4HYOA

Crystal structure of mthk pore
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title The voltage-dependent gate in MthK potassium channels is located at the selectivity filter.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport
total genus 31
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hyoA00
3K03A 3RW0A 2ITCC 4MS2A 5J9PC 4X88A 4HYOA 4LCUC 4H37A 4G27B 2WLLA 4MVUA 2DYSC 3LNMB 4I9WA 4PA4A 4RO2A 1OCOC 3SYPA 4PDMA 2WLNA 4PDVA 4H33A 2EINC 5KUMA 3BEHA 2JK5C 3FB7C 1J95A 2AHYA 1LNQA 3T4DA 4LBEC 4MTOA 3SPIA 4MVRA 4MVSA 4GX0A 4MVQA 4QE7A 4QE9A 3E8BA 2HG5C 4J9ZB 2HVKC 3STLC 2OCCC 3RBZA 3LDDA 5IY5C 1V55C 4J9YB 3F7YC 3T4ZA 4R50A 3SPJA 4RUEA 3SYOA 3ABLC 3LDEA 2DWDC 4KFMA 2IH3C 4HZ3A 2HFEC 2WLIA 3T2MA 3ZRSA 4P9OA 3T1CA 5EBLC 2EIMC 2IH1C 4PDRA 1KKDA 1R3JC 3TCUA 4X8AA 1XL4A 3AG3C 3ABKC 5CBFA 3SYAA 3UKMA 3E89A 2ZD9A 4MSWC 3RVZA 4BW5A 3OR7C 4MW3A 4MTFA 2WLMA 2P7TC 2A0LA 4GX5A 1R3LC 3R65A 3PJSK 3TETA 5BZBA 3X2QC 2BOCC 4G28B 2K1EA 3RVYA 2EIJC 1R3KC 4PDLA 4P2ZA 4XDLA 2WLLB 4CBCA 2X6CA 2DWEC 4UUJC 2X6BA 5EC1C 3FB5C 2EIKC 3EFFK 4MVMA 1ORQC 2QKSA 4JTCB 4PA6A 5EC2C 3AG4C 4XDJA 1P7BA 2NLJC 4JTDB 1S5HC 3IFXA 2Q68A 3F5WC 4MVOA 2H8PC 1OCCC 3AG2C 3LUTB 5B1AC 3SPCA 3ZJZA 2QTOA 3K06A 4TWKA 1BL8A 3SYQA 2Q67A 3E8GA 1OCRC 2KB1A 4OXSA 4WFGA 4WFHA 2A9HA 4GX1A 3K0DA 3E8FA 5CBHA 1G4YB 3E8HA 4RUFA 4WFFA 5E1AC 5B1BC 2BOBC 3LDCA 4P9PA 2AHZA 4F4LA 2Q6AA 2WLIB 3KG2A 3OUFA 1K4DC 4PA7A 4RAIA 2A79B 2Q69A 3ASOC 4PA9A 2R9RB 1M57C 1QLEC 2DYRC 3AG1C 4MTGA 3SYCA 4R6ZA 3K0GA 2YEVA 1V54C 3GB7C 4XDKA 1K4CC 2WLKA 3SPHA 2EILC 1R3IC 3SPGA 3K04A 1OCZC 3UM7A 3STZC 4WFEA 4MVZA 4R8CA 5KUKA 3FB8C 1ZWIC 3ABMC 2ATKC 2Y69C 3OGCC 3E86A 4DXWA 1JVMA 4LP8A 3FB6C 4R7CA 3ASNC 3HPLC 4P30A 2HVJC 4EKWA 3VOUA 3F7VC 5CBGA 3E83A 2WLJA 4X89A 4ZBMA 3IGAC 3OUSA 5EK0A 4JTAB 5B3SC 5EBMC 2W0FC 2HJFC 3K08A 4PA3A 1XL6A 4MW8A 5EBWC 3OR6C 3JYCA 4QNHB 2WLHA 2ZXWC 2ITDC 1M56C 3WG7C 2X6AA 3SJQC 4GX2A
chains in the Genus database with same CATH superfamily
4JI3O 4FZ0A 5CB4A 4KHPB 4E4EA 3JALA 1L0NH 4K8ZA 1J95A 4X1YA 5IYZA 2QWRB 5FLXN 4X1KA 1TGOA 2HG5C 1WP8A 5IYCO 5L3EA 4JI2O 4HNAB 3OFNG 2VQFO 1YF2A 1YVWA 3HKBB 3HKEA 4X62B 3OTOB 3OGIB 3H1HH 1CP9A 3N27A 4AQYB 3CC2V 2BOCC 2EIJC 1EFRG 2JJ2G 1QBZA 3T1YO 1SQXH 1GN3A 4PI2A 4EFEA 4DR2B 2YSUB 1DF5A 5HFMA 1WAZA 3AG4C 2UXDB 4JTDB 2MK3A 3IC9A 2YIBA 4QJFB 4OXSA 3T1HB 1YEWA 3AG3B 1IXBA 4WFFA 3SR2C 4TT3G 1S72V 2BTQA 2Z3YA 2GBOA 1M5IA 3AG1C 3L75H 3G67A 3GB7C 2NR5A 4TV9A 1R3IC 5GTHZ 4CH6A 5JH7A 3UM7A 2OTJV 1AI4A 4TQDA 4JI0O 2DQ3A 1ENVA 4DV6B 3ZHVA 2JS5A 2ODMA 1BGYH 1JQ0A 3B2EE 1GM9A 3G71V 1ZSPA 1RPRA 5BMVB 4PA3A 4X20B 4UCRA 5EBWC 3OMNB 3ETGA 4O4LB 3A2FA 1QLEB 4MVUA 4WFAV 4O4JA 4DR1O 1M1KW 1TVKB 4B3SO 3WG7B 1HDJA 4PA4A 4JYYA 1IURA 1RSOA 3O65A 2YDEA 5J2TB 1NVPD 4GLXA 3ZRXA 4FK5C 2N04A 4LBEC 4DV2O 1XMOO 