4HYOA

Crystal structure of mthk pore
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title The voltage-dependent gate in MthK potassium channels is located at the selectivity filter.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport
total genus 31
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hyoA00
2X6BA 3X2QC 1ZWIC 4PA3A 3SPCA 4P2ZA 1G4YB 4PDMA 3IGAC 3ASOC 3T2MA 2WLIA 3T4DA 4PDLA 3TCUA 1M56C 3ASNC 3E89A 4MTOA 4RO2A 5B3SC 3BEHA 4MW8A 2QTOA 2QKSA 2W0FC 1V54C 2HVJC 4TWKA 3IFXA 4JTDB 1J95A 1XL6A 3LUTB 3LNMB 4PDRA 4MTFA 3HPLC 3SYOA 1P7BA 2ZD9A 5CBHA 4WFGA 5KUKA 3STZC 3OUSA 4BW5A 3K0DA 1ORQC 4R7CA 3E8BA 2WLMA 2AHZA 2YEVA 1S5HC 2DYRC 4RAIA 3K03A 4HZ3A 3SPGA 4R50A 4XDJA 4P30A 3ZRSA 4WFHA 4JTAB 2Q68A 1OCCC 2AHYA 5IY5C 3PJSK 4PDVA 4DXWA 2K1EA 3ZJZA 3E86A 4J9ZB 4MVQA 4R8CA 1K4CC 2EILC 3RVZA 2DYSC 3OGCC 2A79B 1OCRC 4LCUC 2IH1C 4MVSA 4LP8A 4MSWC 4EKWA 2WLLA 3E8HA 1M57C 3UM7A 3F7YC 2ZXWC 2WLNA 3LDDA 2H8PC 3ABKC 2A0LA 2EIMC 3E83A 3FB6C 2KB1A 1R3LC 4JTCB 4X88A 5EC1C 5EK0A 3AG3C 3OR7C 3SPJA 1LNQA 3F5WC 4P9OA 5EC2C 1QLEC 3KG2A 4ZBMA 4G28B 3LDEA 5E1AC 3RW0A 2HG5C 4CBCA 2EIKC 5KUMA 4MTGA 1R3KC 4QE7A 2Q67A 3RBZA 2ITDC 2X6CA 1R3JC 1K4DC 4LBEC 3SYAA 4QNHB 5BZBA 5CBGA 2OCCC 2BOCC 3GB7C 3SPIA 2EIJC 3TETA 1OCZC 3ABMC 2WLIB 1V55C 2ITCC 4GX5A 2JK5C 2NLJC 3F7VC 3K04A 4MVRA 4H33A 3UKMA 2Q6AA 4R6ZA 2EINC 4RUFA 3FB7C 4X8AA 3SYPA 2R9RB 4P9PA 4MW3A 5EBLC 5B1BC 3K0GA 1R3IC 3EFFK 3VOUA 4F4LA 4GX2A 3AG2C 2ATKC 4J9YB 3T4ZA 5CBFA 2Y69C 3SYCA 3K06A 2IH3C 1KKDA 2A9HA 4GX1A 2X6AA 3OUFA 4GX0A 4KFMA 4MVZA 4MVOA 4PA7A 5B1AC 2HJFC 3RVYA 2WLHA 3K08A 3LDCA 3STLC 3OR6C 4RUEA 2WLKA 4WFFA 4MVMA 3T1CA 2P7TC 2DWEC 3E8GA 1XL4A 1OCOC 3R65A 4WFEA 3ABLC 3WG7C 4XDLA 4PA4A 2BOBC 4QE9A 5EBWC 3SJQC 2HFEC 3E8FA 4G27B 2Q69A 2WLJA 3FB8C 1JVMA 4X89A 4PA9A 4HYOA 5EBMC 3FB5C 4MVUA 4UUJC 3AG4C 3JYCA 1BL8A 4I9WA 3SPHA 2WLLB 5J9PC 3AG1C 4H37A 4MS2A 4OXSA 2HVKC 2DWDC 4PA6A 4XDKA 3SYQA
chains in the Genus database with same CATH superfamily
4NKGB 4RQFA 4UV9A 3TGUH 1CEZA 1H2NA 4JI4O 1JCHA 1IZ3A 4MW8A 3HKDB 3ZMVA 1HR0B 2ZCEA 3BFRA 3RN4A 3L74H 5L3DA 3SYOA 4BWAA 2F4VO 3CCQV 2Y4UA 2KQXA 5CBHA 4CH5A 4K8XA 3OMNB 4LH6A 2X7RB 2AHZA 1MOFA 5GONA 3QO7A 2CH7A 3M99B 2QWRB 3W7WA 4LP8A 1IXMA 2Q8VA 3GVMA 1M57C 4X1YA 3F7YC 4ZI7A 1QU7A 3ABKC 5EK0A 3D3IA 1IBLB 4NYKA 5EC2C 4NVPA 4PV1B 3RW0A 2FKXA 2YI9A 5DEDA 1ZL8B 2Q67A 4ABMA 5IYZA 4OPAA 4J80A 4EB6A 1K7DA 4I55A 2CTQA 4PJ0Z 4K0KO 1UFIA 4GYCB 4JI0B 2JGDB 2EINC 4X62B 3JASB 3QTCA 2OIGA 2F93B 1T5EA 1IBMB 1THZA 2LP7A 1QR8A 3JATB 5LBQA 5DM6V 2XOKG 2H94A 2WLKA 2UUCB 2P7TC 3B2EE 3B8NA 1GRJA 4PD4F 2E75B 1GK9A 4FM2A 4GCZA 2QM4A 3RYFB 4JZ2A 3VQVA 4KL1A 3QO5A 3CEIA 5J9PC 3AG1C 1FAFA 4J11A 3HKCB 1FS0G 1Q6UA 1Y76A 1XMQO 4DV2B 1O9HA 1G4YB 1YXBA 3CC2V 4JI6O 1SERA 1KP3A 3I56V 4I5SA 1YCIA 4MTOA 2UUAO 1HNZO 4JI3O 5IJ9B 4RWUA 2BSKA 1U97A 4KHPB 2ZD9A 3D36C 3EVKA 3W7XA 5LYJB 3JSNA 3OE7G 2P5OA 1US6A 5B3SB 2RNBA 3P30A 4XDJA 4P30A 3DTUB 4J7KA 3A2FA 3PJSK 4DV0O 2YIBA 3WU2Z 1K73W 3ZMUA 4I4TA 3L9DA 1BE3H 4LFAO 3K3WA 4OX9B 4TUYB 2UU9B 1R3LC 2QTSA 4DV7B 5KAFZ 5HFMA 3HR0A 1NH2B 4CBCA 5D5QA 4UB8Z 2HEPA 3N2KB 1K34A 2UXXA 5B1BC 3K0GA 1CPYA 4J9YB 5J2TB 3JAWB 2YSUB 3OUFA 2ZNJA 4PA7A 4K35A 3H9VA 1AI4A 3LDCA 3OR6C 1Q90D 2YEVB 3ZHTA 1JJOA 1Y6XA 1ZTEA 3JSLA 1A32A 4PELA 1I5XA 1Y67A 4WFBV 1EFRG 1GN4A 1J5EB 4DUYB 5LXTA 4PA9A 1F7YA 4PI0A 3K79A 1BL8A 4D7TA 1JMKC 3SYQA 3WG7B 5JJJB 1OHHG 4FJCC 3LSUA 1BHAA 3N27A 1WP8A 3CMEV 1DGSA 3P3NA 1JFFB 2VQFB 5K1XA 3OMAB 3A0BZ 3CS5A 4B3SO 1G6UA 2YDEA 4WFGA 1TAEA 3K58A 4BIZA 4EEQA 1VQ4V 1RSOA 5LP6C 2DYRC 3ASNB 4FLYA 2ILMA 4JGSA 4O4HA 2ZINA 1WA8A 1XUQA 3FAVB 2IJKA 4DV6B 3G6BA 1NT2B 4MVSA 5B5EZ 1Q82W 5FNVB 3C3SA 4H44B 3DSQA 3JD2A 4EFEA 2A0LA 2GTAA 4BW5A 4DRXA 4I0XA 3T1HB 3G67A 3CC4V 1FD9A 1U96A 3ZN0A 2PY5A 3KCXA 1OCZC 4UVAA 3KZIZ 1M90W 3VOUA 3C90A 3EFFK 4GX2A 1BSMA 2JJ2G 5KHGA 4O2AA 1AR5A 4JI5O 4MVOA 3S3XA 1VQMV 1OV9A 2ZE5A 4FPPA 4X1KB 4JZGA 3AG7A 3ZBHA 4LF4O 1VQ6V 2Y69B 4DR2B 3JCUZ 1YI2V 4KP4A 5KHJA 2NN4A 3JAKA 3WB1A 3ASOC 4LFCO 3OM3B 5ITZA 1PM9A 3F5TA 5J2UA 1NVPB 4X64B 3AG4B 1OJHA 2JDIG 1P84F 1I0HA 4YJ3A 4DO2A 1VQKV 5LA6A 1S0VA 4O2BA 5CB4B 1S5HC 1YF2A 3K03A 5LGUA 1H2MA 4YIOA 1N32B 4ZOLA 5IY5C 1PL4A 3CRAA 1KC8W 2F1MA 3JCZA 4WBNB 1Q3EA 1MNGA 2P67A 2A7WA 3AG3C 3L71H 1B04A 1GMGA 2B9ZA 4B7EA 1DTOA 1S72V 4FM0A 2OIEA 3DC5A 4IYHA 2UXBB 4FVMA 3SYAA 2ITDC 2X6CA 1YEWA 4FLTA 4KHPO 2OCCC 5GTIZ 2YXLA 2JVDA 5LMNB 4DV1B 1YIJV 3UT5A 1SQXH 4JASA 4R6ZA 1YJNV 1SC5B 1TVKA 5HFLA 1H2KA 1R1BA 1P7GA 2PI5A 2CE4A 3ZIAG 5EBLC 4CH6A 3QVNA 2CTPA 3H1LH 5IWAB 4X65B 1B3QA 1FKAO 3UQ8A 4TOIA 4I50B 5H6QA 4H13B 1AR4A 3BVOA 1SA0B 5EBMC 2Q73A 3W7SA 3CHXA 1TUBB 2VWKA 3RBZA 4UCUA 1JX9A 4CH4A 3LSQA 4FLVA 2ZT9B 3U0ZA 4JV5O 1TGOA 4BIUA 4DR3O 4I7ZB 3OTFA 2KG7A 4F6RA 1AP6A 3SGIA 1D5AA 2EJRA 3HPLC 4JYAB 4AQYO 3FYIB 1S3JA 2DQ0A 3CJHA 3RYHB 4LNUA 3ETEA 3BPZA 2OT5A 4FK5C 3ZHQA 2QGNA 4B3TO 2Q68A 1N33O 3CX5F 1FXKA 2HLDG 1N36B 5BMVA 3Q4HA 3JALA 1YJ9V 2ZXWC 1EM1A 4JI2O 2KB1A 2YIAA 1RM1C 4J7JA 3GWKC 2XNDG 3OGIB 1NTZH 3KG2A 1RP3B 2EIKC 1ZUQA 2NR5A 5EIBC 3ZRXA 1COWG 2LGWA 3ABTA 2VQEO 1EN5A 1K9MW 3MAQA 3ABMC 1WPXA 2OWOA 5CA3A 2QSAA 4H33A 4P9PA 2DW4A 3HKBB 4X1YB 2HHHO 1XDCA 3L75H 5IJ0B 1AI5A 3CWBH 2EULA 2X6AA 2QKAA 4DYLA 5CBFA 4MVZA 4DV6O 2HJFC 3RVYA 2WA4A 3H1HH 1AR1B 2YIBD 4F6EA 5F2VO 3FYEB 1YTFB 1PD3A 1H38A 3FFQA 4O4LA 5L3CA 3E22B 1WJZA 1HNWO 1YHQV 1N0JA 4XDKA 2DWDC 3E89A 1W2BU 2PYJA 3L73H 3ETQA 3SDLA 1SQFA 2GTSA 4JAAA 1VP7A 1ZSPA 5LP6A 1DLBA 3RYIB 4KUMA 4LFBB 1BCCH 3HKEA 3CXHF 2ZE7A 2Q5ZA 4DV5O 5IYBO 3CB2A 3CD6V 3T1YB 2PGGA 4YJ2B 4MTXA 4JI1B 1M56B 4RAIA 1WLEA 1YDXA 4FM1A 1AROP 1RPRA 