4HXIA

Crystal structure of klhl3/cul3 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
192
structure length
192
Chain Sequence
HMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESAAAAIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kelch-like protein 3
publication title Structural and Functional Characterization of KLHL3/Cul3 complex and implications of FHHt mutations in Cul3 binding
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 52
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4hxiA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 4hxiA01
3DCGB 3HTMA 3OGMA 1T1DA 5IBKA 1NN7A 2P1QA 1P22B 4ZOUA 4U2MA 4W9IB 3OHUA 1FS2B 3LUTB 4AP2A 5HZGC 3ZUNB 5BO4C 2VPKA 3L2OA 4W9CB 3ZNGB 2IF5A 4CP3A 3M8VA 4CXTA 4BKSB 2Q81A 4AJYC 3HVEB 1EOFA 3WSOB 2P1NA 2P1PA 3C6NA 5DADA 1CS3A 4B9KB 3OHVA 1NEXA 2NN2A 2PPIA 2ASTA 3LBZA 4W9KB 4B9KE 2OVPA 3ZTDB 3MKSA 2IHCA 5LLIB 1BUOA 4JGHC 2FNJC 4W9GB 5A15A 2P1OA 4W9EB 4CRHA 2OVRA 4AWJB 4CXJA 1VCBB 3C6PA 1LM8C 1S1GA 4JTCB 1EXBE 2R9RB 2OVQA 5A6RA 5BXDA 3M5BA 3OGKA 2YY9A 5FTAA 5H7GA 2P1MA 5JH5B 3ZKJB 3V7DA 5BXBA 3HU6A 5BXHA 4APFA 1DSXA 5HYWB 3M52A 4BKTB 3ZRFB 5DAFA 1LDKD 4U77A 4N9F5 1QDWA 4I6JC 4J8ZA 2JZ3C 1HV2A 1EODA 4JTDB 3I3NA 2A79B 1R2BA 3LNMB 2Z8HA 3C6OA 1FS1B 4EOZA 4WQOC 3ZTCB 3DRZA 4W9HH 1EOEA 2E31B 4W9LB 1FQVB 5H7HA 4BGCA 3HVEA 3HQIA 1A68A 1LQBB 3OGLA 4JTAB 4B95B 3ZRCB 2NZ0B 4W9JB 2VKPA 4HXIA 1R28A 2ASSA 4U2NA 4W9DB 2EQXA 1R29A 4UYIA 1QDVA 4UIJA 3E4UA 3BIMA 3KVTA 3B84A 4CXIA 4W9HB 2E32B 3FKCA 4HS2A 5EUPA 2C9WC 3GA1A 2IZVC 3M4TA 2MA9C 4W9FB 2I2RA
chains in the Genus database with same CATH superfamily
4FP7A 5G55A 4F1PA 5IBKA 2I9CA 2P1QA 1P22B 3FUJA 4XI0A 4HB5A 4GTSA 4V3IA 2MYOA 3UXGA 5T3RA 4I43A 1GW6A 3S7DA 2NC9A 1IXVA 4JC8A 2DYRE 3SO8A 2R03A 3HDXA 1TR4A 1W3BA 3C6NA 3ZUVB 2V4HC 2VYIA 4B9KE 2Y0BG 4OAUC 4GTMA 3ZN3A 1K1BA 1OWNA 2OVRA 4AWJB 1LM8C 3TWXA 3Q9UC 4AY6A 1A5EA 1SA5A 5H7GA 4DLQA 2FI7A 1RZ4A 4UWLA 3NB2A 3CHPA 4BKTB 1N95A 2YQ8A 2RD0A 3BU8A 5KJMA 3O4ZA 5D0QD 1MQSA 4ILIA 1N11A 1SQMA 2VQ2A 4L7TA 4TUUA 2QC9A 1MZCA 4CDRA 5CERB 5BV0A 5AQ9A 1V55E 3S7JA 4J7WA 4GPKA 4RSYA 5FWQA 1OT8A 4HLLA 4GA0A 2DVWA 3GW4A 2XENA 1NFIE 3CK7A 4HQDA 3FTSA 4ME2A 5ENTD 3D9HA 3CHRA 3L08A 3JQ1A 3NF1A 2YNQA 5JJTA 1E8YA 5BNWA 2FULA 4Q96A 3GYZA 1MX4A 4EECA 2GRMA 3FUFA 3RO2A 3PZDA 4IRUA 1S70B 4GA2A 3MYVA 2UWJG 5KNGA 3Q4AB 3ZGQA 2GROB 2I2OA 5EILA 2C2LA 4BT8A 4XKCA 2WPVA 1DNPA 4XI9A 2YHEA 2BEDA 2H6IA 5D66A 2VSNA 1G3NB 3TWSA 3PE3A 1N54A 4I9EA 3BUAA 4ZFHA 2XPIA 4FU3A 4YNDA 2CFZA 4LUNU 4BTBA 3M5BA 3PUJA 3AG1E 4EZJA 3L13A 3C72A 5ANRA 2LXLA 5C2YA 5DAFA 5JMND 4XE0A 1SA4A 4BX9A 4L23A 2Q7FA 4N9F5 1L5JA 5ENOD 2WVIA 1UOHA 3SBTB 3LEWA 4TXQA 4UWFA 2I1KA 4G23A 4GMJA 4F1SA 5B3SE 3ZRCB 4OVVA 1HZ4A 4C0EA 2HM8A 3FTUA 3PUKA 5CHEE 3SBSA 1QNFA 5M72A 4UQYA 3IBEA 5CECB 2X38A 5CEDB 1Q2ZA 4GYYA 1TN7A 4N2SA 2C9WC 2I2RA 4B93B 3DSVA 3T8MA 3ZKJA 3HTMA 1YYHA 2Y4TA 4ACLA 2PQNA 2XZTG 4U2MA 3ZFWA 4GYOA 3WXXA 3FUKA 4AP2A 4HI9A 4HOTA 3C3RA 4UWKA 2WXPA 2P9SG 2R59A 3CHQA 2H6GA 4AVXA 4UI9K 4CYMD 4WUYA 2P1NA 3LYAA 2I6HA 3I5PA 5E75A 3MKSA 2CFUA 5A6CA 2XPYA 3APFA 4FULA 4HRMB 3AG2E 3S2AA 4W9EB 4CXJA 2DIWA 5ENSD 3CVWA 1N9AA 2V5FA 4JD2G 2GRQB 4ANVA 2WXFA 3GZSA 3ZKJB 4IN3B 4TUMA 2OEWA 4KMOA 4J8YA 1PAQA 4LEUA 4U0ZA 3QKYA 1IHBA 4CGVA 4DUIA 3B13A 1EOEA 3CHSA 3L17A 2XS8A 3QARA 2H6FA 2KCLA 3VTXA 1SVXA 2VKPA 4H7XA 2WM9A 2DZOA 4O60A 4CXIA 2M63A 3AJIA 3ULQA 4CRWA 3G2UA 5EIBE 5EUPA 3IV0A 4E6HA 2E0IA 5ENPD 2PZIA 2MA9C 2AVPA 4YDOA 1QQEA 3NOCD 3L22A 2CG2A 3EIQC 3IXEA 3FDHA 4DX6D 1MJ0A 4XKBA 5A7DB 2IO3C 4IYPA 2P2CP 2X6JA 3RRMB 4ANUA 4CP3A 2HE0A 4L9PA 2XGOA 1EOFA 3ZXPA 5HI7A 1U2VG 4ANWA 5ENRD 3Q15A 3EHNA 3PZ3A 2FO1E 2L6JA 4CDNA 4EZKA 1N4RA 2XGMA 4WNDA 2P9LG 3UIPC 3HXCA 4YDWA 2IFUA 4U04A 3G2WA 3U9WA 2GW1A 3APCA 4C0MA 3R7QA 4DI4A 3SI5A 4DX1A 5HYWB 5AQAA 1O5MA 4U8YD 1LDKD 1TNOA 2CHXA 3BG1B 1QDWA 3CVYA 3HYMB 4CGWA 1EODA 4JTDB 5HS0A 4A3TA 3Q78A 1JCRA 1E8XA 4D10C 2WXQA 1IHGA 3AU5A 1BPOA 4B8CB 3FU5A 3RRNB 3VLDA 2Y1LE 3FHEA 1R29A 2PM7A 4I2ZA 2WXIA 3E30A 5HKPA 1FT1A 3Q73A 4JEUA 3MV3B 3B7SA 3FP3A 2QYUA 3RO3A 3L16A 2XCBA 3MZLB 3M4TA 3FEXA 3DPYA 1AWCB 4C9BB 3PNTB 1HS6A 5FT9A 2VPKA 4W9CB 3FH8A 5FTPA 1WY6A 4HLEA 3MJWA 1JUQA 3C98A 3VLFA 1H2UA 4FHKA 3WG7E 1HXIA 3E37A 4I6GA 3ZHEA 2LAIA 1N4SA 3VTYA 4G11A 2XGSA 4GPMA 4TXPA 5AARA 1E7UA 2WMOA 4ATGA 4Y6WA 2MHKA 4BSZB 3D9OA 2RKKA 4L2LA 3UX4A 2OVQA 4JL0A 1X5BA 2X6IA 3V2OA 2IQCA 2IO2C 3CK8A 3VLEA 4WWPA 3TWVA 4I9CA 3I3NA 1Z3YA 4XIFA 3FTXA 3QAQA 2CHWA 4KT6B 3QC1A 4W9HH 3MKRA 5KJNA 3MCXA 2OVBA 3ONLA 3DWLG 3QK0A 4UI9J 4G25A 3D3MA 3UT8A 1IKND 3ZHEB 1EPUA 2LNIA 4KXKB 3LY7A 2VGEA 3G2SA 3ZYMA 3CHOA 5CMWA 2B0OE 4OYSA 4YDEA 2OEVA 5EYLA 5EN5D 5EIDA 4EBAG 3TGOA 2E32B 4BERA 1LD8A 2R05A 2L6BA 1DC2A 1OWOA 3ENEA 5AQBA 3EUVA 3S7FA 1TJFA 3T5XA 5AJDA 2VGYA 3QJZA 1JWGA 1BLXB 2JABA 4DI3A 4EPZA 5LP0A 3BEEA 3FTVA 5G04J 4I2WA 5EYPF 4J8SA 2EINE 4KYOB 2PL2A 3MGBA 3R9MA 2C0MA 2VSYA 3ZXSA 2V5QC 4LNBA 5ENNA 3IHVA 2MRIA 3O48A 3ZYKA 4AJYC 3JQ0A 3CVXA 2NSZA 4I6EA 2NN2A 2IEJA 4W9KB 3D9MA 5LOZA 2WXKA 4DLOA 3TWUA 3Q7FA 4NIKA 2BUGA 1S1GA 2YINA 3F6QA 2PM6A 4HOQA 3ABME 3UQ3A 2IONA 1K3ZD 4RG6A 3D9NA 2DCPA 3EHRA 3FTYA 3C3OA 3J5PA 4U8VD 3HU6A 3TWRA 5BT1A 3ZRFB 2J4DA 4FLHA 5FZSA 1HV2A 3TL5A 3QWVA 2P9PG 2LSUA 2A79B 1R2BA 3LNMB 2X6HA 1ELWA 3RAUA 1QYMA 2X6KA 4FADA 4G2VA 3HVEA 1E96B 2NZ0B 1TN8A 3D9LA 4UWGA 3SD5A 3CVLA 4K5BA 4GZ3A 5BV1A 2JEKA 3E4UA 1LTXA 3SGHA 5B1AE 4W9HB 3UM3A 2BKKB 3TXMA 3EU9A 2FBNA 4HS2A 4AJWA 4GTVA 5J90A 3MEKA 2WQ6A 4OAVB 3JXIA 3NOGD 1BU9A 4YVQC 1UG3A 3RKVA 3V2XA 1BI7B 2BKGA 1N4QA 