3DXRB 2LGWA 4NTWA 3CB2A 3ICXA 2CH7B 5IJ0A 1DK1A 1Q86W 2P4KA 4O4HA 2V1DA 3JD0A 3ZMVA 4JYAB 4DV1O 2IH1C 3G6BA 1NU1H 3ABKC 2OTLV 4JV5O 1FS0G 5JJEB 2QA4V 2ZD9A 2BSKA 1JOYA 3C90A 4BWAA 4LFAO 4I55B 2QM4A 2JS3A 1SKVA 5L3FA 2G38A 4U3JA 1KKCA 1Y6XA 5EC1C 5LXTA 1K5QA 5IWAB 3HKCB 4MVMA 5BR8O 4PA6A 3CWBH 2NLJC 1GAXA 1H8HG 4OGQB 3E22B 2UUBO 5KMGA 5EYPB 3CCJV 2QWQB 2R72A 2YC0A 4B3RO 4P9PA 2HHHB 1S5LZ 3BHPA 5L3DA 1NR1A 1BHBA 4DR4O 4I5SA 1WB8A 3A8TA 1YJ9V 3K5OA 4NYKA 3SPHA 2XOKG 2XAQA 2EIKB 4JYBA 1VF6C 4JI4B 4HNAA 4B7EA 1BHAA 1HW7A 1D2DA 3E83A 4GKKO 3HKBA 3U11A 4BR6A 1XQ8A 4O2BB 1FXVA 2ILMA 3JSNA 2ZE6A 2YS8A 2HJFC 5B1BB 1XHXA 1HWYA 4QNHB 2HR3A 3WG7C 4X88A 4GX2A 2W6JG 1FFTB 2P67A 1Q6HA 3KZIZ 3L9DA 4FJCC 1SA0B 1PM9A 1M4UA 3L74H 2UU9O 1RPOA 3ABLC 2RMKB 3BFRA 5HFLA 4DR3O 1KKDA 2EX3A 1XL4A 1AI5A 3SYAA 3CCUV 3OAAG 3CEIA 1F4MA 2WLMA 4GX5A 3ABTA 4JI8B 3R65A 4YJ3B 3J7AU 1BSMA 2GTAA 4QPKA 2CTRA 4G28B 2M7WA 1GM8A 1PKXA 4JI5B 3D36C 1FD9A 1IDSA 5LGUA 3FX7A 2VWKA 5J2UB 1P7BA 1P84F 1S5HC 1P7GA 1NVPB 3FKSG 3TJTA 5A2QN 4DV5O 4LF9O 4X20A 3VQXA 1OCRC 3W7XA 3MDSA 2QTSA 4O4LA 2B9ZA 4C7UA 3E8FA 1KP2A 5LMNB 1TVKA 2W0XA 2AXTZ 3S3WA 1IBKB 4UFZA 5J2TA 1ZLZA 1K4CC 1PPJH 2WLKA 3DXRA 2YUAA 4LF5B 4KXRA 1SQFA 5JWPA 3ZHRA 4DUYO 2RDCA 1QVFU 2YIBD 4YXWG 2CH7A 2QSAA 4DR6O 4H13B 1GTOA 4RWUA 4FLUA 1K97A 4JYCA 4EEQA 2IJIA 4JTAB 3G4SV 3JYCA 4I55A 3WB2A 4X64B 1SZXA 1XHZA 1O9GA 5J9PC 5KHIA 4I9WA 3CS5A 5JCOA 3HKCA 4JI1O 3D36A 1XNRO 4DV4B 1HNZB 3E22A 4MTXA 4QE7A 3E8BA 5EZYB 2XT9A 3RBZA 5LP6B 1DF4A 3JD2A 3APOA 3FD9A 2F66C 1FXKC 4X1IB 1XREA 1SRYA 2QR4A 3EXAA 5LMUB 1S76D 2CTWA 1N36B 1RM1B 5CMUA 3X2QC 3M7MX 3AEIA 1N0NA 5GW7A 4P2ZA 5D5QA 3ZS8C 2F23A 1UJWB 2EULA 1ZUQA 3AG2C 4LC1A 3NR7A 1SZTA 1NBMG 3RT3C 2L6LA 1AR4A 1VQNV 4OPAA 4B08A 4DO2A 1MZEA 2Q7EA 4LF6B 4UB6Z 1SA0A 4W4KA 2JGDB 3RWRD 2XNDG 4EB6B 1H2SB 2UXDO 4Q6GA 2ADQB 1VQ8V 2ZR3A 2A06H 4JI6B 3FB8C 3D3IA 5LA6B 4X1KB 4N23A 3JSLA 3ZRVA 2ARHA 2UXNA 1EM1A 4X65B 4EKWA 3VOUA 1FJGB 3IGAC 1VQPV 3N2KB 2E76B 1K34A 3HKEB 1FYJA 2ITDC 1YSCA 5IJ9B 3RW0A 4H37A 5DM6V 3OEHG 3MAQA 1MA1A 4RO2A 4DV6O 4L8JA 3JATA 3H1JH 2OT5A 3IC7A 5J2UA 2O57A 3JD3A 3UQ8A 1VEWA 2KKWA 4QE9A 2FMLA 4J9YB 1J5EO 2ZM6B 1VF5B 3CJHA 3OTFA 3B4SA 4HZ3A 4TQFA 4JZGA 3WFVA 1RM1C 2ETNA 1KUQA 2N05A 4MSWC 1VP7A 1JX9A 4G2KA 2XAHA 2A0LA 2Z5UA 4B3TB 3RYCB 4PDLA 5JH7B 3ZN0A 1WB7A 3ZRWB 4YY3B 2X7RB 1QU7A 1G8MA 4KL1A 1N34B 2EBOA 1I5XA 2H8PC 1Y76B 5LYJB 3SPCA 1KB9F 2X0LA 1HR0B 2R9IA 4UV8A 1YJNV 1EN6A 4LF7B 2A3QA 4UVAA 4CZZA 1KQSU 2K9PA 2F4VB 3OUFA 3GWKC 4RAIA 5LHIA 1DLBA 1KBHA 1M57C 3THOA 2HP8A 2EIJB 4XDKA 1WN7A 2F43G 5EZYA 5A9GA 4R8CA 1DGSA 5LP6A 3AG4B 2Y0IA 3K5MA 4X1IA 3OT7A 3LNNA 2CGOA 5IJ0B 4FVMA 2Q9LA 4ZBMA 1AP6A 4LF4O 2P06A 1U96A 5EBMC 2LW1A 1XL6A 1RFYA 4UCTA 4ZHQB 4CS3A 2IJJA 2JJ1G 2E5LO 1SQVH 1Y66A 2P5OA 2IW5A 4U3JB 2JK5C 2Q5ZA 