML A;  3BIM A;  3DXM G;  1D8E A;  2VSX E;  3EU9 A;  3UIP C;  3M52 A;  4U8H A;  4APF A;  2NZ0 B;  2P1N A;  2RFA A;  4FU3 A;  3VLF A;  1ZU2 A;  2VGE A;  2FNJ C;  3RAU A;  1R29 A;  5EUP A;  1G3N B;  3V2O A;  3Q7A A;  3FTU A;  3OGK A;  2IOL A;  3MCX A;  3GZ2 A;  4O1P A;  3ZKJ A;  1H0A A;  1EDU A;  2LXL A;  1Z3X A;  1H6P A;  2VGX A;  1U2V G;  3CQG B;  1JUQ A;  4APO A;  5KWD A;  5IY5 E;  1OUV A;  1YCS B;  1HV2 A;  1ZB1 A;  3L22 A;  3DSW A;  3IBE A;  4XKC A;  1UN8 A;  1TNB A;  3BUA A;  1OY3 D;  4WUY A;  2F8X K;  4N3B A;  1DCE A;  1TNO A;  4Q94 A;  4GYO A;  4GYW A;  3LUT B;  4OAV B;  5A6C A;  3MYV A;  1SW6 A;  3PE3 A;  1TJC A;  3M4T A;  5E75 A;  2DWZ A;  4HI8 A;  1FT1 A;  1HO8 A;  2IQC A;  3AG3 E;  3ABL E;  5FZR A;  2OEW A;  3DPD A;  3B7B A;  4AP2 A;  5BXO A;  3UM3 A;  1H2T C;  3EDT B;  2L6B A;  2OEV A;  3L6A A;  4U77 A;  3V31 A;  1CS3 A;  4U2M A;  2P1Q A;  2LSV A;  4J8S A;  2L0T B;  3KEZ A;  3PUJ A;  1UJJ A;  4V3I A;  3EUV A;  4GCN A;  1XGW A;  3FU6 A;  1RW2 A;  3ZYL A;  4LNU D;  4UI9 J;  5HS0 A;  4BKT B;  3LY8 A;  1E90 A;  4JPS A;  4FP7 A;  2IZV C;  5B1A E;  4NQ0 A;  1H6K A;  3B95 A;  3LEW A;  2VTB A;  4BGC A;  5JH5 B;  1EXB E;  4NRH B;  4O1O A;  3E4U A;  2OVR A;  3SBS A;  3DPY A;  1EPU A;  4HS2 A;  4JTA B;  1HS6 A;  2KM4 A;  3V79 K;  2GRP B;  3FU0 A;  4I2Z A;  2VSN A;  3C3O A;  4B9K B;  2P9I G;  2WXH A;  1LM8 C;  5D0O D;  1BI7 B;  4M7C A;  1INZ A;  4YY8 A;  1EOD A;  2WXN A;  4UWF A;  4W9F B;  3BEE A;  3ZRH A;  4N5C A;  5D66 A;  5LOZ A;  4GTQ A;  1N4Q A;  4XX5 A;  2H6F A;  5BV0 A;  4EZK A;  4N5Q A;  4L7T A;  2C0L A;  3X2Q E;  3TXN A;  3I3N A;  2L9B A;  4RLY A;  4UI9 C;  3C6O A;  3QAQ A;  3IEG A;  4BY6 A;  1TNY A;  4G1T A;  4AM9 A;  3U66 A;  1DNP A;  2P9P G;  5A23 A;  3VTX A;  3TWU A;  2PQN A;  3FP3 A;  2DIW A;  1L5J A;  2KXP C;  2ZU6 B;  2ION A;  1N4S A;  4JTD B;  3KVT A;  4GTM A;  3EIJ A;  3ENE A;  2WXK A;  3T5V A;  3BG1 B;  2ZXW E;  4CXT A;  4K0R A;  1OT8 A;  5C1D A;  2HR2 A;  3JYS A;  3R9A B;  3EJN A;  4N3C A;  2KC7 A;  3JUI A;  5ENN A;  1SA5 A;  4W9R A;  1PC2 A;  1TN8 A;  3L16 A;  5CMY A;  1N9A A;  5KJN A;  3S7D A;  3TJP A;  3ZHE B;  5CEA A;  3UM1 A;  3TWQ A;  1LD7 A;  1K8K G;  4IN3 B;  4H7Y A;  3ESK A;  1NEX A;  4M3O A;  5T3R A;  1H2V C;  2VGY A;  2IU1 A;  1KT0 A;  4BKS B;  5HYW B;  1IHG A;  2C0M A;  3D9O A;  5BNW A;  3FH5 A;  3IXE A;  1MZC A;  2UY1 A;  5BXH A;  4ZFH A;  3CLJ A;  5KNH D;  3RIB A;  4AJY C;  2CFU A;  4F53 A;  1TYQ G;  2LAI A;  3FH8 A;  4B94 A;  1K3Z D;  4BX8 A;  3CEQ A;  4UWL A;  3E34 A;  4CCA A;  3DRZ A;  3R7Q A;  4F1S A;  3PUK A;  3AG4 E;  5AAO A;  2AXZ A;  2FBN A;  2YIN A;  3D9M A;  5AJL A;  1QZ2 A;  2VKP A;  2EIJ E;  1NA0 A;  1LTX A;  3EIQ C;  3NB2 A;  