4HYOA

Crystal structure of mthk pore
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
b'VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title The voltage-dependent gate in MthK potassium channels is located at the selectivity filter.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport
total genus 31
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hyoA00
2EILC 5KUMA 3SYOA 1J95A 3ZRSA 1S5HC 3E8HA 3HPLC 2ATKC 5EC1C 2EINC 4J9ZB 2HVKC 1LNQA 3RW0A 5J9PC 4P2ZA 4PDLA 5EC2C 3ABKC 4MSWC 3BEHA 3F5WC 4MVQA 3GB7C 2WLNA 3LDDA 1V55C 3SPCA 4H33A 4UUJC 2WLLB 3TETA 2A9HA 3SYAA 4WFFA 5B1AC 4MTGA 4P30A 3T2MA 4MVMA 4OXSA 4PA3A 3LDCA 4MVOA 2BOBC 4RUFA 4X89A 5EBMC 1G4YB 2X6BA 2WLLA 1OCOC 3ABMC 3ASNC 4P9PA 4QE7A 3STZC 3OUSA 1K4DC 1ZWIC 2ZD9A 4LBEC 4WFGA 1XL6A 4MVZA 4XDJA 2BOCC 2Q69A 3VOUA 2IH1C 1OCCC 5KUKA 4PDVA 4RO2A 2HG5C 2K1EA 4EKWA 1R3IC 2Y69C 4PA9A 3E83A 1R3JC 3F7VC 5E1AC 5CBGA 3EFFK 5B1BC 2WLHA 3SPHA 3PJSK 4JTCB 2EIKC 2R9RB 4HZ3A 4MTOA 4MVRA 3IFXA 4P9OA 2WLKA 4ZBMA 1M56C 5EBWC 4G27B 4QE9A 4PDMA 4X8AA 2JK5C 3ZJZA 2NLJC 4WFEA 2Q6AA 2YEVA 2EIMC 3OR7C 3R65A 3AG3C 3SYQA 4LCUC 2WLJA 3IGAC 4R7CA 3AG4C 4WFHA 3JYCA 2P7TC 3UM7A 2HFEC 2ZXWC 4GX0A 3RVYA 2HVJC 3SJQC 4QNHB 1ORQC 3K03A 2OCCC 4R50A 3E8FA 3E89A 3OUFA 3RVZA 2DWDC 3E8BA 3LUTB 4F4LA 3FB8C 3E8GA 4MVUA 2WLIA 1JVMA 2DYRC 3ASOC 3T4ZA 3STLC 3K04A 2DWEC 2H8PC 1KKDA 2AHZA 4GX2A 4JTAB 3AG1C 3SPIA 4RUEA 3OR6C 4HYOA 3SPJA 3T4DA 4MS2A 2DYSC 1R3KC 4MW8A 3K06A 2Q67A 3FB7C 4KFMA 4PA4A 3T1CA 3WG7C 4BW5A 5B3SC 3OGCC 1V54C 3UKMA 4R6ZA 4JTDB 2ITCC 2WLMA 2EIJC 4CBCA 2Q68A 3SPGA 4X88A 3X2QC 1OCZC 4J9YB 4MTFA 4I9WA 4PDRA 5EK0A 2WLIB 2QTOA 2IH3C 4PA7A 4XDLA 1K4CC 3SYPA 3SYCA 5CBHA 2A0LA 1R3LC 4G28B 2W0FC 3AG2C 3FB5C 2HJFC 4GX1A 4GX5A 4PA6A 5IY5C 1OCRC 5BZBA 2X6AA 3F7YC 4LP8A 2X6CA 3LNMB 3KG2A 4RAIA 4XDKA 4MW3A 3FB6C 2AHYA 1P7BA 1BL8A 3K08A 5CBFA 2A79B 4MVSA 4TWKA 1XL4A 5EBLC 1M57C 3K0GA 3K0DA 3LDEA 1QLEC 4H37A 2ITDC 2KB1A 3TCUA 3E86A 4DXWA 2QKSA 3ABLC 4R8CA 3RBZA
chains in the Genus database with same CATH superfamily
5KUMA 2P4KA 2ZIMA 4J80A 1KC8W 1PNKA 1F4NA 3OMAB 3TGUH 3FX7A 4DV2O 4LNUA 2N74A 5KHKA 4OX9B 2CUGA 3DXRA 1VQPV 1JFFB 4LBEC 3AK3A 5EZYA 3JARA 1FPOA 4FK5C 4JI6O 4IYIA 4ZI7B 2CGNA 4TV9A 2F66C 3THOA 4QJFB 4CZZA 2UXBB 4ZI7A 5KMGB 4P9OA 3ICXA 1QBZA 1Q6UA 5C8YA 4BW9A 3ZJZA 2PI4A 2ZCEA 5FPOA 1BZKA 2X7RB 4X64O 1H2LA 3SYQA 4IIJA 5CB4A 3DSQA 4O4HB 1I94O 2EIJB 2GV9A 3E89A 3CCSV 2PGGA 4DR2O 2XAGA 1RFYA 1Y6XA 2G38A 2LGWA 3P32A 1V9PA 1RP3B 4E2LA 3CCJV 2QJ1A 4DV3B 4KFMA 3FB7C 2ARHA 4BW5A 4FZ1A 1WP7A 2R70A 2V1DA 5LA6A 2FTKA 4CBCA 3T1YB 4ZHQA 2JVDA 1O9GA 2Z5UA 2YXHA 1IBLO 2A0LA 1YTFD 4KXRA 3ABKB 2Q4PA 4MTXA 5KHJA 3K57A 5GW7A 3FB6C 4TV8B 1YF2A 5CBFA 2P06A 2UUCO 1QLEC 2A3QA 4JI4B 1BQ0A 3E8HA 3HPLC 3OW2U 2EINC 3H1IH 1K92A 1SQBH 5GTIZ 4JYAO 4JZ2A 2E5LB 4UUJC 5ITZB 1W2BU 1SF9A 1VMGA 1M90W 1SRYA 2M7WA 4WBNB 3CCVV 3S3WA 1EBOA 1OCOC 1GN3A 3B8NA 4O2BB 2BOCC 4X9QA 4OX9O 2K1EA 2Y69C 1WP8A 3AG4B 2GHYA 4FFBA 4X1IB 5CA3A 4PD4F 2HR3A 1YIJV 4Q6GA 1GM8A 1KU9A 2ZE5A 4X1IA 1XDCA 3AEIA 4HNAB 1VQ5V 2UXBO 2FKXA 4CC6A 2ZT9B 5H6QA 5B5EZ 2ODMA 1AP5A 3UM7A 3ZBHA 2ZXWC 4B7KA 2F95B 3ZHSA 2YIDA 2YXYA 4R50A 1JX9A 3E8GA 3ASOC 2R9AA 5FL7G 4GX2A 2JS5A 3ZHUA 3SPJA 3DC6A 5CA0A 3K06A 4LFCB 1V54C 5BXZA 4JZGA 3W7TA 4UFZA 4DV3O 4QPKA 4MTFA 4JI1B 2PTMA 1D5AA 1K9MW 4DV5O 4PI0A 3T1YO 4AHCA 1AJQA 4J42A 1EZJA 1PNLA 3ZHRA 2XAJA 2FL4A 3QF7A 3FAVB 2DQ0A 1S5LZ 4F6EA 4FM1A 1I08A 4DXWA 4PV1B 2GSMB 4NTXA 4BWAA 2UUAB 1XHXA 2QM4A 4J9ZB 4O4LB 4K0KB 1TUEB 1DTOA 4JI4O 4CH5A 2ZQMA 3OTFA 4O4LA 2CH7B 1N4CA 4CH3A 4MVMA 5EYPB 2CTQA 2X6BA 2E5LO 2CH7A 2P90A 3K59A 1OCCC 1ROPA 5LYJB 1WA8A 1NTMH 4PA9A 1AVMA 3CSXA 3LSSA 1NVPB 5JQGA 2RN9A 5JH7A 4HZ3A 4MTOA 1QNMA 1NT2B 1PM9A 3CS5A 3HR0A 4JI0B 2ZIOA 4B3SB 2ADQB 3JD3A 2JK5C 1Y74A 4UV9A 2Q6AA 2YEVA 2EIMC 3OR7C 4NR1A 3CCUV 2L6LA 5K1XA 5LBQA 1AJNA 1FAFA 4PHZA 5IYDO 4BR6A 2OCCC 3JD1A 4I4TB 3CPWU 1SA0B 2CK3G 2OYQA 1R6NA 2E76B 2OIGA 1AI5A 3HKDA 1QR8A 2XAFA 2K9PA 5IYZA 1BSMA 3CRMA 3K5OA 5DECA 1N36B 1K7DA 3OGCC 5K1PA 5JCOC 3CCQV 4B08A 3UKMA 2ITCC 3ZRXA 4FIPC 3H1KH 1P4RA 2IH3C 4LFCO 1J5EO 3IC7A 3WB0A 4ZIBA 1HDJA 4JI3B 4JI1O 1VQLV 1E1RG 2O57A 3EHBB 4JPRA 3APOA 2LW7A 3HKCA 5H9CA 4LF7B 4IYHA 4ZOLB 3EVKA 2W6JG 1S72V 3CB2A 3ZEDA 2F23A 1Q81W 4KHPB 3RBZA 5CMUA 4FVMA 4O2AB 1AR4A 2BE3A 3O9OA 1Y66A 1S5JA 3LNNA 1NJIW 2PY5A 5B1BB 1B6QA 4J7KA 1Q86W 4K0KO 3RFRA 2CTWA 1U97A 5LXTA 1GN2A 2Z3YA 4DV0B 4FLTA 4UVAA 1F4MA 2YSUB 3RYCB 2LQTA 2CDYA 4DYLA 2QEXV 5KX5B 4YXWG 5IYCO 3EFFK 3UQ8A 1EN4A 4NXNB 2LFRA 3G4SV 4CC5A 3H1HH 3A2FA 1R6KA 5EBWC 2ILMA 3P3PA 2A7WA 4JI0O 4B3SO 4X20B 3N2KB 4WFHA 3BRCA 5LP6C 3RVYA 1M9NA 1ORQC 2GBOA 2Q7HA 1SKVA 2VWJA 3RVZA 1W0KG 1ZTEA 4EB6B 2V7QG 1HWYA 3N2GB 2AHZA 4FLZA 2EZOA 3H01A 1Z5WA 4FLYA 4RUEA 3OR6C 2L35A 1AR5A 4A5UB 4PA4A 3JATA 1N36O 1DF5A 3VQYA 5JVDB 1WNSA 5C93A 5F2VO 2QKAA 3ZHTA 4G2KA 3RYFB 2IJKA 4QPJA 4BIUA 4YJ3B 4JI3O 2AHYA 2QWRB 1N0NA 3RN4A 3K9SA 1CP9A 1YI2V 4LF7O 4YJ3A 3ABLC 2YUAA 2BCCH 4KHPO 5J9PC 2GDSA 3G6BA 3HB3B 2OTJV 1YTFB 4FLWA 1I0HA 2A9HA 5B1AC 3MD0A 1SZXA 4PA3A 3ETQA 4MVOA 3WFVA 2PUSA 4X89A 3JSLA 4J7ZA 3JD2A 1XL6A 4MVZA 4DV1B 3FYIB 1K33A 1JMKC 4O4JB 4RO2A 5D5PA 4ABMA 3D3QA 4FPPA 3UO2A 1BS3A 1WPBA 2EIKC 4X62B 3QO5A 4O4JA 2R9RB 3AK2A 3HKBA 5BMVA 1VF6A 2JS3A 4LWSB 1M56C 4NXNO 1RPRA 1FXKA 5KLVH 3AG1B 4YY3B 1PKXA 2WLJA 1OV9A 4F6RB 4AQYB 1VQ7V 4UVCA 3CRQA 3JALB 2JGDA 1H8HG 2MK3A 1PPJH 4K8ZA 3E8BA 2IBZH 1FFXB 1IURA 4GT1A 3E22B 4DV4B 1NH2D 2H8PC 2PI5A 3CMAV 1Y76B 1HP8A 3UO3A 3ML0A 3OEEG 1VF7A 4MS2A 2DYSC 3CJHB 2HHHO 3CP1A 2PYLA 5L3EA 4EFBA 3ETEA 4JTDB 5IE9A 2CGOA 3K3WA 5IJ0B 2YI9A 4DR3B 3SJCC 