1GN6A 2K1EA 5C93A 4DR7B 3ZCCA 4WFAV 5C8YA 1R6TA 1Y74B 2P90A 2ZQMA 3UM7A 1QR9A 2OYQA 4TV9A 2HP8A 2F43G 3E83A 2EIMC 2ZIMA 3K5LA 1Q86W 2EX3A 1OCCB 4LF5B 3F5WC 4NXMB 2IU0A 4X64O 2EILB 4ICGA 4DR1B 3J81N 4MTGA 1NR1A 1DF5A 5BZBA 5CBGA 3CYOA 3DC6A 2CK3G 1MZFA 4JAVA 2ITCC 2NLJC 3BA8A 4B3MO 5JJEB 2PYLA 4N21A 1D2DA 5EIBD 1NZ6A 4RUFA 4C7UA 3ZX6A 5H9CA 4MW3A 4L87A 1N32O 4IIJB 2XAHA 3A8TA 4LWSB 2UXCB 3OTOB 2WLHA 1V55B 3FKSG 2GHYA 3STLC 1HDJA 2QJ1A 3G71V 4D7SA 4DV3B 2RCVA 3E8FA 4DW0A 2ODMA 2Q9LA 4U3JB 3CCJV 4X89A 4GKKO 4RQEA 1CP9A 5B1AB 4UCRA 1VF6A 2UXBO 1I94B 3N2GB 1OZ0A 2WLLB 1K5SA 1LUWA 4YHHO 2DOSA 3ABLB 2XTAA 3T4DA 4X66O 4LF9O 1URFA 3L70H 4NXNO 4HAMA 3J80N 5JCOA 4J42A 3IFXA 1VF7A 1NU1H 2K9PA 3ML0A 4UCTA 1NH2D 4L8JA 4I9QA 2WLMA 5KMGA 3ZRSA 1FXVA 3GWOA 5KX5A 1PNKA 1KUQA 4J10A 2QM7A 5FPRA 1N4CA 4DUZO 1MSWD 2CTWA 1K33A 1S77D 3QG5A 4MVQA 3PN1A 1Z5WA 3WB0A 5JQGA 3LDDA 1H2LA 1JA8A 5JWPA 5LOVB 2O57A 1EBOA 5CA1B 3BCCH 1K97A 2ZNIA 3HKDA 1F4MA 1GM9A 4DV4B 4JYAO 1VARA 3GB7C 3CCLV 2GUZB 4EFBA 4PI2A 2Q6AA 4DR4O 1QLEB 1FJGO 4IYIA 4G2KA 3K9AA 1S5JA 1FXKC 1IBKO 2ATKC 4YY3B 3AEIA 3QF7A 3VQWA 4DRXB 3OFNG 4GX1A 4QPKA 3R66A 2CGOA 3T1CA 2ZR3A 5KAIZ 5EZYB 5JVDB 1NI8A 1N34B 4GKJO 3DXRA 1VQNV 5BR8B 4G27B 2Q69A 5BY1A 2E3CA 3CSXA 3RGBA 2P6JA 5JH7A 2Q4PA 1XEQA 5TISZ 4FZ0A 1K5QA 1ZL8A 4GLXA 3WFVA 4E2LA 3JARB 4PDRA 5H5NA 1NR7A 2F23A 2N74A 1I5YA 1MSDA 3B8MA 4BAYA 2JGDA 2L35A 2ZDIA 3JASA 2UXDB 2QKSA 1G1XB 1AJQA 1QHTA 2R9AA 2UUBO 3UO2A 3LNMB 1NJIW 4JAUA 1P7BA 5KUKA 4O4IB 2OTLV 5IYDO 4HZ3A 3I5DA 1FFTB 2XHBA 2ZE8A 3JAKB 3D8CA 4ZHQB 2AW9A 2DYSC 3RYFA 2XT9A 2IH1C 2YXHA 1GN2A 4LH7A 2V1DA 1PV0A 3HKCA 1FFXA 4LF6B 2EBOA 1X59A 2JJ1G 2YUAA 5BXZA 4LFBO 1QQCA 3QO8A 2GV9A 2QWPB 3G6EV 2EIJC 3TETA 3T1YO 2WLIB 4LF7B 1UPGA 1O9GA 4LC1A 1ZX3A 5LYJA 1B06A 3CCVV 3B4SA 2Z5UA 5LGTA 1L0NH 2JIZG 2PF4E 4W4LA 1KU9A 1VMGA 2Q0OC 1F4NA 1JQ0A 4PHZA 1HR0O 4TV8A 1SQQH 1SZXA 2EINB 3ZMSA 1IURA 4LF5O 2W6IG 4TUYA 2HFEC 4NXMO 1G8MA 5DN6G 5CA0B 2NNUA 4H37A 1M93A 2YI8A 4PA6A 2HVKC 4JF3A 2VS0A 3N2KA 3X2QC 5FPOA 4PA3A 3KKYA 1HWYA 2C2AA 3SPCA 1EN4A 3OT7A 4YXWG 4O4JB 4RO2A 1SRYA 1XILA 4IL6Z 1V54C 1IBLO 3AG2B 3AG1B 3BHPA 3OTOO 5J2TA 2CAZC 1QCEA 1XNQB 1ROPA 3OUSA 1AJNA 4CC5A 2YEVA 5K1PA 1NTKH 1GM7A 4FZ1A 1KYOF 1PKXA 4JI0O 1RPOA 4X62O 2R72A 1VF6C 1FXHA 1OCRC 3MD0A 4J7ZA 4EKWA 1S76D 4GUNA 2XAJA 1IBMO 3WB2A 1AI7A 2H8PC 3FB6C 3G80A 3OR7C 3ZS8C 4FLXA 2UUCO 4P9OA 4JI7B 3CCEV 4Q20A 4X1IA 1N8RW 2F4VB 3HB3B 4UFZA 1JFFA 5JCOC 4DR6B 2N05A 2XAFA 4LBEC 1R3JC 1QLNA 1Z2GA 2P4KA 2Q7EA 4CS2A 2JK5C 5B1NA 2XAGA 4FFBB 4DV2O 4TQDA 4W4KA 1TA8A 3K06A 2IH3C 1GM8A 1F51A 1XHXA 3FAVA 5H6RA 2QDOA 1PNLA 2LQTA 2ADPA 2CDYA 5FNVA 2F66C 1OCOC 2XASA 1JOYA 5B1BB 5EBWC 4X9QA 1H2GA 1M1KW 3FB8C 3MDSA 1W59A 2ZM6B 4UV8A 3E35A 1GH6A 3RYCB 4HNAB 4MT8A 4AI8A 5KLVH 1KMIZ 1VQ8V 2N04A 4PDLA 2VWJA 3JAMN 1SKVA 2QEXV 3CRMA 4OX9O 3M7MX 3ZRWB 2UU9O 4TQFA 4DV7O 2HVJC 5A9GA 1DK1A 5EYPB 2BTQB 4CS4A 2IJJA 3BAAA 3STZC 4H0LB 4X1KA 2FMLA 1N34O 3A0HZ 4JTAB 5BR8O 4PDVA 4Z2WA 1NTMH 3APOA 4J9ZB 2PZSA 2IBZH 2Y4TA 5FL7G 5IT9N 2DYRB 2Q7HA 2WA3A 1HNZB 3ZEDA 3HKEB 3ZN1A 4JI3B 2ZDIC 3K5OA 2HG5C 2VRZA 1BZKA 1J5EO 4WF9V 1KECA 4DUYO 2P06A 2LGQA 3CP1A 1KBHA 3P3PA 2ZE6A 3ZHRA 2OTJV 3W7UA 3CRQA 3UKMA 5LL6Y 2Y48A 2JEXA 4DV0B 5CB4A 4U7NA 4X8AA 3K5MA 3DGEA 2RJZA 3ZHUA 1KKDA 4LFAB 1OCZB 1FYJA 3OEEG 2QWNB 3K08A 2VQFO 1QVFU 5GONB 4WBNA 2RMKB 2EZPA 3E8GA 1VQPV 2CH7B 1KB9F 2CGNA 3K57A 3CC7V 1BGYH 1SQBH 4JYYA 3CRCA 1SETA 2F95B 1HW7A 2WAMA 4GZRB 3L72H 2E76B 3I55V 4ZI7B 4FLZA 2Q7GA 1KKCA 4P2ZA 4NR1A 2IW5A 4PDMA 2FTKA 5B3SC 2QWQB 2WWWA 3P32A 5IYZB 3T1HO 3B77A 3IC9A 3AK2A 4MTFA 4EB6B 1VQOV 4I55B 5KA5A 1EN6A 3ASOB 4I50A 2B1IA 3EXAA 2ZKOA 3MHSC 1XOUA 3ZMZA 2AHYA 4AHCA 1SA0A 2A79B 2X0LA 4LCUC 3B09A 1TUBA 2QR4A 4JTCB 4B3RB 1L1FA 4FIPC 5IY5B 3CCMV 4G28B 5KA6A 4B3SB 1WPBA 1HNXB 1R3KC 2QA4V 4DR2O 4K3AA 3LNNA 1Y76B 2AZ0A 3AG3B 2YICA 3K04A 3RYHA 1K3EA 3ZMTA 5JQGB 3SYPA 1IDSA 1BHBA 3JD0A 2BSKB 3OMIB 3ETGA 2OCCB 4KFMA 1ZAUA 2LFRA 3ICXA 1SS3A 1Q81W 3R65A 3WG7C 3NXSA 4JI7O 2XAQA 1VQ7V 1PL0A 2A3QA 4I4TB 4MVUA 5GW7A 4A5UB 5JJNB 4DR6O 1M9NA 3BRCA 3VQXA 3JYCA 1ENVA 4UB6Z 1TUEB 1BQ0A 2UXNA 1WP7A 4BR6A 3ETDA 4JI5B 3ASNC 4KXRA 1BQZA 4U3FH 3H01A 2W0FC 2B5UA 3HKBA 4JTDB 1XL6A 1E79G 1M5IA 5IJ0A 3LSSA 3IAYA 3DXRB 1H2SB 4ZIBA 2QKCA 4LF4B 4JPRA 3ABUA 4OPHA 1EZJA 2BCCH 1W0KG 5JH7B 4WFHA 1NQTA 5H2FZ 5LMNO 4DV1O 4X20A 4N23A 2A06H 2ZM6O 3RVZA 3IC7A 3CE2A 2PTMA 3C3TA 3E22A 4IHJA 3SR2C 1GAXA 4LFCB 5GTHZ 5IWAO 1R6KA 4X65O 1IXBA 3SPHA 4UVCA 1R73A 3SPJA 5LXTB 1E1QG 1Q43A 3RYIA 1PP9H 2EZOA 2Z0AA 3D3QA 2ZXWB 4JYBA 1M4UA 2BOCC 3TXSA 4UXNA 3UCSC 1SZTA 1RM1B 1JPXA 1W0JG 2W0XA 2LW1A 4YJ2A 2CUGA 4UVBA 1Q6IA 2IJIA 1DF4A 2EIKB 2Y0PA 3AG2C 1BMFG 2Y69C 1AVMA 3ZHSA 3CCSV 1FFXB 3M8AA 2H3OA 3ABMB 5B66Z 3AK3A 1RSOB 4MVMA 3UO3A 2MW2B 1Y74A 4WFEA 4FLUA 4XDLA 4O4HB 3SJQC 2V7QG 2QE7G 1L8DA 1WA8B 1AB3A 1AILA 1GN3A 4DW1A 1VF5B 2KSDA 2DN9A 1JJ2U 3AG4C 5B1OA 4WFFA 1QNMA 5L3EA 1VQLV 4FFKA 1N36O 4AILC 2ADQB 3BA9A 4I0XB 3OD4A 4OGQB 1B6QA 2W6JG 2RDCA 4TV8B 1LUVA 4TWKA 1J95A 1NS1A 2LO1A 4IIJA 1I7FA 4LWSA 2ETNA 2R70A 3TK1A 4Z1MG 2FB5A 2JGUA 3K0DA 3K9SA 1XMOB 2CTRA 1Z5VA 2AGAA 4O2AB 1NKDA 1H8EG 1SQGA 4U3JA 2LJ2A 3OGCC 4JV5B 4UCVA 5L3FA 4JYCA 5D5PA 4MSWC 2Z3YA 3N2GA 2JRIA 2WLLA 4DR3B 3APQA 3JATA 2R9IA 1I08A 2G38A 1Q8IA 4ZBMA 4QIWF 4QGPA 4AQYB 1AP5A 4QE7A 1JR9A 4BIOA 1E1RG 1F23A 3H1IH 2EIMB 2OCHA 1XNRB 4B3TB 1N33B 5ITZB 2DMXA 3FX7A 5J2UB 2B1GA 4JI8B 1SQPH 4ZKIA 2HJDA 4YJ3B 1GTOA 2GDSA 4GX0A 5L3GA 1SESA 4JI2B 1FPOA 5LA6B 4CZZA 4RUEA 4O2BB 4X1IB 3AK1A 4DK1A 5CN0A 3RFRA 3CPWU 1M57B 5IJ9A 4B3RO 4PA4A 3ABKB 5LOVA 4ZOLB 2VQEB 2WLJA 2AXTZ 