4GX0A 2E75B 2DOSA 2HEPA 1N4CA 3R66A 4J9ZB 2GV9A 5IY5C 3I5DA 3T4ZA 1U97A 1T5EA 4D7TA 1HNWB 2HKOA 2HFEC 4PDRA 4TSFG 5CN0A 2OYQA 2JGDA 4EB6A 3ZHUA 2Y0PA 3QG5A 4FM1A 3TETA 1ROPA 2LFRA 3JARA 1SQQH 3RVYA 5KX5B 5LA6A 1Q5OA 2LO1A 4I0XB 1AJPA 1IX9A 3LSSA 4XDJA 3IFXA 1BQZA 1K5SA 3N2KA 2QTOA 4CH5A 1XUQA 2JIZG 3CP1A 3I56V 5IJ9A 4GKJB 1EZVH 3ABKB 3K58A 1THZA 1QR8A 2BOBC 3LDCA 2AZ2A 5IYBO 1SC5B 4F4LA 1E1RG 2JRIA 4PA7A 2Q69A 2QKAA 3JCZA 1XMQB 3W7SA 4FFKA 3P32A 1Q3EA 4GCZA 4TOIA 2RQ6A 2QWOB 4Z2WA 3RYIB 1HNXO 2UUAB 1ZWIC 3ABMC 1TUBB 2R70A 2CUGA 2FB5A 3OD4A 4K3AA 5CBGA 5LMNO 2W6IG 5C8YB 2F1MA 4CC5A 2YXLA 3TXQA 2W0FC 4IL6Z 2L35A 2CDYA 1EZJA 1R6KA 3RYCA 4MS2A 3EHBB 1VQLV 3LNMB 5K1PA 2GSMB 3ZRWA 4H33A 4NXNB 1BE3H 1VQ6V 4DUZB 2YEVB 5FPOA 1Y76A 4X66B 5LYJA 3J81N 2ZNJA 4JF3A 1IBMB 3UT5B 1GN6A 1NT2B 1XNQO 1P49A 3SDLA 3ZHSA 2IJHA 1OHHG 4GUNA 5CBFA 2AZ0A 4WBNB 2P90A 2HJDA 4I50B 1HNZO 3PJSK 4UVBA 3L72H 3UO3A 1I94B 1I0HA 1ORQC 3OE7G 3B8NA 1K73W 1OCCC 3ABLB 1K33A 4DR5B 1N36O 1SQPH 4ZHQA 1H2LA 1YCIA 1NH2B 1XOUA 5DEDA 5E1AC 2AHZA 2KG7B 2WLIB 4ABMA 4CH3A 3ZN1A 4F6RB 3IAYA 3A0HZ 1AP5A 4YHHB 2GTSA 3AK3A 3SPGA 2FL4A 4WF9V 2JVDA 1GM7A 1CPYA 1PNMA 2Y4TA 4P30A 1QHTA 3BPZA 2C2AA 5EIBC 4LFCB 3P3NA 1AVMA 1OCRB 3ZMSA 2DQ0A 4LF8B 3Q4HB 5B5EZ 3KCYA 3TK1A 2CK3G 1IBLO 2WLHA 3BY6A 3C3TA 1AR1B 3K9AA 3GWOA 5KX5A 4NB5A 2AW9A 3FYIB 4I0XA 2WWWA 4NXMB 1EN5A 4FLWA 1KECA 2XAJA 3HB3B 1K8AW 1PP9H 1IVSA 4MVRA 2PI5A 2VQEB 4DV7O 3E35A 2BCCH 1V55C 3SJBC 2XTAA 2RNBA 1NTKH 4R50A 4HAMA 4ZOLB 3CCSV 5L3GA 2DWDC 2UXCO 3T2MA 1N33O 4LR3A 4K0KB 5H6RA 2UXBO 3RVZA 1SS3A 2V4DA 4BW5A 4F6EA 2RCVA 1WLEA 2DN9A 2WPDG 4JASA 1WP7A 4DR7O 1X59A 2K1EA 3RYIA 3KKYA 4J42A 1TUBA 4CBCA 2X6CA 2ZDIC 1G1XB 1KP3A 3CCLV 2ZM6O 3FB5C 1X4TA 2QKSA 5C8YA 2Q68A 5IYDO 2PZSA 4B3MB 3CCQV 1FXKB 4TWKA 4WFHA 3H01A 2H3OA 3CYOA 5CA1B 1WPBA 3QTCA 2CGNA 1GN4A 2Y4UA 4UCOA 2Q6AA 2A79B 3VQYA 1MNGA 3ASOC 4JI7B 4JI2B 3X2QB 4MTGA 2YEVA 1VF6A 1ZX3A 3JATB 3NXSA 3J80N 4LFBO 2GUZB 4FLYA 3UT5A 5LHGA 4GT1A 4KP4A 5DN6G 2ATKC 1B04A 1LUVA 2PTMA 1UPGA 4WFBV 2BTOA 3ASNC 4FM2A 3AG2B 3RN4A 4Z1VA 1US6A 5JVDB 3H1LH 5KLVH 3CJHB 3T1YB 1GK9A 4WBNA 2UUCO 4I50A 3QF7A 2AGAA 3W7UA 3K03A 4JAUA 1D5AA 4AILC 2OIEA 2EILB 2QWNB 4NKGB 2ZDIA 2VS0A 4MTOA 1BMFG 5LL6Y 1VQOV 2EINB 4AI8A 3QVNA 4H0LB 4GYCB 3K79A 2KG7A 2WLIA 1S77D 4PI0A 4DV3O 4O2AB 4IGGA 2ZE8A 4F6RA 3ABUA 3E89A 2F93B 2YICA 2IU3A 2RJZA 1VMGA 1NS1A 2CAZC 1N8RW 4DW0A 4XDLA 2ZINA 2YIAA 1YJWV 1WNSA 4B7KA 2YI9A 4E2LA 4FZ1A 4CC6A 3M99B 1JCHA 4K35A 4MVOA 3Q4HA 4DR1B 4B3SB 3PN1A 5B1AC 4KHPO 4DW1A 1YXBA 2QDOA 2ZQMA 3ZMZA 3B77A 1F7YA 1JJOA 1G4YB 4DV2B 2P6JA 3AK1A 1XMOB 1KC8W 2RN9A 1S3JA 1DTOA 3CPWU 2DYRC 2JEXA 1CEZA 5DECA 1VQ4V 2IJKA 1MSWD 2JDIG 4DV1B 4WFEA 4GZRB 1AILA 5KUKA 1Q7YW 3IJ4A 4X62O 3OTOO 1JVMA 1KU9A 3FB6C 4J10A 5FPRA 4ZOLA 5ITZB 2OWOA 4AQYO 4QPJA 4FLXA 