5FLXN 4GX1A 5IJ0A 4GX5A 1YJNV 2CTPA 3ZX6A 3S3XA 3KG2A 1ZLZA 2HJDA 3JCZA 3ASNB 4H44B 2Z0AA 1S5HC 5LGUA 2Q7EA 4D6TH 3RW0A 2ADPA 4I55A 5LMNB 3B77A 3SYAA 1XQ8A 1BQZA 2BOBC 4I5SA 4I9QA 2AZ2A 3BPZA 2Q69A 3WU2Z 3ZRWA 1PL0A 5E1AC 4I0XA 4ICGA 4DV1O 4LNUB 4LF5B 3BA8A 3A0RA 4HBNA 4TQDA 3DXRB 4NVPA 4ZBMA 4X62O 1FXVA 4DK0A 5EZYB 1KP3A 4JI8B 3JARB 4DK1A 4WFBV 2ZR3A 1D2DA 4TV9B 2P7TC 2XNDG 4YY3O 5KA6A 1VARA 2XASA 2X0LA 1O9HA 3I5DA 3LUTB 4AQYO 4MVUA 2YIAA 5C8YB 1AROP 3RWRD 3AG2B 4IIJB 1UPGA 5CB4B 4DV4O 1SQFA 3ZN1A 1JQ0A 1BE3H 1QQCA 2EIJC 4CS2A 1M57B 4LH6A 1OZ0A 2QTOA 3AG7A 2LFSA 2EILB 4RWUA 5L3CA 1EN6A 2UXNA 1M1KW 4DR3O 2X6CA 1Q6HA 1K5SA 1XNQB 3L72H 3L75H 5LA6B 1XOUA 3WB2A 1XREA 2VS0A 3K08A 4MVSA 1XL4A 4ZHQB 4TT3G 4E4EA 2E75B 2Q8VA 1MZFA 1R1BA 2W0XA 3RYIB 5JJNB 1JA8A 2LJ2A 5EC2C 4MSWC 3ABKC 2OT5A 4D7TA 3GB7C 3RYIA 1R73A 1HNWB 1Y67A 1ENVA 3T2MA 2QKCA 3K5NA 1G4YB 1SQQH 3I56V 3BVOA 4J41A 2XT9A 1XMOB 2JGUA 5FNVA 1WB8A 4JI7B 2B9ZA 1AB3A 4GUNA 1IZ3A 3LSQA 4JTCB 3QNEA 2JEXA 3ETDA 4LF5O 1NBMG 3J80N 5KAFZ 1GM7A 1XUQA 4WFEA 5CA1A 4UCRA 3ZHQA 1KB9F 4FFBB 1RM1B 3AG4C 2N05A 1AP6A 1NZ6A 4J10A 3L70H 4JI8O 1AI6A 2BTQA 2DWDC 4W4KA 1AILA 1N34B 5FPRA 1IDSA 3JAKB 1H2GA 1CXZB 3JAKA 1IXMA 1R3KC 2XHBA 2Q67A 3KKYA 2MW2B 5BR8B 2IU0A 2WA4A 3D36A 4NTYA 2QWPB 1FYJA 5EIBC 3CXCU 1PP9H 2E3CA 4GKJB 2W0FC 3QTCA 2JEUA 2QDOA 3UT5A 2AXTZ 5CA0B 2NNUA 3TXSA 1X4TA 1VF5B 3ABTA 4LH7A 5LHHA 5J2TA 3H1JH 2DN9A 3AK1A 1Q82W 2VQFB 2KB1A 1SETA 2B1GA 2QKSA 1XNQO 2BTOA 4R8CA 3OGIB 1BT8A 1NU1H 2DE0X 4PDLA 1Q6IA 2IM9A 2Y4TA 4WFFA 2VRZA 3OFNG 4MTGA 4FLXA 2PYJA 1S0VA 2FYUH 3OUSA 1K8AW 1GK9A 1ZWIC 2ZD9A 1HNWO 3OE7G 3FKSG 3QO7A 5B66Z 4QGPA 3AG3B 4UCOA 4RQEA 1XMOO 5LHIA 1GN4A 1T5EA 3SDLA 1GRJA 4JI7O 3IFXA 3H9VA 4O4IA 4X66B 3JASB 1YDXA 3MDSA 2E74B 3KZIZ 2NLJC 4DUYB 1WA8B 4JASA 3JASA 1CPYA 1GN6A 5KHIA 2UXDB 4QIWF 1QLNA 5JQGB 5JH7B 1NI8A 1KP2A 1YJWV 3X2QB 1G1XB 4YIPA 1W0JG 3M99B 3FB8C 3R66A 2YICA 1FFTB 2HP8A 2WAMA 2UU9B 4U7NA 2IW5A 2YI8A 3MHHC 1Y74B 2YDEA 2YEVB 5JJJB 1N34O 3ZMUA 1TUBA 5A2QN 3W7UA 1ZUQA 5H6RA 4H0LB 4NKGB 2WLMA 3RYHB 2JDIG 3HKDB 5BR8O 3CD6V 5IYZB 4DV7B 2BSKA 3OD4A 4UB8Z 3RYHA 3QG5A 3Q4HA 2Y0PA 3FB5C 2OTLV 1NH2B 4RAIA 2M6YA 4GKJO 3L74H 5B1OA 1H2NA 5EBLC 4TWKA 3ZRVA 4B3MB 2LGQA 2AW9A 3ABMB 3DC5A 1NS1A 3CHXA 2ZDIC 1MA1A 5H2FZ 2ZM6B 1WLEA 1LNQA 2QE7G 4AI8A 2VQFO 1MOFA 3BEHA 1VQ4V 3HKCB 1V55C 4DR5B 2ZNJA 4DR7B 4UVBA 4CH6A 1GM9A 1V55B 4B3RB 4OGQB 1GTOA 3STZC 3NR7A 1IXBA 1NKDA 1PNMA 2Q9LA 2DJVA 3VOUA 4UB6Z 4EKWA 3F7VC 5B1BC 1VQMV 3HKEA 5JCOA 1H38A 5LOVA 1XMQB 1KKCA 5D5QA 5LXTB 1PV0A 2UUAO 2WLKA 2DYRB 4I50B 1H2MA 4X66O 4JF3A 1COWG 4I50A 4R7CA 1AR1B 2IU3A 4DUZB 4DUYO 3L9DA 2Y0IA 4BIOA 4UCTA 1OCZB 1YCIA 3E8FA 2UXDO 2WLIA 1JVMA 3BY6A 2EULA 2Q5ZA 1EM1A 4IL6Z 5IY5B 4NYKA 4HYOA 4U3FH 5HFMA 3JCUZ 1HNXB 1Q7YW 2UU9O 4FLVA 1H8EG 1KBHA 3VQXA 2Q68A 2LP7A 4JV5B 1WPXA 1N8RW 2P22C 4L87A 3SYCA 2LO1A 5CBHA 2GTSA 1R3LC 3UCSC 2OCHA 1K97A 2KKWA 5BZBA 1SZTA 2KSDA 2X6AA 4DV7O 3VQVA 3JATB 4DR1B 3CC4V 3C3SA 4MW3A 3GWOA 3NXSA 5GONA 2IJJA 1BL8A 1P7BA 1G6UA 4X1YA 1Q3EA 3E86A 1N33B 4I7ZB 5H5NA 1ZSPA 3ZRSA 4DR4B 2ATKC 2RJZA 4X1KA 4NTWA 2NR5A 4UCUA 4LR3A 1YEWA 2WLNA 3CCEV 1URFA 5LP6A 2AZ0A 2ZM6O 2RDCA 4OXSA 4DR5O 4DR7O 1VQ9V 4DW1A 3OEHG 4B3RO 3CRCA 3LSUA 1JJOA 2UUBB 4JI2B 4D7SA 3CYOA 3ZMVA 2C2AA 2Y4UA 4FMTA 4YHHB 4NXMB 1XI1A 1XMQO 4X8AA 2PF4E 5DEDA 1YSCA 1FJGB 2DOSA 2EX3A 2JJ1G 4QNHB 3M7MX 4DV0O 3HKBB 5BMVB 2QM8A 2KG7A 2YC0A 3G67A 1Q8IA 1K3EA 4DUZO 1FXKB 4BAYA 5KHGA 3AG1C 5JWPA 3RGBA 1JCHA 3U10A 3T1CA 3G71V 1NTZH 2JGDB 3VQWA 1HNXO 1HW7A 2OWOA 4PA7A 1Q43A 1KD1W 3K58A 1RSOB 1YITV 3BHPA 4N21A 1IBMB 4JV5O 2HJFC 1LUVA 2N04A 5HFLA 2F43G 4IHJA 1WB7A 1RSOA 2QM7A 2GTAA 2A79B 2JJ2G 4DR1O 1B06A 2QA4V 3RT3C 3SYOA 3SJBC 5BY1A 2HVKC 3CE2A 3W7WA 1N33O 1G8MA 1P84F 2H94A 4DR4O 4Z1MG 3A0BZ 4P30A 4LF8B 1OHHG 4RUFA 3ASNC 4QE7A 3CXHF 1L8DA 3K79A 4XDJA 4BIZA 1YVWA 5IYBO 1X59A 4I55B 1HR0B 1R3JC 1KYOF 1S3JA 4JAVA 3G80A 3OM3B 4CH4A 2ZE8A 2UUBO 1VEWA 4HAMA 1TAEA 2XTAA 4L8JA 4DRXA 4JI2O 1TA8A 3ZRWB 1DLBA 4YHHO 4YJ2A 4I0XB 4NXMO 5B3SB 3WG7B 1MMMA 5A9GA 1ZL8A 3P3NA 4NB5A 5GTHZ 5DN6G 3GVMA 1MG1A 4FJCC 1FJGO 1QU7A 1FXHA 3K04A 1KKDA 5J2UA 1F51A 5JJEB 1ZAUA 1OCRB 2VQEB 2PZSA 4U3JB 4ASUG 1JJ2U 1K73W 4JYAB 5L3GA 4U3JA 1I7FA 3ZMZA 4IT5A 3K9AA 5CN0A 1DGSA 4G28B 3AG2C 1WAZA 1GMGA 2P6JA 1IBMO 2CAZC 1M57C 1N32B 4H37A 3ZHVA 2XOKG 2EILC 3ZN0A 1JFFA 2F4VB 1J95A 1QR9A 3JSNA 2R9IA 1K34A 3CX5F 1VP7A 4EEQA 4B3TB 3LDDA 5LL6Y 4WF9V 1QVGU 3JD4A 4C7UA 4X65B 1JOYA 4MT8A 2ZR2A 3GWKC 5KMGA 3BA9A 4PELA 2OIEA 4LF8O 2WWWA 2IH1C 2NN4A 4PDVA 2R72A 3APQA 4JAUA 5CBGA 2AGAA 3OAAG 1B04A 1YZBA 2WLHA 1XHZA 4O4HA 1HR0O 1B3QA 2IJIA 4JGSA 5LGTA 2RMKB 1Y4MA 2YIBA 3CEIA 1KUQA 5FNVB 3W7SA 1THZA 3IAYA 1BHBA 5LMNO 2DMXA 3CCLV 4DV5B 1F7YA 4UXNA 3IGAC 4W4LA 2HFEC 2ZE7A 3OUFA 5LGNA 4GLXA 4F4LA 2WSSG 5LMUB 3QVNA 3PN1A 3ZMSA 3STLC 3SPIA 5CA1B 1OJHA 2WA3A 4FZ0A 3K5MA 1RM1C 1E79G 1QHTA 1HNZB 2DQ3A 4GZRB 2Q0OC 4LF4B 2BTQB 4TV8A 3SPGA 4X88A 2VQEO 1QLEB 4J9YB 4I9WA 1WN7A 2UXCB 1MNGA 2EINB 3D36C 4UCSA 1VQKV 1BCCH 2QWOB 3CWBH 2RCVA 4JI5B 5ITZA 3C3TA 4JYYA 3SJAC 4WBNA 1H2KA 1OCOB 1L1FA 3K5LA 5L3DA 1N32O 4O2BA 2ZINA 1JR9A 3ZS8C 4H13B 3UT5B 3DGEA 2QR4A 4LFAB 2Y69B 2QSAA 3F5WC 2F4VO 1NQTA 5TISZ 3SPCA 1LR1A 3D3IA 2WLLB 1L0LH 3TETA 5J2TB 4LF9B 1KECA 4B3TO 1S76D 2WLLA 2ETNA 3B2EE 4P9PA 2B5UA 2P4VA 3A8TA 4WFGA 4X65O 2Q73A 4TUYB 4HNAA 4LFBB 1JPXA 4FLUA 1R3IC 3E83A 4TUYA 2ZXWB 2FB5A 3SPHA 3PJSK 2KQXA 4MVRA 1MSWD 2XAQA 3JAWB 3ASOB 3T1HB 3BCCH 3JAWA 1J5EB 1XEQA 3AG3C 1Q90D 4KL1A 3FFQA 1V54B 1VQOV 4GX0A 3MHSC 1M5IA 3EXAA 4O4IB 1SQPH 3T4ZA 1YXBA 5LHGA 3T4DA 5LMUO 4GCZA 3M8AA 2HLDG 3FAVA 3X2QC 1ZX3A 