4QPJA 4JI1O 5CA1A 3RT3C 2PUSA 3W7TA 4UUJC 1HNXO 1WAZA 4NTWA 4LF8B 4I9WA 4DR7O 2PI4A 2FL4A 4WCEV 1ZWIC 3B40A 2GUZA 1NVPD 3IGAC 2HHHB 3TCUA 1XQ8A 4IGGA 1WB7A 1Q5OA 2QTOA 3VQYA 3U11A 1KP2A 5LHGA 1YZBA 4XBFA 4DR1O 3UT5B 1TVKB 4FLWA 4LR3A 5EZYA 3SPGA 5JVDA 5CMUA 2EJ7A 1HNWB 1KQSU 3H1JH 1XHZA 4DR5B 2ZIOA 1AJPA 5IDJA 2E5LB 4TSFG 3O9OA 1GO3F 2UXCO 1VIBA 3JARA 4X88A 5EC1C 3JAWA 3TJTA 3RWRD 5KHHA 4HBNA 4DV5B 1EZVH 4DV3O 1Y4MA 5LMUB 4NTXA 1SQVH 3JD1A 3E2EA 4QNHB 3OW2U 3CMAV 3NR7A 1PPJH 3SPIA 3KCYA 5E79Z 1I94O 2KG7B 4O4IA 4F6RB 4JI4B 1BS3A 1SF9A 2R9RB 1R3IC 4F4LA 3T4ZA 3ZRVA 3SYCA 2YC0A 4ZHQA 2P4VA 2IJHA 3CJHB 4LNUB 1Q6HA 1XL4A 1MABG 1KD1W 2GBOA 2MK3A 4QE9A 1FXKB 3SJCC 3CCRV 5BMVB 1JVMA 2L6LA 3Q4HB 4UCOA 1BT8A 3JALB 1YVWA 3FD9A 3FB5C 1D5NA 1QVGU 3CXCU 1P4RA 4B3MB 1YITV 3K59A 4MS2A 1L0LH 3T2MA 2WLIA 2RQ6A 3QNEA 2QM8A 2DE0X 1M56C 4CH3A 2JEUA 5L3BA 3SJBC 2FYUH 2BE3A 2V4DA 3LUTB 1MZEA 2JS5A 4FMTA 2BTOA 4K8ZA 4QJFB 1V9PA 4U7OA 4DV4O 4K0KB 4GKKB 2XUMA 1CXZB 1OCCC 2RN9A 1S5LZ 3CRRA 4YHHB 3CCUV 4DXWA 3VBBA 3ZJZA 3E86A 2HKOA 4R8CA 2EILC 4NB5A 5FLXN 4YIPA 4YY3O 5CA0A 3E8HA 5LHIA 1K8AW 5DECA 4X66B 4LF9B 3J7AU 4NXNB 4O4LB 3LDEA 5E1AC 4O4JA 2DYSB 5IYCO 2KKWA 4IT5A 4TT3G 1VEWA 1K92A 3A0RA 4CS3A 2ARHA 1V55C 2M6YA 1XMQB 4JI6B 2LFSA 4GX5A 4DUZB 1XMOO 5LP6B 3FB7C 2UUAB 1MA1A 1P49A 1Q7YW 1WB8A 1HP8A 5KHKA 1NBMG 2EIJB 5B1AC 2UXDO 4B7KA 5IE9A 3D36A 1YTFD 2HR3A 2DWEC 1IX9A 5KHIA 3ABLC 2AZ2A 3SJAC 4J41A 3MHHC 3ZHVA 4HYOA 5C8YB 1XBLA 3JD4A 4OXSA 4TV9B 3IJ4A 4DR4B 3H1KH 1FJGB 2D2CB 1XNRO 2X6BA 2M7WA 3JD3A 4UCSA 4ASUG 1IBKB 2QWOB 4JI8O 2YS8A 3BEHA 5A2QN 2YXYA 4FFBA 2IU3A 4LF6O 4DK0A 2DQ3A 1LR1A 2D3OW 3X2QB 1QBZA 4GKJB 1ORQC 4R7CA 3E8BA 2P22C 1IVSA 1YSCA 4E4EA 5LHHA 3OEHG 1WN7A 5AG2A 4R50A 4LF7O 1GKFA 3OAAG 3G4SV 3TXQA 1V54B 3BABA 1MG1A 1N0NA 2DJVA 1K4CC 1R6NA 1XREA 1H8HG 4LF8O 2JS3A 1ZLZA 2GSMB 2ZR2A 1UJWB 3U10A 4GT1A 3RYCA 4HNAA 1Y66A 4CC6A 1X4TA 2WSSG 3THOA 1LNQA 3K5NA 1PNMA 2UUBB 1QLEC 4NTYA 2WPDG 3BY6A 1OCRB 3ZRWA 1VQ5V 5KUMA 3EHBB 1K4DC 2Q0AA 5EYPA 2BTQA 4BW9A 4X20B 2YIDA 3F7VC 4MVRA 2E74B 4IHJB 1VQ9V 1AI6A 4B08A 4DR5O 2Y0IA 1RFYA 2A9HA 2E5LO 3O65A 3S3WA 5LGNA 5KMGB 4D6TH 1MMMA 5KX5B 1XNQO 4Q6GA 2BOBC 4Z1VA 1XI1A 5LMUO 1YJWV 1WNSA 2IM9A 2LW7A 2WLNA 1OCOB
chains in the Genus database with same CATH topology
3LSQA 3X2QC 4PA3A 3SPCA 1HWYA 2C2AA 4RQFA 4UV9A 4BIUA 1CEZA 4YXWG 1B6QA 2W6JG 1JCHA 4RO2A 4MW8A 1SRYA 3ZMVA 1V54C 4TWKA 3AG2B 3AG1B 1J95A 3SYOA 2EJRA 3HPLC 5L3DA 3CCQV 1QCEA 3TK1A 4Z1MG 5CBHA 3FYIB 1S3JA 2DQ0A 1ROPA 3OMNB 3OUSA 3K0DA 1AJNA 2X7RB 2AHZA 1MOFA 2YEVA 3ETEA 2OT5A 1GM7A 3QO7A 4FK5C 1PKXA 2Q68A 1FXKA 1NKDA 2HLDG 1RPOA 1H8EG 3M99B 3OGCC 1FXHA 1OCRC 3MD0A 5L3FA 3W7WA 4LP8A 4JYCA 1IXMA 4MSWC 2Z3YA 4EKWA 1S76D 2XAJA 2WLLA 1YJ9V 1M57C 3F7YC 1AI7A 2ZXWC 2H8PC 3ABKC 3FB6C 5EK0A 2KB1A 1RM1C 3OR7C 3D3IA 2R9IA 2XNDG 4P9OA 5EC2C 3CCEV 4Q20A 1N8RW 3KG2A 4ZBMA 4QIWF 3RW0A 3HB3B 2EIKC 4QE7A 2Q67A 2XAFA 4LBEC 1E1RG 1R3JC 1COWG 1F23A 3ABTA 3ZRXA 1K9MW 1QLNA 2EIMB 1K7DA 3ABMC 1WPXA 5CA3A 2JK5C 4H33A 2EINC 5B1NA 2B1GA 2XAGA 4P9PA 2DW4A 4ZKIA 3K06A 2IH3C 1AI5A 1GM8A 1THZA 2LP7A 1F51A 1QR8A 2X6AA 1GTOA 4GX0A 5CBFA 4MVZA 5L3GA 1SESA 5LBQA 2HJFC 2XOKG 3RVYA 5DM6V 5H6RA 4CZZA 2H94A 4RUEA 2WLKA 2P7TC 1PNLA 5CN0A 1AR1B 3CPWU 1M57B 1OCOC 2XASA 3B8NA 4PA4A 3ABKB 3FYEB 1JOYA 5B1BB 1PD3A 5EBWC 1YTFB 1GK9A 4GCZA 1H38A 1H2GA 1M1KW 2WLJA 3FB8C 4QPJA 3W7TA 5L3CA 4UUJC 4UV8A 3E35A 4I9WA 3QO5A 5J9PC 4MT8A 3AG1C 1YHQV 4XDKA 2DWDC 3E89A 2PI4A 1FS0G 4WCEV 1VQ8V 1ZWIC 1W2BU 3CC2V 1G4YB 1NVPD 3IGAC 1SERA 4PDLA 1KP3A 3I56V 3TCUA 4I5SA 2QEXV 4MTOA 1DLBA 2QTOA 3ZRWB 4KUMA 2HVJC 1KP2A 5LHGA 5IYBO 2IJJA 3CD6V 2ZD9A 4XBFA 3STZC 4MTXA 3W7XA 3OE7G 1M56B 4RAIA 1WLEA 5B3SB 3SPGA 3P30A 4XDJA 4P30A 4JTAB 3DTUB 5CMUA 1AROP 3PJSK 4PDVA 1KQSU 1RPRA 5L3EA 2K1EA 1AJPA 5C93A 5IDJA 4J9ZB 3ZCCA 1K73W 4WFAV 3ZMUA 4TSFG 1GO3F 5FL7G 2P90A 3UM7A 2ZQMA 2DYRB 1QR9A 2WLNA 3K3WA 2F43G 3E83A 4X88A 2EIMC 5EC1C 1R3LC 1Q86W 1OCCB 3ZN1A 3F5WC 5HFMA 2ZDIC 2IU0A 2EILB 1Y4MA 2HG5C 1NH2B 4CBCA 4MTGA 1NR1A 3JD1A 3RBZA 3E2EA 4WF9V 4QNHB 1KECA 3OW2U 3CMAV 1DF5A 5BZBA 5CBGA 3CYOA 3SPIA 3CP1A 2CK3G 2OTJV 4JAVA 2ITCC 3W7UA 2NLJC 3UKMA 4N21A 2Y48A 1K34A 2JEXA 4RUFA 4U7NA 4X8AA 2UXXA 5H9CA 2R9RB 4MW3A 3DGEA 4L87A 5B1BC 3K0GA 1R3IC 1CPYA 4F4LA 4J9YB 3T4ZA 3ZRVA 3SYCA 2XAHA 1KKDA 2YSUB 2IJHA 3OUFA 1OCZB 4PA7A 3OEEG 2WLHA 1V55B 3FKSG 1AI4A 3K08A 3LDCA 2GHYA 3STLC 3OR6C 1QVFU 2YEVB 4PELA 1I5XA 3E8GA 2EZPA 1XL4A 1VQPV 1MABG 1KD1W 3G71V 2MK3A 4WFBV 3CC7V 4QE9A 1FXKB 1EFRG 3E8FA 3CCRV 3CCJV 1JVMA 4X89A 4PA9A 4RQEA 1CP9A 1SETA 5B1AB 3FB5C 2WAMA 3K79A 1BL8A 1QVGU 3CXCU 1OZ0A 1P4RA 1K5SA 2WLLB 3I55V 1YITV 4MS2A 3SYQA 3WG7B 3ABLB 1OHHG 4FJCC 4P2ZA 1BHAA 4PDMA 2IW5A 3T2MA 3T4DA 2WLIA 2FTKA 3QNEA 2QM8A 3CMEV 1M56C 5B3SC 2JEUA 2WWWA 5L3BA 3P32A 4HAMA 3B77A 3IFXA 3OMAB 3LUTB 3ML0A 4MTFA 1VQOV 5KA5A 4FMTA 4WFGA 4QJFB 3ASOB 1NH2D 2B1IA 4BIZA 2WLMA 4U7OA 1VQ4V 2DYRC 3ASNB 3ZRSA 3MHSC 1FXVA 3GWOA 1PNKA 4JGSA 3ZMZA 1OCCC 2AHYA 2QM7A 1MSWD 3CCUV 4DXWA 1K33A 1S77D 3VBBA 3ZJZA 3E86A 2HKOA 4MVQA 4R8CA 2EILC 2A79B 2IJKA 2X0LA 4LCUC 4MVSA 1Q82W 3E8HA 5LHIA 1K8AW 3JD2A 3LDDA 4JTCB 2A0LA 4BW5A 1L1FA 1EBOA 4FIPC 5IY5B 3CCMV 3CC4V 4G28B 3LDEA 5E1AC 1K97A 5KA6A 2DYSB 5IYCO 3ZN0A 4TT3G 1R3KC 2QA4V 1F4MA 1GM9A 1K92A 3GB7C 3CCLV 3A0RA 1OCZC 3AG3B 1V55C 2LFSA 4GX5A 4UVAA 3K04A 1K3EA 2Q6AA 1QLEB 3ZMTA 3SYPA 3FB7C 4G2KA 1M90W 1BHBA 3K9AA 3VOUA 3EFFK 3JD0A 1FXKC 4GX2A 2JJ2G 1Q7YW 2ATKC 3OMIB 3AEIA 3ETGA 2OCCB 3OFNG 1NBMG 2EIJB 4GX1A 4QPKA 4KFMA 4MVOA 5B1AC 1VQMV 2LFRA 4FPPA 3D36A 1YTFD 3T1CA 2HR3A 2DWEC 2ZR3A 1Q81W 3R65A 3WG7C 3ABLC 3NXSA 