3LCAA 1EF1C 3OXFA 4I17A 1HFAA 4KZ0A 1QZ2A 3SZ7A 3LUTB 2AW6A 5CEAA 5BO4C 5FINA 4WWOA 4JZYA 4CXTA 2E2EA 1NZNA 3HVEB 3T9KA 3AS4A 4CT4A 3CVQA 1CS3A 2H6HA 1D9SA 4MS6A 3ONKA 5AN8A 3ZTDB 4F7AA 3ASHA 1JCSA 4JHRA 3FUIA 4YY8A 2WXLA 3AAAC 1HU3A 3PZ2A 3TG4A 2ONDA 2KATA 1INZA 2XRZA 4JHKA 3ZRHA 5FTAA 1OY3D 4CZ2D 4HOSA 4LSZE 4U77A 3KD7A 3LKUA 4N3CA 4J8ZA 2OOEA 3CSTA 1OUVA 4EOZA 3SHFA 3LY9A 3Q5MA 4BT9A 2Y4UA 1QBQA 3UMVA 1UJJA 2ASSA 4W9DB 1TNUA 3KS2A 1UN8A 1QDVA 1H0AA 3ZVVA 1D8DA 1OCZE 1E8ZA 2ETAA 3LPZA 5AAOA 4GZ5A 3HIZA 4WNFA 3CHMA 4WNGA 2ZGDA 3DSTA 2KBXA 1NI1A 3AU4A 2XEEA 1V54E 3OGMA 1YCSB 3DEPA 4J8DA 2WQHA 4GTOA 4H7YA 4N5QA 4A3VA 4N3AA 4A55A 5BXUA 5ENQD 2VSXE 4B0ZA 1S63A 4FJYA 4YDYA 2I1JA 3NZUA 2GGFA 4U07A 4L1BA 5FQ8A 4I1AA 4GZ6A 4LNUD 4MBGA 3PDNA 1BUOA 2Y69E 3D9JA 3UI2A 3ML9A 3NBNB 3UINC 5AQ7A 3G2TA 1OCCE 2ZGGA 2WQ7A 1WAO1 2P1MA 3CQGB 2R02A 3ZU7B 5FJYA 1U3DA 4I6JC 1TNYA 3U66A 2VSOE 2XZDG 4LCTA 1N4PA 5BPPA 2Z8HA 3MKQA 2DWZA 2XRYA 3HG0D 4WWNA 2E31B 2R17C 2KM4A 2WXMA 4B95B 3AS5A 4DX5D 3UIOC 4G26A 4JHJA 3CVNA 3IHYA 4W9RA 1SW6A 5DIZA 3CIAA 3LXUX 4UIJA 4RG9A 4DPRA 3BIMA 3Q47B 3UKUG 4A1SA 1O1RA 1KZOA 3FKCA 1FCHA 2HO1A 2XPZA 4GA1A 3GA1A 2IZVC 1VDYA 4BX8A 4U0UA 2L0TB 2A5EA 3TWWA 4AOFA 4G1TA 3SY2A 1O1SA 4RLYA 5HZGC 3MKQB 3EIJA 2AWIA 2GRRB 4U96D 3PE4A 4LERA 4RQIA 4YVOA 4F6RD 4GB9A 2WXHA 5AJLA 2LO6A 5LCWJ 4B9KB 3OHVA 2A5UA 1UN9A 1XGWA 1S64A 1DCQA 4JPSA 2R5SA 4AV7A 1HO8A 3E33A 2IHCA 2XS1A 5A15A 4GYWA 4FJZA 3ASGA 4CRHA 1HF8A 4CT0A 4JTCB 1EXBE 5E76A 3FH7A 3FUHA 5KBAA 4EQFA 3G2VA 4UWHA 4ANXA 5T4YA 5T8IA 3EJNA 4GTRA 5BXOA 3DRXA 4BSXA 3X2QE 4BESA 3ZW3A 3C3QA 1H19A 2F37A 2JZ3C 2J4BA 3JYSA 3EDTB 3ZNGA 5KNHD 4U0SA 2X6FA 4W9LB 1FQVB 5JHBA 3LDZA 3W9FA 3HXDA 1SZ9A 1WG0A 4UQZA 4ILHB 3U64A 1R28A 4U2NA 3KSQA 4AY5A 1H2TC 3IKOB 3KVTA 2J07A 3ZEFA 2PNNA 3V31A 3DBSA 2KC7A 3UTMA 5CBOA 2ETBA 5AENA 3HXEA 3ZYQA 4GCNA 4W9IB 2HYZA 4G24A 3OAWA 3OTNA 1NL4A 4KBQA 2B6CA 3ZNGB 3CLJA 5AIJA 3ABLE 3D9PA 2JLBA 4FHJA 4IULA 4GTQA 4K5CA 1LD7A 3B7RL 3ASNE 3MA5A 2FO7A 4W9GB 1MHQA 5H7PA 3UT7A 2ETCA 1HH8A 2P1OA 3ZPJA 2LUHA 1E90A 4ZHBA 3FY4A 2L0IA 5HRYA 3APDA 4PUCA 3LS8A 3ZYLA 2ZU6B 2F8XK 3B7BA 4ATZD 2J49A 5CRVA 3B7UX 2ZISA 1JPLA 5C1DA 3V30A 4GTPA 4B89A 3ZTCB 4GU5A 3PNLB 1MX2A 2VTBA 1S0PA 4HNAD 3KEZA 4MLPA 5H7HA 3BQOA 3SNXA 3OGLA 4E85A 4I1OB 5FQ6A 1DCEA 3OXGA 1XNFA 4M3OA 5ANLA 3QOUA 1KT0A 2OCCE 1FPPA 4GAAA 2WMNA 4CCAA 4HRLA 1Z6TA 3FH5A 4LRZA 3URZA 3DCGB 4WAFA 1BI8B 4XZ4A 3QWWA 4U7EB 3R9AB 3ABKE 5FZRA 3RRUA 4B8AA 1H6PA 4EZLA 5FZQA 4HORA 2P9UG 2XEVA 2Q81A 1X81A 3PVLA 3U4TA 2P1PA 4QQIA 5DADA 4PS7A 3L82A 2XQ0A 3SFYA 4F3VA 5EKQD 3FWVA 4O6FA 2RFAA 4JGHC 1ZU2A 5EDSA 3C6PA 2IOSA 2PQRA 2LSVA 5BUZA 3JCKC 1FVFA 1DSXA 3DXKG 4EHMA 3SFXA 2F0YA 1AP7A 3DXMG 1TYQG 3TWTA 3DRYA 2WXJA 3C6OA 3S7BA 3DRZA 4WNEA 4BEPA 3NQPA 2BTDA 5D0OD 1HG2A 5LFAA 1WDYA 3ISMC 4JXTA 1DVPA 3MV2B 2AXZA 3ZIMA 3B84A 4HI8A 3Q79A 4JEHA 1Y6IA 5ARGA 3NAWA 3FUMA 1N0RA 3T8KA 3E32A 2V0PA 5FIOA 3FEYA 1HE8A 4UUCA 2L9BA 4UI9C 2DYSE 3L6AA 3LJ3A 4FC8A 2QYJA 5KWDA 1K8KG 4R7LA 2KCKA 3DSSA 2YHCA 3M8VA 4N2QA 3J5QB 3KSLA 3L9TA 3N71A 3UPVA 2J9QA 4O1OA 4C48B 3SF4A 2LXMA 3CVVA 4GZCA 1OWLA 2VGXA 4P29A 3Q9NC 5G04C 3FFLA 1TNBA 5CBNA 5EX3A 3K9IA 4NURA 3FU3A 3E34A 3QDNA 5JJ7A 2R9RB 2XHEA 2YY9A 3QWPA 2CHZA 4EBAA 2XEHA 3CEQA 3M52A 1OCOE 3ULEG 4GMLA 4OVUA 4DX2A 3KEAA 5D2MC 4AM9A 3DEOA 1JWFA 3LVQE 5FQ7A 5IY5E 4U8HA 4XEIG 3EHMA 1HG5A 2OVFA 5AYWD 1A68A 1LQBB 3L54A 2GRPB 2VGXB 1TJCA 5CCLA 3UKRG 2QFCA 4UYIA 3C5RA 1H2VC 2C0LA 5EX0A 2BF0X 5ARFA 2ILRA 2VJ8A 1YA0A 4HOUA 4PH4B 3TJPA 3CQCB 4KVMA 2J8SD 5DBKA 1K1AA 3FTZA 5CMYA 2EIKE 3EHQA 1T1DA 1YMPA 5LX8A 4NQ0A 1OXJA 3CKBA 2AXUA 1Y8MA 3OHUA 4K5AB 2DBAA 3ZUNB 1MYOA 3DSUA 4XX5A 1SZAA 5KJLA 4BKSB 3PS6A 4BTAA 4X8QA 2UY1A 1FT2A 5J08A 3RSEG 3DSWA 2OVPA 2P9NG 3CGHA 1NA0A 3T5VA 5CCMA 3ASOE 1VCBB 1IQUA 3BG0B 5CRUA 3QB2A 3FUEA 3D9KA 5HQ8A 2XCCA 3PEVB 4AXHA 2F8YA 1LF8A 4KVOA 4BFRA 4JB8P 4DJAA 3V79K 2P9IG 2DZNA 3KAEA 3JXJA 2WXGA 3MX3A 4HRNA 4QFVA 4DK5A 4PS8A 3E4BA 3DRAA 2UY1B 3UM2A 4Q69A 1ZB1A 2FF4A 2RG8A 3CVUA 4G8KA 3IEGA 3PZ4A 3RIBA 4AEZC 2LAHA 3JUEA 1OWMA 3HXFA 2AJAA 3HHMA 1ELRA 4N5CA 3AS8A 4W9FB 3PH0C 4N39A 3PREA 1NN7A 4ABNA 4J0UA 3W9GA 4ZOUA 2EIME 4Y6CA 3TAXA 4F53A 1MX6A 1U3CA 2IF4A 3WSOB 3GZ2A 4ACKA 1NEXA 3LBZA 4LNGA 2IOLA 4APOA 4UQXA 3RJVA 2NYJA 3FUDA 4AIFA 4J6IA 3QNKA 4Q94A 2ZXWE 4JW1A 5BW8C 4URKA 3UM1A 1ZBPA 1KPSB 1Z5SC 4U95D 3DSXA 3FUNA 2Y3AA 5JH5B 5ITZF 1N0QA 3LVRE 3AG4E 5B1BE 3ML8A 4PDXA 4GMRA 1FVHA 2CG3A 4PS3A 5FQ4A 2RFMA 3EU5A 1N94A 2P58C 4N3BA 4K03A 2EILE 2IY0C 5KCMA 2HR2A 3Q49B 2ZIRA 4HXIA 5G05J 4ZGCA 3R7RA 4DX7D 2AXVA 4HFGA 3CSFA 4DRXE 3P2BA 4U63A 3DPDA 5G2NA 1O1TA 2KZTA 4FA6A 3PEUB 1UJKA 1BD8A 1KT1A 3L2OA 2EIJE 1H6OA 2IF5A 1TN6A 1P5QA 2GRLA 3D9IA 3TXNA 1RW2A 3FULA 2FEZA 1EYHA 2PPIA 3LJNA 1N52A 3B7TA 3OXLA 2WXNA 4TRQA 2FNJC 1WM5A 3I4GA 3TG5A 1D8EA 3FU0A 3SFZA 1E8WA 4M7CA 4G8LA 2V4LA 5BXDA 4GTTA 2IU1A 3RK6A 5LCWC 2NXPA 4BWRA 2KZTB 3I4RB 1PC2A 4APFA 3UUXA 5BXHA 3CKCA 3Q7AA 1UW4B 4BETA 3Q75A 4HVBA 4HBDA 4CEMA 3ULYA 3UT4A 2P9KG 1FS1B 3GZ1A 3RU0A 4WQOC 1IYGA 4Z68A 3ESLA 4BGCA 4CDMA 4J8EA 4JTAB 5JJ6A 4J8FA 4JVSA 5G05C 3AG3E 2J08A 1KZPA 5A23A 4ILGA 5JA4D 2KCVA 2WXOA 2MOWA 3HRAA 4L2YA 2X3MA 4I1MA 1NA3A 4TV3A 1IQRA 3HXBA 1HX8A 4FLBA 3ASDA 1FS2B 2WB2A 3P1UA 1Z3XA 4NACA 2OV8A 3UM0A 4B94A 1H6KA 4TXRA 3B95A 2IJGX 4NRHB 2WXRA 1TNZA 3TWQA 4BY6A 2ASTA 4A1GA 3CK9A 2KXPC 3ESKA 1A17A 5LLIB 3FTWA 4RVBA 3FU6A 3JUIA 4GCOA 2GRNB 2V8SE 2VTBB 3CR3A 5A6RA 2R2LA 4GZDA 4JA9A 3SQVA 3OGKA 4K0RA 4KZCA 3V7DA 5BXBA 1EDUA 4A63B 1PY1A 3PZ1A 5JHAA 2QY7A 1OCRE 3ASFA 4JA7A 1KLXA 3NZSA 3U3WA 4O1PA 3HQIA 3LY8A 4W9JB 1OWPA 4MRUA 1E7VA 2EQXA 4MKTA 4I6JA 1NP7A 2A4ZA 3CV0A 2J09A 3CVPA 4LG6A 3PRZA 1ELKA 1B89A 5KJKA 1TEZA 2QZAA 1JCQA