2AXV A;  2AVP A;  3UUX A;  3C6N A;  3ZTC B;  3AU4 A;  2XZT G;  3AAA C;  2E0I A;  3LS8 A;  3ASD A;  2ILR A;  3TWV A;  1ELW A;  2WXF A;  5KJK A;  4BTB A;  5JJT A;  3IV0 A;  4YND A;  1D8D A;  2P1O A;  2J4D A;  1YYH A;  1E8X A;  2MHK A;  4W9E B;  4GAA A;  3MEK A;  1WDY A;  5BUZ A;  3OGM A;  3LY7 A;  3UPV A;  4UQX A;  1HU3 A;  3HXE A;  5BPP A;  3P1U A;  2FUL A;  3S7F A;  4N2S A;  3UM2 A;  3LNM B;  4UWG A;  4MKT A;  3EU5 A;  4GMR A;  4UI9 K;  5AAR A;  1BU9 A;  4YDO A;  3DCG B;  3FU5 A;  3FTW A;  3LY9 A;  2EIM E;  2M63 A;  5ENS D;  5BO4 C;  3KAE A;  3HYM B;  3SNX A;  3B7U X;  5AIJ A;  3ZNG B;  4FLB A;  2XRY A;  5CED B;  4CDN A;  1OCO E;  1K1A A;  3MA5 A;  1Q2Z A;  2L0I A;  3E37 A;  2ETA A;  2H6G A;  3Q4A B;  3PVL A;  3DRX A;  1NL4 A;  1JWG A;  2JZ3 C;  3C6P A;  4JHR A;  5JHB A;  3RKV A;  3PZD A;  1EF1 C;  3SY2 A;  4UYI A;  1SA4 A;  1FVF A;  3BU8 A;  1FPP A;  1A17 A;  2C2L A;  4NAC A;  4TUU A;  2XEH A;  4ATZ D;  3ZKJ B;  2B0O E;  4I43 A;  3TG4 A;  4JEU A;  2X6H A;  2R17 C;  3ZXS A;  4N3A A;  3CHP A;  1FS1 B;  1V54 E;  1KZO A;  4K03 A;  4RG6 A;  1SZ9 A;  4JVS A;  3LBZ A;  3D9J A;  5A6R A;  2LO6 A;  3MKQ A;  2F37 A;  4CRH A;  3GYZ A;  3B7S A;  4EQF A;  2WXG A;  4U2N A;  1TNU A;  3UT7 A;  4HOS A;  4Q96 A;  2IF4 A;  4MRU A;  1HF8 A;  4J6I A;  4B89 A;  3TG5 A;  1KPS B;  5FWQ A;  3LVR E;  4GPK A;  3HXD A;  4GZ5 A;  4PS8 A;  5BV1 A;  2NYJ A;  4U07 A;  3AS4 A;  2I1J A;  5H7H A;  3ZFW A;  3FTS A;  1SQM A;  5AQA A;  3FY4 A;  1N54 A;  4IUL A;  5EID A;  4DI3 A;  5FQ4 A;  4E6H A;  1FT2 A;  1EOF A;  3URZ A;  1LD8 A;  3CK7 A;  3C72 A;  5HKP A;  2LNI A;  3RRU A;  2YNQ A;  3TXM A;  4GMJ A;  3FEX A;  3G2S A;  4R7L A;  4L2L A;  3NZU A;  1WY6 A;  3OXG A;  4A63 B;  3FUL A;  4A55 A;  1FQV B;  1OWL A;  3ZUV B;  1IKN D;  3MV2 B;  4W9H B;  5JJ7 A;  1XNF A;  5HRY A;  3RJV A;  4GZ3 A;  1A5E A;  3P2B A;  2EIL E;  1TN6 A;  3B84 A;  3RSE G;  1SVX A;  3FUM A;  2CHW A;  4UWH A;  3HIZ A;  2MA9 C;  1N4P A;  2EIK E;  2Y3A A;  3DST A;  4CRW A;  4G11 A;  3CST A;  4W9G B;  2GRQ B;  2J4B A;  2KCL A;  2BED A;  2IFU A;  4LEU A;  3SI5 A;  4P29 A;  4LSZ E;  3DRA A;  3WG7 E;  4I1M A;  1MX6 A;  3SBT B;  2J49 A;  3L17 A;  3PEU B;  3CHQ A;  3FWV A;  4AIF A;  4G24 A;  3GZS A;  1BD8 A;  2Y4U A;  3M8V A;  2P9S G;  4W9D B;  2GGF A;  2XPY A;  5E76 A;  3KEA A;  3PEV B;  3IKO B;  4GTS A;  4RSY A;  3SHF A;  4ANV A;  5KCM A;  4KVM A;  2NC9 A;  4YDE A;  4JC8 A;  3DSU A;  2RD0 A;  3E32 A;  3JQ1 A;  5FZQ A;  3JXI A;  2KCV A;  4BT8 A;  1IYG A;  4W9J B;  1JWF A;  4TUM A;  2BKG A;  3E30 A;  4G2V A;  5B3S E;  1QBQ A;  2IEJ A;  3Q5M A;  5EN5 D;  1DC2 A;  4WAF A;  2I2O A;  3EHN A;  3TWR A;  5FTA A;  4JXT A;  4PDX A;  3DBS A;  2I9C A;  2QZA A;  