1HNZO 4XDLA 4IGGA 4N23A 1K4CC 4LF4O 1CEZA 5IJ9B 2IJHA 3JD0A 1TUBB 1YJ9V 2UXCO 4LP8A 5IJ9A 2YXLA 4B7EA 3I55V 3SR2C 1TVKB 1VQ8V 1M4UA 3LDEA 5EYPA 3L73H 2BSKB 1MABG 4JI5O 1TVKA 3Q4HB 3B4SA 4Q20A 1OCCB 5LYJA 3H1LH 2YS8A 3U0ZA 1IBKB 3F5TA 2CTRA 3G6EV 3MAQA 1FD9A 4LFAO 4JYCA 2D2CB 1P7GA 4K3AA 3ABMC 1K4DC 1DF4A 3OMIB 4LF9O 1Z5VA 1KMIZ 2EIMB 3C90A 2HEPA 1VQ6V 3OT7A 3B09A 3L71H 4Z1VA 1BGYH 4LFBO 2YIBD 3CRRA 2OCCB 3IC9A 4I4TA 1EN5A 1SA0A 4ZKIA 2EJ7A 2ZE6A 3IJ4A 1U96A 1QVFU 3R65A 4DO2A 3E2EA 4LCUC 3T1HO 3HKEB 1S77D 2P67A 4CS3A 3OMNB 5LOVB 3K03A 3N27A 4JYBA 1I5YA 5IDJA 5KHHA 1RPOA 1EFRG 3TK1A 4LF6B 2DYRC 4OPAA 2ZDIA 2XUMA 4JTAB 4J11A 1XILA 3ZMTA 4FM0A 4GKKB 3W7XA 2A06H 1P49A 4ZOLA 1OCZC 2W6IG 3U11A 1UJWB 2WLIB 4DV6B 4XBFA 2P5OA 2WPDG 4O2AA 1SQXH 1SC5B 5IY5C 2EZPA 3LNMB 4XDKA 2DW4A 3DTUB 1Z2GA 1AJPA 3SGIA 2ZNIA 2JIZG 3K0GA 5L3FA 1GAXA 2ITDC 3TCUA 1BMFG 2FMLA 5EC1C 2Y48A 3OTOB 3RYCA 1TGOA 3BAAA 2EJRA 1FS0G 4MVQA 5KX5A 1NR1A 4H33A 5GONB 1WJZA 4TQFA 2GUZB 4X1YB 1IBKO 3LDCA 5EBMC 2RNBA 3FD9A 2XAHA 1VIBA 2GUZA 3TJTA 1IVSA 4X1KB 1AI4A 2F93B 4JAAA 1M93A 2HG5C 5KAIZ 4LC1A 5LP6B 4X20A 3N2KA 4B3MO 5EIBD 2V4DA 2HHHB 1UFIA 3CC2V 3P30A 4KUMA 2ZKOA 4EB6A 3N2GA 1NTKH 4Z2WA 1FKAO 1E1QG 3JYCA 3SJQC 2HVJC 1Q5OA 3B40A 3J81N 4RQFA 5JVDA 2DWEC 2F1MA 4AILC 3E35A 5IWAB 3RYFA 4LF6O 4UCVA 4MW8A 4UV8A 3A0HZ 1N0JA 1XNRB 3O65A 4GKKO 5EK0A 4PDRA 2KG7B 1D5NA 1VF6C 1LUWA 3VBBA 3ABLB 1AI7A 3SYPA 5B1NA 4FFKA 1FXKC 4U7OA 1SS3A 4K35A 4DV6O 4DR6B 3ZIAG 3F7YC 4KP4A 3ABUA 5B1AB 3CC7V 4PJ0Z 3K0DA 2Q0AA 2VWKA 3BFRA 3J7AU 1SERA 1L0NH 3D8CA 4DV2B 3FYEB 1NVPD 4FM2A 4P2ZA 4K8XA 1MSDA 3KCYA 1SQVH 4IHJB 1DK1A 2EIKB 1NR7A 3OTOO 1SQGA 5L3BA 2QWQB 4JI6B 2Q7GA 1M56B 4LWSA 4DW0A 4OPHA 5KUKA 2LW1A 3ETGA 3ZCCA 1KQSU 4EFEA 1MZEA 4F6RA 1H2SB 3CMEV 1EZVH 1BHAA 3JALA 1FFXA 1PD3A 4GYCB 3E22A 4X64B 1IX9A 2QTSA 4G27B 4QE9A 4PDMA 1I94B 1Y76A 2CE4A 1F23A 1W59A 2DYSB 1GH6A 3CJHA 4DR2B 1YHQV 2QWNB 1PL4A 2H3OA 3QO8A 5AG2A 3JAMN 4TOIA 4J7JA 2HKOA 4DRXB 4WFAV 1A32A 5E79Z 1GO3F 5IT9N 4YJ2B 1QCEA 1R6TA 3TXQA 5KA5A 5B3SC 4PI2A 3WG7C 1ZL8B 4TSFG 5DM6V 4R6ZA 5IWAO 1IBLB 4CS4A 2QGNA 3WB1A 1XNRO 1XBLA 1K5QA 2D3OW 5J2UB 3KCXA 1I5XA 3CCMV 1GKFA 4PA6A 3B8MA 2B1IA 1OCRC 1US6A 4YIOA 4WCEV 2UUCB 1SESA 3CRAA 2RQ6A 2UXXA 1VQNV 3BABA 2JRIA 4DR6O 2EBOA 3CCRV
chains in the Genus database with same CATH topology
5KUMA 2ZDIC 5L3DA 1WLEA 1LNQA 2QE7G 5J9PC 3DGEA 1MOFA 1KC8W 2Y69B 1PNKA 1F4NA 3BEHA 3F5WC 3OMAB 1NQTA 1VQ4V 3HB3B 1V55C 3SPCA 2OTJV 1YTFB 3D3IA 2WLLB 3TETA 2A9HA 4UVBA 5B1AC 3MD0A 1GM9A 1V55B 4PA3A 1KECA 4MVOA 1GTOA 3WFVA 4X89A 1S76D 2WLLA 4P9PA 1VQPV 2B5UA 3STZC 3JD2A 1NKDA 1PNMA 4LBEC 4WFGA 1XL6A 4MVZA 3FYIB 3VOUA 1K33A 1JPXA 4FK5C 4RO2A 4EKWA 1R3IC 3E83A 3F7VC 4FPPA 2ZXWB 5B1BC 1VQMV 1H38A 3SPHA 3PJSK 2EIKC 3QO5A 2R9RB 4MVRA 4QJFB 4CZZA 1MSWD 2XAQA 4P9OA 2WLKA 2DYRB 1QBZA 3ASOB 1M56C 1RPRA 1FXKA 3ZJZA 2PI4A 3AG1B 4JF3A 2X7RB 1PKXA 3AG3C 3SYQA 1COWG 2WLJA 4R7CA 1AR1B 1VQ7V 1V54B 4UVCA 2IU3A 4GX0A 1VQOV 3MHSC 2EIJB 1H8HG 1OCZB 2MK3A 3E8FA 3E89A 3CCSV 3E8BA 2XAGA 4GT1A 2WLIA 1JVMA 3BY6A 3T4ZA 1NH2D 2H8PC 3P32A 2PI5A 3CMAV 3ML0A 5IY5B 4E2LA 4HYOA 5LHGA 3CCJV 3OEEG 3T4DA 4MS2A 2DYSC 5HFMA 4GCZA 1Q7YW 4KFMA 1H8EG 3FB7C 3CP1A 2HLDG 4BW5A 2V1DA 5L3EA 3ETEA 2FTKA 4JTDB 4CBCA 2Q68A 3K3WA 3X2QC 2LP7A 4XDLA 1WPXA 1N8RW 4N23A 2Z5UA 1K4CC 1CEZA 2IJHA 4L87A 3SYCA 3JD0A 5CBHA 2A0LA 1R3LC 1YTFD 4GX1A 4GX5A 1K97A 1YJNV 3ABKB 5BZBA 1YJ9V 1SZTA 2X6AA 4LP8A 4MTXA 3KG2A 3CC4V 4MW3A 5GW7A 3FB6C 3GWOA 3NXSA 3I55V 2IJJA 1BL8A 1P7BA 5CBFA 1VQ8V 3LDEA 1QLEC 3JCZA 3ASNB 3E86A 1MABG 3ZRSA 1S5HC 3E8HA 3HPLC 2ATKC 5LGUA 3OW2U 4Q20A 1OCCB 2EINC 1K92A 3RW0A 2WLNA 3CCEV 3G6EV 4UUJC 3B77A 3SYAA 1W2BU 1M90W 1SRYA 2M7WA 3CCVV 4OXSA 1EBOA 2BOBC 4JYCA 4I5SA 1OCOC 3ABMC 3B8NA 1K4DC 1DF4A 1VQ9V 3OMIB 2BOCC 2Q69A 3OEHG 2EIMB 1VQ6V 3ZRWA 1PL0A 2K1EA 2Y69C 3AG4B 2GHYA 5E1AC 5CA3A 2HR3A 3A0RA 1YIJV 3CYOA 2OCCB 3ZMVA 1GM8A 2C2AA 4ZKIA 4FMTA 3AEIA 4ZBMA 1FXVA 4X8AA 1KP3A 1VQ5V 1QVFU 5H6QA 3R65A 4DO2A 3E2EA 4WFBV 1YSCA 4LCUC 2ZR3A 3UM7A 2P7TC 1S77D 2P67A 2ZXWC 3OMNB 2JJ1G 2XNDG 4QNHB 3K03A 5KA6A 4JYBA 1I5YA 2XASA 2X0LA 5IDJA 4R50A 1JX9A 3LUTB 2QM8A 3E8GA 1RPOA 4MVUA 1EFRG 3TK1A 2DYRC 1K3EA 3ASOC 1AROP 1FXKB 2ZDIA 4BAYA 5FL7G 4GX2A 4JTAB 3AG1C 3AG2B 3ZMTA 3SPJA 1JCHA 3K06A 3T1CA 3G71V 1V54C 3ZN1A 1JQ0A 3W7XA 2EIJC 3W7TA 1M57B 1OCZC 1OZ0A 2W6IG 4QPKA 4MTFA 1UJWB 2WLIB 2QTOA 4XBFA 4PA7A 2LFSA 2EILB 1K9MW 2WPDG 1KD1W 1YITV 5L3CA 2UXNA 4N21A 1AJQA 1M1KW 2HJFC 5HFLA 5IY5C 2F43G 1EZJA 2EZPA 2X6CA 1PNLA 3LNMB 4XDKA 2QM7A 2XAJA 1K5SA 2DW4A 3DTUB 2DQ0A 3K08A 1AJPA 2A79B 2JJ2G 4MVSA 1XL4A 2JIZG 3K0GA 4TT3G 5L3FA 2ITDC 3TCUA 4DXWA 2QA4V 2GSMB 3SYOA 1BMFG 5EC1C 2Y48A 4J9ZB 2HVKC 3W7WA 5EC2C 3ABKC 1G8MA 1TUEB 2EJRA 1FS0G 1DTOA 2H94A 2OT5A 3GB7C 4MSWC 4MVQA 1NR1A 2ZQMA 4H33A 4Z1MG 1R73A 1ENVA 4P30A 3T2MA 4MVMA 3LDCA 1OHHG 4RUFA 5EBMC 1G4YB 2X6BA 3ASNC 4QE7A 3I56V 2XAHA 3K79A 4XDJA 4BIZA 2P90A 1AI4A 1OCCC 1ROPA 5IYBO 2HG5C 4PA9A 4LC1A 1R3JC 1S3JA 4JAVA 3LSSA 3OM3B 1NVPB 3LSQA 4JTCB 3QNEA 4HZ3A 4MTOA 3CC2V 4HAMA 2JEXA 3ETDA 3P30A 4KUMA 1NBMG 3JD3A 1GM7A 2JK5C 4WFEA 3ZRWB 4UV9A 2Q6AA 2YEVA 1DLBA 2EIMC 3OR7C 3CCUV 1E1QG 5LBQA 5B3SB 3WG7B 1RM1B 3AG4C 1AJNA 3JYCA 3SJQC 2HVJC 5IYDO 1AI6A 2OCCC 3JD1A 3CPWU 5DN6G 2CK3G 2DWDC 1MG1A 4FJCC 4RQFA 1R6NA 1AI5A 1QR8A 1H2GA 1FXHA 2XAFA 3K04A 2DWEC 1KKDA 3E35A 1F51A 1OCRB 1K7DA 1IXMA 1R3KC 4MW8A 4UV8A 2Q67A 3OGCC 3CCQV 2IU0A 4ASUG 3D36A 3UKMA 1JJ2U 2ITCC 3ZRXA 1K73W 5L3GA 4FIPC 5EK0A 4PDRA 3ZMZA 1P4RA 3VBBA 2IH3C 3ABLB 3IC7A 1AI7A 3K9AA 3SYPA 5CN0A 5B1NA 1FXKC 4U7OA 3CXCU 4G28B 2W0FC 3AG2C 1VQLV 2JEUA 1E1RG 3EHBB 4JPRA 