1VQNV 2XAQA 2Y69B 4G27B 2Q69A 1VQ7V 1VQ6V 3MHHC 1YI2V 1PL0A 4HYOA 4MVUA 3JD4A 5GW7A 1M9NA 2P6JA 3JYCA 1ENVA 4KP4A 1K5QA 4OXSA 3WFVA 4E2LA 4PDRA 2X6BA 1TUEB 2M7WA 3JD3A 2UXNA 1NR7A 3ASOC 4ASUG 3ETDA 1I5YA 3OM3B 3B8MA 4BAYA 3ASNC 1NVPB 2ZDIA 3BEHA 3H01A 2QKSA 2IU3A 3AG4B 2W0FC 2B5UA 1AJQA 2JDIG 4JTDB 1XL6A 1E79G 3LNMB 2DQ3A 3LSSA 1NJIW 4JAUA 1P7BA 2D3OW 3X2QB 4DO2A 1QBZA 5KUKA 1VQKV 1ORQC 4R7CA 3E8BA 1S0VA 4JPRA 1YSCA 1S5HC 3ABUA 5LHHA 1EZJA 2OTLV 3OEHG 3K03A 4HZ3A 5IYDO 4R50A 1W0KG 5LGUA 4WFHA 1NQTA 1GKFA 3OAAG 3G4SV 1V54B 1FFTB 1MG1A 5IY5C 4N23A 1KC8W 1K4CC 1R6NA 3IC7A 3RVZA 1H8HG 2DYSC 2IH1C 2GSMB 2ZR2A 3JCZA 1UJWB 4GT1A 1R6KA 1Y66A 2P67A 2V1DA 3SPHA 4UVCA 1R73A 3AG3C 2WSSG 3SPJA 1LNQA 2EBOA 1GMGA 1E1QG 1PNMA 1DTOA 2JJ1G 1S72V 1QLEC 2WPDG 3BY6A 1OCRB 2EZOA 3ZRWA 1VQ5V 3QO8A 5KUMA 3EHBB 3SYAA 2ITDC 2X6CA 1K4DC 4JYBA 2ZXWB 2OCCC 2BOCC 4UXNA 2EIJC 3G6EV 3TETA 1SZTA 2WLIB 1RM1B 1JPXA 1YIJV 1W0JG 3F7VC 4MVRA 4JASA 4LC1A 4R6ZA 1YJNV 5HFLA 4UVBA 2IJIA 3CCVV 2Z5UA 2PI5A 1VQ9V 1DF4A 5LGTA 3ZIAG 2EIKB 5EBLC 1AI6A 2JIZG 3AG2C 1BMFG 2Y69C 3CCSV 2A9HA 1F4NA 3ABMB 1JQ0A 4MVMA 5LGNA 2EINB 3ZMSA 4WFEA 4XDLA 2W6IG 2BOBC 5H6QA 3SJQC 2V7QG 2HFEC 2QE7G 1G8MA 5EBMC 3W7SA 1JJ2U 3AG4C 5DN6G 1YJWV 2NNUA 5B1OA 4H37A 4PA6A 2HVKC 4WFFA 1JX9A 4JF3A 1OCOB 1VQLV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6B A;  3X2Q C;  1ZWI C;  4PA3 A;  3SPC A;  4P2Z A;  1G4Y B;  4PDM A;  3IGA C;  3ASO C;  3T2M A;  2WLI A;  3T4D A;  4PDL A;  3TCU A;  1M56 C;  3ASN C;  3E89 A;  4MTO A;  4RO2 A;  5B3S C;  3BEH A;  4MW8 A;  2QTO A;  2QKS A;  2W0F C;  1V54 C;  2HVJ C;  4TWK A;  3IFX A;  4JTD B;  1J95 A;  1XL6 A;  3LUT B;  3LNM B;  4PDR A;  4MTF A;  3HPL C;  3SYO A;  1P7B A;  2ZD9 A;  5CBH A;  4WFG A;  5KUK A;  3STZ C;  3OUS A;  4BW5 A;  3K0D A;  1ORQ C;  4R7C A;  3E8B A;  2WLM A;  2AHZ A;  2YEV A;  1S5H C;  2DYR C;  4RAI A;  3K03 A;  4HZ3 A;  3SPG A;  4R50 A;  4XDJ A;  4P30 A;  3ZRS A;  4WFH A;  4JTA B;  2Q68 A;  1OCC C;  2AHY A;  5IY5 C;  3PJS K;  4PDV A;  4DXW A;  2K1E A;  3ZJZ A;  3E86 A;  4J9Z B;  4MVQ A;  4R8C A;  1K4C C;  2EIL C;  3RVZ A;  2DYS C;  3OGC C;  2A79 B;  1OCR C;  4LCU C;  2IH1 C;  4MVS A;  4LP8 A;  4MSW C;  4EKW A;  2WLL A;  3E8H A;  1M57 C;  3UM7 A;  3F7Y C;  2ZXW C;  2WLN A;  3LDD A;  2H8P C;  3ABK C;  2A0L A;  2EIM C;  3E83 A;  3FB6 C;  2KB1 A;  1R3L C;  4JTC B;  4X88 A;  5EC1 C;  5EK0 A;  3AG3 C;  3OR7 C;  3SPJ A;  1LNQ A;  3F5W C;  4P9O A;  5EC2 C;  1QLE C;  3KG2 A;  4ZBM A;  4G28 B;  3LDE A;  5E1A C;  3RW0 A;  2HG5 C;  4CBC A;  2EIK C;  5KUM A;  4MTG A;  1R3K C;  4QE7 A;  2Q67 A;  3RBZ A;  2ITD C;  2X6C A;  1R3J C;  1K4D C;  4LBE C;  3SYA A;  4QNH B;  5BZB A;  5CBG A;  2OCC C;  2BOC C;  3GB7 C;  3SPI A;  2EIJ C;  3TET A;  1OCZ C;  3ABM C;  2WLI B;  1V55 C;  2ITC C;  4GX5 A;  2JK5 C;  2NLJ C;  3F7V C;  3K04 A;  4MVR A;  4H33 A;  3UKM A;  2Q6A A;  4R6Z A;  2EIN C;  4RUF A;  3FB7 C;  4X8A A;  3SYP A;  2R9R B;  4P9P A;  4MW3 A;  5EBL C;  5B1B C;  3K0G A;  1R3I C;  3EFF K;  3VOU A;  4F4L A;  4GX2 A;  3AG2 C;  2ATK C;  4J9Y B;  3T4Z A;  5CBF A;  2Y69 C;  3SYC A;  3K06 A;  2IH3 C;  1KKD A;  2A9H A;  4GX1 A;  2X6A A;  3OUF A;  4GX0 A;  4KFM A;  4MVZ A;  4MVO A;  4PA7 A;  5B1A C;  2HJF C;  3RVY A;  2WLH A;  3K08 A;  3LDC A;  3STL C;  3OR6 C;  4RUE A;  2WLK A;  4WFF A;  4MVM A;  3T1C A;  2P7T C;  2DWE C;  3E8G A;  1XL4 A;  1OCO C;  3R65 A;  4WFE A;  3ABL C;  3WG7 C;  4XDL A;  4PA4 A;  2BOB C;  4QE9 A;  5EBW C;  3SJQ C;  2HFE C;  3E8F A;  4G27 B;  2Q69 A;  2WLJ A;  3FB8 C;  1JVM A;  4X89 A;  4PA9 A;  4HYO A;  5EBM C;  3FB5 C;  4MVU A;  4UUJ C;  3AG4 C;  3JYC A;  1BL8 A;  4I9W A;  3SPH A;  2WLL B;  5J9P C;  3AG1 C;  4H37 A;  4MS2 A;  4OXS A;  2HVK C;  2DWD C;  4PA6 A;  4XDK A;  3SYQ A; 
#chains in the Genus database with same CATH topology
 4NKG B;  4RQF A;  4UV9 A;  3TGU H;  1CEZ A;  1H2N A;  4JI4 O;  1JCH A;  1IZ3 A;  4MW8 A;  3HKD B;  3ZMV A;  1HR0 B;  2ZCE A;  3BFR A;  3RN4 A;  3L74 H;  5L3D A;  3SYO A;  4BWA A;  2F4V O;  3CCQ V;  2Y4U A;  2KQX A;  5CBH A;  4CH5 A;  4K8X A;  3OMN B;  4LH6 A;  2X7R B;  2AHZ A;  1MOF A;  5GON A;  3QO7 A;  2CH7 A;  3M99 B;  2QWR B;  3W7W A;  4LP8 A;  1IXM A;  2Q8V A;  3GVM A;  1M57 C;  4X1Y A;  3F7Y C;  4ZI7 A;  1QU7 A;  3ABK C;  5EK0 A;  3D3I A;  1IBL B;  4NYK A;  5EC2 C;  4NVP A;  4PV1 B;  3RW0 A;  2FKX A;  2YI9 A;  5DED A;  1ZL8 B;  2Q67 A;  4ABM A;  5IYZ A;  4OPA A;  4J80 A;  4EB6 A;  1K7D A;  4I55 A;  2CTQ A;  4PJ0 Z;  4K0K O;  1UFI A;  4GYC B;  4JI0 B;  2JGD B;  2EIN C;  4X62 B;  3JAS B;  3QTC A;  2OIG A;  2F93 B;  1T5E A;  1IBM B;  1THZ A;  2LP7 A;  1QR8 A;  3JAT B;  5LBQ A;  5DM6 V;  2XOK G;  2H94 A;  2WLK A;  2UUC B;  2P7T C;  3B2E E;  3B8N A;  1GRJ A;  4PD4 F;  2E75 B;  1GK9 A;  4FM2 A;  4GCZ A;  2QM4 A;  3RYF B;  4JZ2 A;  3VQV A;  4KL1 A;  3QO5 A;  3CEI A;  5J9P C;  3AG1 C;  1FAF A;  4J11 A;  3HKC B;  1FS0 G;  1Q6U A;  1Y76 A;  1XMQ O;  4DV2 B;  1O9H A;  1G4Y B;  1YXB A;  3CC2 V;  4JI6 O;  1SER A;  1KP3 A;  3I56 V;  4I5S A;  1YCI A;  4MTO A;  2UUA O;  1HNZ O;  4JI3 O;  5IJ9 B;  4RWU A;  2BSK A;  1U97 A;  4KHP B;  2ZD9 A;  3D36 C;  3EVK A;  3W7X A;  5LYJ B;  3JSN A;  3OE7 G;  2P5O A;  1US6 A;  5B3S B;  2RNB A;  3P30 A;  4XDJ A;  4P30 A;  3DTU B;  4J7K A;  3A2F A;  3PJS K;  4DV0 O;  2YIB A;  3WU2 Z;  1K73 W;  3ZMU A;  4I4T A;  3L9D A;  1BE3 H;  4LFA O;  3K3W A;  4OX9 B;  4TUY B;  2UU9 B;  1R3L C;  2QTS A;  4DV7 B;  5KAF Z;  5HFM A;  3HR0 A;  1NH2 B;  4CBC A;  5D5Q A;  4UB8 Z;  2HEP A;  3N2K B;  1K34 A;  2UXX A;  5B1B C;  3K0G A;  1CPY A;  4J9Y B;  5J2T B;  3JAW B;  2YSU B;  3OUF A;  