chains in the Genus database with same CATH topology
3FTZA 3FEXA 1VDYA 4FP7A 5CMYA 4U0UA 4BX8A 4C9BB 5G55A 2L0TB 1T1DA 5IBKA 3PNTB 4AOFA 2I9CA 2P1QA 4G1TA 5LX8A 1P22B 1HS6A 4NQ0A 3CKBA 3FUJA 4XI0A 2AXUA 5FT9A 1Y8MA 3OHUA 4V3IA 2DBAA 5HZGC 3ZUNB 3MKQB 2VPKA 4XX5A 3FH8A 5FTPA 3EIJA 1WY6A 4W9CB 5T3RA 4I43A 1GW6A 2AWIA 3S7DA 4HLEA 3MJWA 3PE4A 1JUQA 1SZAA 2NC9A 3C98A 4LERA 5KJLA 4JC8A 4BKSB 3VLFA 3PS6A 4YVOA 4BTAA 1H2UA 4GB9A 4FHKA 2WXHA 3HDXA 5AJLA 2LO6A 5LCWJ 1W3BA 2UY1A 3C6NA 1HXIA 5J08A 4B9KB 4I6GA 3OHVA 2A5UA 1UN9A 1XGWA 2VYIA 3ZHEA 2LAIA 4JPSA 3VTYA 4B9KE 2R5SA 4G11A 2XGSA 4AV7A 2OVPA 1HO8A 2IHCA 1E7UA 3CGHA 2WMOA 3ZN3A 4ATGA 5A15A 1NA0A 4GYWA 4Y6WA 2MHKA 3T5VA 4FJZA 1OWNA 3ASGA 5CCMA 4CRHA 1HF8A 3D9OA 4CT0A 2OVRA 4AWJB 1VCBB 1IQUA 3BG0B 1LM8C 4JTCB 1EXBE 5E76A 3QB2A 3FH7A 3FUEA 3FUHA 4L2LA 4EQFA 3D9KA 3UX4A 4JL0A 3G2VA 4UWHA 2XCCA 4ANXA 5HQ8A 2OVQA 1X5BA 5T4YA 5T8IA 3PEVB 4AY6A 4AXHA 3EJNA 5H7GA 4DLQA 2FI7A 3DRXA 2X6IA 4BSXA 4UWLA 1LF8A 4KVOA 4BFRA 2IQCA 3CK8A 3VLEA 4DJAA 3CHPA 4BKTB 3ZW3A 2YQ8A 2RD0A 3KAEA 4WWPA 5KJMA 1H19A 3O4ZA 4I9CA 1MQSA 4ILIA 5D0QD 2JZ3C 2J4BA 1SQMA 2VQ2A 2WXGA 3I3NA 3MX3A 4L7TA 4TUUA 1Z3YA 4XIFA 3FTXA 4CDRA 3QAQA 2CHWA 3JYSA 3EDTB 4KT6B 5BV0A 3QC1A 4W9HH 4U0SA 3MKRA 3S7JA 2X6FA 5KJNA 4W9LB 4QFVA 4DK5A 5JHBA 1FQVB 4PS8A 3MCXA 2OVBA 4GPKA 3E4BA 3ONLA 4RSYA 5FWQA 3QK0A 2UY1B 3LDZA 4UI9J 4Q69A 4G25A 3D3MA 1SZ9A 4UQZA 3UT8A 4ILHB 4GA0A 2FF4A 1EPUA 2LNIA 4KXKB 3U64A 3ZHEB 3LY7A 1R28A 4U2NA 3G2SA 2RG8A 3CHOA 3ZYMA 5CMWA 3GW4A 3CVUA 4AY5A 3IEGA 4OYSA 1H2TC 3RIBA 4AEZC 4EBAG 3CK7A 3IKOB 3KVTA 2J07A 2LAHA 3TGOA 2E32B 3FTSA 3ZEFA 1OWMA 4ME2A 1OWOA 3ENEA 3DBSA 3CHRA 3HHMA 3S7FA 1TJFA 2KC7A 3L08A 3JQ1A 3NF1A 3T5XA 1ELRA 5AJDA 2YNQA 2VGYA 3QJZA 1JWGA 4N5CA 3AS8A 5AENA 5JJTA 4W9FB 1E8YA 3PH0C 5BNWA 4N39A 2FULA 3PREA 4Q96A 1NN7A 3ZYQA 4DI3A 4EPZA 5LP0A 3BEEA 4ABNA 4J0UA 3FTVA 3GYZA 4GCNA 5G04J 4ZOUA 4I2WA 4W9IB 4EECA 2HYZA 4G24A 4J8SA 2GRMA 3FUFA 4Y6CA 3RO2A 3OAWA 4KYOB 2PL2A 3PZDA 4IRUA 4GA2A 3MGBA 3MYVA 3TAXA 2UWJG 2C0MA 2VSYA 3ZXSA 3OTNA 4KBQA 3ZNGB 5ENNA 3CLJA 3IHVA 2MRIA 5AIJA 4F53A 3O48A 3D9PA 2JLBA 3ZYKA 4AJYC 4FHJA 1U3CA 3JQ0A 3CVXA 2IF4A 3Q4AB 3WSOB 3ZGQA 4IULA 2I2OA 2NSZA 4BT8A 2C2LA 3GZ2A 4ACKA 4XKCA 2WPVA 1DNPA 1NEXA 2YY9A 4I6EA 4XI9A 2YHEA 2NN2A 3LBZA 4W9KB 2IOLA 3D9MA 4APOA 4UQXA 3RJVA 3B7RL 5LOZA 3MA5A 2WXKA 2FO7A 4W9GB 3FUDA 2VSNA 4AIFA 4J6IA 1MHQA 3UT7A 3QNKA 4Q94A 4DLOA 1HH8A 2P1OA 3PE3A 4JW1A 5BW8C 4URKA 1N54A 2BUGA 3ZPJA 2YINA 4I9EA 1S1GA 2PM6A 4HOQA 1ZBPA 1E90A 2XPIA 4FU3A 3UQ3A 2CFZA 2IONA 2L0IA 3FY4A 4LUNU 4YNDA 3PUJA 4BTBA 4RG6A 3M5BA 3D9NA 3FUNA 2DCPA 2Y3AA 3APDA 3FTYA 5JH5B 4PUCA 4EZJA 3LS8A 3L13A 3ZYLA 3HU6A 5ANRA 3LVRE 5C2YA 5BT1A 2ZU6B 3ZRFB 5DAFA 3ML8A 2J4DA 4PDXA 4XE0A 4FLHA 4N9F5 4BX9A 4L23A 2Q7FA 1FVHA 1L5JA 5FZSA 1HV2A 3TL5A 2CG3A 2J49A 3B7UX 3QWVA 2WVIA 2LSUA 2A79B 1R2BA 4PS3A 3LNMB 5FQ4A 1JPLA 3SBTB 3LEWA 5C1DA 2P58C 2X6HA 4B89A 4N3BA 3ZTCB 4K03A 4GU5A 3PNLB 4UWFA 2VTBA 1ELWA 1S0PA 2I1KA 2X6KA 4FADA 3KEZA 4MLPA 4G2VA 5H7HA 5KCMA 2HR2A 3Q49B 3HVEA 4G23A 1E96B 4GMJA 3SNXA 4F1SA 3OGLA 3ZRCB 2NZ0B 4OVVA 3D9LA 1HZ4A 4C0EA 4E85A 4HXIA 4UWGA 2HM8A 3SD5A 3FTUA 3PUKA 5CHEE 3SBSA 5G05J 3CVLA 4I1OB 4GZ3A 1QNFA 4ZGCA 5BV1A 2JEKA 5FQ6A 3R7RA 5M72A 3E4UA 3SGHA 3OXGA 2AXVA 1XNFA 4UQYA 4W9HB 4M3OA 5ANLA 3QOUA 3TXMA 3IBEA 4HFGA 1KT0A 3CSFA 3P2BA 4U63A 2FBNA 2X38A 4GAAA 4HS2A 2WMNA 4AJWA 3DPDA 4GYYA 4CCAA 4N2SA 5G2NA 5J90A 1Z6TA 3FH5A 3MEKA 4LRZA 3URZA 2WQ6A 2C9WC 2I2RA 3DCGB 4WAFA 4YVQC 3T8MA 1UG3A 3HTMA 2Y4TA 3RKVA 2KZTA 4FA6A 4ACLA 4XZ4A 3PEUB 3QWWA 3R9AB 2PQNA 3LCAA 1EF1C 3OXFA 4I17A 1HFAA 4KZ0A 1QZ2A 5FZRA 4U2MA 1UJKA 3ZFWA 4GYOA 3SZ7A 3WXXA 3FUKA 4AP2A 3LUTB 1KT1A 2AW6A 5BO4C 3RRUA 4B8AA 4HOTA 3L2OA 4UWKA 2WXPA 4EZLA 4WWOA 2R59A 5FZQA 3CHQA 4JZYA 4HORA 2IF5A 4CXTA 2E2EA 2XEVA 2Q81A 1P5QA 4AVXA 2GRLA 4UI9K 3D9IA 1NZNA 3HVEB 3TXNA 3PVLA 4WUYA 3U4TA 3AS4A 2P1NA 4CT4A 3LYAA 2P1PA 3FULA 3CVQA 5DADA 1CS3A 4PS7A 2I6HA 4MS6A 3ONKA 2FEZA 1EYHA 2PPIA 2XQ0A 3I5PA 4F3VA 3ZTDB 5EKQD 5E75A 3FWVA 4F7AA 2CFUA 1N52A 3ASHA 3MKSA 3B7TA 2XPYA 2WXNA 3APFA 3OXLA 4O6FA 4TRQA 5A6CA 4FULA 4JHRA 2FNJC 3FUIA 4JGHC 1WM5A 3I4GA 4YY8A 2WXLA 1ZU2A 3S2AA 1HU3A 3TG5A 4W9EB 4CXJA 2DIWA 3FU0A 3SFZA 3TG4A 5EDSA 1E8WA 2ONDA 3CVWA 3C6PA 2IOSA 2KATA 2PQRA 2V5FA 1INZA 2XRZA 2LSVA 2V4LA 5BXDA 2IU1A 4JHKA 3ZRHA 4ANVA 5FTAA 2WXFA 3RK6A 5BUZA 2NXPA 3GZSA 5LCWC 3JCKC 3ZKJB 4BWRA 1FVFA 2KZTB 3I4RB 1PC2A 4IN3B 3UUXA 4APFA 5BXHA 1DSXA 4HOSA 3CKCA 1UW4B 4KMOA 4HVBA 1PAQA 4LEUA 4U77A 3KD7A 3LKUA 4CEMA 4U0ZA 4N3CA 3QKYA 2OOEA 4J8ZA 4CGVA 3CSTA 3UT4A 1OUVA 2WXJA 3DRYA 3C6OA 3B13A 3SHFA 1FS1B 3GZ1A 3RU0A 3S7BA 4WQOC 4EOZA 3LY9A 3DRZA 3Q5MA 4WNEA 1EOEA 4BT9A 1IYGA 2Y4UA 3CHSA 3ESLA 3NQPA 3L17A 4BGCA 4CDMA 3QARA 2BTDA 4J8EA 3UMVA 2KCLA 3VTXA 4JTAB 5D0OD 1UJJA 5JJ6A 4H7XA 1HG2A 4J8FA 4JVSA 2ASSA 2VKPA 4W9DB 3KS2A 2WM9A 5G05C 5LFAA 2J08A 4JXTA 1UN8A 1DVPA 3MV2B 1QDVA 5A23A 1H0AA 2AXZA 3ZVVA 3ZIMA 3B84A 1E8ZA 4ILGA 4CXIA 2KCVA 1Y6IA 2M63A 2WXOA 3LPZA 4JEHA 2MOWA 5ARGA 4GZ5A 3ULQA 3HIZA 4CRWA 3G2UA 4WNFA 4L2YA 3FUMA 5EUPA 3CHMA 2X3MA 4WNGA 3IV0A 4I1MA 2V0PA 4E6HA 3AU4A 1NA3A 3FEYA 2E0IA 2PZIA 1IQRA 1HE8A 4TV3A 2L9BA 4UI9C 2MA9C 2AVPA 3L6AA 3LJ3A 4FC8A 1HX8A 3OGMA 1QQEA 4FLBA 3L22A 2CG2A 4J8DA 2WQHA 3EIQC 4H7YA 4R7LA 3FDHA 3ASDA 1FS2B 4XKBA 4A3VA 5A7DB 4N3AA 2KCKA 4IYPA 2WB2A 3P1UA 4A55A 1Z3XA 4NACA 2X6JA 2OV8A 2YHCA 3RRMB 2VSXE 4B0ZA 4B94A 4ANUA 3M8VA 1H6KA 4CP3A 2XGOA 4N2QA 4FJYA 1EOFA 3N71A 2I1JA 3UPVA 2J9QA 5HI7A 2IJGX 4NRHB 3SF4A 2WXRA 4ANWA 3CVVA 3NZUA 4GZCA 2GGFA 4BY6A 1OWLA 4U07A 4L1BA 2VGXA 3Q15A 2ASTA 4P29A 3EHNA 4A1GA 5G04C 5FQ8A 3FFLA 4I1AA 3CK9A 2L6JA 3ESKA 4GZ6A 1A17A 5LLIB 3FTWA 3PDNA 1BUOA 4RVBA 3D9JA 5EX3A 4CDNA 3K9IA 4EZKA 3ML9A 3FU6A 2XGMA 3FU3A 4NURA 4WNDA 3JUIA 3QDNA 4GCOA 3G2TA 2V8SE 5JJ7A 2R9RB 2VTBB 3CR3A 2IFUA 5A6RA 4GZDA 2XHEA 4U04A 3G2WA 4JA9A 3OGKA 2WQ7A 1WAO1 4K0RA 3U9WA 2GW1A 3QWPA 2CHZA 3APCA 3CQGB 4KZCA 2P1MA 4C0MA 3V7DA 3R7QA 4DI4A 1EDUA 3SI5A 4EBAA 5BXBA 1PY1A 3CEQA 5HYWB 5FJYA 3M52A 1LDKD 2CHXA 1U3DA 4GMLA 4OVUA 3BG1B 1QDWA 4I6JC 3U66A 3CVYA 3HYMB 4CGWA 2VSOE 1EODA 4JTDB 5JHAA 4LCTA 2QY7A 4A3TA 5BPPA 4AM9A 2Z8HA 1JWFA 3LVQE 3MKQA 5FQ7A 4U8HA 2XRYA 3ASFA 3EHMA 4JA7A 1HG5A 4WWNA 1KLXA 2E31B 2R17C 3NZSA 2KM4A 1E8XA 2OVFA 3U3WA 4D10C 2WXMA 5AYWD 2WXQA 1IHGA 3AU5A 1A68A 1LQBB 3HQIA 3L54A 3LY8A 4B95B 1BPOA 3AS5A 4W9JB 4B8CB 3FU5A 1OWPA 4MRUA 2VGXB 3RRNB 3VLDA 1TJCA 3FHEA 1E7VA 2EQXA 4G26A 4JHJA 5CCLA 3CVNA 3IHYA 4MKTA 1R29A 4I6JA 4W9RA 2PM7A 2QFCA 1NP7A 4I2ZA 2WXIA 4UYIA 5DIZA 3CIAA 2A4ZA 1H2VC 2C0LA 3LXUX 4UIJA 3CV0A 4RG9A 4DPRA 2J09A 3CVPA 4JEUA 5EX0A 3BIMA 3Q47B 3MV3B 3PRZA 3B7SA 3FP3A 4A1SA 2BF0X 5ARFA 2ILRA 1ELKA 2VJ8A 1YA0A 4HOUA 3FKCA 1B89A 4PH4B 3RO3A 5KJKA 3L16A 2XCBA 3TJPA 1FCHA 3CQCB 4KVMA 3MZLB 2HO1A 2XPZA 4GA1A 1TEZA 3GA1A 5DBKA 2IZVC 3M4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCG B;  3HTM A;  3OGM A;  1T1D A;  5IBK A;  1NN7 A;  2P1Q A;  1P22 B;  4ZOU A;  4U2M A;  4W9I B;  3OHU A;  1FS2 B;  3LUT B;  4AP2 A;  5HZG C;  3ZUN B;  5BO4 C;  2VPK A;  3L2O A;  4W9C B;  3ZNG B;  2IF5 A;  4CP3 A;  3M8V A;  4CXT A;  4BKS B;  2Q81 A;  4AJY C;  3HVE B;  1EOF A;  3WSO B;  2P1N A;  2P1P A;  3C6N A;  5DAD A;  1CS3 A;  4B9K B;  3OHV A;  1NEX A;  2NN2 A;  2PPI A;  2AST A;  3LBZ A;  4W9K B;  4B9K E;  2OVP A;  3ZTD B;  3MKS A;  2IHC A;  5LLI B;  1BUO A;  4JGH C;  2FNJ C;  4W9G B;  5A15 A;  2P1O A;  4W9E B;  4CRH A;  2OVR A;  4AWJ B;  4CXJ A;  1VCB B;  3C6P A;  1LM8 C;  1S1G A;  4JTC B;  1EXB E;  2R9R B;  2OVQ A;  5A6R A;  5BXD A;  3M5B A;  3OGK A;  2YY9 A;  5FTA A;  5H7G A;  2P1M A;  5JH5 B;  3ZKJ B;  3V7D A;  5BXB A;  3HU6 A;  5BXH A;  4APF A;  1DSX A;  5HYW B;  3M52 A;  4BKT B;  3ZRF B;  5DAF A;  1LDK D;  4U77 A;  4N9F 5;  1QDW A;  4I6J C;  4J8Z A;  2JZ3 C;  1HV2 A;  1EOD A;  4JTD B;  3I3N A;  2A79 B;  1R2B A;  3LNM B;  2Z8H A;  3C6O A;  1FS1 B;  4EOZ A;  4WQO C;  3ZTC B;  3DRZ A;  4W9H H;  1EOE A;  2E31 B;  4W9L B;  1FQV B;  5H7H A;  4BGC A;  3HVE A;  3HQI A;  1A68 A;  1LQB B;  3OGL A;  4JTA B;  4B95 B;  3ZRC B;  2NZ0 B;  4W9J B;  2VKP A;  4HXI A;  1R28 A;  2ASS A;  4U2N A;  4W9D B;  2EQX A;  1R29 A;  4UYI A;  1QDV A;  4UIJ A;  3E4U A;  3BIM A;  3KVT A;  3B84 A;  4CXI A;  4W9H B;  2E32 B;  3FKC A;  4HS2 A;  5EUP A;  2C9W C;  3GA1 A;  2IZV C;  3M4T A;  2MA9 C;  4W9F B;  2I2R A; 
#chains in the Genus database with same CATH topology
 4FP7 A;  5G55 A;  4F1P A;  5IBK A;  2I9C A;  2P1Q A;  1P22 B;  3FUJ A;  4XI0 A;  4HB5 A;  4GTS A;  4V3I A;  2MYO A;  3UXG A;  5T3R A;  4I43 A;  1GW6 A;  3S7D A;  2NC9 A;  1IXV A;  4JC8 A;  2DYR E;  3SO8 A;  2R03 A;  3HDX A;  1TR4 A;  1W3B A;  3C6N A;  3ZUV B;  2V4H C;  2VYI A;  4B9K E;  2Y0B G;  4OAU C;  4GTM A;  3ZN3 A;  1K1B A;  1OWN A;  2OVR A;  4AWJ B;  1LM8 C;  3TWX A;  3Q9U C;  4AY6 A;  1A5E A;  1SA5 A;  5H7G A;  4DLQ A;  2FI7 A;  1RZ4 A;  4UWL A;  3NB2 A;  3CHP A;  4BKT B;  1N95 A;  2YQ8 A;  2RD0 A;  3BU8 A;  5KJM A;  3O4Z A;  5D0Q D;  1MQS A;  4ILI A;  1N11 A;  1SQM A;  2VQ2 A;  4L7T A;  4TUU A;  2QC9 A;  1MZC A;  4CDR A;  5CER B;  5BV0 A;  5AQ9 A;  1V55 E;  3S7J A;  4J7W A;  4GPK A;  4RSY A;  5FWQ A;  1OT8 A;  4HLL A;  4GA0 A;  2DVW A;  3GW4 A;  2XEN A;  1NFI E;  3CK7 A;  4HQD A;  3FTS A;  4ME2 A;  5ENT D;  3D9H A;  3CHR A;  3L08 A;  3JQ1 A;  3NF1 A;  2YNQ A;  5JJT A;  1E8Y A;  5BNW A;  2FUL A;  4Q96 A;  3GYZ A;  1MX4 A;  4EEC A;  2GRM A;  3FUF A;  3RO2 A;  3PZD A;  4IRU A;  1S70 B;  4GA2 A;  3MYV A;  2UWJ G;  5KNG A;  3Q4A B;  3ZGQ A;  2GRO B;  2I2O A;  5EIL A;  2C2L A;  4BT8 A;  4XKC A;  2WPV A;  1DNP A;  4XI9 A;  2YHE A;  2BED A;  2H6I A;  5D66 A;  2VSN A;  1G3N B;  3TWS A;  3PE3 A;  1N54 A;  4I9E A;  3BUA A;  4ZFH A;  2XPI A;  4FU3 A;  4YND A;  2CFZ A;  4LUN U;  4BTB A;  3M5B A;  3PUJ A;  3AG1 E;  4EZJ A;  3L13 A;  3C72 A;  5ANR A;  2LXL A;  5C2Y A;  5DAF A;  5JMN D;  4XE0 A;  1SA4 A;  4BX9 A;  4L23 A;  2Q7F A;  4N9F 5;  1L5J A;  5ENO D;  2WVI A;  1UOH A;  3SBT B;  3LEW A;  4TXQ A;  4UWF A;  2I1K A;  4G23 A;  4GMJ A;  4F1S A;  5B3S E;  3ZRC B;  4OVV A;  1HZ4 A;  4C0E A;  2HM8 A;  3FTU A;  3PUK A;  5CHE E;  3SBS A;  1QNF A;  5M72 A;  4UQY A;  3IBE A;  5CEC B;  2X38 A;  5CED B;  1Q2Z A;  4GYY A;  1TN7 A;  4N2S A;  2C9W C;  2I2R A;  4B93 B;  3DSV A;  3T8M A;  3ZKJ A;  3HTM A;  1YYH A;  2Y4T A;  4ACL A;  2PQN A;  2XZT G;  4U2M A;  3ZFW A;  4GYO A;  3WXX A;  3FUK A;  4AP2 A;  4HI9 A;  4HOT A;  3C3R A;  4UWK A;  2WXP A;  2P9S G;  2R59 A;  3CHQ A;  2H6G A;  4AVX A;  4UI9 K;  4CYM D;  4WUY A;  2P1N A;  3LYA A;  2I6H A;  3I5P A;  5E75 A;  3MKS A;  2CFU A;  5A6C A;  2XPY A;  3APF A;  4FUL A;  4HRM B;  3AG2 E;  3S2A A;  4W9E B;  4CXJ A;  2DIW A;  5ENS D;  3CVW A;  1N9A A;  2V5F A;  4JD2 G;  2GRQ B;  4ANV A;  2WXF A;  3GZS A;  3ZKJ B;  4IN3 B;  4TUM A;  2OEW A;  4KMO A;  4J8Y A;  1PAQ A;  4LEU A;  4U0Z A;  3QKY A;  1IHB A;  4CGV A;  4DUI A;  3B13 A;  1EOE A;  3CHS A;  3L17 A;  2XS8 