3ZIAG 3F7YC 2NNUA 1GMGA 2P6JA 4KP4A 5H9CA 3ABTA 5LHHA 3ABUA 5B1AB 3CC7V 2W6JG 1S72V 1M57C 3K0DA 4H37A 1Q82W 2XOKG 2KB1A 1SETA 1Q81W 2B1GA 2QKSA 1SERA 4R8CA 3RBZA 2EILC 3ZN0A 5CMUA 1J95A 1QR9A 3FYEB 1NVPD 2R9IA 1K34A 1Y66A 4P2ZA 4PDLA 1NJIW 3LDDA 5B1BB 1B6QA 1Q86W 4WF9V 1QVGU 3JD4A 2EIKB 1NR7A 4WFFA 3OFNG 4MTGA 5L3BA 1JOYA 4MT8A 2ZR2A 1S0VA 2Z3YA 1M56B 4PELA 3OUSA 1K8AW 1GK9A 1ZWIC 2ZD9A 4UVAA 3OE7G 2WWWA 3FKSG 1F4MA 2YSUB 2IH1C 3QO7A 5KUKA 3ETGA 4PDVA 3AG3B 3ZCCA 4RQEA 1KQSU 2QEXV 4YXWG 4JAUA 5CBGA 5IYCO 3EFFK 3OAAG 5LHIA 2WLHA 3CMEV 2LFRA 3G4SV 1BHAA 3IFXA 2IJIA 4JGSA 5LGTA 1PD3A 1Y4MA 1R6KA 5EBWC 4G27B 4QE9A 4PDMA 3W7SA 2NLJC 1THZA 1BHBA 4JASA 1F23A 2DYSB 3CCLV 1CPYA 1YHQV 4UXNA 3IGAC 4QIWF 1QLNA 4WFHA 3QO8A 2HFEC 3RVYA 1M9NA 1ORQC 2HKOA 1KP2A 1YJWV 3X2QB 3OUFA 3RVZA 5LGNA 1W0KG 1W0JG 3M99B 3FB8C 2WSSG 4F4LA 1FFTB 2WAMA 4WFAV 2V7QG 1HWYA 3STLC 4U7NA 2IW5A 3ZMSA 3MHHC 2AHZA 2EZOA 3SPIA 3H01A 2YEVB 1GO3F 4RUEA 3OR6C 3ZMUA 1QCEA 3W7UA 4PA4A 5B3SC 3WG7C 1E79G 5KA5A 4TSFG 5H6RA 1RM1C 2DQ3A 5DM6V 4R6ZA 1DF5A 2WLMA 3SPGA 4X88A 1QLEB 4J9YB 2JDIG 4I9WA 3CD6V 5C93A 1K5QA 2D3OW 4G2KA 1I5XA 3CCMV 2EINB 1GKFA 3FB5C 2IJKA 4PA6A 3B8MA 2B1IA 1OCRC 1VQKV 4WCEV 1NH2B 4QPJA 2OTLV 4RAIA 1SESA 4BIUA 2UXXA 2AHYA 1VQNV 5B1OA 5EBLC 4TWKA 3ZRVA 2EBOA 1CP9A 3CCRV 1YI2V 1OCOB 3ABMB 1L1FA 3ABLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL C;  5KUM A;  3SYO A;  1J95 A;  3ZRS A;  1S5H C;  3E8H A;  3HPL C;  2ATK C;  5EC1 C;  2EIN C;  4J9Z B;  2HVK C;  1LNQ A;  3RW0 A;  5J9P C;  4P2Z A;  4PDL A;  5EC2 C;  3ABK C;  4MSW C;  3BEH A;  3F5W C;  4MVQ A;  3GB7 C;  2WLN A;  3LDD A;  1V55 C;  3SPC A;  4H33 A;  4UUJ C;  2WLL B;  3TET A;  2A9H A;  3SYA A;  4WFF A;  5B1A C;  4MTG A;  4P30 A;  3T2M A;  4MVM A;  4OXS A;  4PA3 A;  3LDC A;  4MVO A;  2BOB C;  4RUF A;  4X89 A;  5EBM C;  1G4Y B;  2X6B A;  2WLL A;  1OCO C;  3ABM C;  3ASN C;  4P9P A;  4QE7 A;  3STZ C;  3OUS A;  1K4D C;  1ZWI C;  2ZD9 A;  4LBE C;  4WFG A;  1XL6 A;  4MVZ A;  4XDJ A;  2BOC C;  2Q69 A;  3VOU A;  2IH1 C;  1OCC C;  5KUK A;  4PDV A;  4RO2 A;  2HG5 C;  2K1E A;  4EKW A;  1R3I C;  2Y69 C;  4PA9 A;  3E83 A;  1R3J C;  3F7V C;  5E1A C;  5CBG A;  3EFF K;  5B1B C;  2WLH A;  3SPH A;  3PJS K;  4JTC B;  2EIK C;  2R9R B;  4HZ3 A;  4MTO A;  4MVR A;  3IFX A;  4P9O A;  2WLK A;  4ZBM A;  1M56 C;  5EBW C;  4G27 B;  4QE9 A;  4PDM A;  4X8A A;  2JK5 C;  3ZJZ A;  2NLJ C;  4WFE A;  2Q6A A;  2YEV A;  2EIM C;  3OR7 C;  3R65 A;  3AG3 C;  3SYQ A;  4LCU C;  2WLJ A;  3IGA C;  4R7C A;  3AG4 C;  4WFH A;  3JYC A;  2P7T C;  3UM7 A;  2HFE C;  2ZXW C;  4GX0 A;  3RVY A;  2HVJ C;  3SJQ C;  4QNH B;  1ORQ C;  3K03 A;  2OCC C;  4R50 A;  3E8F A;  3E89 A;  3OUF A;  3RVZ A;  2DWD C;  3E8B A;  3LUT B;  4F4L A;  3FB8 C;  3E8G A;  4MVU A;  2WLI A;  1JVM A;  2DYR C;  3ASO C;  3T4Z A;  3STL C;  3K04 A;  2DWE C;  2H8P C;  1KKD A;  2AHZ A;  4GX2 A;  4JTA B;  3AG1 C;  3SPI A;  4RUE A;  3OR6 C;  4HYO A;  3SPJ A;  3T4D A;  4MS2 A;  2DYS C;  1R3K C;  4MW8 A;  3K06 A;  2Q67 A;  3FB7 C;  4KFM A;  4PA4 A;  3T1C A;  3WG7 C;  4BW5 A;  5B3S C;  3OGC C;  1V54 C;  3UKM A;  4R6Z A;  4JTD B;  2ITC C;  2WLM A;  2EIJ C;  4CBC A;  2Q68 A;  3SPG A;  4X88 A;  3X2Q C;  1OCZ C;  4J9Y B;  4MTF A;  4I9W A;  4PDR A;  5EK0 A;  2WLI B;  2QTO A;  2IH3 C;  4PA7 A;  4XDL A;  1K4C C;  3SYP A;  3SYC A;  5CBH A;  2A0L A;  1R3L C;  4G28 B;  2W0F C;  3AG2 C;  3FB5 C;  2HJF C;  4GX1 A;  4GX5 A;  4PA6 A;  5IY5 C;  1OCR C;  5BZB A;  2X6A A;  3F7Y C;  4LP8 A;  2X6C A;  3LNM B;  3KG2 A;  4RAI A;  4XDK A;  4MW3 A;  3FB6 C;  2AHY A;  1P7B A;  1BL8 A;  3K08 A;  5CBF A;  2A79 B;  4MVS A;  4TWK A;  1XL4 A;  5EBL C;  1M57 C;  3K0G A;  3K0D A;  3LDE A;  1QLE C;  4H37 A;  2ITD C;  2KB1 A;  3TCU A;  3E86 A;  4DXW A;  2QKS A;  3ABL C;  4R8C A;  3RBZ A; 
#chains in the Genus database with same CATH topology
 5KUM A;  2P4K A;  2ZIM A;  4J80 A;  1KC8 W;  1PNK A;  1F4N A;  3OMA B;  3TGU H;  3FX7 A;  4DV2 O;  4LNU A;  2N74 A;  5KHK A;  4OX9 B;  2CUG A;  3DXR A;  1VQP V;  1JFF B;  4LBE C;  3AK3 A;  5EZY A;  3JAR A;  1FPO A;  4FK5 C;  4JI6 O;  4IYI A;  4ZI7 B;  2CGN A;  4TV9 A;  2F66 C;  3THO A;  4QJF B;  4CZZ A;  2UXB B;  4ZI7 A;  5KMG B;  4P9O A;  3ICX A;  1QBZ A;  1Q6U A;  5C8Y A;  4BW9 A;  3ZJZ A;  2PI4 A;  2ZCE A;  5FPO A;  1BZK A;  2X7R B;  4X64 O;  1H2L A;  3SYQ A;  4IIJ A;  5CB4 A;  3DSQ A;  4O4H B;  1I94 O;  2EIJ B;  2GV9 A;  3E89 A;  3CCS V;  2PGG A;  4DR2 O;  2XAG A;  1RFY A;  1Y6X A;  2G38 A;  2LGW A;  3P32 A;  1V9P A;  1RP3 B;  4E2L A;  3CCJ V;  2QJ1 A;  4DV3 B;  4KFM A;  3FB7 C;  2ARH A;  4BW5 A;  4FZ1 A;  1WP7 A;  2R70 A;  2V1D A;  5LA6 A;  2FTK A;  4CBC A;  3T1Y B;  4ZHQ A;  2JVD A;  1O9G A;  2Z5U A;  2YXH A;  1IBL O;  2A0L A;  1YTF D;  4KXR A;  3ABK B;  2Q4P A;  4MTX A;  5KHJ A;  3K57 A;  5GW7 A;  3FB6 C;  4TV8 B;  1YF2 A;  5CBF A;  2P06 A;  2UUC O;  1QLE C;  2A3Q A;  4JI4 B;  1BQ0 A;  3E8H A;  3HPL C;  3OW2 U;  2EIN C;  3H1I H;  1K92 A;  1SQB H;  5GTI Z;  4JYA O;  4JZ2 A;  2E5L B;  4UUJ C;  5ITZ B;  1W2B U;  1SF9 A;  1VMG A;  1M90 W;  1SRY A;  2M7W A;  4WBN B;  3CCV V;  3S3W A;  1EBO A;  1OCO C;  1GN3 A;  3B8N A;  4O2B B;  2BOC C;  4X9Q A;  4OX9 O;  2K1E A;  2Y69 C;  1WP8 A;  3AG4 B;  2GHY A;  4FFB A;  4X1I B;  5CA3 A;  4PD4 F;  2HR3 A;  1YIJ V;  4Q6G A;  1GM8 A;  1KU9 A;  2ZE5 A;  4X1I A;  1XDC A;  3AEI A;  4HNA B;  1VQ5 V;  2UXB O;  2FKX A;  4CC6 A;  2ZT9 B;  5H6Q A;  5B5E Z;  2ODM A;  1AP5 A;  3UM7 A;  3ZBH A;  2ZXW C;  4B7K A;  2F95 B;  3ZHS A;  2YID A;  2YXY A;  4R50 A;  1JX9 A;  3E8G A;  3ASO C;  2R9A A;  5FL7 G;  4GX2 A;  2JS5 A;  3ZHU A;  3SPJ A;  3DC6 A;  5CA0 A;  3K06 A;  4LFC B;  1V54 C;  5BXZ A;  4JZG A;  3W7T A;  4UFZ A;  4DV3 O;  4QPK A;  4MTF A;  4JI1 B;  2PTM A;  1D5A A;  1K9M W;  4DV5 O;  4PI0 A;  3T1Y O;  4AHC A;  1AJQ A;  4J42 A;  1EZJ A;  1PNL A;  3ZHR A;  2XAJ A;  2FL4 A;  3QF7 A;  3FAV B;  2DQ0 A;  1S5L Z;  4F6E A;  4FM1 A;  1I08 A;  4DXW A;  4PV1 B;  2GSM B;  4NTX A;  4BWA A;  2UUA B;  1XHX A;  2QM4 A;  4J9Z B;  4O4L B;  4K0K B;  1TUE B;  1DTO A;  4JI4 O;  4CH5 A;  2ZQM A;  3OTF A;  4O4L A;  2CH7 B;  1N4C A;  4CH3 A;  4MVM A;  5EYP B;  2CTQ A;  2X6B A;  2E5L O;  2CH7 A;  2P90 A;  3K59 A;  1OCC C;  1ROP A;  5LYJ B;  1WA8 A;  1NTM H;  4PA9 A;  1AVM A;  3CSX A;  3LSS A;  1NVP B;  5JQG A;  2RN9 A;  5JH7 A;  4HZ3 A;  4MTO A;  1QNM A;  1NT2 B;  1PM9 A;  3CS5 A;  3HR0 A;  4JI0 B;  2ZIO A;  4B3S B;  2ADQ B;  3JD3 A;  2JK5 C;  1Y74 A;  4UV9 A;  2Q6A A;  2YEV A;  2EIM C;  3OR7 C;  4NR1 A;  3CCU V;  2L6L A;  5K1X A;  5LBQ A;  1AJN A;  1FAF A;  4PHZ A;  5IYD O;  4BR6 A;  2OCC C;  3JD1 A;  4I4T B;  3CPW U;  1SA0 B;  2CK3 G;  2OYQ A;  1R6N A;  2E76 B;  2OIG A;  1AI5 A;  3HKD A;  1QR8 A;  2XAF A;  2K9P A;  5IYZ A;  1BSM A;  3CRM A;  3K5O A;  5DEC A;  1N36 B;  1K7D A;  3OGC C;  5K1P A;  5JCO C;  3CCQ V;  4B08 A;  3UKM A;  2ITC C;  3ZRX A;  4FIP C;  3H1K H;  1P4R A;  2IH3 C;  4LFC O;  1J5E O;  3IC7 A;  3WB0 A;  4ZIB A;  1HDJ A;  4JI3 B;  4JI1 O;  1VQL V;  1E1R G;  2O57 A;  3EHB B;  4JPR A;  3APO A;  2LW7 A;  3HKC A;  5H9C A;  4LF7 B;  4IYH A;  4ZOL B;  3EVK A;  2W6J G;  1S72 V;  3CB2 A;  3ZED A;  2F23 A;  1Q81 W;  4KHP B;  3RBZ A;  5CMU A;  4FVM A;  4O2A B;  1AR4 A;  2BE3 A;  3O9O A;  1Y66 A;  1S5J A;  3LNN A;  1NJI W;  2PY5 A;  5B1B B;  1B6Q A;  4J7K A;  1Q86 W;  4K0K O;  3RFR A;  2CTW A;  1U97 A;  5LXT A;  1GN2 A;  2Z3Y A;  4DV0 B;  4FLT A;  4UVA A;  1F4M A;  2YSU B;  3RYC B;  2LQT A;  2CDY A;  4DYL A;  2QEX V;  5KX5 B;  4YXW G;  5IYC O;  3EFF K;  3UQ8 A;  1EN4 A;  4NXN B;  2LFR A;  3G4S V;  4CC5 A;  3H1H H;  3A2F A;  1R6K A;  5EBW C;  2ILM A;  3P3P A;  2A7W A;  4JI0 O;  4B3S O;  4X20 B;  3N2K B;  4WFH A;  3BRC A;  5LP6 C;  3RVY A;  1M9N A;  1ORQ C;  2GBO A;  2Q7H A;  1SKV A;  2VWJ A;  3RVZ A;  1W0K G;  1ZTE A;  4EB6 B;  2V7Q G;  1HWY A;  3N2G B;  2AHZ A;  4FLZ A;  2EZO A;  3H01 A;  1Z5W A;  4FLY A;  4RUE A;  3OR6 C;  2L35 A;  1AR5 A;  4A5U B;  4PA4 A;  3JAT A;  1N36 O;  1DF5 A;  3VQY A;  5JVD B;  1WNS A;  5C93 A;  5F2V O;  2QKA A;  3ZHT A;  4G2K A;  3RYF B;  2IJK A;  4QPJ A;  4BIU A;  4YJ3 B;  4JI3 O;  2AHY A;  2QWR B;  1N0N A;  3RN4 A;  3K9S A;  1CP9 A;  1YI2 V;  4LF7 O;  4YJ3 A;  3ABL C;  2YUA A;  2BCC H;  4KHP O;  5J9P C;  2GDS A;  3G6B A;  3HB3 B;  2OTJ V;  1YTF B;  4FLW A;  1I0H A;  2A9H A;  5B1A C;  3MD0 A;  1SZX A;  4PA3 A;  3ETQ A;  4MVO A;  3WFV A;  2PUS A;  4X89 A;  3JSL A;  4J7Z A;  3JD2 A;  1XL6 A;  4MVZ A;  4DV1 B;  3FYI B;  1K33 A;  1JMK C;  4O4J B;  4RO2 A;  5D5P A;  4ABM A;  3D3Q A;  4FPP A;  3UO2 A;  1BS3 A;  1WPB A;  2EIK C;  4X62 B;  3QO5 A;  4O4J A;  2R9R B;  3AK2 A;  3HKB A;  5BMV A;  1VF6 A;  2JS3 A;  4LWS B;  1M56 C;  4NXN O;  1RPR A;  1FXK A;  5KLV H;  3AG1 B;  4YY3 B;  1PKX A;  2WLJ A;  1OV9 A;  4F6R B;  4AQY B;  1VQ7 V;  4UVC A;  3CRQ A;  3JAL B;  2JGD A;  1H8H G;  2MK3 A;  1PPJ H;  4K8Z A;  3E8B A;  2IBZ H;  1FFX B;  1IUR A;  4GT1 A;  3E22 B;  4DV4 B;  1NH2 D;  2H8P C;  2PI5 A;  3CMA V;  1Y76 B;  1HP8 A;  3UO3 A;  3ML0 A;  3OEE G;  1VF7 A;  4MS2 A;  2DYS C;  3CJH B;  2HHH O;  3CP1 A;  2PYL A;  5L3E A;  4EFB A;  3ETE A;  4JTD B;  5IE9 A;  2CGO A;  3K3W A;  5IJ0 B;  2YI9 A;  4DR3 B;  3SJC C;  5FLX N;  4GX1 A;  5IJ0 A;  4GX5 A;  1YJN V;  2CTP A;  3ZX6 A;  3S3X A;  3KG2 A;  1ZLZ A;  2HJD A;  3JCZ A;  3ASN B;  4H44 B;  2Z0A A;  1S5H C;  5LGU A;  2Q7E A;  4D6T H;  3RW0 A;  2ADP A;  4I55 A;  5LMN B;  3B77 A;  3SYA A;  1XQ8 A;  1BQZ A;  2BOB C;  4I5S A;  4I9Q A;  2AZ2 A;  3BPZ A;  2Q69 A;  3WU2 Z;  3ZRW A;  1PL0 A;  5E1A C;  4I0X A;  4ICG A;  4DV1 O;  4LNU B;  4LF5 B;  3BA8 A;  3A0R A;  4HBN A;  4TQD A;  3DXR B;  4NVP A;  4ZBM A;  4X62 O;  1FXV A;  4DK0 A;  5EZY B;  1KP3 A;  4JI8 B;  3JAR B;  4DK1 A;  4WFB V;  2ZR3 A;  1D2D A;  4TV9 B;  2P7T C;  2XND G;  4YY3 O;  5KA6 A;  1VAR A;  2XAS A;  2X0L A;  1O9H A;  3I5D A;  3LUT B;  4AQY O;  4MVU A;  2YIA A;  5C8Y B;  1ARO P;  3RWR D;  3AG2 B;  4IIJ B;  1UPG A;  5CB4 B;  4DV4 O;  1SQF A;  3ZN1 A;  1JQ0 A;  1BE3 H;  1QQC A;  2EIJ C;  4CS2 A;  1M57 B;  4LH6 A;  1OZ0 A;  2QTO A;  3AG7 A;  2LFS A;  2EIL B;  4RWU A;  5L3C A;  1EN6 A;  2UXN A;  1M1K W;  4DR3 O;  2X6C A;  1Q6H A;  1K5S A;  1XNQ B;  3L72 H;  3L75 H;  5LA6 B;  1XOU A;  3WB2 A;  1XRE A;  2VS0 A;  3K08 A;  4MVS A;  1XL4 A;  4ZHQ B;  4TT3 G;  4E4E A;  2E75 B;  2Q8V A;  1MZF A;  1R1B A;  2W0X A;  3RYI B;  5JJN B;  1JA8 A;  2LJ2 A;  5EC2 C;  4MSW C;  3ABK C;  2OT5 A;  4D7T A;  3GB7 C;  3RYI A;  1R73 A;  1HNW B;  1Y67 A;  1ENV A;  3T2M A;  2QKC A;  3K5N A;  1G4Y B;  1SQQ H;  3I56 V;  3BVO A;  4J41 A;  2XT9 A;  1XMO B;  2JGU A;  5FNV A;  1WB8 A;  4JI7 B;  2B9Z A;  1AB3 A;  4GUN A;  1IZ3 A;  3LSQ A;  4JTC B;  3QNE A;  2JEX A;  3ETD A;  4LF5 O;  1NBM G;  3J80 N;  5KAF Z;  1GM7 A;  1XUQ A;  4WFE A;  5CA1 A;  4UCR A;  3ZHQ A;  1KB9 F;  4FFB B;  1RM1 B;  3AG4 C;  2N05 A;  1AP6 A;  1NZ6 A;  4J10 A;  3L70 H;  4JI8 O;  1AI6 A;  2BTQ A;  2DWD C;  4W4K A;  1AIL A;  1N34 B;  5FPR A;  1IDS A;  3JAK B;  1H2G A;  1CXZ B;  3JAK A;  1IXM A;  1R3K C;  2XHB A;  2Q67 A;  3KKY A;  2MW2 B;  5BR8 B;  2IU0 A;  2WA4 A;  3D36 A;  4NTY A;  2QWP B;  1FYJ A;  5EIB C;  3CXC U;  1PP9 H;  2E3C A;  4GKJ B;  2W0F C;  3QTC A;  2JEU A;  2QDO A;  3UT5 A;  2AXT Z;  