2ZNJ A;  4PA7 A;  4K35 A;  3H9V A;  1AI4 A;  3LDC A;  3OR6 C;  1Q90 D;  2YEV B;  3ZHT A;  1JJO A;  1Y6X A;  1ZTE A;  3JSL A;  1A32 A;  4PEL A;  1I5X A;  1Y67 A;  4WFB V;  1EFR G;  1GN4 A;  1J5E B;  4DUY B;  5LXT A;  4PA9 A;  1F7Y A;  4PI0 A;  3K79 A;  1BL8 A;  4D7T A;  1JMK C;  3SYQ A;  3WG7 B;  5JJJ B;  1OHH G;  4FJC C;  3LSU A;  1BHA A;  3N27 A;  1WP8 A;  3CME V;  1DGS A;  3P3N A;  1JFF B;  2VQF B;  5K1X A;  3OMA B;  3A0B Z;  3CS5 A;  4B3S O;  1G6U A;  2YDE A;  4WFG A;  1TAE A;  3K58 A;  4BIZ A;  4EEQ A;  1VQ4 V;  1RSO A;  5LP6 C;  2DYR C;  3ASN B;  4FLY A;  2ILM A;  4JGS A;  4O4H A;  2ZIN A;  1WA8 A;  1XUQ A;  3FAV B;  2IJK A;  4DV6 B;  3G6B A;  1NT2 B;  4MVS A;  5B5E Z;  1Q82 W;  5FNV B;  3C3S A;  4H44 B;  3DSQ A;  3JD2 A;  4EFE A;  2A0L A;  2GTA A;  4BW5 A;  4DRX A;  4I0X A;  3T1H B;  3G67 A;  3CC4 V;  1FD9 A;  1U96 A;  3ZN0 A;  2PY5 A;  3KCX A;  1OCZ C;  4UVA A;  3KZI Z;  1M90 W;  3VOU A;  3C90 A;  3EFF K;  4GX2 A;  1BSM A;  2JJ2 G;  5KHG A;  4O2A A;  1AR5 A;  4JI5 O;  4MVO A;  3S3X A;  1VQM V;  1OV9 A;  2ZE5 A;  4FPP A;  4X1K B;  4JZG A;  3AG7 A;  3ZBH A;  4LF4 O;  1VQ6 V;  2Y69 B;  4DR2 B;  3JCU Z;  1YI2 V;  4KP4 A;  5KHJ A;  2NN4 A;  3JAK A;  3WB1 A;  3ASO C;  4LFC O;  3OM3 B;  5ITZ A;  1PM9 A;  3F5T A;  5J2U A;  1NVP B;  4X64 B;  3AG4 B;  1OJH A;  2JDI G;  1P84 F;  1I0H A;  4YJ3 A;  4DO2 A;  1VQK V;  5LA6 A;  1S0V A;  4O2B A;  5CB4 B;  1S5H C;  1YF2 A;  3K03 A;  5LGU A;  1H2M A;  4YIO A;  1N32 B;  4ZOL A;  5IY5 C;  1PL4 A;  3CRA A;  1KC8 W;  2F1M A;  3JCZ A;  4WBN B;  1Q3E A;  1MNG A;  2P67 A;  2A7W A;  3AG3 C;  3L71 H;  1B04 A;  1GMG A;  2B9Z A;  4B7E A;  1DTO A;  1S72 V;  4FM0 A;  2OIE A;  3DC5 A;  4IYH A;  2UXB B;  4FVM A;  3SYA A;  2ITD C;  2X6C A;  1YEW A;  4FLT A;  4KHP O;  2OCC C;  5GTI Z;  2YXL A;  2JVD A;  5LMN B;  4DV1 B;  1YIJ V;  3UT5 A;  1SQX H;  4JAS A;  4R6Z A;  1YJN V;  1SC5 B;  1TVK A;  5HFL A;  1H2K A;  1R1B A;  1P7G A;  2PI5 A;  2CE4 A;  3ZIA G;  5EBL C;  4CH6 A;  3QVN A;  2CTP A;  3H1L H;  5IWA B;  4X65 B;  1B3Q A;  1FKA O;  3UQ8 A;  4TOI A;  4I50 B;  5H6Q A;  4H13 B;  1AR4 A;  3BVO A;  1SA0 B;  5EBM C;  2Q73 A;  3W7S A;  3CHX A;  1TUB B;  2VWK A;  3RBZ A;  4UCU A;  1JX9 A;  4CH4 A;  3LSQ A;  4FLV A;  2ZT9 B;  3U0Z A;  4JV5 O;  1TGO A;  4BIU A;  4DR3 O;  4I7Z B;  3OTF A;  2KG7 A;  4F6R A;  1AP6 A;  3SGI A;  1D5A A;  2EJR A;  3HPL C;  4JYA B;  4AQY O;  3FYI B;  1S3J A;  2DQ0 A;  3CJH A;  3RYH B;  4LNU A;  3ETE A;  3BPZ A;  2OT5 A;  4FK5 C;  3ZHQ A;  2QGN A;  4B3T O;  2Q68 A;  1N33 O;  3CX5 F;  1FXK A;  2HLD G;  1N36 B;  5BMV A;  3Q4H A;  3JAL A;  1YJ9 V;  2ZXW C;  1EM1 A;  4JI2 O;  2KB1 A;  2YIA A;  1RM1 C;  4J7J A;  3GWK C;  2XND G;  3OGI B;  1NTZ H;  3KG2 A;  1RP3 B;  2EIK C;  1ZUQ A;  2NR5 A;  5EIB C;  3ZRX A;  1COW G;  2LGW A;  3ABT A;  2VQE O;  1EN5 A;  1K9M W;  3MAQ A;  3ABM C;  1WPX A;  2OWO A;  5CA3 A;  2QSA A;  4H33 A;  4P9P A;  2DW4 A;  3HKB B;  4X1Y B;  2HHH O;  1XDC A;  3L75 H;  5IJ0 B;  1AI5 A;  3CWB H;  2EUL A;  2X6A A;  2QKA A;  4DYL A;  5CBF A;  4MVZ A;  4DV6 O;  2HJF C;  3RVY A;  2WA4 A;  3H1H H;  1AR1 B;  2YIB D;  4F6E A;  5F2V O;  3FYE B;  1YTF B;  1PD3 A;  1H38 A;  3FFQ A;  4O4L A;  5L3C A;  3E22 B;  1WJZ A;  1HNW O;  1YHQ V;  1N0J A;  4XDK A;  2DWD C;  3E89 A;  1W2B U;  2PYJ A;  3L73 H;  3ETQ A;  3SDL A;  1SQF A;  2GTS A;  4JAA A;  1VP7 A;  1ZSP A;  5LP6 A;  1DLB A;  3RYI B;  4KUM A;  4LFB B;  1BCC H;  3HKE A;  3CXH F;  2ZE7 A;  2Q5Z A;  4DV5 O;  5IYB O;  3CB2 A;  3CD6 V;  3T1Y B;  2PGG A;  4YJ2 B;  4MTX A;  4JI1 B;  1M56 B;  4RAI A;  1WLE A;  1YDX A;  4FM1 A;  1ARO P;  1RPR A;  1GN6 A;  2K1E A;  5C93 A;  4DR7 B;  3ZCC A;  4WFA V;  5C8Y A;  1R6T A;  1Y74 B;  2P90 A;  2ZQM A;  3UM7 A;  1QR9 A;  2OYQ A;  4TV9 A;  2HP8 A;  2F43 G;  3E83 A;  2EIM C;  2ZIM A;  3K5L A;  1Q86 W;  2EX3 A;  1OCC B;  4LF5 B;  3F5W C;  4NXM B;  2IU0 A;  4X64 O;  2EIL B;  4ICG A;  4DR1 B;  3J81 N;  4MTG A;  1NR1 A;  1DF5 A;  5BZB A;  5CBG A;  3CYO A;  3DC6 A;  2CK3 G;  1MZF A;  4JAV A;  2ITC C;  2NLJ C;  3BA8 A;  4B3M O;  5JJE B;  2PYL A;  4N21 A;  1D2D A;  5EIB D;  1NZ6 A;  4RUF A;  4C7U A;  3ZX6 A;  5H9C A;  4MW3 A;  4L87 A;  1N32 O;  4IIJ B;  2XAH A;  3A8T A;  4LWS B;  2UXC B;  3OTO B;  2WLH A;  1V55 B;  3FKS G;  2GHY A;  3STL C;  1HDJ A;  2QJ1 A;  3G71 V;  4D7S A;  4DV3 B;  2RCV A;  3E8F A;  4DW0 A;  2ODM A;  2Q9L A;  4U3J B;  3CCJ V;  4X89 A;  4GKK O;  4RQE A;  1CP9 A;  5B1A B;  4UCR A;  1VF6 A;  2UXB O;  1I94 B;  3N2G B;  1OZ0 A;  2WLL B;  1K5S A;  1LUW A;  4YHH O;  2DOS A;  3ABL B;  2XTA A;  3T4D A;  4X66 O;  4LF9 O;  1URF A;  3L70 H;  4NXN O;  4HAM A;  3J80 N;  5JCO A;  4J42 A;  3IFX A;  1VF7 A;  1NU1 H;  2K9P A;  3ML0 A;  4UCT A;  1NH2 D;  4L8J A;  4I9Q A;  2WLM A;  5KMG A;  3ZRS A;  1FXV A;  3GWO A;  5KX5 A;  1PNK A;  1KUQ A;  4J10 A;  2QM7 A;  5FPR A;  1N4C A;  4DUZ O;  1MSW D;  2CTW A;  1K33 A;  1S77 D;  3QG5 A;  4MVQ A;  3PN1 A;  1Z5W A;  3WB0 A;  5JQG A;  3LDD A;  1H2L A;  1JA8 A;  5JWP A;  5LOV B;  2O57 A;  1EBO A;  5CA1 B;  3BCC H;  1K97 A;  2ZNI A;  3HKD A;  1F4M A;  1GM9 A;  4DV4 B;  4JYA O;  1VAR A;  3GB7 C;  3CCL V;  2GUZ B;  4EFB A;  4PI2 A;  2Q6A A;  4DR4 O;  1QLE B;  1FJG O;  4IYI A;  4G2K A;  3K9A A;  1S5J A;  1FXK C;  1IBK O;  2ATK C;  4YY3 B;  3AEI A;  3QF7 A;  3VQW A;  4DRX B;  3OFN G;  4GX1 A;  4QPK A;  3R66 A;  2CGO A;  3T1C A;  2ZR3 A;  5KAI Z;  5EZY B;  5JVD B;  1NI8 A;  1N34 B;  4GKJ O;  3DXR A;  1VQN V;  5BR8 B;  4G27 B;  2Q69 A;  5BY1 A;  2E3C A;  3CSX A;  3RGB A;  2P6J A;  5JH7 A;  2Q4P A;  1XEQ A;  5TIS Z;  4FZ0 A;  1K5Q A;  1ZL8 A;  4GLX