A;  3QAR A;  2H6F A;  2KCL A;  3VTX A;  1SVX A;  2VKP A;  4H7X A;  2WM9 A;  2DZO A;  4O60 A;  4CXI A;  2M63 A;  3AJI A;  3ULQ A;  4CRW A;  3G2U A;  5EIB E;  5EUP A;  3IV0 A;  4E6H A;  2E0I A;  5ENP D;  2PZI A;  2MA9 C;  2AVP A;  4YDO A;  1QQE A;  3NOC D;  3L22 A;  2CG2 A;  3EIQ C;  3IXE A;  3FDH A;  4DX6 D;  1MJ0 A;  4XKB A;  5A7D B;  2IO3 C;  4IYP A;  2P2C P;  2X6J A;  3RRM B;  4ANU A;  4CP3 A;  2HE0 A;  4L9P A;  2XGO A;  1EOF A;  3ZXP A;  5HI7 A;  1U2V G;  4ANW A;  5ENR D;  3Q15 A;  3EHN A;  3PZ3 A;  2FO1 E;  2L6J A;  4CDN A;  4EZK A;  1N4R A;  2XGM A;  4WND A;  2P9L G;  3UIP C;  3HXC A;  4YDW A;  2IFU A;  4U04 A;  3G2W A;  3U9W A;  2GW1 A;  3APC A;  4C0M A;  3R7Q A;  4DI4 A;  3SI5 A;  4DX1 A;  5HYW B;  5AQA A;  1O5M A;  4U8Y D;  1LDK D;  1TNO A;  2CHX A;  3BG1 B;  1QDW A;  3CVY A;  3HYM B;  4CGW A;  1EOD A;  4JTD B;  5HS0 A;  4A3T A;  3Q78 A;  1JCR A;  1E8X A;  4D10 C;  2WXQ A;  1IHG A;  3AU5 A;  1BPO A;  4B8C B;  3FU5 A;  3RRN B;  3VLD A;  2Y1L E;  3FHE A;  1R29 A;  2PM7 A;  4I2Z A;  2WXI A;  3E30 A;  5HKP A;  1FT1 A;  3Q73 A;  4JEU A;  3MV3 B;  3B7S A;  3FP3 A;  2QYU A;  3RO3 A;  3L16 A;  2XCB A;  3MZL B;  3M4T A;  3FEX A;  3DPY A;  1AWC B;  4C9B B;  3PNT B;  1HS6 A;  5FT9 A;  2VPK A;  4W9C B;  3FH8 A;  5FTP A;  1WY6 A;  4HLE A;  3MJW A;  1JUQ A;  3C98 A;  3VLF A;  1H2U A;  4FHK A;  3WG7 E;  1HXI A;  3E37 A;  4I6G A;  3ZHE A;  2LAI A;  1N4S A;  3VTY A;  4G11 A;  2XGS A;  4GPM A;  4TXP A;  5AAR A;  1E7U A;  2WMO A;  4ATG A;  4Y6W A;  2MHK A;  4BSZ B;  3D9O A;  2RKK A;  4L2L A;  3UX4 A;  2OVQ A;  4JL0 A;  1X5B A;  2X6I A;  3V2O A;  2IQC A;  2IO2 C;  3CK8 A;  3VLE A;  4WWP A;  3TWV A;  4I9C A;  3I3N A;  1Z3Y A;  4XIF A;  3FTX A;  3QAQ A;  2CHW A;  4KT6 B;  3QC1 A;  4W9H H;  3MKR A;  5KJN A;  3MCX A;  2OVB A;  3ONL A;  3DWL G;  3QK0 A;  4UI9 J;  4G25 A;  3D3M A;  3UT8 A;  1IKN D;  3ZHE B;  1EPU A;  2LNI A;  4KXK B;  3LY7 A;  2VGE A;  3G2S A;  3ZYM A;  3CHO A;  5CMW A;  2B0O E;  4OYS A;  4YDE A;  2OEV A;  5EYL A;  5EN5 D;  5EID A;  4EBA G;  3TGO A;  2E32 B;  4BER A;  1LD8 A;  2R05 A;  2L6B A;  1DC2 A;  1OWO A;  3ENE A;  5AQB A;  3EUV A;  3S7F A;  1TJF A;  3T5X A;  5AJD A;  2VGY A;  3QJZ A;  1JWG A;  1BLX B;  2JAB A;  4DI3 A;  4EPZ A;  5LP0 A;  3BEE A;  3FTV A;  5G04 J;  4I2W A;  5EYP F;  4J8S A;  2EIN E;  4KYO B;  2PL2 A;  3MGB A;  3R9M A;  2C0M A;  2VSY A;  3ZXS A;  2V5Q C;  4LNB A;  5ENN A;  3IHV A;  2MRI A;  3O48 A;  3ZYK A;  4AJY C;  3JQ0 A;  3CVX A;  2NSZ A;  4I6E A;  2NN2 A;  2IEJ A;  4W9K B;  3D9M A;  5LOZ A;  2WXK A;  4DLO A;  3TWU A;  3Q7F A;  4NIK A;  2BUG A;  1S1G A;  2YIN A;  3F6Q A;  2PM6 A;  4HOQ A;  3ABM E;  3UQ3 A;  2ION A;  1K3Z D;  4RG6 A;  3D9N A;  2DCP A;  3EHR A;  3FTY A;  3C3O A;  3J5P A;  4U8V D;  3HU6 A;  3TWR A;  5BT1 A;  3ZRF B;  2J4D A;  4FLH A;  5FZS A;  1HV2 A;  3TL5 A;  3QWV A;  2P9P G;  2LSU A;  2A79 B;  1R2B A;  3LNM B;  2X6H A;  1ELW A;  3RAU A;  1QYM A;  2X6K A;  4FAD A;  4G2V A;  3HVE A;  1E96 B;  2NZ0 B;  1TN8 A;  3D9L A;  4UWG A;  3SD5 A;  3CVL A;  4K5B A;  4GZ3 A;  5BV1 A;  2JEK A;  3E4U A;  1LTX A;  3SGH A;  5B1A E;  4W9H B;  3UM3 A;  2BKK B;  3TXM A;  3EU9 A;  2FBN A;  4HS2 A;  4AJW A;  4GTV A;  5J90 A;  3MEK A;  2WQ6 A;  4OAV B;  3JXI A;  3NOG D;  1BU9 A;  4YVQ C;  1UG3 A;  3RKV A;  3V2X A;  1BI7 B;  2BKG A;  1N4Q A;  3LCA A;  1EF1 C;  3OXF A;  4I17 A;  1HFA A;  4KZ0 A;  1QZ2 A;  3SZ7 A;  3LUT B;  2AW6 A;  5CEA A;  5BO4 C;  5FIN A;  4WWO A;  4JZY A;  4CXT A;  2E2E A;  1NZN A;  3HVE B;  3T9K A;  3AS4 A;  4CT4 A;  3CVQ A;  1CS3 A;  2H6H A;  1D9S A;  4MS6 A;  3ONK A;  5AN8 A;  3ZTD B;  4F7A A;  3ASH A;  1JCS A;  4JHR A;  3FUI A;  4YY8 A;  2WXL A;  3AAA C;  1HU3 A;  3PZ2 A;  3TG4 A;  2OND A;  2KAT A;  1INZ A;  2XRZ A;  4JHK A;  3ZRH A;  5FTA A;  1OY3 D;  4CZ2 D;  4HOS A;  4LSZ E;  4U77 A;  3KD7 A;  3LKU A;  4N3C A;  4J8Z A;  2OOE A;  3CST A;  1OUV A;  4EOZ A;  3SHF A;  3LY9 A;  3Q5M A;  4BT9 A;  2Y4U A;  1QBQ A;  3UMV A;  1UJJ A;  2ASS A;  4W9D B;  1TNU A;  3KS2 A;  1UN8 A;  1QDV A;  1H0A A;  3ZVV A;  1D8D A;  1OCZ E;  1E8Z A;  2ETA A;  3LPZ A;  5AAO A;  4GZ5 A;  3HIZ A;  4WNF A;  3CHM A;  4WNG A;  2ZGD A;  3DST A;  2KBX A;  1NI1 A;  3AU4 A;  2XEE A;  1V54 E;  3OGM A;  1YCS B;  3DEP A;  4J8D A;  2WQH A;  4GTO A;  4H7Y A;  4N5Q A;  4A3V A;  4N3A A;  4A55 A;  5BXU A;  5ENQ D;  2VSX E;  4B0Z A;  1S63 A;  4FJY A;  4YDY A;  2I1J A;  3NZU A;  2GGF A;  4U07 A;  4L1B A;  5FQ8 A;  4I1A A;  4GZ6 A;  4LNU D;  4MBG A;  3PDN A;  1BUO A;  2Y69 E;  3D9J A;  3UI2 A;  3ML9 A;  3NBN B;  3UIN C;  5AQ7 A;  3G2T A;  1OCC E;  2ZGG A;  2WQ7 A;  1WAO 1;  2P1M A;  3CQG B;  2R02 A;  3ZU7 B;  5FJY A;  1U3D A;  4I6J C;  1TNY A;  3U66 A;  2VSO E;  2XZD G;  4LCT A;  1N4P A;  5BPP A;  2Z8H A;  3MKQ A;  2DWZ A;  2XRY A;  3HG0 D;  4WWN A;  2E31 B;  2R17 C;  2KM4 A;  2WXM A;  4B95 B;  3AS5 A;  4DX5 D;  3UIO C;  4G26 A;  4JHJ A;  3CVN A;  3IHY A;  4W9R A;  1SW6 A;  5DIZ A;  3CIA A;  3LXU X;  4UIJ A;  4RG9 A;  4DPR A;  3BIM A;  3Q47 B;  3UKU G;  4A1S A;  1O1R A;  1KZO A;  3FKC A;  1FCH A;  2HO1 A;  2XPZ A;  4GA1 A;  3GA1 A;  2IZV C;  1VDY A;  4BX8 A;  4U0U A;  2L0T B;  2A5E A;  3TWW A;  4AOF A;  4G1T A;  3SY2 A;  1O1S A;  4RLY A;  5HZG C;  3MKQ B;  3EIJ A;  2AWI A;  2GRR B;  4U96 D;  3PE4 A;  4LER A;  4RQI A;  4YVO A;  4F6R D;  4GB9 A;  2WXH A;  5AJL A;  2LO6 A;  5LCW J;  4B9K B;  3OHV A;  2A5U A;  1UN9 A;  1XGW A;  1S64 A;  1DCQ A;  4JPS A;  2R5S A;  4AV7 A;  1HO8 A;  3E33 A;  2IHC A;  2XS1 A;  5A15 A;  4GYW A;  4FJZ A;  3ASG A;  4CRH A;  