5CA0 B;  2NNU A;  3TXS A;  1X4T A;  1VF5 B;  3ABT A;  4LH7 A;  5LHH A;  5J2T A;  3H1J H;  2DN9 A;  3AK1 A;  1Q82 W;  2VQF B;  2KB1 A;  1SET A;  2B1G A;  2QKS A;  1XNQ O;  2BTO A;  4R8C A;  3OGI B;  1BT8 A;  1NU1 H;  2DE0 X;  4PDL A;  1Q6I A;  2IM9 A;  2Y4T A;  4WFF A;  2VRZ A;  3OFN G;  4MTG A;  4FLX A;  2PYJ A;  1S0V A;  2FYU H;  3OUS A;  1K8A W;  1GK9 A;  1ZWI C;  2ZD9 A;  1HNW O;  3OE7 G;  3FKS G;  3QO7 A;  5B66 Z;  4QGP A;  3AG3 B;  4UCO A;  4RQE A;  1XMO O;  5LHI A;  1GN4 A;  1T5E A;  3SDL A;  1GRJ A;  4JI7 O;  3IFX A;  3H9V A;  4O4I A;  4X66 B;  3JAS B;  1YDX A;  3MDS A;  2E74 B;  3KZI Z;  2NLJ C;  4DUY B;  1WA8 B;  4JAS A;  3JAS A;  1CPY A;  1GN6 A;  5KHI A;  2UXD B;  4QIW F;  1QLN A;  5JQG B;  5JH7 B;  1NI8 A;  1KP2 A;  1YJW V;  3X2Q B;  1G1X B;  4YIP A;  1W0J G;  3M99 B;  3FB8 C;  3R66 A;  2YIC A;  1FFT B;  2HP8 A;  2WAM A;  2UU9 B;  4U7N A;  2IW5 A;  2YI8 A;  3MHH C;  1Y74 B;  2YDE A;  2YEV B;  5JJJ B;  1N34 O;  3ZMU A;  1TUB A;  5A2Q N;  3W7U A;  1ZUQ A;  5H6R A;  4H0L B;  4NKG B;  2WLM A;  3RYH B;  2JDI G;  3HKD B;  5BR8 O;  3CD6 V;  5IYZ B;  4DV7 B;  2BSK A;  3OD4 A;  4UB8 Z;  3RYH A;  3QG5 A;  3Q4H A;  2Y0P A;  3FB5 C;  2OTL V;  1NH2 B;  4RAI A;  2M6Y A;  4GKJ O;  3L74 H;  5B1O A;  1H2N A;  5EBL C;  4TWK A;  3ZRV A;  4B3M B;  2LGQ A;  2AW9 A;  3ABM B;  3DC5 A;  1NS1 A;  3CHX A;  2ZDI C;  1MA1 A;  5H2F Z;  2ZM6 B;  1WLE A;  1LNQ A;  2QE7 G;  4AI8 A;  2VQF O;  1MOF A;  3BEH A;  1VQ4 V;  3HKC B;  1V55 C;  4DR5 B;  2ZNJ A;  4DR7 B;  4UVB A;  4CH6 A;  1GM9 A;  1V55 B;  4B3R B;  4OGQ B;  1GTO A;  3STZ C;  3NR7 A;  1IXB A;  1NKD A;  1PNM A;  2Q9L A;  2DJV A;  3VOU A;  4UB6 Z;  4EKW A;  3F7V C;  5B1B C;  1VQM V;  3HKE A;  5JCO A;  1H38 A;  5LOV A;  1XMQ B;  1KKC A;  5D5Q A;  5LXT B;  1PV0 A;  2UUA O;  2WLK A;  2DYR B;  4I50 B;  1H2M A;  4X66 O;  4JF3 A;  1COW G;  4I50 A;  4R7C A;  1AR1 B;  2IU3 A;  4DUZ B;  4DUY O;  3L9D A;  2Y0I A;  4BIO A;  4UCT A;  1OCZ B;  1YCI A;  3E8F A;  2UXD O;  2WLI A;  1JVM A;  3BY6 A;  2EUL A;  2Q5Z A;  1EM1 A;  4IL6 Z;  5IY5 B;  4NYK A;  4HYO A;  4U3F H;  5HFM A;  3JCU Z;  1HNX B;  1Q7Y W;  2UU9 O;  4FLV A;  1H8E G;  1KBH A;  3VQX A;  2Q68 A;  2LP7 A;  4JV5 B;  1WPX A;  1N8R W;  2P22 C;  4L87 A;  3SYC A;  2LO1 A;  5CBH A;  2GTS A;  1R3L C;  3UCS C;  2OCH A;  1K97 A;  2KKW A;  5BZB A;  1SZT A;  2KSD A;  2X6A A;  4DV7 O;  3VQV A;  3JAT B;  4DR1 B;  3CC4 V;  3C3S A;  4MW3 A;  3GWO A;  3NXS A;  5GON A;  2IJJ A;  1BL8 A;  1P7B A;  1G6U A;  4X1Y A;  1Q3E A;  3E86 A;  1N33 B;  4I7Z B;  5H5N A;  1ZSP A;  3ZRS A;  4DR4 B;  2ATK C;  2RJZ A;  4X1K A;  4NTW A;  2NR5 A;  4UCU A;  4LR3 A;  1YEW A;  2WLN A;  3CCE V;  1URF A;  5LP6 A;  2AZ0 A;  2ZM6 O;  2RDC A;  4OXS A;  4DR5 O;  4DR7 O;  1VQ9 V;  4DW1 A;  3OEH G;  4B3R O;  3CRC A;  3LSU A;  1JJO A;  2UUB B;  4JI2 B;  4D7S A;  3CYO A;  3ZMV A;  2C2A A;  2Y4U A;  4FMT A;  4YHH B;  4NXM B;  1XI1 A;  1XMQ O;  4X8A A;  2PF4 E;  5DED A;  1YSC A;  1FJG B;  2DOS A;  2EX3 A;  2JJ1 G;  4QNH B;  3M7M X;  4DV0 O;  3HKB B;  5BMV B;  2QM8 A;  2KG7 A;  2YC0 A;  3G67 A;  1Q8I A;  1K3E A;  4DUZ O;  1FXK B;  4BAY A;  5KHG A;  3AG1 C;  5JWP A;  3RGB A;  1JCH A;  3U10 A;  3T1C A;  3G71 V;  1NTZ H;  2JGD B;  3VQW A;  1HNX O;  1HW7 A;  2OWO A;  4PA7 A;  1Q43 A;  1KD1 W;  3K58 A;  1RSO B;  1YIT V;  3BHP A;  4N21 A;  1IBM B;  4JV5 O;  2HJF C;  1LUV A;  2N04 A;  5HFL A;  2F43 G;  4IHJ A;  1WB7 A;  1RSO A;  2QM7 A;  2GTA A;  2A79 B;  2JJ2 G;  4DR1 O;  1B06 A;  2QA4 V;  3RT3 C;  3SYO A;  3SJB C;  5BY1 A;  2HVK C;  3CE2 A;  3W7W A;  1N33 O;  1G8M A;  1P84 F;  2H94 A;  4DR4 O;  4Z1M G;  3A0B Z;  4P30 A;  4LF8 B;  1OHH G;  4RUF A;  3ASN C;  4QE7 A;  3CXH F;  1L8D A;  3K79 A;  4XDJ A;  4BIZ A;  1YVW A;  5IYB O;  1X59 A;  4I55 B;  1HR0 B;  1R3J C;  1KYO F;  1S3J A;  4JAV A;  3G80 A;  3OM3 B;  4CH4 A;  2ZE8 A;  2UUB O;  1VEW A;  4HAM A;  1TAE A;  2XTA A;  4L8J A;  4DRX A;  4JI2 O;  1TA8 A;  3ZRW B;  1DLB A;  4YHH O;  4YJ2 A;  4I0X B;  4NXM O;  5B3S B;  3WG7 B;  1MMM A;  5A9G A;  1ZL8 A;  3P3N A;  4NB5 A;  5GTH Z;  5DN6 G;  3GVM A;  1MG1 A;  4FJC C;  1FJG O;  1QU7 A;  1FXH A;  3K04 A;  1KKD A;  5J2U A;  1F51 A;  5JJE B;  1ZAU A;  1OCR B;  2VQE B;  2PZS A;  4U3J B;  4ASU G;  1JJ2 U;  1K73 W;  4JYA B;  5L3G A;  4U3J A;  1I7F A;  3ZMZ A;  4IT5 A;  3K9A A;  5CN0 A;  1DGS A;  4G28 B;  3AG2 C;  1WAZ A;  1GMG A;  2P6J A;  1IBM O;  2CAZ C;  1M57 C;  1N32 B;  4H37 A;  3ZHV A;  2XOK G;  2EIL C;  3ZN0 A;  1JFF A;  2F4V B;  1J95 A;  1QR9 A;  3JSN A;  2R9I A;  1K34 A;  3CX5 F;  1VP7 A;  4EEQ A;  4B3T B;  3LDD A;  5LL6 Y;  4WF9 V;  1QVG U;  3JD4 A;  4C7U A;  4X65 B;  1JOY A;  4MT8 A;  2ZR2 A;  3GWK C;  5KMG A;  3BA9 A;  4PEL A;  2OIE A;  4LF8 O;  2WWW A;  2IH1 C;  2NN4 A;  4PDV A;  2R72 A;  3APQ A;  4JAU A;  5CBG A;  2AGA A;  3OAA G;  1B04 A;  1YZB A;  2WLH A;  1XHZ A;  4O4H A;  1HR0 O;  1B3Q A;  2IJI A;  4JGS A;  5LGT A;  2RMK B;  1Y4M A;  2YIB A;  3CEI A;  1KUQ A;  5FNV B;  3W7S A;  1THZ A;  3IAY A;  1BHB A;  5LMN O;  2DMX A;  3CCL V;  4DV5 B;  1F7Y A;  4UXN A;  3IGA C;  4W4L A;  2HFE C;  2ZE7 A;  3OUF A;  5LGN A;  4GLX A;  4F4L A;  2WSS G;  5LMU B;  3QVN A;  3PN1 A;  3ZMS A;  3STL C;  3SPI A;  5CA1 B;  1OJH A;  2WA3 A;  4FZ0 A;  3K5M A;  1RM1 C;  1E79 G;  1QHT A;  1HNZ B;  2DQ3 A;  4GZR B;  2Q0O C;  4LF4 B;  2BTQ B;  4TV8 A;  3SPG A;  4X88 A;  2VQE O;  1QLE B;  4J9Y B;  4I9W A;  1WN7 A;  2UXC B;  1MNG A;  2EIN B;  3D36 C;  4UCS A;  1VQK V;  1BCC H;  2QWO B;  3CWB H;  2RCV A;  4JI5 B;  5ITZ A;  3C3T A;  4JYY A;  3SJA C;  4WBN A;  1H2K A;  1OCO B;  1L1F A;  3K5L A;  5L3D A;  1N32 