4L2Y A;  3J5P A;  2MOW A;  3SFY A;  2DVW A;  3L54 A;  1U3D A;  5DBK A;  4UQY A;  3UI2 A;  2PM7 A;  2WXJ A;  1BUO A;  2FF4 A;  2NSZ A;  2WQ6 A;  3PZ1 A;  5ITZ F;  3PZ3 A;  4ILG A;  3QWP A;  3ULQ A;  3ZHE A;  4DUI A;  4FJZ A;  1V55 E;  4MBG A;  4AVX A;  4GU5 A;  2GRL A;  3FUF A;  4ME2 A;  3NOC D;  4N39 A;  1VCB B;  4F6R D;  3TWW A;  4QQI A;  2LAH A;  3OAW A;  2PL2 A;  1NZN A;  3OXL A;  5CER B;  4EZL A;  5G04 J;  4XKB A;  4HRM B;  4URK A;  2DZN A;  4GTR A;  4JB8 P;  2DYS E;  2J08 A;  3PH0 C;  1KZP A;  4U0U A;  4JL0 A;  5FIN A;  5FJY A;  2AXU A;  1NFI E;  4J8E A;  1MHQ A;  3OTN A;  2WXR A;  3CKB A;  4EHM A;  2YHE A;  4PUC A;  4LG6 A;  1N95 A;  3HU6 A;  5D2M C;  2HE0 A;  1FVH A;  4WWP A;  4WNF A;  5EIB E;  3T8M A;  3KD7 A;  4J8Y A;  1EYH A;  4L23 A;  3PRE A;  3APF A;  2H6I A;  2WB2 A;  4GTV A;  4C0E A;  2QC9 A;  4J8F A;  4EBA A;  4NUR A;  4I9C A;  3QAR A;  1JCS A;  3MKS A;  3ASO E;  4EPZ A;  2ZGD A;  3ZXP A;  3TGO A;  1ELK A;  4J8D A;  3DSX A;  4GCO A;  1Y6I A;  2QY7 A;  1H19 A;  2P2C P;  4U63 A;  3N71 A;  4AXH A;  4ABN A;  3PE4 A;  2IHC A;  4U8V D;  5T4Y A;  3EHQ A;  4GB9 A;  5LCW J;  5D0Q D;  4QFV A;  2AJA A;  3FUJ A;  2JLB A;  4FLH A;  1KT1 A;  4JGH C;  3FU3 A;  2Y1L E;  3FHE A;  3DEP A;  4KYO B;  3U9W A;  3RRN B;  2QYU A;  4JW1 A;  4ATG A;  2E2E A;  1Z5S C;  2EQX A;  3TWT A;  3IHY A;  4DPR A;  1HE8 A;  3Q7F A;  4I6E A;  1TJF A;  3EHM A;  5ENQ D;  2NN2 A;  5EIL A;  3NAW A;  2IF5 A;  3NBN B;  4ZOU A;  2IO3 C;  2KZT A;  5FQ8 A;  4FC8 A;  5CBN A;  1HX8 A;  4EOZ A;  3CVU A;  3FUE A;  3AJI A;  1OXJ A;  1LDK D;  3AG1 E;  2WXO A;  3MKR A;  4MLP A;  3ESL A;  4DI4 A;  3RO3 A;  4FJY A;  4J8Z A;  2DYR E;  3CSF A;  3C5R A;  4BER A;  3FUN A;  4YVQ C;  3WSO B;  5KBA A;  2P1M A;  3ZUN B;  5KJL A;  2J09 A;  4HXI A;  2CG2 A;  5G05 C;  1Y8M A;  2P58 C;  1R2B A;  3CK8 A;  4HFG A;  2P9U G;  2LSU A;  3B7R L;  2L6J A;  5FZS A;  5CEC B;  3FDH A;  3S7B A;  4C9B B;  4WWO A;  1Z6T A;  3QNK A;  3ML8 A;  4HRN A;  4CT4 A;  3AG2 E;  1OWP A;  5CRU A;  1S70 B;  3T9K A;  2QYJ A;  5BT1 A;  3U64 A;  2AWI A;  3ZGQ A;  2FI7 A;  4CXJ A;  4AY5 A;  2DZO A;  2PM6 A;  1N4R A;  5IBK A;  1X81 A;  5AQB A;  3PS6 A;  4BFR A;  3FTY A;  1NI1 A;  4XIF A;  3ZNG A;  3HRA A;  3UKU G;  4FUL A;  3UTM A;  4GA0 A;  2PPI A;  1EOE A;  4WQO C;  3MZL B;  2CG3 A;  3LCA A;  3DRY A;  3OGL A;  2V4H C;  2YHC A;  2P1P A;  2HO1 A;  5JJ6 A;  2DCP A;  2NXP A;  4ZHB A;  4WNG A;  3CHM A;  3MJW A;  3I4R B;  1E7V A;  2LXM A;  5AYW D;  3S7J A;  5LFA A;  3HXB A;  2KCK A;  3Q79 A;  5CBO A;  1K1B A;  4PH4 B;  3ULY A;  2Y4T A;  2P9N G;  3D9K A;  1HZ4 A;  3FUD A;  5BXD A;  2ASS A;  1H2U A;  4B95 B;  3BQO A;  4GZ6 A;  2OVB A;  3QDN A;  3ZRC B;  4N2Q A;  