2WSSG 4FLZA 2XHBA 1VIBA 3ML0A 1YITV 1S5JA 1R1BA 4DR2O 2Q4PA 5BR8B 3TGUH 2EILC 1M57B 1PNLA 2OIGA 3CC4V 4JAAA 3K59A 2DYSC 3JARB 1M56B 4ZKIA 1PV0A 3UCSC 4PDVA 4BAYA 5L3BA 3ETQA 5B1OA 2EINC 3T1HO 1YZBA 3FB7C 5FNVA 3SJCC 1LNQA 3T4DA 4B3RB 1XI1A 3DC6A 2PUSA 1FXKA 3STLC 2QKCA 3U10A 3JAWB 2QM7A 4DRXB 1L0LH 1MMMA 4DR4B 5CA1A 4O4IA 2P22C 2IM9A 2ZE5A 2FKXA 1O9HA 2ADPA 3AK2A 1IXMA 3E2EA 2GUZA 3RYFB 1VARA 4GKKB 1LUWA 3OM3B 4FLVA 4JZ2A 1H2NA 3N2GB 1OJHA 1Q90D 5AG2A 5F2VO 3CRQA 4TV8B 5JVDA 2PF4E 2GHYA 5IY5B 1SESA 2Q7HA 1URFA 3CCVV 4RQFA 2Q67A 1E79G 4JPRA 1JMKC 1G6UA 2OCHA 3GVMA 2F95B 2R9RB 1XBLA 3SYCA 2Q73A 2DMXA 3AG7A 5EIBD 2JEUA 4X9QA 4JYAO 2PYJA 2PGGA 3W7TA 1Z2GA 1VQ7V 4DXWA 2CE4A 2Q0AA 1H2GA 2LJ2A 3FFQA 1BZKA 4D7SA 4OPHA 4O2AA 1UFIA 3CXHF 1Q6UA 2QWPB 5IWAO 1LR1A 1M56C 4TUYB 4HYOA 5CA3A 2UXXA 4LWSB 4DV5B 4LF9B 1OCOC 1NTZH 4PDMA 3BEHA 1SQGA 2AHYA 2WA3A 3ABMB 3SPIA 4CS2A 5CA0B 2HHHO 4FM0A 4LF8O 1XEQA 4CS4A 4J80A 4OX9B 1TAEA 1MSDA 2GDSA 1L8DA 3DGEA 3B09A 3EVKA 3CHXA 4NXMO 4DUYB 1YI2V 3DSQA 3CX5F 4JI4O 2LP7A 1Q8IA 1NI8A 4DR6B 3LSQA 4MW3A 4K8XA 2QE7G 3BA8A 1M93A 2N74A 1R3KC 1NH2D 1D5NA 5ITZA 2ZR2A 2PI4A 1PL4A 1FXHA 4DK0A 4JAVA 3K5NA 2VRZA 1VQMV 1YTFD 4JI1B 4N21A 1Q82W 2A9HA 1XNRB 1ZTEA 1I7FA 3E8HA 4AHCA 4ZI7B 2P4VA 3B40A 3S3XA 4DYLA 1OV9A 4R6ZA 3RFRA 2NNUA 2Q0OC 4NTYA 4FFBA 1OCZC 2XAFA 4B3MO 1Y4MA 3JAWA 4DRXA 1JPXA 1AJQA 1Q43A 4JI8O 1OCCB 1GH6A 3CSXA 5H5NA 4I7ZB 4JI7O 4JI5O 2EJ7A 4IIJA 3VBBA 4DV0B 3RYFA 4YJ2B 3BRCA 3MHHC 1ZL8B 3N2GA 3O9OA 3ZHTA 4TV8A 5KUMA 4FMTA 3DC5A 3CE2A 3H1KH 1JR9A 1N32B 3HKDB 4J11A 1IBKO 5H6QA 3F7YC 3SYOA 3ZCCA 2BE3A 1KYOF 3ETEA 4LF5O 4P9OA 3OEEG 3UKMA 1YHQV 1R3LC 2B1GA 3MHSC 1Y74A 5C93A 1K3EA 4IYIA 4UCSA 3EFFK 4X64O 4JTCB 4NVPA 3P30A 1V55B 1MOFA 1WJZA 3VQWA 1L1FA 3BVOA 1ZAUA 3HR0A 3RYHB 2A7WA 2YXYA 4TUYA 3ZHQA 4DV4O 5CBHA 5GONB 4LWSA 5GTIZ 1K4DC 3D3QA 1WPXA 4JGSA 4RQEA 3JASB 3A0RA 1J5EB 4YIOA 1CXZB 3CRAA 5CA0A 2B5UA 2NN4A 5LMUO 4BIZA 5TISZ 5JJNB 1QNMA 1JFFB 3HPLC 2HVJC 4BIUA 3JD1A 5BXZA 2WLJA 4FLTA 5EK0A 2Z0AA 3QO5A 3WU2Z 1AROP 2WAMA 1Z5WA 1YDXA 3ZX6A 3OR6C 3C3SA 1NJIW 3ASOB 2LW7A 3SJQC 2JGUA 1K7DA 4PD4F 1YTFB 1FPOA 4LCUC 2WLNA 3K3WA 4LH7A 1FFXB 3ZIAG 3JAKB 3K9SA 1YIJV 4MVSA 3FAVB 3ASNB 4PJ0Z 4LF6O 2HLDG 2KSDA 3LDDA 4DK1A 3QNEA 1VQKV 3LDEA 2IH3C 1I5YA 1E1QG 3JD4A 4ZI7A 4JI6O 3AG3C 1S0VA 4NTXA 2P7TC 4X65O 1TUEB 2QGNA 3G80A 2IU0A 3U0ZA 2LGQA 5BZBA 1FJGO 3W7WA 1AJNA 1V9PA 4LF4B 4CH4A 1R6TA 1NTMH 1FKAO 4PV1B 1QQCA 3CD6V 4YIPA 2PYLA 3H1IH 4U7OA 4IYHA 2E5LB 2XUMA 3ETDA 2EJRA 3JAMN 2ZIOA 4YJ2A 1QLNA 3LSUA 1ZL8A 3ZMUA 3L71H 1QLEC 3MD0A 3CRMA 3ZBHA 4IHJB 5IT9N 5D5PA 2M6YA 5FNVB 1V54B 3HKDA 5H2FZ 4JI3B 4D6TH 3OW2U 3E86A 2ZCEA 1EBOA 1MABG 2XASA 5B1AB 2Y69B 5LOVB 2PY5A 4B3TO 3M8AA 4O4IB 3FYEB 1NKDA 2Y48A 3K08A 3F5TA 4MW8A 4YY3O 2DJVA 5LGNA 1B06A 5B3SB 2ZT9B 2X6AA 2VQFB 1N34O 