O;  4O2B A;  2ZIN A;  1JR9 A;  3ZS8 C;  4H13 B;  3UT5 B;  3DGE A;  2QR4 A;  4LFA B;  2Y69 B;  2QSA A;  3F5W C;  2F4V O;  1NQT A;  5TIS Z;  3SPC A;  1LR1 A;  3D3I A;  2WLL B;  1L0L H;  3TET A;  5J2T B;  4LF9 B;  1KEC A;  4B3T O;  1S76 D;  2WLL A;  2ETN A;  3B2E E;  4P9P A;  2B5U A;  2P4V A;  3A8T A;  4WFG A;  4X65 O;  2Q73 A;  4TUY B;  4HNA A;  4LFB B;  1JPX A;  4FLU A;  1R3I C;  3E83 A;  4TUY A;  2ZXW B;  2FB5 A;  3SPH A;  3PJS K;  2KQX A;  4MVR A;  1MSW D;  2XAQ A;  3JAW B;  3ASO B;  3T1H B;  3BCC H;  3JAW A;  1J5E B;  1XEQ A;  3AG3 C;  1Q90 D;  4KL1 A;  3FFQ A;  1V54 B;  1VQO V;  4GX0 A;  3MHS C;  1M5I A;  3EXA A;  4O4I B;  1SQP H;  3T4Z A;  1YXB A;  5LHG A;  3T4D A;  5LMU O;  4GCZ A;  3M8A A;  2HLD G;  3FAV A;  3X2Q C;  1ZX3 A;  1HNZ O;  4XDL A;  4IGG A;  4N23 A;  1K4C C;  4LF4 O;  1CEZ A;  5IJ9 B;  2IJH A;  3JD0 A;  1TUB B;  1YJ9 V;  2UXC O;  4LP8 A;  5IJ9 A;  2YXL A;  4B7E A;  3I55 V;  3SR2 C;  1TVK B;  1VQ8 V;  1M4U A;  3LDE A;  5EYP A;  3L73 H;  2BSK B;  1MAB G;  4JI5 O;  1TVK A;  3Q4H B;  3B4S A;  4Q20 A;  1OCC B;  5LYJ A;  3H1L H;  2YS8 A;  3U0Z A;  1IBK B;  3F5T A;  2CTR A;  3G6E V;  3MAQ A;  1FD9 A;  4LFA O;  4JYC A;  2D2C B;  1P7G A;  4K3A A;  3ABM C;  1K4D C;  1DF4 A;  3OMI B;  4LF9 O;  1Z5V A;  1KMI Z;  2EIM B;  3C90 A;  2HEP A;  1VQ6 V;  3OT7 A;  3B09 A;  3L71 H;  4Z1V A;  1BGY H;  4LFB O;  2YIB D;  3CRR A;  2OCC B;  3IC9 A;  4I4T A;  1EN5 A;  1SA0 A;  4ZKI A;  2EJ7 A;  2ZE6 A;  3IJ4 A;  1U96 A;  1QVF U;  3R65 A;  4DO2 A;  3E2E A;  4LCU C;  3T1H O;  3HKE B;  1S77 D;  2P67 A;  4CS3 A;  3OMN B;  5LOV B;  3K03 A;  3N27 A;  4JYB A;  1I5Y A;  5IDJ A;  5KHH A;  1RPO A;  1EFR G;  3TK1 A;  4LF6 B;  2DYR C;  4OPA A;  2ZDI A;  2XUM A;  4JTA B;  4J11 A;  1XIL A;  3ZMT A;  4FM0 A;  4GKK B;  3W7X A;  2A06 H;  1P49 A;  4ZOL A;  1OCZ C;  2W6I G;  3U11 A;  1UJW B;  2WLI B;  4DV6 B;  4XBF A;  2P5O A;  2WPD G;  4O2A A;  1SQX H;  1SC5 B;  5IY5 C;  2EZP A;  3LNM B;  4XDK A;  2DW4 A;  3DTU B;  1Z2G A;  1AJP A;  3SGI A;  2ZNI A;  2JIZ G;  3K0G A;  5L3F A;  1GAX A;  2ITD C;  3TCU A;  1BMF G;  2FML A;  5EC1 C;  2Y48 A;  3OTO B;  3RYC A;  1TGO A;  3BAA A;  2EJR A;  1FS0 G;  4MVQ A;  5KX5 A;  1NR1 A;  4H33 A;  5GON B;  1WJZ A;  4TQF A;  2GUZ B;  4X1Y B;  1IBK O;  3LDC A;  5EBM C;  2RNB A;  3FD9 A;  2XAH A;  1VIB A;  2GUZ A;  3TJT A;  1IVS A;  4X1K B;  1AI4 A;  2F93 B;  4JAA A;  1M93 A;  2HG5 C;  5KAI Z;  4LC1 A;  5LP6 B;  4X20 A;  3N2K A;  4B3M O;  5EIB D;  2V4D A;  2HHH B;  1UFI A;  3CC2 V;  3P30 A;  4KUM A;  2ZKO A;  4EB6 A;  3N2G A;  1NTK H;  4Z2W A;  1FKA O;  1E1Q G;  3JYC A;  3SJQ C;  2HVJ C;  1Q5O A;  3B40 A;  3J81 N;  4RQF A;  5JVD A;  2DWE C;  2F1M A;  4AIL C;  3E35 A;  5IWA B;  3RYF A;  4LF6 O;  4UCV A;  4MW8 A;  4UV8 A;  3A0H Z;  1N0J A;  1XNR B;  3O65 A;  4GKK O;  5EK0 A;  4PDR A;  2KG7 B;  1D5N A;  1VF6 C;  1LUW A;  3VBB A;  3ABL B;  1AI7 A;  3SYP A;  5B1N A;  4FFK A;  1FXK C;  4U7O A;  1SS3 A;  4K35 A;  4DV6 O;  4DR6 B;  3ZIA G;  3F7Y C;  4KP4 A;  3ABU A;  5B1A B;  3CC7 V;  4PJ0 Z;  3K0D A;  2Q0A A;  2VWK A;  3BFR A;  3J7A U;  1SER A;  1L0N H;  3D8C A;  4DV2 B;  3FYE B;  1NVP D;  4FM2 A;  4P2Z A;  4K8X A;  1MSD A;  3KCY A;  1SQV H;  4IHJ B;  1DK1 A;  2EIK B;  1NR7 A;  3OTO O;  1SQG A;  5L3B A;  2QWQ B;  4JI6 B;  2Q7G A;  1M56 B;  4LWS A;  4DW0 A;  4OPH A;  5KUK A;  2LW1 A;  3ETG A;  3ZCC A;  1KQS U;  4EFE A;  1MZE A;  4F6R A;  1H2S B;  3CME V;  1EZV H;  1BHA A;  3JAL A;  1FFX A;  1PD3 A;  4GYC B;  3E22 A;  4X64 B;  1IX9 A;  2QTS A;  4G27 B;  4QE9 A;  4PDM A;  1I94 B;  1Y76 A;  2CE4 A;  1F23 A;  1W59 A;  2DYS B;  1GH6 A;  3CJH A;  4DR2 B;  1YHQ V;  2QWN B;  1PL4 A;  2H3O A;  3QO8 A;  5AG2 A;  3JAM N;  4TOI A;  4J7J A;  2HKO A;  4DRX B;  4WFA V;  1A32 A;  5E79 Z;  1GO3 F;  5IT9 N;  4YJ2 B;  1QCE A;  1R6T A;  3TXQ A;  5KA5 A;  5B3S C;  4PI2 A;  3WG7 C;  1ZL8 B;  4TSF G;  5DM6 V;  4R6Z A;  5IWA O;  1IBL B;  4CS4 A;  2QGN A;  3WB1 A;  1XNR O;  1XBL A;  1K5Q A;  2D3O W;  5J2U B;  3KCX A;  1I5X A;  3CCM V;  1GKF A;  4PA6 A;  3B8M A;  2B1I A;  1OCR C;  1US6 A;  4YIO A;  4WCE V;  2UUC B;  1SES A;  3CRA A;  2RQ6 A;  2UXX A;  1VQN V;  3BAB A;  2JRI A;  4DR6 O;  2EBO A;  3CCR V; 
#chains in the Genus database with same CATH homology
 5KUM A;  2ZDI C;  5L3D A;  1WLE A;  1LNQ A;  2QE7 G;  5J9P C;  3DGE A;  1MOF A;  1KC8 W;  2Y69 B;  1PNK A;  1F4N A;  3BEH A;  3F5W C;  3OMA B;  1NQT A;  1VQ4 V;  3HB3 B;  1V55 C;  3SPC A;  2OTJ V;  1YTF B;  3D3I A;  2WLL B;  3TET A;  2A9H A;  4UVB A;  5B1A C;  3MD0 A;  1GM9 A;  1V55 B;  4PA3 A;  1KEC A;  4MVO A;  1GTO A;  3WFV A;  4X89 A;  1S76 D;  2WLL A;  4P9P A;  1VQP V;  2B5U A;  3STZ C;  3JD2 A;  1NKD A;  1PNM A;  4LBE C;  4WFG A;  1XL6 A;  4MVZ A;  3FYI B;  3VOU A;  1K33 A;  1JPX A;  4FK5 C;  4RO2 A;  4EKW A;  1R3I C;  3E83 A;  3F7V C;  4FPP A;  2ZXW B;  5B1B C;  1VQM V;  1H38 A;  3SPH A;  3PJS K;  2EIK C;  3QO5 A;  2R9R B;  4MVR A;  4QJF B;  4CZZ A;  1MSW D;  2XAQ A;  4P9O A;  2WLK A;  2DYR B;  1QBZ A;  3ASO B;  1M56 C;  1RPR A;  1FXK A;  3ZJZ A;  2PI4 A;  3AG1 B;  4JF3 A;  2X7R B;  1PKX A;  3AG3 C;  3SYQ A;  1COW G;  2WLJ A;  4R7C A;  1AR1 B;  1VQ7 V;  1V54 B;  4UVC A;  2IU3 A;  4GX0 A;  1VQO V;  3MHS C;  2EIJ B;  1H8H G;  1OCZ B;  2MK3 A;  3E8F A;  3E89 A;  3CCS V;  3E8B A;  2XAG A;  4GT1 A;  2WLI A;  1JVM A;  3BY6 A;  3T4Z A;  1NH2 D;  2H8P C;  3P32 A;  2PI5 A;  3CMA V;  3ML0 A;  5IY5 B;  4E2L A;  4HYO A;  5LHG A;  3CCJ V;  3OEE G;  3T4D A;  4MS2 A;  2DYS C;  5HFM A;  4GCZ A;  1Q7Y W;  4KFM A;  1H8E G;  3FB7 C;  3CP1 A;  2HLD G;  4BW5 A;  2V1D A;  5L3E A;  3ETE A;  2FTK A;  