1N94 A;  5EX3 A;  1N0R A;  4JD2 G;  2WXQ A;  4CYM D;  4TXR A;  3D3M A;  1Z3Y A;  2KAT A;  2BKK B;  1ELR A;  2XHE A;  4L1B A;  4U8Y D;  4CXI A;  3CVX A;  4G26 A;  4Z68 A;  4UQZ A;  4OAU C;  5KJM A;  2R03 A;  2XS1 A;  3CGH A;  1T1D A;  3LKU A;  2C9W C;  1TNZ A;  4HBD A;  3OHV A;  3FH7 A;  3K9I A;  4U95 D;  3FTZ A;  3L08 A;  4LNB A;  4RQI A;  3UQ3 A;  2KZT B;  2JEK A;  1IHB A;  4HOT A;  3UKR G;  3NF1 A;  3RU0 A;  4BET A;  2V5Q C;  5FT9 A;  1QDW A;  1TN7 A;  3HXF A;  4AV7 A;  4TV3 A;  2MYO A;  4HLL A;  4XEI G;  5HQ8 A;  4BEP A;  4JA7 A;  4A1G A;  4JEH A;  3G2V A;  1IQU A;  5KNG A;  4ANX A;  2B6C A;  5AQ7 A;  1WM5 A;  2IOS A;  2VSY A;  3CV0 A;  1WAO 1;  2XEV A;  3D9I A;  4GZD A;  4JHJ A;  2X6F A;  3U4T A;  4G8K A;  4EBA G;  5ENO D;  1P22 B;  1LQB B;  4FAD A;  3MGB A;  3TWX A;  4ACK A;  3ZTD B;  3UX4 A;  3JCK C;  5ENT D;  3Q75 A;  3QWV A;  5J08 A;  2J8S D;  3I5P A;  4BSX A;  4DX6 D;  2A4Z A;  2GRN B;  4Y6C A;  3ZYK A;  1E8W A;  2R59 A;  4I6G A;  4LUN U;  3KS2 A;  4JZY A;  4WNE A;  5A15 A;  2I6H A;  3C3Q A;  2F0Y A;  5EDS A;  4O6F A;  1PY1 A;  3Q9N C;  3T5X A;  4CEM A;  1N11 A;  5H7P A;  1BLX B;  1S64 A;  3HTM A;  4K5C A;  3FFL A;  2R02 A;  3Q73 A;  3PZ2 A;  5B1B E;  3U3W A;  2FO1 E;  2XRZ A;  3AS8 A;  2WMN A;  4L9P A;  3PZ4 A;  1TR4 A;  4O60 A;  5ANR A;  1UN9 A;  4CZ2 D;  4GPM A;  3ASG A;  3CR3 A;  2PNN A;  2XEN A;  3ISM C;  4G8L A;  2AST A;  1MX2 A;  3APD A;  3E33 A;  3JXJ A;  3LPZ A;  3DEO A;  1P5Q A;  4OYS A;  2WQ7 A;  2V4L A;  1VDY A;  3ZVV A;  2AW6 A;  2H6H A;  1S1G A;  2V0P A;  4KZC A;  4CGW A;  2GRO B;  1ZBP A;  1IXV A;  2KBX A;  4X8Q A;  2XS8 A;  4CGV A;  3D9L A;  2XPZ A;  3ASH A;  3FTX A;  4G25 A;  1UOH A;  4ILI A;  4B8A A;  2ZIR A;  3EHR A;  4XI0 A;  3UIN C;  3V2X A;  4GZC A;  4U04 A;  4A1S A;  2V5F A;  1O1T A;  1O5M A;  2XPI A;  1U3C A;  2RG8 A;  4LNG A;  4ANU A;  5AEN A;  1GW6 A;  2X6I A;  2RFM A;  3AS5 A;  5JHA A;  4DRX E;  3R9M A;  3HDX A;  3BG0 B;  5DAD A;  3HHM A;  4N9F 5;  2Q7F A;  3QOU A;  2XEE A;  4UIJ A;  4XE0 A;  2Y0B G;  3TL5 A;  5JA4 D;  2OOE A;  2WVI A;  4W9L B;  1OWM A;  3QC1 A;  5ARF A;  2HYZ A;  5DAF A;  3V7D A;  1HG2 A;  3HXC A;  4BT9 A;  5FQ6 A;  3CQC B;  4DLO A;  4U0Z A;  5FTP A;  1JPL A;  3LDZ A;  3ULE G;  4FA6 A;  4GA1 A;  1N52 A;  4DJA A;  2WMO A;  4YDY A;  5ENP D;  3UXG A;  2P9K G;  3ML9 A;  4I1A A;  3WXX A;  3JUE A;  2BTD A;  1TEZ A;  4B9K E;  1E8Z A;  3TWS A;  2QFC A;  1OCC E;  3CVV A;  1MYO A;  1W3B A;  1E8Y A;  1HH8 A;  3HG0 D;  4HOQ A;  4I6J C;  1N0Q A;  5LLI B;  2CHX A;  3APC A;  2BUG A;  4I17 A;  4DK5 A;  4K5A B;  2JAB A;  2GRR B;  2WQH A;  1FS2 B;  3Q49 B;  4D10 C;  1BPO A;  4Q69 A;  2XCB A;  1FCH A;  4JHK A;  3MKQ B;  5AJD A;  3ABK E;  