4NR1A 2DYRB 1EN4A 2ITCC 3BABA 3L73H 5JQGB 1HR0O 2EZOA 4W4LA 3CCEV 1SF9A 2EZPA 5LHHA 1AI7A 1QCEA 3A0BZ 4LF7O 5KHHA 5JCOC 4I4TB 2F4VO 2CTQA 2HVKC 2IBZH 1KD1W 3H9VA 3RYHA 3SPJA 2OCCB 1GO3F 1IZ3A 2KQXA 4J7JA 5GONA 4FIPC 3ZRSA 5EBLC 1R3JC 5BMVA 1GMGA 1HNXB 3JASA 3OR7C 2DW4A 2DYSB 4H44B 3RGBA 5LBQA 4OX9O 2WLLB 3CXCU 1PL0A 1JFFA 2X6BA 2EIKC 3F5WC 4ICGA 4JI0B 3E8GA 1MZFA 4GX1A 2D3OW 3B8MA 4RUFA 5B1BC 5KHGA 3D8CA 4PA9A 1FFXA 2QJ1A 1V54C 2E3CA 1XNQB 3JAKA 1GKFA 1HNWO 3FAVA 1AB3A 1I08A 1M90W 2XAGA 1HP8A 2ZIMA 2H94A 2FTKA 3WB1A 2Y69C 1GN2A 4UXNA 4R7CA 1NZ6A 4XBFA 1H2MA 3K57A 3OUSA 1A32A 5EYPA 5BY1A 1F23A 3DTUB 5B3SC 1SERA 1Z5VA 2VWJA 1COWG 4UV9A 2ZXWB 5KHJA 3QO8A 4LNUB 4KUMA 4JV5B 3WB0A 3CRRA 3BAAA 4GKJO 2MW2B 4BW9A 4LFAB 4MVQA 4J7KA 3CCRV 2OCCC 1WA8B 4DV0O 2YXHA 5IE9A 1JA8A 1XMQO 3CRCA 3CMEV 1VQ5V 1BQ0A 4KFMA 4O2BA 3T1CA 4X8AA 3SGIA 2UUAO 5LGTA 2UUBB 5L3CA 4IHJA 2EIMB 1H8EG 4MTFA 1F51A 5H9CA 5B1NA 2LQTA 1OCOB 1N32O 3G6EV 2YI8A 4FFBB 2DWEC 3CMAV 5CB4B 3JALB 1IBLB 5LOVA 3I55V 5EC2C 4EFBA 4Q20A 4X1YB 2DE0X 1PNKA 5IYZB 1B3QA 1H2KA 1FAFA 1RP3B 3LUTB 1KMIZ 1NQTA 3K06A 3ZEDA 1Q81W 4NXNO 3OMAB 4WFGA 2CTPA 4IIJB 3K0DA 4DUZO 3BCCH 3OMIB 4X66O 3ZMTA 3KG2A 5JQGA 1IBMO 3SJAC 4DV7B 4YJ3A 1Y67A 1W2BU 1W0JG 4ZIBA 4MT8A 1JJ2U 2UXCB 5IDJA 4I4TA 3K04A 1N33B 3STZC 2UXBB 1H38A 3BA9A 2FYUH 4FPPA 5KA5A 1F4NA 3F7VC 4Z1MG 5LP6C 4DR7B 4U3FH 4U7NA 2QM8A 4BIOA 5FL7G 4QGPA 3CCMV 1NR7A 3TXSA 2UU9B 1I94O 2ZXWC 2Q8VA 4L87A 1VQ9V 4DR3B 3UO2A 1K92A 1QR9A 4G27B 2WLLA 2Q7GA 5B66Z 4DR5O 1Y74B 1BS3A 3SYPA 2BTQB 1OCZB 3VQVA 1XILA 1GRJA 1R73A 2D2CB 2ZKOA 3KCXA 4TV9B 2QEXV 2ZE7A 1AI6A 2E74B 1Q6IA 3APQA 5KAFZ 3CC7V 4QIWF 1QVGU 4RUEA 4UCVA 4YHHO 4LFBB 4I9QA 5KAIZ 5K1XA 2EIMC 1XDCA 1MG1A 3TCUA 5E79Z 5JJJB 2ZNIA 3JCUZ 1P4RA 1TA8A 4UVCA 2B1IA 4LFCO 1BCCH 4PELA 4WCEV 1OZ0A 2WA4A 4O4JB 4UUJC 2UUCB 1AR5A 4UB8Z 1RSOB 4UCUA 1SETA 1W0KG 3QO7A 2LFSA 5KA6A 1N0JA 4J7ZA 4PHZA 1B6QA 3ZJZA 1BL8A 3SYQA 2KB1A 1BT8A 2R9AA 4O4HB 1VF7A 2YIDA 3K5LA 2VQEO 4LNUA 3K0GA 2BSKB 1R6NA 3AG1B 4A5UB 5KHKA 1SQBH 1PD3A 1W59A 1M9NA 1WA8A 4MVZA 4DV3B 4K0KO 1K9MW 2V7QG 4ASUG 3OGCC 4LP8A 3L70H 5LXTB 4X89A 4HBNA 4J41A 3P3PA 4IT5A 4LH6A 5KMGB
chains in the Genus database with same CATH topology
3K03A 1K7DA 3RW0A 4JAUA 1YTFB 4LCUC 4H37A 5DM6V 3OEHG 2EILB 4RO2A 2WLNA 3K3WA 2ZDIA 2OT5A 1J95A 3IC7A 3ZIAG 3JD3A 4MTOA 1BMFG 1VQOV 1YIJV 2EINB 4MVSA 4QE9A 2HG5C 3ASNB 5IYCO 5L3EA 2HLDG 3LDDA 4J9YB 3OFNG 3QNEA 3W7UA 1VQKV 3LDEA 3K79A 2IH3C 4HZ3A 1S77D 1I5YA 1E1QG 2WLIA 3WFVA 1RM1C 3JD4A 1S0VA 3AG3C 3ABUA 3E89A 4MSWC 1JX9A 4G2KA 2XAHA 2P7TC 2A0LA 1TUEB 2IU0A 1CP9A 2IU3A 5BZBA 3CC2V 2Z5UA 2BOCC 1N8RW 3W7WA 1AJNA 2EIJC 4PDLA 1EFRG 2JJ2G 1QBZA 4XDLA 1YJWV 4E2LA 3ZN0A 3ZRWB 2X7RB 2YSUB 3CD6V 1G8MA 3M99B 1JCHA 1DF5A 5HFMA 2EBOA 3AG4C 4JTDB 4U7OA 2MK3A 4MVOA 1I5XA 2H8PC 5B1AC 3ETDA 2EJRA 2X0LA 3SPCA 4QJFB 2R9IA 4OXSA 2ZQMA 1QLNA 4UV8A 1YJNV 3ZMZA 3B77A 3AG3B 1G4YB 4WFFA 4TT3G 2P6JA 4UVAA 4CZZA 1KQSU 1KC8W 3OUFA 4RAIA 5LHIA 1S3JA 1DTOA 3CPWU 3ZMUA 1DLBA 1S72V 1M57C 1QLEC 2Z3YA 2DYRC 3AG1C 3MD0A 2JEXA 1CEZA 3GB7C 2EIJB 4XDKA 1VQ4V 1R3IC 2IJKA 2F43G 1MSWD 2JDIG 3UM7A 2OTJV 1AI4A 1V54B 4WFEA 4R8CA 5KUKA 1Q7YW 3OW2U 3E86A 3AG4B 2DQ3A 1JVMA 1ENVA 3FB6C 1EBOA 1MABG 2XASA 5B1AB 2Y69B 1JQ0A 4ZBMA 1GM9A 3FYEB 3G71V 4QPJA 2WSSG 1NKDA 2Y48A 1RPRA 3ML0A 1YITV 5EBMC 3K08A 4PA3A 1XL6A 4MW8A 5EBWC 3OMNB 5LGNA 3ETGA 5B3SB 2X6AA 2EILC 2IJJA 1QLEB 1M57B 2DYRB 1PNLA 4MVUA 3CC4V 2ITCC 4WFAV 2JJ1G 1M1KW 2DYSC 1Y66A 1M56B 3WG7B 4ZKIA 2IW5A 4PA4A 2EZOA 4PDVA 4BAYA 5L3BA 3CCEV 5B1OA 2EZPA 2EINC 5LHHA 2JK5C 3FB7C 1AI7A 1NVPD 3ZRXA 1QCEA 1LNQA 4FK5C 3T4DA 4LBEC 4GX0A 4J9ZB 1FXKA 2HVKC 3STLC 1KD1W 2QM7A 5IY5C 3T4ZA 1Q86W 3SPJA 2OCCB 1GO3F 4FIPC 2HKOA 2V1DA 2HFEC 3JD0A 3ZRSA 3ZMVA 5EBLC 2IH1C 4PDRA 1R3JC 4TSFG 1GMGA 5CN0A 3ABKC 2OTLV 1FS0G 2QA4V 2ZD9A 1IXMA 3OR7C 3E2EA 1JOYA 2DW4A 2DYSB 3TETA 1ROPA 2LFRA 3RVYA 3OM3B 5L3FA 5LBQA 2WLLB 3CXCU 1AJPA 1PL0A 3LSSA 2X6BA 5EC1C 1K5QA 2EIKC 4MVMA 4PA6A 4XDJA 2NLJC 3IFXA 2GHYA 1H8HG 1SESA 3F5WC 5IY5B 1K5SA 3CCVV 2QTOA 4RQFA 3CCJV 2Q67A 3E8GA 2JIZG 1E79G 3CP1A 3I56V 4JPRA 4GX1A 2D3OW 3B8MA 3ABKB 1THZA 4RUFA 1QR8A 5B1BC 2BOBC 3LDCA 4P9PA 5IYBO 4F4LA 1E1RG 4PA7A 2Q69A 5L3DA 4PA9A 2R9RB 1NR1A 3JCZA 3W7SA 1BHBA 3SYCA 4I5SA 1V54C 3P32A 1YJ9V 3SPHA 1GKFA 2XOKG 2XAGA 4GCZA 1M90W 2JEUA 2XAQA 2EIKB 4JYBA 2H94A 2FTKA 1ZWIC 3W7TA 3ABMC 2Y69C 1VQ7V 4DXWA 4UXNA 4R7CA 1H2GA 1BHAA 4XBFA 5CBGA 3E83A 2W6IG 3OUSA 1FXVA 1F23A 3DTUB 5B3SC 2W0FC 2HJFC 1SERA 5B1BB 1HWYA 4QNHB 1EZJA 1R6KA 1M56C 2HR3A 3WG7C 4X88A 4GX2A 2W6JG 1FFTB 4MS2A 1COWG 3EHBB 4HYOA 2ZXWB 4UV9A 1VQLV 3LNMB 5CA3A 2UXXA 2P67A 3QO8A 1OCOC 4PDMA 2GSMB 4KUMA 3ZRWA 4H33A 4FJCC 3BEHA 1VQ6V 2AHYA 2YEVB 3ABMB 3SPIA 4MVQA 3CCRV 4JF3A 2OCCC 1RPOA 3DGEA 3CMEV 3ABLC 5HFLA 1VQ5V 4KFMA 3T1CA 1KKDA 2IJHA 1OHHG 4X8AA 1YI2V 1XL4A 5LGTA 1AI5A 2LP7A 3SYAA 5CBFA 3CCUV 3LSQA 5L3CA 3OAAG 2EIMB 2P90A 4MW3A 1F4MA 1H8EG 4MTFA 2WLMA 1F51A 3ABTA 4GX5A 2QE7G 5H9CA 3SJQC 3R65A 5B1NA 3PJSK 1OCOB 4QPKA 4G28B 4UVBA 2M7WA 3G6EV 1R3KC 1GM8A 1PKXA 2DWEC 3CMAV 1NH2D 5LGUA 1ORQC 3I55V 5EC2C 1P7BA 1S5HC 4Q20A 2ZR2A 1PNKA 3B8NA 3OE7G 1K73W 2PI4A 1OCCC 1NVPB 1FXHA 3LUTB 3FKSG 4JAVA 3ABLB 1K33A 1NQTA 3K06A 1Q81W 1VQMV 1YTFD 1OCRC 4N21A 3OMAB 4WFGA 3W7XA 1Q82W 2A9HA 3K0DA 1NH2B 3E8FA 3OMIB 3E8HA 5E1AC 1KP2A 2AHZA 3ZMTA 2WLIB 3KG2A 3ZN1A 4R6ZA 5LHGA 1W2BU 1W0JG 2NNUA 1K4CC 4MT8A 2WLKA 1JJ2U 5IDJA 3SPGA 3K04A 1OCZC 2XAFA 3STZC 1Y4MA 4WF9V 1QVFU 4YXWG 1GM7A 1CPYA 1PNMA 1H38A 4FPPA 5KA5A 1JPXA 1AJQA 1GTOA 4P30A 1F4NA 1OCCB 1K97A 2C2AA 3F7VC 4JYCA 4Z1MG 4U7NA 3ZMSA 1OCRB 2DQ0A 2QM8A 2IJIA 4JTAB 5FL7G 3TK1A 3CCMV 1NR7A 3VBBA 