1HF8 A;  4CT0 A;  4JTC B;  1EXB E;  5E76 A;  3FH7 A;  3FUH A;  5KBA A;  4EQF A;  3G2V A;  4UWH A;  4ANX A;  5T4Y A;  5T8I A;  3EJN A;  4GTR A;  5BXO A;  3DRX A;  4BSX A;  3X2Q E;  4BES A;  3ZW3 A;  3C3Q A;  1H19 A;  2F37 A;  2JZ3 C;  2J4B A;  3JYS A;  3EDT B;  3ZNG A;  5KNH D;  4U0S A;  2X6F A;  4W9L B;  1FQV B;  5JHB A;  3LDZ A;  3W9F A;  3HXD A;  1SZ9 A;  1WG0 A;  4UQZ A;  4ILH B;  3U64 A;  1R28 A;  4U2N A;  3KSQ A;  4AY5 A;  1H2T C;  3IKO B;  3KVT A;  2J07 A;  3ZEF A;  2PNN A;  3V31 A;  3DBS A;  2KC7 A;  3UTM A;  5CBO A;  2ETB A;  5AEN A;  3HXE A;  3ZYQ A;  4GCN A;  4W9I B;  2HYZ A;  4G24 A;  3OAW A;  3OTN A;  1NL4 A;  4KBQ A;  2B6C A;  3ZNG B;  3CLJ A;  5AIJ A;  3ABL E;  3D9P A;  2JLB A;  4FHJ A;  4IUL A;  4GTQ A;  4K5C A;  1LD7 A;  3B7R L;  3ASN E;  3MA5 A;  2FO7 A;  4W9G B;  1MHQ A;  5H7P A;  3UT7 A;  2ETC A;  1HH8 A;  2P1O A;  3ZPJ A;  2LUH A;  1E90 A;  4ZHB A;  3FY4 A;  2L0I A;  5HRY A;  3APD A;  4PUC A;  3LS8 A;  3ZYL A;  2ZU6 B;  2F8X K;  3B7B A;  4ATZ D;  2J49 A;  5CRV A;  3B7U X;  2ZIS A;  1JPL A;  5C1D A;  3V30 A;  4GTP A;  4B89 A;  3ZTC B;  4GU5 A;  3PNL B;  1MX2 A;  2VTB A;  1S0P A;  4HNA D;  3KEZ A;  4MLP A;  5H7H A;  3BQO A;  3SNX A;  3OGL A;  4E85 A;  4I1O B;  5FQ6 A;  1DCE A;  3OXG A;  1XNF A;  4M3O A;  5ANL A;  3QOU A;  1KT0 A;  2OCC E;  1FPP A;  4GAA A;  2WMN A;  4CCA A;  4HRL A;  1Z6T A;  3FH5 A;  4LRZ A;  3URZ A;  3DCG B;  4WAF A;  1BI8 B;  4XZ4 A;  3QWW A;  4U7E B;  3R9A B;  3ABK E;  5FZR A;  3RRU A;  4B8A A;  1H6P A;  4EZL A;  5FZQ A;  4HOR A;  2P9U G;  2XEV A;  2Q81 A;  1X81 A;  3PVL A;  3U4T A;  2P1P A;  4QQI A;  5DAD A;  4PS7 A;  3L82 A;  2XQ0 A;  3SFY A;  4F3V A;  5EKQ D;  3FWV A;  4O6F A;  2RFA A;  4JGH C;  1ZU2 A;  5EDS A;  3C6P A;  2IOS A;  2PQR A;  2LSV A;  5BUZ A;  3JCK C;  1FVF A;  1DSX A;  3DXK G;  4EHM A;  3SFX A;  2F0Y A;  1AP7 A;  3DXM G;  1TYQ G;  3TWT A;  3DRY A;  2WXJ A;  3C6O A;  3S7B A;  3DRZ A;  4WNE A;  4BEP A;  3NQP A;  2BTD A;  5D0O D;  1HG2 A;  5LFA A;  1WDY A;  3ISM C;  4JXT A;  1DVP A;  3MV2 B;  2AXZ A;  3ZIM A;  3B84 A;  4HI8 A;  3Q79 A;  4JEH A;  1Y6I A;  5ARG A;  3NAW A;  3FUM A;  1N0R A;  3T8K A;  3E32 A;  2V0P A;  5FIO A;  3FEY A;  1HE8 A;  4UUC A;  2L9B A;  4UI9 C;  2DYS E;  3L6A A;  3LJ3 A;  4FC8 A;  2QYJ A;  5KWD A;  1K8K G;  4R7L A;  2KCK A;  3DSS A;  2YHC A;  3M8V A;  4N2Q A;  3J5Q B;  3KSL A;  3L9T A;  3N71 A;  3UPV A;  2J9Q A;  4O1O A;  4C48 B;  3SF4 A;  2LXM A;  3CVV A;  4GZC A;  1OWL A;  2VGX A;  4P29 A;  3Q9N C;  5G04 C;  3FFL A;  1TNB A;  5CBN A;  5EX3 A;  3K9I A;  4NUR A;  3FU3 A;  3E34 A;  3QDN A;  5JJ7 A;  2R9R B;  2XHE A;  2YY9 A;  3QWP A;  2CHZ A;  4EBA A;  2XEH A;  3CEQ A;  3M52 A;  1OCO E;  3ULE G;  4GML A;  4OVU A;  4DX2 A;  3KEA A;  5D2M C;  4AM9 A;  3DEO A;  1JWF A;  3LVQ E;  5FQ7 A;  5IY5 E;  4U8H A;  4XEI G;  3EHM A;  1HG5 A;  2OVF A;  5AYW D;  1A68 A;  1LQB B;  3L54 A;  2GRP B;  2VGX B;  1TJC A;  5CCL A;  3UKR G;  2QFC A;  4UYI A;  3C5R A;  1H2V C;  2C0L A;  5EX0 A;  2BF0 X;  5ARF A;  2ILR A;  2VJ8 A;  1YA0 A;  4HOU A;  4PH4 B;  3TJP A;  3CQC B;  4KVM A;  2J8S D;  5DBK A;  1K1A A;  3FTZ A;  5CMY A;  2EIK E;  3EHQ A;  1T1D A;  1YMP A;  5LX8 A;  4NQ0 A;  1OXJ A;  3CKB A;  2AXU A;  1Y8M A;  3OHU A;  4K5A B;  2DBA A;  3ZUN B;  1MYO A;  3DSU A;  4XX5 A;  1SZA A;  5KJL A;  4BKS B;  3PS6 A;  4BTA A;  4X8Q A;  2UY1 A;  1FT2 A;  5J08 A;  3RSE G;  3DSW A;  2OVP A;  2P9N G;  3CGH A;  1NA0 A;  3T5V A;  5CCM A;  3ASO E;  1VCB B;  1IQU A;  3BG0 B;  5CRU A;  3QB2 A;  3FUE A;  3D9K A;  5HQ8 A;  2XCC A;  3PEV B;  4AXH A;  2F8Y A;  1LF8 A;  4KVO A;  4BFR A;  4JB8 P;  4DJA A;  3V79 K;  2P9I G;  2DZN A;  3KAE A;  3JXJ A;  2WXG A;  3MX3 A;  4HRN A;  4QFV A;  4DK5 A;  4PS8 A;  3E4B A;  3DRA A;  2UY1 B;  3UM2 A;  4Q69 A;  1ZB1 A;  2FF4 A;  2RG8 A;  3CVU A;  4G8K A;  3IEG A;  3PZ4 A;  3RIB A;  4AEZ C;  2LAH A;  3JUE A;  1OWM A;  3HXF A;  2AJA A;  3HHM A;  1ELR A;  4N5C A;  3AS8 A;  4W9F B;  3PH0 C;  4N39 A;  3PRE A;  1NN7 A;  4ABN A;  4J0U A;  3W9G A;  4ZOU A;  2EIM E;  4Y6C A;  3TAX A;  4F53 A;  1MX6 A;  1U3C A;  2IF4 A;  3WSO B;  3GZ2 A;  4ACK A;  1NEX A;  3LBZ A;  4LNG A;  2IOL A;  4APO A;  4UQX A;  3RJV A;  2NYJ A;  3FUD A;  4AIF A;  4J6I A;  3QNK A;  4Q94 A;  2ZXW E;  4JW1 A;  5BW8 C;  4URK A;  3UM1 A;  1ZBP A;  1KPS B;  1Z5S C;  4U95 D;  3DSX A;  3FUN A;  2Y3A A;  5JH5 B;  5ITZ F;  1N0Q A;  3LVR E;  3AG4 E;  5B1B E;  3ML8 A;  4PDX A;  4GMR A;  1FVH A;  2CG3 A;  4PS3 A;  5FQ4 A;  2RFM A;  3EU5 A;  1N94 A;  2P58 C;  4N3B A;  4K03 A;  2EIL E;  2IY0 C;  5KCM A;  2HR2 A;  3Q49 B;  2ZIR A;  4HXI A;  5G05 J;  4ZGC A;  3R7R A;  4DX7 D;  2AXV A;  4HFG A;  3CSF A;  4DRX E;  3P2B A;  4U63 A;  3DPD A;  5G2N A;  1O1T A;  2KZT A;  4FA6 A;  3PEU B;  1UJK A;  1BD8 A;  1KT1 A;  3L2O A;  2EIJ E;  1H6O A;  2IF5 A;  1TN6 A;  1P5Q A;  2GRL A;  3D9I A;  3TXN A;  1RW2 A;  3FUL A;  2FEZ A;  1EYH A;  2PPI A;  3LJN A;  1N52 A;  3B7T A;  3OXL A;  2WXN A;  4TRQ A;  2FNJ C;  1WM5 A;  3I4G A;  3TG5 A;  1D8E A;  3FU0 A;  3SFZ A;  1E8W A;  4M7C A;  4G8L A;  2V4L A;  5BXD A;  4GTT A;  2IU1 A;  3RK6 A;  5LCW C;  2NXP A;  4BWR A;  2KZT B;  3I4R B;  1PC2 A;  4APF A;  3UUX A;  5BXH A;  3CKC A;  3Q7A A;  1UW4 B;  4BET A;  3Q75 A;  4HVB A;  4HBD A;  4CEM A;  3ULY A;  3UT4 A;  2P9K G;  1FS1 B;  3GZ1 A;  3RU0 A;  4WQO C;  1IYG A;  4Z68 A;  3ESL A;  4BGC A;  4CDM A;  4J8E A;  4JTA B;  5JJ6 A;  4J8F A;  4JVS A;  5G05 C;  3AG3 E;  2J08 A;  1KZP A;  5A23 A;  4ILG A;  5JA4 D;  2KCV A;  2WXO A;  2MOW A;  3HRA A;  4L2Y A;  2X3M A;  4I1M A;  1NA3 A;  4TV3 A;  1IQR A;  3HXB A;  1HX8 A;  4FLB A;  3ASD A;  1FS2 B;  2WB2 A;  3P1U A;  1Z3X A;  4NAC A;  2OV8 A;  3UM0 A;  4B94 A;  1H6K A;  4TXR A;  3B95 A;  2IJG X;  4NRH B;  2WXR A;  1TNZ A;  3TWQ A;  4BY6 A;  2AST A;  4A1G A;  3CK9 A;  2KXP C;  3ESK A;  1A17 A;  5LLI B;  3FTW A;  4RVB A;  3FU6 A;  3JUI A;  4GCO A;  2GRN B;  2V8S E;  2VTB B;  3CR3 A;  5A6R A;  2R2L A;  4GZD A;  4JA9 A;  3SQV A;  3OGK A;  4K0R A;  4KZC A;  3V7D A;  5BXB A;  1EDU A;  4A63 B;  1PY1 A;  3PZ1 A;  5JHA A;  2QY7 A;  1OCR E;  3ASF A;  4JA7 A;  1KLX A;  3NZS A;  3U3W A;  4O1P A;  3HQI A;  3LY8 A;  4W9J B;  1OWP A;  4MRU A;  1E7V A;  2EQX A;  4MKT A;  4I6J A;  1NP7 A;  2A4Z A;  3CV0 A;  2J09 A;  3CVP A;  4LG6 A;  3PRZ A;  1ELK A;  1B89 A;  5KJK A;  1TEZ A;  2QZA A;  1JCQ A; 