3ZYM A;  3CK9 A;  1QQE A;  1OCR E;  3CKC A;  4J0U A;  4I1O B;  2I1K A;  1HFA A;  3J5Q B;  5FIO A;  1RZ4 A;  4AWJ B;  3CHR A;  3CVL A;  4F7A A;  2CHZ A;  5LP0 A;  4FHJ A;  2J07 A;  3HQI A;  1DCQ A;  3Q9U C;  2WXM A;  4AJW A;  3W9G A;  1OCZ E;  5CCM A;  2CFZ A;  2WM9 A;  5CCL A;  3FEY A;  4HLE A;  2XGO A;  4UWK A;  3QB2 A;  2WXP A;  3NQP A;  2IY0 C;  5JMN D;  3CVN A;  4I6J A;  5EYL A;  4YVO A;  1UW4 B;  1UG3 A;  4GA2 A;  2V8S E;  2PQR A;  4U96 D;  4HOR A;  3SD5 A;  5CMW A;  4BSZ B;  4FHK A;  2FO7 A;  2Y69 E;  4TRQ A;  1AWC B;  2IJG X;  5CHE E;  2VPK A;  4KZ0 A;  3G2T A; 
#chains in the Genus database with same CATH homology
 4KBQ A;  4BX9 A;  2VYI A;  4GYY A;  3ZFW A;  2HO1 A;  2LSV A;  3FTS A;  2P1P A;  4J8S A;  3PRZ A;  5JJ6 A;  2DCP A;  2L0T B;  3KEZ A;  2NXP A;  3PUJ A;  1UJJ A;  5G05 J;  4V3I A;  1SQM A;  4GCN A;  4WNG A;  3CHM A;  3MJW A;  3LXU X;  1XGW A;  3FU6 A;  3ZYL A;  2VJ8 A;  3I4R B;  3NZS A;  1E7V A;  5AYW D;  4I9E A;  2OVP A;  3FY4 A;  1E7U A;  3S7J A;  3M5B A;  1N54 A;  5LFA A;  4IUL A;  2KCK A;  3LYA A;  4UI9 J;  4PH4 B;  4BKT B;  2R9R B;  2Y4T A;  3LY8 A;  5FQ4 A;  1E90 A;  4DI3 A;  4E6H A;  4JPS A;  1EOF A;  3URZ A;  4FP7 A;  5ANL A;  3CK7 A;  3D9K A;  5HI7 A;  3ZPJ A;  2LNI A;  4G23 A;  3D9P A;  2IZV C;  3RRU A;  2YNQ A;  4XZ4 A;  1HZ4 A;  3TXM A;  4GMJ A;  4NQ0 A;  1H6K A;  3FEX A;  3FUD A;  2ASS A;  5BXD A;  3LEW A;  2VTB A;  3L2O A;  1H2U A;  4B95 B;  4BGC A;  4GZ6 A;  5JH5 B;  1EXB E;  4CP3 A;  1LF8 A;  2OVB A;  3QDN A;  2X3M A;  3G2S A;  4NRH B;  4R7L A;  4U0S A;  4N2Q A;  3ZRC B;  4L2L A;  5EX3 A;  3CVP A;  1WY6 A;  3NZU A;  3OXG A;  2E32 B;  3FUL A;  4A55 A;  3E4U A;  2OVR A;  2WXQ A;  3L13 A;  5G2N A;  3RK6 A;  3SBS A;  3FUI A;  3D3M A;  1FQV B;  1Z3Y A;  2KAT A;  1SZA A;  1OWL A;  1EPU A;  1ELR A;  3MV2 B;  4W9H B;  4HS2 A;  5JJ7 A;  4JTA B;  1HS6 A;  2KM4 A;  1XNF A;  2XHE A;  4LRZ A;  4L1B A;  2VTB B;  3RJV A;  4CXI A;  3FU0 A;  4GZ3 A;  4I2Z A;  1DSX A;  3P2B A;  3CVX A;  4HVB A;  3SZ7 A;  5H7G A;  2VSN A;  4G26 A;  4B9K B;  4EZJ A;  3B84 A;  4UQZ A;  2WXH A;  1LM8 C;  3LVQ E;  5EX0 A;  3FUH A;  3FUM A;  2CHW A;  3QWW A;  4UWH A;  3HIZ A;  2MA9 C;  5D0O D;  2Y3A A;  3RRM B;  5KJM A;  4F3V A;  3CGH A;  1T1D A;  1INZ A;  4YY8 A;  3LKU A;  4CRW A;  4G11 A;  3CST A;  2C9W C;  2J9Q A;  4W9G B;  1EOD A;  2WXN A;  3MV3 B;  3UT8 A;  4UWF A;  2J4B A;  3FUK A;  4W9F B;  2KCL A;  3OHV A;  3BEE A;  2BF0 X;  3FH7 A;  3K9I A;  3ZRH A;  3QK0 A;  3CVW A;  2IFU A;  2UWJ G;  4LEU A;  4N5C A;  4E85 A;  3FTZ A;  5LOZ A;  4P29 A;  4IRU A;  3SI5 A;  2YY9 A;  4XX5 A;  5BV0 A;  3L08 A;  4EZK A;  3UQ3 A;  2KZT B;  2JEK A;  3JQ0 A;  4I1M A;  4L7T A;  5FQ7 A;  3SFZ A;  4HOT A;  2C0L A;  3TXN A;  3NF1 A;  3I3N A;  2L9B A;  3SBT B;  3RU0 A;  4UI9 C;  2J49 A;  5FT9 A;  3C6O A;  3QAQ A;  5LCW C;  1QDW A;  3L17 A;  3PEU B;  3CHQ A;  4AV7 A;  3FWV A;  4AIF A;  3CIA A;  2X6K A;  3HVE B;  3IEG A;  4G24 A;  4LCT A;  3R7R A;  4ANW A;  4BY6 A;  1YA0 A;  3GZS A;  2WPV A;  2OVQ A;  2Y4U A;  4TV3 A;  5DIZ A;  4G1T A;  2OND A;  3TAX A;  3M8V A;  5HQ8 A;  2GGF A;  3GA1 A;  4W9D B;  4JA7 A;  4AM9 A;  2XPY A;  3I4G A;  5E76 A;  3U66 A;  2WXI A;  3ONL A;  4KXK B;  4A1G A;  1DNP A;  5G55 A;  5A23 A;  3PEV B;  4JEH A;  3IKO B;  4RSY A;  3VTX A;  3G2V A;  3SHF A;  1IQU A;  4ANV A;  4ANX A;  2PQN A;  2XQ0 A;  3SF4 A;  1WM5 A;  2IOS A;  3FP3 A;  2DIW A;  5KCM A;  2XCC A;  5M72 A;  2VSY A;  3CV0 A;  4KVM A;  5EKQ D;  2NC9 A;  1L5J A;  1WAO 1;  2XEV A;  4JC8 A;  5BXB A;  3D9I A;  4CDR A;  2RD0 A;  3JQ1 A;  5FZQ A;  2KCV A;  4GZD A;  4BT8 A;  4JHJ A;  2X6F A;  2ZU6 B;  3LJ3 A;  3U4T A;  1IYG A;  4W9J B;  2ION A;  4EBA G;  4JTD B;  1JWF A;  3KVT A;  1P22 B;  3EIJ A;  4G2V A;  4ACL A;  5ARG A;  1LQB B;  3C98 A;  4FAD A;  3ENE A;  3MGB A;  2OVF A;  2WXK A;  4ACK A;  3Q5M A;  3T5V A;  2XGS A;  4OVV A;  3BG1 B;  3UX4 A;  3ZTD B;  4CXT A;  4K0R A;  4OVU A;  4WAF A;  2I2O A;  5C1D A;  3JCK C;  3EHN A;  2HR2 A;  2WXL A;  5FTA A;  3JYS A;  3R9A B;  3Q15 A;  4JXT A;  3QWV A;  3EJN A;  4N3C A;  4W9H H;  4PDX A;  3DBS A;  2KC7 A;  3JUI A;  2I2R A;  5J08 A;  5ENN A;  2I9C A;  4L2Y A;  4KVO A;  3S2A A;  4AEZ C;  3PNL B;  4W9R A;  1PC2 A;  4WWN A;  3I5P A;  3L16 A;  4BSX A;  2MOW A;  5CMY A;  3ZIM A;  2A4Z A;  5KJN A;  3L54 A;  3S7D A;  1U3D A;  4Y6C A;  4UQY A;  5DBK A;  1E8W A;  2R59 A;  4I6G A;  1MQS A;  3TJP A;  4LUN U;  3CVQ A;  3ZHE B;  3KS2 A;  4JZY A;  2PM7 A;  4WNE A;  4W9C B;  2I6H A;  5A15 A;  4IN3 B;  2WXJ A;  3OXF A;  4O6F A;  4H7Y A;  5EDS A;  3ESK A;  1NEX A;  4M3O A;  5T3R A;  2FF4 A;  1H2V C;  2HM8 A;  1PY1 A;  2VGY A;  3VLD A;  4CT0 A;  1BUO A;  2NSZ A;  2IU1 A;  1KT0 A;  2PZI A;  3T5X A;  2WQ6 A;  4BKS B;  5HZG C;  5HYW B;  3QKY A;  4ILG A;  1IHG A;  2C0M A;  3D9O A;  4CEM A;  5BNW A;  3QWP A;  1OWN A;  3ULQ A;  3FH5 A;  3ZHE A;  1KLX A;  2FEZ A;  4FJZ A;  1HXI A;  3HTM A;  4AVX A;  4GU5 A;  2GRL A;  2UY1 A;  2X38 A;  3FUF A;  5BXH A;  4ME2 A;  3ZYK A;  4N39 A;  3CLJ A;  4AOF A;  1VCB B;  4AY6 A;  3RIB A;  3FFL A;  4AJY C;  2LAH A;  1IQR A;  3OAW A;  5J90 A;  2PL2 A;  1NZN A;  2CFU A;  3OXL A;  5T8I A;  3U3W A;  2MRI A;  1X5B A;  4RVB A;  2XRZ A;  3AS8 A;  4F53 A;  2Z8H A;  1NA3 A;  2WMN A;  2E31 B;  4MS6 A;  4EZL A;  2LAI A;  5G04 J;  5ANR A;  3FH8 A;  4B94 A;  1UN9 A;  1DVP A;  4PS7 A;  3OHU A;  3ASG A;  4XKB A;  3CR3 A;  4URK A;  1HG5 A;  3CEQ A;  4BX8 