A;  3WFV A;  4E2L A;  3JAR B;  4PDR A;  5H5N A;  1NR7 A;  2F23 A;  2N74 A;  1I5Y A;  1MSD A;  3B8M A;  4BAY A;  2JGD A;  2L35 A;  2ZDI A;  3JAS A;  2UXD B;  2QKS A;  1G1X B;  1AJQ A;  1QHT A;  2R9A A;  2UUB O;  3UO2 A;  3LNM B;  1NJI W;  4JAU A;  1P7B A;  5KUK A;  4O4I B;  2OTL V;  5IYD O;  4HZ3 A;  3I5D A;  1FFT B;  2XHB A;  2ZE8 A;  3JAK B;  3D8C A;  4ZHQ B;  2AW9 A;  2DYS C;  3RYF A;  2XT9 A;  2IH1 C;  2YXH A;  1GN2 A;  4LH7 A;  2V1D A;  1PV0 A;  3HKC A;  1FFX A;  4LF6 B;  2EBO A;  1X59 A;  2JJ1 G;  2YUA A;  5BXZ A;  4LFB O;  1QQC A;  3QO8 A;  2GV9 A;  2QWP B;  3G6E V;  2EIJ C;  3TET A;  3T1Y O;  2WLI B;  4LF7 B;  1UPG A;  1O9G A;  4LC1 A;  1ZX3 A;  5LYJ A;  1B06 A;  3CCV V;  3B4S A;  2Z5U A;  5LGT A;  1L0N H;  2JIZ G;  2PF4 E;  4W4L A;  1KU9 A;  1VMG A;  2Q0O C;  1F4N A;  1JQ0 A;  4PHZ A;  1HR0 O;  4TV8 A;  1SQQ H;  1SZX A;  2EIN B;  3ZMS A;  1IUR A;  4LF5 O;  2W6I G;  4TUY A;  2HFE C;  4NXM O;  1G8M A;  5DN6 G;  5CA0 B;  2NNU A;  4H37 A;  1M93 A;  2YI8 A;  4PA6 A;  2HVK C;  4JF3 A;  2VS0 A;  3N2K A;  3X2Q C;  5FPO A;  4PA3 A;  3KKY A;  1HWY A;  2C2A A;  3SPC A;  1EN4 A;  3OT7 A;  4YXW G;  4O4J B;  4RO2 A;  1SRY A;  1XIL A;  4IL6 Z;  1V54 C;  1IBL O;  3AG2 B;  3AG1 B;  3BHP A;  3OTO O;  5J2T A;  2CAZ C;  1QCE A;  1XNQ B;  1ROP A;  3OUS A;  1AJN A;  4CC5 A;  2YEV A;  5K1P A;  1NTK H;  1GM7 A;  4FZ1 A;  1KYO F;  1PKX A;  4JI0 O;  1RPO A;  4X62 O;  2R72 A;  1VF6 C;  1FXH A;  1OCR C;  3MD0 A;  4J7Z A;  4EKW A;  1S76 D;  4GUN A;  2XAJ A;  1IBM O;  3WB2 A;  1AI7 A;  2H8P C;  3FB6 C;  3G80 A;  3OR7 C;  3ZS8 C;  4FLX A;  2UUC O;  4P9O A;  4JI7 B;  3CCE V;  4Q20 A;  4X1I A;  1N8R W;  2F4V B;  3HB3 B;  4UFZ A;  1JFF A;  5JCO C;  4DR6 B;  2N05 A;  2XAF A;  4LBE C;  1R3J C;  1QLN A;  1Z2G A;  2P4K A;  2Q7E A;  4CS2 A;  2JK5 C;  5B1N A;  2XAG A;  4FFB B;  4DV2 O;  4TQD A;  4W4K A;  1TA8 A;  3K06 A;  2IH3 C;  1GM8 A;  1F51 A;  1XHX A;  3FAV A;  5H6R A;  2QDO A;  1PNL A;  2LQT A;  2ADP A;  2CDY A;  5FNV A;  2F66 C;  1OCO C;  2XAS A;  1JOY A;  5B1B B;  5EBW C;  4X9Q A;  1H2G A;  1M1K W;  3FB8 C;  3MDS A;  1W59 A;  2ZM6 B;  4UV8 A;  3E35 A;  1GH6 A;  3RYC B;  4HNA B;  4MT8 A;  4AI8 A;  5KLV H;  1KMI Z;  1VQ8 V;  2N04 A;  4PDL A;  2VWJ A;  3JAM N;  1SKV A;  2QEX V;  3CRM A;  4OX9 O;  3M7M X;  3ZRW B;  2UU9 O;  4TQF A;  4DV7 O;  2HVJ C;  5A9G A;  1DK1 A;  5EYP B;  2BTQ B;  4CS4 A;  2IJJ A;  3BAA A;  3STZ C;  4H0L B;  4X1K A;  2FML A;  1N34 O;  3A0H Z;  4JTA B;  5BR8 O;  4PDV A;  4Z2W A;  1NTM H;  3APO A;  4J9Z B;  2PZS A;  2IBZ H;  2Y4T A;  5FL7 G;  5IT9 N;  2DYR B;  2Q7H A;  2WA3 A;  1HNZ B;  3ZED A;  3HKE B;  3ZN1 A;  4JI3 B;  2ZDI C;  3K5O A;  2HG5 C;  2VRZ A;  1BZK A;  1J5E O;  4WF9 V;  1KEC A;  4DUY O;  2P06 A;  2LGQ A;  3CP1 A;  1KBH A;  3P3P A;  2ZE6 A;  3ZHR A;  2OTJ V;  3W7U A;  3CRQ A;  3UKM A;  5LL6 Y;  2Y48 A;  2JEX A;  4DV0 B;  5CB4 A;  4U7N A;  4X8A A;  3K5M A;  3DGE A;  2RJZ A;  3ZHU A;  1KKD A;  4LFA B;  1OCZ B;  1FYJ A;  3OEE G;  2QWN B;  3K08 A;  2VQF O;  1QVF U;  5GON B;  4WBN A;  2RMK B;  2EZP A;  3E8G A;  1VQP V;  2CH7 B;  1KB9 F;  2CGN A;  3K57 A;  3CC7 V;  1BGY H;  1SQB H;  4JYY A;  3CRC A;  1SET A;  2F95 B;  1HW7 A;  2WAM A;  4GZR B;  3L72 H;  2E76 B;  3I55 V;  4ZI7 B;  4FLZ A;  2Q7G A;  1KKC A;  4P2Z A;  4NR1 A;  2IW5 A;  4PDM A;  2FTK A;  5B3S C;  2QWQ B;  2WWW A;  3P32 A;  5IYZ B;  3T1H O;  3B77 A;  3IC9 A;  3AK2 A;  4MTF A;  4EB6 B;  1VQO V;  4I55 B;  5KA5 A;  1EN6 A;  3ASO B;  4I50 A;  2B1I A;  3EXA A;  2ZKO A;  3MHS C;  1XOU A;  3ZMZ A;  2AHY A;  4AHC A;  1SA0 A;  2A79 B;  2X0L A;  4LCU C;  3B09 A;  1TUB A;  2QR4 A;  4JTC B;  4B3R B;  1L1F A;  4FIP C;  5IY5 B;  3CCM V;  4G28 B;  5KA6 A;  4B3S B;  1WPB A;  1HNX B;  1R3K C;  2QA4 V;  4DR2 O;  4K3A A;  3LNN A;  1Y76 B;  2AZ0 A;  3AG3 B;  2YIC A;  3K04 A;  3RYH A;  1K3E A;  3ZMT A;  5JQG B;  3SYP A;  1IDS A;  1BHB A;  3JD0 A;  2BSK B;  3OMI B;  3ETG A;  2OCC B;  4KFM A;  1ZAU A;  2LFR A;  3ICX A;  1SS3 A;  1Q81 W;  3R65 A;  3WG7 C;  3NXS A;  4JI7 O;  2XAQ A;  1VQ7 V;  1PL0 A;  2A3Q A;  4I4T B;  4MVU A;  5GW7 A;  4A5U B;  5JJN B;  4DR6 O;  1M9N A;  3BRC A;  3VQX A;  3JYC A;  1ENV A;  4UB6 Z;  1TUE B;  1BQ0 A;  2UXN A;  1WP7 A;  4BR6 A;  3ETD A;  4JI5 B;  3ASN C;  4KXR A;  1BQZ A;  4U3F H;  3H01 A;  2W0F C;  2B5U A;  3HKB A;  4JTD B;  1XL6 A;  1E79 G;  1M5I A;  5IJ0 A;  3LSS A;  3IAY A;  3DXR B;  1H2S B;  4ZIB A;  2QKC A;  4LF4 B;  4JPR A;  3ABU A;  4OPH A;  1EZJ A;  2BCC H;  1W0K G;  5JH7 B;  4WFH A;  1NQT A;  5H2F Z;  5LMN O;  4DV1 O;  4X20 A;  4N23 A;  2A06 H;  2ZM6 O;  3RVZ A;  3IC7 A;  3CE2 A;  2PTM A;  3C3T A;  3E22 A;  4IHJ A;  3SR2 C;  1GAX A;  4LFC B;  5GTH Z;  5IWA O;  1R6K A;  4X65 O;  1IXB A;  3SPH A;  4UVC A;  1R73 A;  3SPJ A;  5LXT B;  1E1Q G;  1Q43 A;  3RYI A;  1PP9 H;  2EZO A;  2Z0A A;  3D3Q A;  2ZXW B;  4JYB A;  1M4U A;  2BOC C;  3TXS A;  4UXN A;  3UCS C;  1SZT A;  1RM1 B;  1JPX A;  1W0J G;  2W0X A;  2LW1 A;  4YJ2 A;  2CUG A;  4UVB A;  1Q6I A;  2IJI A;  1DF4 A;  2EIK B;  2Y0P A;  3AG2 C;  1BMF G;  2Y69 C;  1AVM A;  3ZHS A;  3CCS V;  1FFX B;  3M8A A;  2H3O A;  3ABM B;  5B66 Z;  3AK3 A;  1RSO B;  4MVM A;  3UO3 A;  2MW2 B;  1Y74 A;  4WFE A;  4FLU A;  4XDL A;  4O4H B;  3SJQ C;  2V7Q G;  2QE7 G;  1L8D A;  1WA8 B;  1AB3 A;  1AIL A;  1GN3 A;  4DW1 A;  1VF5 B;  2KSD A;  2DN9 A;  1JJ2 U;  3AG4 C;  5B1O A;  4WFF A;  1QNM A;  5L3E A;  1VQL V;  4FFK A;  1N36 O;  4AIL C;  2ADQ B;  3BA9 A;  4I0X B;  3OD4 A;  4OGQ B;  1B6Q A;  2W6J G;  2RDC A;  4TV8 B;  1LUV A;  4TWK A;  1J95 A;  1NS1 A;  2LO1 A;  4IIJ A;  1I7F A;  4LWS A;  2ETN A;  2R70 