2CK3G 3G4SV 3JYCA 2WLHA 2ZXWC 3BY6A 4L87A 1AR1B 1VQ9V 3K9AA 1K92A 1QR9A 3GWOA 5J9PC 4G27B 2WLLA 3MHHC 4I9WA 3FYIB 2WWWA 1KECA 2XAJA 3SYPA 1OCZB 5KUMA 1R73A 3HB3B 3D36A 1K8AW 4FMTA 4MTXA 2QEXV 4MVRA 2PI5A 4QE7A 3E8BA 1AI6A 3E35A 3RBZA 3CC7V 1V55C 5H6QA 1DF4A 3F7YC 3JD2A 4QIWF 4R50A 1QVGU 4RUEA 3SYOA 4HAMA 1FXKC 3CCSV 3ZCCA 5L3GA 2DWDC 1SRYA 3ETEA 3T2MA 1S76D 4P9OA 3OEEG 2EIMC 1MG1A 3TCUA 5H6RA 3UKMA 1YHQV 3RVZA 4BW5A 1RM1B 5CMUA 1WLEA 1R3LC 2B1GA 1P4RA 2WPDG 4JASA 2B1IA 4UVCA 3X2QC 3AEIA 3MHSC 4PELA 2K1EA 4WCEV 1OZ0A 5GW7A 5C93A 4P2ZA 4CBCA 1K3EA 2X6CA 2ZDIC 1KP3A 4UUJC 3CCLV 3FB5C 3EFFK 2QKSA 4JTCB 1SETA 1W0KG 3P30A 2Q68A 1V55B 5IYDO 3QO7A 2LFSA 5KA6A 1MOFA 1UJWB 3CCQV 1L1FA 3AG2C 4LC1A 1B6QA 1FXKB 3ZJZA 4TWKA 1BL8A 1SZTA 3SYQA 2KB1A 1NBMG 4WFHA 3H01A 3CYOA 5CBHA 1VQNV 2Q6AA 1K4DC 4DO2A 2A79B 3ASOC 1WPXA 4JGSA 4RQEA 3X2QB 3A0RA 4MTGA 3K0GA 2XNDG 2YEVA 1R6NA 3NXSA 3AG1B 2B5UA 1PD3A 1VQ8V 2ZR3A 1M9NA 4MVZA 3FB8C 4GT1A 4KP4A 3D3IA 4BIZA 2V7QG 2ATKC 3OGCC 4ASUG 4N23A 5DN6G 1K9MW 4LP8A 4WFBV 3ZRVA 2UXNA 3ASNC 3HPLC 2HVJC 4BIUA 3VOUA 4EKWA 3AG2B 3JD1A 2WLJA 4X89A 3IGAC 1VQPV 5EK0A 3QO5A 1AROP 2WAMA 1GK9A 1K34A 3OR6C 1NJIW 2ITDC 3ASOB 1YSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K03 A;  3RW0 A;  2ITC C;  4MS2 A;  5J9P C;  4X88 A;  4HYO A;  4LCU C;  4H37 A;  4G27 B;  2WLL A;  4MVU A;  2DYS C;  3LNM B;  4I9W A;  4PA4 A;  4RO2 A;  1OCO C;  3SYP A;  4PDM A;  2WLN A;  4PDV A;  4H33 A;  2EIN C;  5KUM A;  3BEH A;  2JK5 C;  3FB7 C;  1J95 A;  2AHY A;  1LNQ A;  3T4D A;  4LBE C;  4MTO A;  3SPI A;  4MVR A;  4MVS A;  4GX0 A;  4MVQ A;  4QE7 A;  4QE9 A;  3E8B A;  2HG5 C;  4J9Z B;  2HVK C;  3STL C;  2OCC C;  3RBZ A;  3LDD A;  5IY5 C;  1V55 C;  4J9Y B;  3F7Y C;  3T4Z A;  4R50 A;  3SPJ A;  4RUE A;  3SYO A;  3ABL C;  3LDE A;  2DWD C;  4KFM A;  2IH3 C;  4HZ3 A;  2HFE C;  2WLI A;  3T2M A;  3ZRS A;  4P9O A;  3T1C A;  5EBL C;  2EIM C;  2IH1 C;  4PDR A;  1KKD A;  1R3J C;  3TCU A;  4X8A A;  1XL4 A;  3AG3 C;  3ABK C;  5CBF A;  3SYA A;  3UKM A;  3E89 A;  2ZD9 A;  4MSW C;  3RVZ A;  4BW5 A;  3OR7 C;  4MW3 A;  4MTF A;  2WLM A;  2P7T C;  2A0L A;  4GX5 A;  1R3L C;  3R65 A;  3PJS K;  3TET A;  5BZB A;  3X2Q C;  2BOC C;  4G28 B;  2K1E A;  3RVY A;  2EIJ C;  1R3K C;  4PDL A;  4P2Z A;  4XDL A;  2WLL B;  4CBC A;  2X6C A;  2DWE C;  4UUJ C;  2X6B A;  5EC1 C;  3FB5 C;  2EIK C;  3EFF K;  4MVM A;  1ORQ C;  2QKS A;  4JTC B;  4PA6 A;  5EC2 C;  3AG4 C;  4XDJ A;  1P7B A;  2NLJ C;  4JTD B;  1S5H C;  3IFX A;  2Q68 A;  3F5W C;  4MVO A;  2H8P C;  1OCC C;  3AG2 C;  3LUT B;  5B1A C;  3SPC A;  3ZJZ A;  2QTO A;  3K06 A;  4TWK A;  1BL8 A;  3SYQ A;  2Q67 A;  3E8G A;  1OCR C;  2KB1 A;  4OXS A;  4WFG A;  4WFH A;  2A9H A;  4GX1 A;  3K0D A;  3E8F A;  5CBH A;  1G4Y B;  3E8H A;  4RUF A;  4WFF A;  5E1A C;  5B1B C;  2BOB C;  3LDC