#chains in the Genus database with same CATH homology
 3FTZ A;  3FEX A;  1VDY A;  4FP7 A;  5CMY A;  4U0U A;  4BX8 A;  4C9B B;  5G55 A;  2L0T B;  1T1D A;  5IBK A;  3PNT B;  4AOF A;  2I9C A;  2P1Q A;  4G1T A;  5LX8 A;  1P22 B;  1HS6 A;  4NQ0 A;  3CKB A;  3FUJ A;  4XI0 A;  2AXU A;  5FT9 A;  1Y8M A;  3OHU A;  4V3I A;  2DBA A;  5HZG C;  3ZUN B;  3MKQ B;  2VPK A;  4XX5 A;  3FH8 A;  5FTP A;  3EIJ A;  1WY6 A;  4W9C B;  5T3R A;  4I43 A;  1GW6 A;  2AWI A;  3S7D A;  4HLE A;  3MJW A;  3PE4 A;  1JUQ A;  1SZA A;  2NC9 A;  3C98 A;  4LER A;  5KJL A;  4JC8 A;  4BKS B;  3VLF A;  3PS6 A;  4YVO A;  4BTA A;  1H2U A;  4GB9 A;  4FHK A;  2WXH A;  3HDX A;  5AJL A;  2LO6 A;  5LCW J;  1W3B A;  2UY1 A;  3C6N A;  1HXI A;  5J08 A;  4B9K B;  4I6G A;  3OHV A;  2A5U A;  1UN9 A;  1XGW A;  2VYI A;  3ZHE A;  2LAI A;  4JPS A;  3VTY A;  4B9K E;  2R5S A;  4G11 A;  2XGS A;  4AV7 A;  2OVP A;  1HO8 A;  2IHC A;  1E7U A;  3CGH A;  2WMO A;  3ZN3 A;  4ATG A;  5A15 A;  1NA0 A;  4GYW A;  4Y6W A;  2MHK A;  3T5V A;  4FJZ A;  1OWN A;  3ASG A;  5CCM A;  4CRH A;  1HF8 A;  3D9O A;  4CT0 A;  2OVR A;  4AWJ B;  1VCB B;  1IQU A;  3BG0 B;  1LM8 C;  4JTC B;  1EXB E;  5E76 A;  3QB2 A;  3FH7 A;  3FUE A;  3FUH A;  4L2L A;  4EQF A;  3D9K A;  3UX4 A;  4JL0 A;  3G2V A;  4UWH A;  2XCC A;  4ANX A;  5HQ8 A;  2OVQ A;  1X5B A;  5T4Y A;  5T8I A;  3PEV B;  4AY6 A;  4AXH A;  3EJN A;  5H7G A;  4DLQ A;  2FI7 A;  3DRX A;  2X6I A;  4BSX A;  4UWL A;  1LF8 A;  4KVO A;  4BFR A;  2IQC A;  3CK8 A;  3VLE A;  4DJA A;  3CHP A;  4BKT B;  3ZW3 A;  2YQ8 A;  2RD0 A;  3KAE A;  4WWP A;  5KJM A;  1H19 A;  3O4Z A;  4I9C A;  1MQS A;  4ILI A;  5D0Q D;  2JZ3 C;  2J4B A;  1SQM A;  2VQ2 A;  2WXG A;  3I3N A;  3MX3 A;  4L7T A;  4TUU A;  1Z3Y A;  4XIF A;  3FTX A;  4CDR A;  3QAQ A;  2CHW A;  3JYS A;  3EDT B;  4KT6 B;  5BV0 A;  3QC1 A;  4W9H H;  4U0S A;  3MKR A;  3S7J A;  2X6F A;  5KJN A;  4W9L B;  4QFV A;  4DK5 A;  5JHB A;  1FQV B;  4PS8 A;  3MCX A;  2OVB A;  4GPK A;  3E4B A;  3ONL A;  4RSY A;  5FWQ A;  3QK0 A;  2UY1 B;  3LDZ A;  4UI9 J;  4Q69 A;  4G25 A;  3D3M A;  1SZ9 A;  4UQZ A;  3UT8 A;  4ILH B;  4GA0 A;  2FF4 A;  1EPU A;  2LNI A;  4KXK B;  3U64 A;  3ZHE B;  3LY7 A;  1R28 A;  4U2N A;  3G2S A;  2RG8 A;  3CHO A;  3ZYM A;  5CMW A;  3GW4 A;  3CVU A;  4AY5 A;  3IEG A;  4OYS A;  1H2T C;  3RIB A;  4AEZ C;  4EBA G;  3CK7 A;  3IKO B;  3KVT A;  2J07 A;  2LAH A;  3TGO A;  2E32 B;  3FTS A;  3ZEF A;  1OWM A;  4ME2 A;  1OWO A;  3ENE A;  3DBS A;  3CHR A;  3HHM A;  3S7F A;  1TJF A;  2KC7 A;  3L08 A;  3JQ1 A;  3NF1 A;  3T5X A;  1ELR A;  5AJD A;  2YNQ A;  2VGY A;  3QJZ A;  1JWG A;  4N5C A;  3AS8 A;  5AEN A;  5JJT A;  4W9F B;  1E8Y A;  3PH0 C;  5BNW A;  4N39 A;  2FUL A;  3PRE A;  4Q96 A;  1NN7 A;  3ZYQ A;  4DI3 A;  4EPZ A;  5LP0 A;  3BEE A;  4ABN A;  4J0U A;  3FTV A;  3GYZ A;  4GCN A;  5G04 J;  4ZOU A;  4I2W A;  4W9I B;  4EEC A;  2HYZ A;  4G24 A;  4J8S A;  2GRM A;  3FUF A;  4Y6C A;  3RO2 A;  3OAW A;  4KYO B;  2PL2 A;  3PZD A;  4IRU A;  4GA2 A;  3MGB A;  3MYV A;  3TAX A;  2UWJ G;  2C0M A;  2VSY A;  3ZXS A;  3OTN A;  4KBQ A;  3ZNG B;  5ENN A;  3CLJ A;  3IHV A;  2MRI A;  5AIJ A;  4F53 A;  3O48 A;  3D9P A;  2JLB A;  3ZYK A;  4AJY C;  4FHJ A;  1U3C A;  3JQ0 A;  3CVX A;  2IF4 A;  3Q4A B;  3WSO B;  3ZGQ A;  4IUL A;  2I2O A;  2NSZ A;  4BT8 A;  2C2L A;  3GZ2 A;  4ACK A;  4XKC A;  2WPV A;  1DNP A;  1NEX A;  2YY9 A;  4I6E A;  4XI9 A;  2YHE A;  2NN2 A;  3LBZ A;  4W9K B;  2IOL A;  3D9M A;  4APO A;  4UQX A;  3RJV A;  3B7R L;  5LOZ A;  3MA5 A;  2WXK A;  2FO7 A;  4W9G B;  3FUD A;  2VSN A;  4AIF A;  4J6I A;  1MHQ A;  3UT7 A;  3QNK A;  4Q94 A;  4DLO A;  1HH8 A;  2P1O A;  3PE3 A;  4JW1 A;  5BW8 C;  4URK A;  1N54 A;  2BUG A;  3ZPJ A;  2YIN A;  4I9E A;  1S1G A;  2PM6 A;  4HOQ A;  1ZBP A;  1E90 A;  2XPI A;  4FU3 A;  3UQ3 A;  2CFZ A;  2ION A;  2L0I A;  3FY4 A;  4LUN U;  4YND A;  3PUJ A;  4BTB A;  4RG6 A;  3M5B A;  3D9N A;  3FUN A;  2DCP A;  2Y3A A;  3APD A;  3FTY A;  5JH5 B;  4PUC A;  4EZJ A;  3LS8 A;  3L13 A;  3ZYL A;  3HU6 A;  5ANR A;  3LVR E;  5C2Y A;  5BT1 A;  2ZU6 B;  3ZRF B;  5DAF A;  3ML8 A;  2J4D A;  4PDX A;  4XE0 A;  4FLH A;  4N9F 5;  4BX9 A;  4L23 A;  2Q7F A;  1FVH A;  1L5J A;  5FZS A;  1HV2 A;  3TL5 A;  2CG3 A;  2J49 A;  3B7U X;  3QWV A;  2WVI A;  2LSU A;  2A79 B;  1R2B A;  4PS3 A;  3LNM B;  5FQ4 A;  1JPL A;  3SBT B;  3LEW A;  5C1D A;  2P58 C;  2X6H A;  4B89 A;  4N3B A;  3ZTC B;  4K03 A;  4GU5 A;  3PNL B;  4UWF A;  2VTB A;  1ELW A;  1S0P A;  2I1K A;  2X6K A;  4FAD A;  3KEZ A;  4MLP A;  4G2V A;  5H7H A;  5KCM A;  2HR2 A;  3Q49 B;  3HVE A;  4G23 A;  1E96 B;  4GMJ A;  3SNX A;  4F1S A;  3OGL A;  3ZRC B;  2NZ0 B;  4OVV A;  3D9L A;  1HZ4 A;  4C0E A;  4E85 A;  4HXI A;  4UWG A;  2HM8 A;  3SD5 A;  3FTU A;  