A;  3TK1 A;  4Z1M G;  2FB5 A;  2JGU A;  3K0D A;  3K9S A;  1XMO B;  2CTR A;  1Z5V A;  2AGA A;  4O2A B;  1NKD A;  1H8E G;  1SQG A;  4U3J A;  2LJ2 A;  3OGC C;  4JV5 B;  4UCV A;  5L3F A;  4JYC A;  5D5P A;  4MSW C;  2Z3Y A;  3N2G A;  2JRI A;  2WLL A;  4DR3 B;  3APQ A;  3JAT A;  2R9I A;  1I08 A;  2G38 A;  1Q8I A;  4ZBM A;  4QIW F;  4QGP A;  4AQY B;  1AP5 A;  4QE7 A;  1JR9 A;  4BIO A;  1E1R G;  1F23 A;  3H1I H;  2EIM B;  2OCH A;  1XNR B;  4B3T B;  1N33 B;  5ITZ B;  2DMX A;  3FX7 A;  5J2U B;  2B1G A;  4JI8 B;  1SQP H;  4ZKI A;  2HJD A;  4YJ3 B;  1GTO A;  2GDS A;  4GX0 A;  5L3G A;  1SES A;  4JI2 B;  1FPO A;  5LA6 B;  4CZZ A;  4RUE A;  4O2B B;  4X1I B;  3AK1 A;  4DK1 A;  5CN0 A;  3RFR A;  3CPW U;  1M57 B;  5IJ9 A;  4B3R O;  4PA4 A;  3ABK B;  5LOV A;  4ZOL B;  2VQE B;  2WLJ A;  2AXT Z;  4QPJ A;  4JI1 O;  5CA1 A;  3RT3 C;  2PUS A;  3W7T A;  4UUJ C;  1HNX O;  1WAZ A;  4NTW A;  4LF8 B;  4I9W A;  4DR7 O;  2PI4 A;  2FL4 A;  4WCE V;  1ZWI C;  3B40 A;  2GUZ A;  1NVP D;  3IGA C;  2HHH B;  3TCU A;  1XQ8 A;  4IGG A;  1WB7 A;  1Q5O A;  2QTO A;  3VQY A;  3U11 A;  1KP2 A;  5LHG A;  1YZB A;  4XBF A;  4DR1 O;  3UT5 B;  1TVK B;  4FLW A;  4LR3 A;  5EZY A;  3SPG A;  5JVD A;  5CMU A;  2EJ7 A;  1HNW B;  1KQS U;  3H1J H;  1XHZ A;  4DR5 B;  2ZIO A;  1AJP A;  5IDJ A;  2E5L B;  4TSF G;  3O9O A;  1GO3 F;  2UXC O;  1VIB A;  3JAR A;  4X88 A;  5EC1 C;  3JAW A;  3TJT A;  3RWR D;  5KHH A;  4HBN A;  4DV5 B;  1EZV H;  4DV3 O;  1Y4M A;  5LMU B;  4NTX A;  1SQV H;  3JD1 A;  3E2E A;  4QNH B;  3OW2 U;  3CMA V;  3NR7 A;  1PPJ H;  3SPI A;  3KCY A;  5E79 Z;  1I94 O;  2KG7 B;  4O4I A;  4F6R B;  4JI4 B;  1BS3 A;  1SF9 A;  2R9R B;  1R3I C;  4F4L A;  3T4Z A;  3ZRV A;  3SYC A;  2YC0 A;  4ZHQ A;  2P4V A;  2IJH A;  3CJH B;  4LNU B;  1Q6H A;  1XL4 A;  1MAB G;  1KD1 W;  2GBO A;  2MK3 A;  4QE9 A;  1FXK B;  3SJC C;  3CCR V;  5BMV B;  1JVM A;  2L6L A;  3Q4H B;  4UCO A;  1BT8 A;  3JAL B;  1YVW A;  3FD9 A;  3FB5 C;  1D5N A;  1QVG U;  3CXC U;  1P4R A;  4B3M B;  1YIT V;  3K59 A;  4MS2 A;  1L0L H;  3T2M A;  2WLI A;  2RQ6 A;  3QNE A;  2QM8 A;  2DE0 X;  1M56 C;  4CH3 A;  2JEU A;  5L3B A;  3SJB C;  2FYU H;  2BE3 A;  2V4D A;  3LUT B;  1MZE A;  2JS5 A;  4FMT A;  2BTO A;  4K8Z A;  4QJF B;  1V9P A;  4U7O A;  4DV4 O;  4K0K B;  4GKK B;  2XUM A;  1CXZ B;  1OCC C;  2RN9 A;  1S5L Z;  3CRR A;  4YHH B;  3CCU V;  4DXW A;  3VBB A;  3ZJZ A;  3E86 A;  2HKO A;  4R8C A;  2EIL C;  4NB5 A;  5FLX N;  4YIP A;  4YY3 O;  5CA0 A;  3E8H A;  5LHI A;  1K8A W;  5DEC A;  4X66 B;  4LF9 B;  3J7A U;  4NXN B;  4O4L B;  3LDE A;  5E1A C;  4O4J A;  2DYS B;  5IYC O;  2KKW A;  4IT5 A;  4TT3 G;  1VEW A;  1K92 A;  3A0R A;  4CS3 A;  2ARH A;  1V55 C;  2M6Y A;  1XMQ B;  4JI6 B;  2LFS A;  4GX5 A;  4DUZ B;  1XMO O;  5LP6 B;  3FB7 C;  2UUA B;  1MA1 A;  1P49 A;  1Q7Y W;  1WB8 A;  1HP8 A;  5KHK A;  1NBM G;  2EIJ B;  5B1A C;  2UXD O;  4B7K A;  5IE9 A;  3D36 A;  1YTF D;  2HR3 A;  2DWE C;  1IX9 A;  5KHI A;  3ABL C;  2AZ2 A;  3SJA C;  4J41 A;  3MHH C;  3ZHV A;  4HYO A;  5C8Y B;  1XBL A;  3JD4 A;  4OXS A;  4TV9 B;  3IJ4 A;  4DR4 B;  3H1K H;  1FJG B;  2D2C B;  1XNR O;  2X6B A;  2M7W A;  3JD3 A;  4UCS A;  4ASU G;  1IBK B;  2QWO B;  4JI8 O;  2YS8 A;  3BEH A;  5A2Q N;  2YXY A;  4FFB A;  2IU3 A;  4LF6 O;  4DK0 A;  2DQ3 A;  1LR1 A;  2D3O W;  3X2Q B;  1QBZ A;  4GKJ B;  1ORQ C;  4R7C A;  3E8B A;  2P22 C;  1IVS A;  1YSC A;  4E4E A;  5LHH A;  3OEH G;  1WN7 A;  5AG2 A;  4R50 A;  4LF7 O;  1GKF A;  3OAA G;  3G4S V;  3TXQ A;  1V54 B;  3BAB A;  1MG1 A;  1N0N A;  2DJV A;  1K4C C;  1R6N A;  1XRE A;  1H8H G;  4LF8 O;  2JS3 A;  1ZLZ A;  2GSM B;  2ZR2 A;  1UJW B;  3U10 A;  4GT1 A;  3RYC A;  4HNA A;  1Y66 A;  4CC6 A;  1X4T A;  2WSS G;  3THO A;  1LNQ A;  3K5N A;  1PNM A;  2UUB B;  1QLE C;  4NTY A;  2WPD G;  3BY6 A;  1OCR B;  3ZRW A;  1VQ5 V;  5KUM A;  3EHB B;  1K4D C;  2Q0A A;  5EYP A;  2BTQ A;  4BW9 A;  4X20 B;  2YID A;  3F7V C;  4MVR A;  2E74 B;  4IHJ B;  1VQ9 V;  1AI6 A;  4B08 A;  4DR5 O;  2Y0I A;  1RFY A;  2A9H A;  2E5L O;  3O65 A;  3S3W A;  5LGN A;  5KMG B;  4D6T H;  1MMM A;  5KX5 B;  1XNQ O;  4Q6G A;  2BOB C;  4Z1V A;  1XI1 A;  5LMU O;  1YJW V;  1WNS A;  2IM9 A;  2LW7 A;  2WLN A;  1OCO B; 
#chains in the Genus database with same CATH homology
 3LSQ A;  3X2Q C;  4PA3 A;  3SPC A;  1HWY A;  2C2A A;  4RQF A;  4UV9 A;  4BIU A;  1CEZ A;  4YXW G;  1B6Q A;  2W6J G;  1JCH A;  4RO2 A;  4MW8 A;  1SRY A;  3ZMV A;  1V54 C;  4TWK A;  3AG2 B;  3AG1 B;  1J95 A;  3SYO A;  2EJR A;  3HPL C;  5L3D A;  3CCQ V;  1QCE A;  3TK1 A;  4Z1M G;  5CBH A;  3FYI B;  1S3J A;  2DQ0 A;  1ROP A;  3OMN B;  3OUS A;  3K0D A;  1AJN A;  2X7R B;  2AHZ A;  1MOF A;  2YEV A;  3ETE A;  2OT5 A;  1GM7 A;  3QO7 A;  4FK5 C;  1PKX A;  2Q68 A;  1FXK A;  1NKD A;  2HLD G;  1RPO A;  1H8E G;  3M99 B;  3OGC C;  1FXH A;  1OCR C;  3MD0 A;  5L3F A;  3W7W A;  4LP8 A;  4JYC A;  1IXM A;  4MSW C;  2Z3Y A;  4EKW A;  1S76 D;  2XAJ A;  2WLL A;  1YJ9 V;  1M57 C;  3F7Y C;  1AI7 A;  2ZXW C;  2H8P C;  3ABK C;  3FB6 C;  5EK0 A;  2KB1 A;  1RM1 C;  3OR7 C;  3D3I A;  2R9I A;  2XND G;  4P9O A;  5EC2 C;  3CCE V;  4Q20 A;  1N8R W;  3KG2 A;  4ZBM A;  4QIW F;  3RW0 A;  3HB3 B;  2EIK C;  4QE7 A;  2Q67 A;  2XAF A;  4LBE C;  1E1R G;  1R3J C;  1COW G;  1F23 A;  3ABT A;  3ZRX A;  1K9M W;  1QLN A;  2EIM B;  1K7D A;  3ABM C;  1WPX A;  5CA3 A;  2JK5 C;  4H33 A;  2EIN C;  5B1N A;  2B1G A;  2XAG A;  4P9P A;  2DW4 A;  4ZKI A;  3K06 A;  2IH3 C;  1AI5 A;  1GM8 A;  1THZ A;  2LP7 A;  1F51 A;  1QR8 A;  2X6A A;  1GTO A;  4GX0 A;  5CBF A;  4MVZ A;  5L3G A;  1SES A;  5LBQ A;  2HJF C;  2XOK G;  3RVY A;  5DM6 V;  5H6R A;  4CZZ A;  