A;  3B13 A;  4UWL A;  1NP7 A;  2AST A;  4C0M A;  4CCA A;  3APD A;  3R7Q A;  4H7X A;  4F1S A;  3DRZ A;  3LPZ A;  2J08 A;  3PH0 C;  3PUK A;  1P5Q A;  4OYS A;  4W9I B;  4U0U A;  2WQ7 A;  2V4L A;  2AXZ A;  3HVE A;  1VDY A;  2FBN A;  4JL0 A;  3ZVV A;  5FJY A;  2AW6 A;  2YIN A;  3ZW3 A;  1S1G A;  1NN7 A;  2AXU A;  4J8E A;  3D9M A;  1MHQ A;  2V0P A;  3OTN A;  5AJL A;  2WXR A;  1QZ2 A;  4I2W A;  3ASF A;  4KZC A;  1A68 A;  4CGW A;  3Q47 B;  1ZBP A;  2VKP A;  2VGX B;  4RG9 A;  1NA0 A;  3EIQ C;  3CKB A;  3FTV A;  4B8C B;  4HOU A;  4CGV A;  3D9L A;  2YHE A;  4PUC A;  4PS3 A;  2XPZ A;  2AXV A;  2AVP A;  3UUX A;  4XI9 A;  4CDM A;  3C6N A;  2A5U A;  3ASH A;  3FTX A;  4KMO A;  2DBA A;  3HU6 A;  3ZTC B;  4G25 A;  4ILI A;  3AU4 A;  1FVH A;  4WWP A;  4B8A A;  2E0I A;  2OV8 A;  4XI0 A;  4Y6W A;  4GZC A;  3LS8 A;  4U04 A;  4WNF A;  4A1S A;  2V5F A;  3ASD A;  5LX8 A;  3T8M A;  2VQ2 A;  3KD7 A;  3O48 A;  1EYH A;  4A3V A;  1QDV A;  2ILR A;  4L23 A;  1ELW A;  1UJK A;  2WXF A;  3GZ1 A;  3ONK A;  4BTB A;  3PRE A;  3APF A;  4ILH B;  5KJK A;  5JJT A;  4JTC B;  4ZGC A;  2XPI A;  1U3C A;  3PNT B;  2RG8 A;  2WB2 A;  3IV0 A;  4ANU A;  3CVY A;  5AEN A;  4B0Z A;  2X6J A;  3CHS A;  4YND A;  1GW6 A;  2X6I A;  4C0E A;  4BTA A;  2P1O A;  4J8F A;  4EBA A;  2J4D A;  4NUR A;  4I9C A;  3QAR A;  1E8X A;  2MHK A;  4JA9 A;  3FKC A;  4W9E B;  2XGM A;  4GAA A;  3AS5 A;  3MKS A;  3G2U A;  4EPZ A;  3B7T A;  5JHA A;  3MEK A;  3HDX A;  3BG0 B;  5DAD A;  5BUZ A;  3D9N A;  2GRM A;  3LY7 A;  3OGM A;  3UPV A;  3HHM A;  3TGO A;  1ELK A;  4UQX A;  4N9F 5;  3AU5 A;  1HU3 A;  2Q7F A;  3E4B A;  3QOU A;  4J8D A;  5BPP A;  4IYP A;  4WND A;  3P1U A;  4GCO A;  4UIJ A;  1Y6I A;  4XE0 A;  2FUL A;  3S7F A;  4N2S A;  3TL5 A;  2QY7 A;  5G04 C;  3VTY A;  1QNF A;  1H19 A;  2OOE A;  2WVI A;  4U63 A;  4UWG A;  3LNM B;  3N71 A;  4W9L B;  1OWM A;  5C2Y A;  4MKT A;  4AXH A;  3ZYQ A;  4ABN A;  3ZEF A;  3QC1 A;  3PE4 A;  5BW8 C;  2IHC A;  2R5S A;  4UI9 K;  2HYZ A;  1B89 A;  5ARF A;  5T4Y A;  3RO2 A;  1HG2 A;  3VLE A;  5DAF A;  3V7D A;  4A3T A;  4GB9 A;  5LCW J;  4BT9 A;  3GW4 A;  5D0Q D;  4BWR A;  4QFV A;  3DCG B;  3FU5 A;  3IHV A;  3QJZ A;  4LER A;  3FTW A;  2A79 B;  3SGH A;  5FQ6 A;  3LY9 A;  4EEC A;  2M63 A;  5A7D B;  3CQC B;  3FUJ A;  3KAE A;  3HYM B;  3ZRF B;  5BO4 C;  2Q81 A;  2JLB A;  3B7U X;  2UY1 B;  1OWO A;  2VSO E;  4FLB A;  3SNX A;  4DLO A;  2XRY A;  4U0Z A;  5AIJ A;  3ZNG B;  5FTP A;  4FLH A;  1KT1 A;  1JPL A;  3FU3 A;  3LDZ A;  4CDN A;  4JGH C;  3FHE A;  3U9W A;  4KYO B;  3UMV A;  4DLQ A;  3MA5 A;  3RRN B;  4JW1 A;  4KT6 B;  2L0I A;  4FA6 A;  3UT4 A;  4GA1 A;  3PDN A;  4ATG A;  2E2E A;  1N52 A;  4DJA A;  2EQX A;  1S0P A;  3ZN3 A;  2WMO