3PUK A;  5CHE E;  3SBS A;  5G05 J;  3CVL A;  4I1O B;  4GZ3 A;  1QNF A;  4ZGC A;  5BV1 A;  2JEK A;  5FQ6 A;  3R7R A;  5M72 A;  3E4U A;  3SGH A;  3OXG A;  2AXV A;  1XNF A;  4UQY A;  4W9H B;  4M3O A;  5ANL A;  3QOU A;  3TXM A;  3IBE A;  4HFG A;  1KT0 A;  3CSF A;  3P2B A;  4U63 A;  2FBN A;  2X38 A;  4GAA A;  4HS2 A;  2WMN A;  4AJW A;  3DPD A;  4GYY A;  4CCA A;  4N2S A;  5G2N A;  5J90 A;  1Z6T A;  3FH5 A;  3MEK A;  4LRZ A;  3URZ A;  2WQ6 A;  2C9W C;  2I2R A;  3DCG B;  4WAF A;  4YVQ C;  3T8M A;  1UG3 A;  3HTM A;  2Y4T A;  3RKV A;  2KZT A;  4FA6 A;  4ACL A;  4XZ4 A;  3PEU B;  3QWW A;  3R9A B;  2PQN A;  3LCA A;  1EF1 C;  3OXF A;  4I17 A;  1HFA A;  4KZ0 A;  1QZ2 A;  5FZR A;  4U2M A;  1UJK A;  3ZFW A;  4GYO A;  3SZ7 A;  3WXX A;  3FUK A;  4AP2 A;  3LUT B;  1KT1 A;  2AW6 A;  5BO4 C;  3RRU A;  4B8A A;  4HOT A;  3L2O A;  4UWK A;  2WXP A;  4EZL A;  4WWO A;  2R59 A;  5FZQ A;  3CHQ A;  4JZY A;  4HOR A;  2IF5 A;  4CXT A;  2E2E A;  2XEV A;  2Q81 A;  1P5Q A;  4AVX A;  2GRL A;  4UI9 K;  3D9I A;  1NZN A;  3HVE B;  3TXN A;  3PVL A;  4WUY A;  3U4T A;  3AS4 A;  2P1N A;  4CT4 A;  3LYA A;  2P1P A;  3FUL A;  3CVQ A;  5DAD A;  1CS3 A;  4PS7 A;  2I6H A;  4MS6 A;  3ONK A;  2FEZ A;  1EYH A;  2PPI A;  2XQ0 A;  3I5P A;  4F3V A;  3ZTD B;  5EKQ D;  5E75 A;  3FWV A;  4F7A A;  2CFU A;  1N52 A;  3ASH A;  3MKS A;  3B7T A;  2XPY A;  2WXN A;  3APF A;  3OXL A;  4O6F A;  4TRQ A;  5A6C A;  4FUL A;  4JHR A;  2FNJ C;  3FUI A;  4JGH C;  1WM5 A;  3I4G A;  4YY8 A;  2WXL A;  1ZU2 A;  3S2A A;  1HU3 A;  3TG5 A;  4W9E B;  4CXJ A;  2DIW A;  3FU0 A;  3SFZ A;  3TG4 A;  5EDS A;  1E8W A;  2OND A;  3CVW A;  3C6P A;  2IOS A;  2KAT A;  2PQR A;  2V5F A;  1INZ A;  2XRZ A;  2LSV A;  2V4L A;  5BXD A;  2IU1 A;  4JHK A;  3ZRH A;  4ANV A;  5FTA A;  2WXF A;  3RK6 A;  5BUZ A;  2NXP A;  3GZS A;  5LCW C;  3JCK C;  3ZKJ B;  4BWR A;  1FVF A;  2KZT B;  3I4R B;  1PC2 A;  4IN3 B;  3UUX A;  4APF A;  5BXH A;  1DSX A;  4HOS A;  3CKC A;  1UW4 B;  4KMO A;  4HVB A;  1PAQ A;  4LEU A;  4U77 A;  3KD7 A;  3LKU A;  4CEM A;  4U0Z A;  4N3C A;  3QKY A;  2OOE A;  4J8Z A;  4CGV A;  3CST A;  3UT4 A;  1OUV A;  2WXJ A;  3DRY A;  3C6O A;  3B13 A;  3SHF A;  1FS1 B;  3GZ1 A;  3RU0 A;  3S7B A;  4WQO C;  4EOZ A;  3LY9 A;  3DRZ A;  3Q5M A;  4WNE A;  1EOE A;  4BT9 A;  1IYG A;  2Y4U A;  3CHS A;  3ESL A;  3NQP A;  3L17 A;  4BGC A;  4CDM A;  3QAR A;  2BTD A;  4J8E A;  3UMV A;  2KCL A;  3VTX A;  4JTA B;  5D0O D;  1UJJ A;  5JJ6 A;  4H7X A;  1HG2 A;  4J8F A;  4JVS A;  2ASS A;  2VKP A;  4W9D B;  3KS2 A;  2WM9 A;  5G05 C;  5LFA A;  2J08 A;  4JXT A;  1UN8 A;  1DVP A;  3MV2 B;  1QDV A;  5A23 A;  1H0A A;  2AXZ A;  3ZVV A;  3ZIM A;  3B84 A;  1E8Z A;  4ILG A;  4CXI A;  2KCV A;  1Y6I A;  2M63 A;  2WXO A;  3LPZ A;  4JEH A;  2MOW A;  5ARG A;  4GZ5 A;  3ULQ A;  3HIZ A;  4CRW A;  3G2U A;  4WNF A;  4L2Y A;  3FUM A;  5EUP A;  3CHM A;  2X3M A;  4WNG A;  3IV0 A;  4I1M A;  2V0P A;  4E6H A;  3AU4 A;  1NA3 A;  3FEY A;  2E0I A;  2PZI A;  1IQR A;  1HE8 A;  4TV3 A;  2L9B A;  4UI9 C;  2MA9 C;  2AVP A;  3L6A A;  3LJ3 A;  4FC8 A;  1HX8 A;  3OGM A;  1QQE A;  4FLB A;  3L22 A;  2CG2 A;  4J8D A;  2WQH A;  3EIQ C;  4H7Y A;  4R7L A;  3FDH A;  3ASD A;  1FS2 B;  4XKB A;  4A3V A;  5A7D B;  4N3A A;  2KCK A;  4IYP A;  2WB2 A;  3P1U A;  4A55 A;  1Z3X A;  4NAC A;  2X6J A;  2OV8 A;  2YHC A;  3RRM B;  2VSX E;  4B0Z A;  4B94 A;  4ANU A;  3M8V A;  1H6K A;  4CP3 A;  2XGO A;  4N2Q A;  4FJY A;  1EOF A;  3N71 A;  2I1J A;  3UPV A;  2J9Q A;  5HI7 A;  2IJG X;  4NRH B;  3SF4 A;  2WXR A;  4ANW A;  3CVV A;  3NZU A;  4GZC A;  2GGF A;  4BY6 A;  1OWL A;  4U07 A;  4L1B A;  2VGX A;  3Q15 A;  2AST A;  4P29 A;  3EHN A;  4A1G A;  5G04 C;  5FQ8 A;  3FFL A;  4I1A A;  3CK9 A;  2L6J A;  3ESK A;  4GZ6 A;  1A17 A;  5LLI B;  3FTW A;  3PDN A;  1BUO A;  4RVB A;  3D9J A;  5EX3 A;  4CDN A;  3K9I A;  4EZK A;  3ML9 A;  3FU6 A;  2XGM A;  3FU3 A;  4NUR A;  4WND A;  3JUI A;  3QDN A;  4GCO A;  3G2T A;  2V8S E;  5JJ7 A;  2R9R B;  2VTB B;  3CR3 A;  2IFU A;  5A6R A;  4GZD A;  2XHE A;  4U04 A;  3G2W A;  4JA9 A;  3OGK A;  2WQ7 A;  1WAO 1;  4K0R A;  3U9W A;  2GW1 A;  3QWP A;  2CHZ A;  3APC A;  3CQG B;  4KZC A;  2P1M A;  4C0M A;  3V7D A;  3R7Q A;  4DI4 A;  1EDU A;  3SI5 A;  4EBA A;  5BXB A;  1PY1 A;  3CEQ A;  5HYW B;  5FJY A;  3M52 A;  1LDK D;  2CHX A;  1U3D A;  4GML A;  4OVU A;  3BG1 B;  1QDW A;  4I6J C;  3U66 A;  3CVY A;  3HYM B;  4CGW A;  2VSO E;  1EOD A;  4JTD B;  5JHA A;  4LCT A;  2QY7 A;  4A3T A;  5BPP A;  4AM9 A;  2Z8H A;  1JWF A;  3LVQ E;  3MKQ A;  5FQ7 A;  4U8H A;  2XRY A;  3ASF A;  3EHM A;  4JA7 A;  1HG5 A;  4WWN A;  1KLX A;  2E31 B;  2R17 C;  3NZS A;  2KM4 A;  1E8X A;  2OVF A;  3U3W A;  4D10 C;  2WXM A;  5AYW D;  2WXQ A;  1IHG A;  3AU5 A;  1A68 A;  1LQB B;  3HQI A;  3L54 A;  3LY8 A;  4B95 B;  1BPO A;  3AS5 A;  4W9J B;  4B8C B;  3FU5 A;  1OWP A;  4MRU A;  2VGX B;  3RRN B;  3VLD A;  1TJC A;  3FHE A;  1E7V A;  2EQX A;  4G26 A;  4JHJ A;  5CCL A;  3CVN A;  3IHY A;  4MKT A;  1R29 A;  4I6J A;  4W9R A;  2PM7 A;  2QFC A;  1NP7 A;  4I2Z A;  2WXI A;  4UYI A;  5DIZ A;  3CIA A;  2A4Z A;  1H2V C;  2C0L A;  3LXU X;  4UIJ A;  3CV0 A;  4RG9 A;  4DPR A;  2J09 A;  3CVP A;  4JEU A;  5EX0 A;  3BIM A;  3Q47 B;  3MV3 B;  3PRZ A;  3B7S A;  3FP3 A;  4A1S A;  2BF0 X;  5ARF A;  2ILR A;  1ELK A;  2VJ8 A;  1YA0 A;  4HOU A;  3FKC A;  1B89 A;  4PH4 B;  3RO3 A;  5KJK A;  3L16 A;  2XCB A;  3TJP A;  1FCH A;  3CQC B;  4KVM A;  3MZL B;  2HO1 A;  2XPZ A;  4GA1 A;  1TEZ A;  3GA1 A;  5DBK A;  2IZV C;  3M4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...