2H94 A;  4RUE A;  2WLK A;  2P7T C;  1PNL A;  5CN0 A;  1AR1 B;  3CPW U;  1M57 B;  1OCO C;  2XAS A;  3B8N A;  4PA4 A;  3ABK B;  3FYE B;  1JOY A;  5B1B B;  1PD3 A;  5EBW C;  1YTF B;  1GK9 A;  4GCZ A;  1H38 A;  1H2G A;  1M1K W;  2WLJ A;  3FB8 C;  4QPJ A;  3W7T A;  5L3C A;  4UUJ C;  4UV8 A;  3E35 A;  4I9W A;  3QO5 A;  5J9P C;  4MT8 A;  3AG1 C;  1YHQ V;  4XDK A;  2DWD C;  3E89 A;  2PI4 A;  1FS0 G;  4WCE V;  1VQ8 V;  1ZWI C;  1W2B U;  3CC2 V;  1G4Y B;  1NVP D;  3IGA C;  1SER A;  4PDL A;  1KP3 A;  3I56 V;  3TCU A;  4I5S A;  2QEX V;  4MTO A;  1DLB A;  2QTO A;  3ZRW B;  4KUM A;  2HVJ C;  1KP2 A;  5LHG A;  5IYB O;  2IJJ A;  3CD6 V;  2ZD9 A;  4XBF A;  3STZ C;  4MTX A;  3W7X A;  3OE7 G;  1M56 B;  4RAI A;  1WLE A;  5B3S B;  3SPG A;  3P30 A;  4XDJ A;  4P30 A;  4JTA B;  3DTU B;  5CMU A;  1ARO P;  3PJS K;  4PDV A;  1KQS U;  1RPR A;  5L3E A;  2K1E A;  1AJP A;  5C93 A;  5IDJ A;  4J9Z B;  3ZCC A;  1K73 W;  4WFA V;  3ZMU A;  4TSF G;  1GO3 F;  5FL7 G;  2P90 A;  3UM7 A;  2ZQM A;  2DYR B;  1QR9 A;  2WLN A;  3K3W A;  2F43 G;  3E83 A;  4X88 A;  2EIM C;  5EC1 C;  1R3L C;  1Q86 W;  1OCC B;  3ZN1 A;  3F5W C;  5HFM A;  2ZDI C;  2IU0 A;  2EIL B;  1Y4M A;  2HG5 C;  1NH2 B;  4CBC A;  4MTG A;  1NR1 A;  3JD1 A;  3RBZ A;  3E2E A;  4WF9 V;  4QNH B;  1KEC A;  3OW2 U;  3CMA V;  1DF5 A;  5BZB A;  5CBG A;  3CYO A;  3SPI A;  3CP1 A;  2CK3 G;  2OTJ V;  4JAV A;  2ITC C;  3W7U A;  2NLJ C;  3UKM A;  4N21 A;  2Y48 A;  1K34 A;  2JEX A;  4RUF A;  4U7N A;  4X8A A;  2UXX A;  5H9C A;  2R9R B;  4MW3 A;  3DGE A;  4L87 A;  5B1B C;  3K0G A;  1R3I C;  1CPY A;  4F4L A;  4J9Y B;  3T4Z A;  3ZRV A;  3SYC A;  2XAH A;  1KKD A;  2YSU B;  2IJH A;  3OUF A;  1OCZ B;  4PA7 A;  3OEE G;  2WLH A;  1V55 B;  3FKS G;  1AI4 A;  3K08 A;  3LDC A;  2GHY A;  3STL C;  3OR6 C;  1QVF U;  2YEV B;  4PEL A;  1I5X A;  3E8G A;  2EZP A;  1XL4 A;  1VQP V;  1MAB G;  1KD1 W;  3G71 V;  2MK3 A;  4WFB V;  3CC7 V;  4QE9 A;  1FXK B;  1EFR G;  3E8F A;  3CCR V;  3CCJ V;  1JVM A;  4X89 A;  4PA9 A;  4RQE A;  1CP9 A;  1SET A;  5B1A B;  3FB5 C;  2WAM A;  3K79 A;  1BL8 A;  1QVG U;  3CXC U;  1OZ0 A;  1P4R A;  1K5S A;  2WLL B;  3I55 V;  1YIT V;  4MS2 A;  3SYQ A;  3WG7 B;  3ABL B;  1OHH G;  4FJC C;  4P2Z A;  1BHA A;  4PDM A;  2IW5 A;  3T2M A;  3T4D A;  2WLI A;  2FTK A;  3QNE A;  2QM8 A;  3CME V;  1M56 C;  5B3S C;  2JEU A;  2WWW A;  5L3B A;  3P32 A;  4HAM A;  3B77 A;  3IFX A;  3OMA B;  3LUT B;  3ML0 A;  4MTF A;  1VQO V;  5KA5 A;  4FMT A;  4WFG A;  4QJF B;  3ASO B;  1NH2 D;  2B1I A;  4BIZ A;  2WLM A;  4U7O A;  1VQ4 V;  2DYR C;  3ASN B;  3ZRS A;  3MHS C;  1FXV A;  3GWO A;  1PNK A;  4JGS A;  3ZMZ A;  1OCC C;  2AHY A;  2QM7 A;  1MSW D;  3CCU V;  4DXW A;  1K33 A;  1S77 D;  3VBB A;  3ZJZ A;  3E86 A;  2HKO A;  4MVQ A;  4R8C A;  2EIL C;  2A79 B;  2IJK A;  2X0L A;  4LCU C;  4MVS A;  1Q82 W;  3E8H A;  5LHI A;  1K8A W;  3JD2 A;  3LDD A;  4JTC B;  2A0L A;  4BW5 A;  1L1F A;  1EBO A;  4FIP C;  5IY5 B;  3CCM V;  3CC4 V;  4G28 B;  3LDE A;  5E1A C;  1K97 A;  5KA6 A;  2DYS B;  5IYC O;  3ZN0 A;  4TT3 G;  1R3K C;  2QA4 V;  1F4M A;  1GM9 A;  1K92 A;  3GB7 C;  3CCL V;  3A0R A;  1OCZ C;  3AG3 B;  1V55 C;  2LFS A;  4GX5 A;  4UVA A;  3K04 A;  1K3E A;  2Q6A A;  1QLE B;  3ZMT A;  3SYP A;  3FB7 C;  4G2K A;  1M90 W;  1BHB A;  3K9A A;  3VOU A;  3EFF K;  3JD0 A;  1FXK C;  4GX2 A;  2JJ2 G;  1Q7Y W;  2ATK C;  3OMI B;  3AEI A;  3ETG A;  2OCC B;  3OFN G;  1NBM G;  2EIJ B;  4GX1 A;  4QPK A;  4KFM A;  4MVO A;  5B1A C;  1VQM V;  2LFR A;  4FPP A;  3D36 A;  1YTF D;  3T1C A;  2HR3 A;  2DWE C;  2ZR3 A;  1Q81 W;  3R65 A;  3WG7 C;  3ABL C;  3NXS A;  1VQN V;  2XAQ A;  2Y69 B;  4G27 B;  2Q69 A;  1VQ7 V;  1VQ6 V;  3MHH C;  1YI2 V;  1PL0 A;  4HYO A;  4MVU A;  3JD4 A;  5GW7 A;  1M9N A;  2P6J A;  3JYC A;  1ENV A;  4KP4 A;  1K5Q A;  4OXS A;  3WFV A;  4E2L A;  4PDR A;  2X6B A;  1TUE B;  2M7W A;  3JD3 A;  2UXN A;  1NR7 A;  3ASO C;  4ASU G;  3ETD A;  1I5Y A;  3OM3 B;  3B8M A;  4BAY A;  3ASN C;  1NVP B;  2ZDI A;  3BEH A;  3H01 A;  2QKS A;  2IU3 A;  3AG4 B;  2W0F C;  2B5U A;  1AJQ A;  2JDI G;  4JTD B;  1XL6 A;  1E79 G;  3LNM B;  2DQ3 A;  3LSS A;  1NJI W;  4JAU A;  1P7B A;  2D3O W;  3X2Q B;  4DO2 A;  1QBZ A;  5KUK A;  1VQK V;  1ORQ C;  4R7C A;  3E8B A;  1S0V A;  4JPR A;  1YSC A;  1S5H C;  3ABU A;  5LHH A;  1EZJ A;  2OTL V;  3OEH G;  3K03 A;  4HZ3 A;  5IYD O;  4R50 A;  1W0K G;  5LGU A;  4WFH A;  1NQT A;  1GKF A;  3OAA G;  3G4S V;  1V54 B;  1FFT B;  1MG1 A;  5IY5 C;  4N23 A;  1KC8 W;  1K4C C;  1R6N A;  3IC7 A;  3RVZ A;  1H8H G;  2DYS C;  2IH1 C;  2GSM B;  2ZR2 A;  3JCZ A;  1UJW B;  4GT1 A;  1R6K A;  1Y66 A;  2P67 A;  2V1D A;  3SPH A;  4UVC A;  1R73 A;  3AG3 C;  2WSS G;  3SPJ A;  1LNQ A;  2EBO A;  1GMG A;  1E1Q G;  1PNM A;  1DTO A;  2JJ1 G;  1S72 V;  1QLE C;  2WPD G;  3BY6 A;  1OCR B;  2EZO A;  3ZRW A;  1VQ5 V;  3QO8 A;  5KUM A;  3EHB B;  3SYA A;  2ITD C;  2X6C A;  1K4D C;  4JYB A;  2ZXW B;  2OCC C;  2BOC C;  4UXN A;  2EIJ C;  3G6E V;  3TET A;  1SZT A;  2WLI B;  1RM1 B;  1JPX A;  1YIJ V;  1W0J G;  3F7V C;  4MVR A;  4JAS A;  4LC1 A;  4R6Z A;  1YJN V;  5HFL A;  4UVB A;  2IJI A;  3CCV V;  2Z5U A;  2PI5 A;  1VQ9 V;  1DF4 A;  5LGT A;  3ZIA G;  2EIK B;  5EBL C;  1AI6 A;  2JIZ G;  3AG2 C;  1BMF G;  2Y69 C;  3CCS V;  2A9H A;  1F4N A;  3ABM B;  1JQ0 A;  4MVM A;  5LGN A;  2EIN B;  3ZMS A;  4WFE A;  4XDL A;  2W6I G;  2BOB C;  5H6Q A;  3SJQ C;  2V7Q G;  2HFE C;  2QE7 G;  1G8M A;  5EBM C;  3W7S A;  1JJ2 U;  3AG4 C;  5DN6 G;  1YJW V;  2NNU A;  5B1O A;  4H37 A;  4PA6 A;  2HVK C;  4WFF A;  1JX9 A;  4JF3 A;  1OCO B;  1VQL V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...