4JTD B;  4CBC A;  2Q68 A;  3K3W A;  3X2Q C;  2LP7 A;  4XDL A;  1WPX A;  1N8R W;  4N23 A;  2Z5U A;  1K4C C;  1CEZ A;  2IJH A;  4L87 A;  3SYC A;  3JD0 A;  5CBH A;  2A0L A;  1R3L C;  1YTF D;  4GX1 A;  4GX5 A;  1K97 A;  1YJN V;  3ABK B;  5BZB A;  1YJ9 V;  1SZT A;  2X6A A;  4LP8 A;  4MTX A;  3KG2 A;  3CC4 V;  4MW3 A;  5GW7 A;  3FB6 C;  3GWO A;  3NXS A;  3I55 V;  2IJJ A;  1BL8 A;  1P7B A;  5CBF A;  1VQ8 V;  3LDE A;  1QLE C;  3JCZ A;  3ASN B;  3E86 A;  1MAB G;  3ZRS A;  1S5H C;  3E8H A;  3HPL C;  2ATK C;  5LGU A;  3OW2 U;  4Q20 A;  1OCC B;  2EIN C;  1K92 A;  3RW0 A;  2WLN A;  3CCE V;  3G6E V;  4UUJ C;  3B77 A;  3SYA A;  1W2B U;  1M90 W;  1SRY A;  2M7W A;  3CCV V;  4OXS A;  1EBO A;  2BOB C;  4JYC A;  4I5S A;  1OCO C;  3ABM C;  3B8N A;  1K4D C;  1DF4 A;  1VQ9 V;  3OMI B;  2BOC C;  2Q69 A;  3OEH G;  2EIM B;  1VQ6 V;  3ZRW A;  1PL0 A;  2K1E A;  2Y69 C;  3AG4 B;  2GHY A;  5E1A C;  5CA3 A;  2HR3 A;  3A0R A;  1YIJ V;  3CYO A;  2OCC B;  3ZMV A;  1GM8 A;  2C2A A;  4ZKI A;  4FMT A;  3AEI A;  4ZBM A;  1FXV A;  4X8A A;  1KP3 A;  1VQ5 V;  1QVF U;  5H6Q A;  3R65 A;  4DO2 A;  3E2E A;  4WFB V;  1YSC A;  4LCU C;  2ZR3 A;  3UM7 A;  2P7T C;  1S77 D;  2P67 A;  2ZXW C;  3OMN B;  2JJ1 G;  2XND G;  4QNH B;  3K03 A;  5KA6 A;  4JYB A;  1I5Y A;  2XAS A;  2X0L A;  5IDJ A;  4R50 A;  1JX9 A;  3LUT B;  2QM8 A;  3E8G A;  1RPO A;  4MVU A;  1EFR G;  3TK1 A;  2DYR C;  1K3E A;  3ASO C;  1ARO P;  1FXK B;  2ZDI A;  4BAY A;  5FL7 G;  4GX2 A;  4JTA B;  3AG1 C;  3AG2 B;  3ZMT A;  3SPJ A;  1JCH A;  3K06 A;  3T1C A;  3G71 V;  1V54 C;  3ZN1 A;  1JQ0 A;  3W7X A;  2EIJ C;  3W7T A;  1M57 B;  1OCZ C;  1OZ0 A;  2W6I G;  4QPK A;  4MTF A;  1UJW B;  2WLI B;  2QTO A;  4XBF A;  4PA7 A;  2LFS A;  2EIL B;  1K9M W;  2WPD G;  1KD1 W;  1YIT V;  5L3C A;  2UXN A;  4N21 A;  1AJQ A;  1M1K W;  2HJF C;  5HFL A;  5IY5 C;  2F43 G;  1EZJ A;  2EZP A;  2X6C A;  1PNL A;  3LNM B;  4XDK A;  2QM7 A;  2XAJ A;  1K5S A;  2DW4 A;  3DTU B;  2DQ0 A;  3K08 A;  1AJP A;  2A79 B;  2JJ2 G;  4MVS A;  1XL4 A;  2JIZ G;  3K0G A;  4TT3 G;  5L3F A;  2ITD C;  3TCU A;  4DXW A;  2QA4 V;  2GSM B;  3SYO A;  1BMF G;  5EC1 C;  2Y48 A;  4J9Z B;  2HVK C;  3W7W A;  5EC2 C;  3ABK C;  1G8M A;  1TUE B;  2EJR A;  1FS0 G;  1DTO A;  2H94 A;  2OT5 A;  3GB7 C;  4MSW C;  4MVQ A;  1NR1 A;  2ZQM A;  4H33 A;  4Z1M G;  1R73 A;  1ENV A;  4P30 A;  3T2M A;  4MVM A;  3LDC A;  1OHH G;  4RUF A;  5EBM C;  1G4Y B;  2X6B A;  3ASN C;  4QE7 A;  3I56 V;  2XAH A;  3K79 A;  4XDJ A;  4BIZ A;  2P90 A;  1AI4 A;  1OCC C;  1ROP A;  5IYB O;  2HG5 C;  4PA9 A;  4LC1 A;  1R3J C;  1S3J A;  4JAV A;  3LSS A;  3OM3 B;  1NVP B;  3LSQ A;  4JTC B;  3QNE A;  4HZ3 A;  4MTO A;  3CC2 V;  4HAM A;  2JEX A;  3ETD A;  3P30 A;  4KUM A;  1NBM G;  3JD3 A;  1GM7 A;  2JK5 C;  4WFE A;  3ZRW B;  4UV9 A;  2Q6A A;  2YEV A;  1DLB A;  2EIM C;  3OR7 C;  3CCU V;  1E1Q G;  5LBQ A;  5B3S B;  3WG7 B;  1RM1 B;  3AG4 C;  1AJN A;  3JYC A;  3SJQ C;  2HVJ C;  5IYD O;  1AI6 A;  2OCC C;  3JD1 A;  3CPW U;  5DN6 G;  2CK3 G;  2DWD C;  1MG1 A;  4FJC C;  4RQF A;  1R6N A;  1AI5 A;  1QR8 A;  1H2G A;  1FXH A;  2XAF A;  3K04 A;  2DWE C;  1KKD A;  3E35 A;  1F51 A;  1OCR B;  1K7D A;  1IXM A;  1R3K C;  4MW8 A;  4UV8 A;  2Q67 A;  3OGC C;  3CCQ V;  2IU0 A;  4ASU G;  3D36 A;  3UKM A;  1JJ2 U;  2ITC C;  3ZRX A;  1K73 W;  5L3G A;  4FIP C;  5EK0 A;  4PDR A;  3ZMZ A;  1P4R A;  3VBB A;  2IH3 C;  3ABL B;  3IC7 A;  1AI7 A;  3K9A A;  3SYP A;  5CN0 A;  5B1N A;  1FXK C;  4U7O A;  3CXC U;  4G28 B;  2W0F C;  3AG2 C;  1VQL V;  2JEU A;  1E1R G;  3EHB B;  4JPR A;  3ZIA G;  3F7Y C;  2NNU A;  1GMG A;  2P6J A;  4KP4 A;  5H9C A;  3ABT A;  5LHH A;  3ABU A;  5B1A B;  3CC7 V;  2W6J G;  1S72 V;  1M57 C;  3K0D A;  4H37 A;  1Q82 W;  2XOK G;  2KB1 A;  1SET A;  1Q81 W;  2B1G A;  2QKS A;  1SER A;  4R8C A;  3RBZ A;  2EIL C;  3ZN0 A;  5CMU A;  1J95 A;  1QR9 A;  3FYE B;  1NVP D;  2R9I A;  1K34 A;  1Y66 A;  4P2Z A;  4PDL A;  1NJI W;  3LDD A;  5B1B B;  1B6Q A;  1Q86 W;  4WF9 V;  1QVG U;  3JD4 A;  2EIK B;  1NR7 A;  4WFF A;  3OFN G;  4MTG A;  5L3B A;  1JOY A;  4MT8 A;  2ZR2 A;  1S0V A;  2Z3Y A;  1M56 B;  4PEL A;  3OUS A;  1K8A W;  1GK9 A;  1ZWI C;  2ZD9 A;  4UVA A;  3OE7 G;  2WWW A;  3FKS G;  1F4M A;  2YSU B;  2IH1 C;  3QO7 A;  5KUK A;  3ETG A;  4PDV A;  3AG3 B;  3ZCC A;  4RQE A;  1KQS U;  2QEX V;  4YXW G;  4JAU A;  5CBG A;  5IYC O;  3EFF K;  3OAA G;  5LHI A;  2WLH A;  3CME V;  2LFR A;  3G4S V;  1BHA A;  3IFX A;  2IJI A;  4JGS A;  5LGT A;  1PD3 A;  1Y4M A;  1R6K A;  5EBW C;  4G27 B;  4QE9 A;  4PDM A;  3W7S A;  2NLJ C;  1THZ A;  1BHB A;  4JAS A;  1F23 A;  2DYS B;  3CCL V;  1CPY A;  1YHQ V;  4UXN A;  3IGA C;  4QIW F;  1QLN A;  4WFH A;  3QO8 A;  2HFE C;  3RVY A;  1M9N A;  1ORQ C;  2HKO A;  1KP2 A;  1YJW V;  3X2Q B;  3OUF A;  3RVZ A;  5LGN A;  1W0K G;  1W0J G;  3M99 B;  3FB8 C;  2WSS G;  4F4L A;  1FFT B;  2WAM A;  4WFA V;  2V7Q G;  1HWY A;  3STL C;  4U7N A;  2IW5 A;  3ZMS A;  3MHH C;  2AHZ A;  2EZO A;  3SPI A;  3H01 A;  2YEV B;  1GO3 F;  4RUE A;  3OR6 C;  3ZMU A;  1QCE A;  3W7U A;  4PA4 A;  5B3S C;  3WG7 C;  1E79 G;  5KA5 A;  4TSF G;  5H6R A;  1RM1 C;  2DQ3 A;  5DM6 V;  4R6Z A;  1DF5 A;  2WLM A;  3SPG A;  4X88 A;  1QLE B;  4J9Y B;  2JDI G;  4I9W A;  3CD6 V;  5C93 A;  1K5Q A;  2D3O W;  4G2K A;  1I5X A;  3CCM V;  2EIN B;  1GKF A;  3FB5 C;  2IJK A;  4PA6 A;  3B8M A;  2B1I A;  1OCR C;  1VQK V;  4WCE V;  1NH2 B;  4QPJ A;  2OTL V;  4RAI A;  1SES A;  4BIU A;  2UXX A;  2AHY A;  1VQN V;  5B1O A;  5EBL C;  4TWK A;  3ZRV A;  2EBO A;  1CP9 A;  3CCR V;  1YI2 V;  1OCO B;  3ABM B;  1L1F A;  3ABL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...