A;  1R28 A;  3O4Z A;  2GW1 A;  3Q4A B;  3PVL A;  3ML9 A;  3IHY A;  4I1A A;  4DPR A;  3DRX A;  1PAQ A;  1HE8 A;  3WXX A;  1TEZ A;  2BTD A;  3G2W A;  4B9K E;  1JWG A;  4I6E A;  2JZ3 C;  1E8Z A;  1TJF A;  2QFC A;  3EHM A;  1E96 B;  3MX3 A;  3CVV A;  1W3B A;  2YQ8 A;  2NN2 A;  3CHO A;  3C6P A;  4JHR A;  5JHB A;  3RKV A;  1E8Y A;  3PZD A;  2IF5 A;  1HH8 A;  4GML A;  1EF1 C;  3BIM A;  4ZOU A;  4HOQ A;  2KZT A;  4UYI A;  4I6J C;  5FQ8 A;  5LLI B;  4FC8 A;  2VSX E;  1HX8 A;  2CHX A;  1FVF A;  3APC A;  3M52 A;  4U8H A;  4EOZ A;  3CVU A;  3FUE A;  4APF A;  2C2L A;  1A17 A;  2NZ0 B;  1LDK D;  2P1N A;  2BUG A;  4NAC A;  4I17 A;  4TUU A;  4DK5 A;  4FU3 A;  2WXO A;  3MKR A;  3VLF A;  1ZU2 A;  4MLP A;  3ZKJ B;  3ESL A;  4I43 A;  3TG4 A;  2FNJ C;  4DI4 A;  3RO3 A;  4FJY A;  4J8Z A;  4JEU A;  3CSF A;  1R29 A;  5EUP A;  2X6H A;  2R17 C;  2WQH A;  3FUN A;  1FS2 B;  3ZXS A;  3Q49 B;  3FTU A;  4N3A A;  4YVQ C;  3WSO B;  2P1M A;  4D10 C;  1BPO A;  4Q69 A;  2XCB A;  1FCH A;  2IOL A;  3CHP A;  3MCX A;  3OGK A;  3GZ2 A;  3ZUN B;  4JHK A;  1FS1 B;  5KJL A;  3MKQ B;  2J09 A;  4HXI A;  1H0A A;  1EDU A;  4K03 A;  5AJD A;  3ZYM A;  2CG2 A;  5G05 C;  1Z3X A;  3CK9 A;  1QQE A;  1Y8M A;  4RG6 A;  2VGX A;  1SZ9 A;  3CQG B;  1JUQ A;  2P58 C;  3CKC A;  4JVS A;  1R2B A;  4J0U A;  4APO A;  4I1O B;  2I1K A;  3CK8 A;  4HFG A;  1HFA A;  3LBZ A;  4AWJ B;  3D9J A;  2LSU A;  3CHR A;  5A6R A;  1OUV A;  3B7R L;  3CVL A;  4F7A A;  1HV2 A;  3L22 A;  2CHZ A;  5LP0 A;  2L6J A;  5FZS A;  2LO6 A;  3MKQ A;  3IBE A;  4FHJ A;  2J07 A;  4XKC A;  1UN8 A;  3FDH A;  3S7B A;  4C9B B;  4WUY A;  3HQI A;  4WWO A;  1Z6T A;  4CRH A;  4W9K B;  3QNK A;  3GYZ A;  3B7S A;  3ML8 A;  4N3B A;  4CT4 A;  4EQF A;  2WXM A;  2WXG A;  1OWP A;  4Q94 A;  4AJW A;  5CCM A;  4GYO A;  4GYW A;  4U2N A;  3LUT B;  2CFZ A;  5A6C A;  3MYV A;  5BT1 A;  2WM9 A;  5CCL A;  3FEY A;  3PE3 A;  1TJC A;  4HLE A;  3M4T A;  5E75 A;  3UT7 A;  3U64 A;  2AWI A;  2XGO A;  4UWK A;  2FI7 A;  1HO8 A;  3ZGQ A;  4HOS A;  4CXJ A;  3QB2 A;  4AY5 A;  2PM6 A;  4Q96 A;  2IF4 A;  2WXP A;  2IQC A;  4MRU A;  3NQP A;  5IBK A;  1HF8 A;  5FZR A;  3PS6 A;  4J6I A;  4BFR A;  3CVN A;  3TG5 A;  4B89 A;  3FTY A;  4I6J A;  4XIF A;  4YVO A;  1UW4 B;  1UG3 A;  3DPD A;  4GA2 A;  5FWQ A;  2V8S E;  3LVR E;  2PQR A;  4FUL A;  4AP2 A;  4GPK A;  4GA0 A;  4HOR A;  2PPI A;  1H2T C;  1EOE A;  3SD5 A;  3EDT B;  4GZ5 A;  4PS8 A;  5BV1 A;  5CMW A;  4WQO C;  4FHK A;  2FO7 A;  3L6A A;  3MZL B;  4TRQ A;  4U77 A;  2IJG X;  4U07 A;  5CHE E;  2VPK A;  1CS3 A;  2CG3 A;  4KZ0 A;  3LCA A;  4U2M A;  3DRY A;  3AS4 A;  2I1J A;  3OGL A;  5H7H A;  2YHC A;  2P1Q A;  3G2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...