A;  4P9P A;  2AHZ A;  4F4L A;  2Q6A A;  2WLI B;  3KG2 A;  3OUF A;  1K4D C;  4PA7 A;  4RAI A;  2A79 B;  2Q69 A;  3ASO C;  4PA9 A;  2R9R B;  1M57 C;  1QLE C;  2DYR C;  3AG1 C;  4MTG A;  3SYC A;  4R6Z A;  3K0G A;  2YEV A;  1V54 C;  3GB7 C;  4XDK A;  1K4C C;  2WLK A;  3SPH A;  2EIL C;  1R3I C;  3SPG A;  3K04 A;  1OCZ C;  3UM7 A;  3STZ C;  4WFE A;  4MVZ A;  4R8C A;  5KUK A;  3FB8 C;  1ZWI C;  3ABM C;  2ATK C;  2Y69 C;  3OGC C;  3E86 A;  4DXW A;  1JVM A;  4LP8 A;  3FB6 C;  4R7C A;  3ASN C;  3HPL C;  4P30 A;  2HVJ C;  4EKW A;  3VOU A;  3F7V C;  5CBG A;  3E83 A;  2WLJ A;  4X89 A;  4ZBM A;  3IGA C;  3OUS A;  5EK0 A;  4JTA B;  5B3S C;  5EBM C;  2W0F C;  2HJF C;  3K08 A;  4PA3 A;  1XL6 A;  4MW8 A;  5EBW C;  3OR6 C;  3JYC A;  4QNH B;  2WLH A;  2ZXW C;  2ITD C;  1M56 C;  3WG7 C;  2X6A A;  3SJQ C;  4GX2 A; 
#chains in the Genus database with same CATH topology
 4JI3 O;  4FZ0 A;  5CB4 A;  4KHP B;  4E4E A;  3JAL A;  1L0N H;  4K8Z A;  1J95 A;  4X1Y A;  5IYZ A;  2QWR B;  5FLX N;  4X1K A;  1TGO A;  2HG5 C;  1WP8 A;  5IYC O;  5L3E A;  4JI2 O;  4HNA B;  3OFN G;  2VQF O;  1YF2 A;  1YVW A;  3HKB B;  3HKE A;  4X62 B;  3OTO B;  3OGI B;  3H1H H;  1CP9 A;  3N27 A;  4AQY B;  3CC2 V;  2BOC C;  2EIJ C;  1EFR G;  2JJ2 G;  1QBZ A;  3T1Y O;  1SQX H;  1GN3 A;  4PI2 A;  4EFE A;  4DR2 B;  2YSU B;  1DF5 A;  5HFM A;  1WAZ A;  3AG4 C;  2UXD B;  4JTD B;  2MK3 A;  3IC9 A;  2YIB A;  4QJF B;  4OXS A;  3T1H B;  1YEW A;  3AG3 B;  1IXB A;  4WFF A;  3SR2 C;  4TT3 G;  1S72 V;  2BTQ A;  2Z3Y A;  2GBO A;  1M5I A;  3AG1 C;  3L75 H;  3G67 A;  3GB7 C;  2NR5 A;  4TV9 A;  1R3I C;  5GTH Z;  4CH6 A;  5JH7 A;  3UM7 A;  2OTJ V;  1AI4 A;  4TQD A;  4JI0 O;  2DQ3 A;  1ENV A;  4DV6 B;  3ZHV A;  2JS5 A;  2ODM A;  1BGY H;  1JQ0 A;  3B2E E;  1GM9 A;  3G71 V;  1ZSP A;  1RPR A;  5BMV B;  4PA3 A;  4X20 B;  4UCR A;  5EBW C;  3OMN B;  3ETG A;  4O4L B;  3A2F A;  1QLE B;  4MVU A;  4WFA V;  4O4J A;  4DR1 O;  1M1K W;  1TVK B;  4B3S O;  3WG7 B;  1HDJ A;  4PA4 A;  4JYY A;  1IUR A;  1RSO A;  3O65 A;  2YDE A;  5J2T B;  1NVP D;  4GLX A;  3ZRX A;  4FK5 C;  2N04 A;  4LBE C;  4DV2 O;  1XMO O;  3DXR B;  2LGW A;  4NTW A;  3CB2 A;  3ICX A;  2CH7 B;  5IJ0 A;  1DK1 A;  1Q86 W;  2P4K A;  4O4H A;  2V1D A;  3JD0 A;  3ZMV A;  4JYA B;  4DV1 O;  2IH1 C;  3G6B A;  1NU1 H;  3ABK C;  2OTL V;  4JV5 O;  1FS0 G;  5JJE B;  2QA4 V;  2ZD9 A;  2BSK A;  1JOY A;  3C90 A;  4BWA A;  4LFA O;  4I55 B;  2QM4 A;  2JS3 A;  1SKV A;  5L3F A;  2G38 A;  4U3J A;  1KKC A;  1Y6X A;  5EC1 C;  5LXT A;  1K5Q A;  5IWA B;  3HKC B;  4MVM A;  5BR8 O;  4PA6 A;  3CWB H;  2NLJ C;  1GAX A;  1H8H G;  4OGQ B;  3E22 B;  2UUB O;  5KMG A;  5EYP B;  3CCJ V;  2QWQ B;  2R72 A;  2YC0 A;  4B3R O;  4P9P A;  2HHH B;  1S5L Z;  3BHP A;  5L3D A;  1NR1 A;  1BHB A;  4DR4 O;  4I5S A;  1WB8 A;  3A8T A;  1YJ9 V;  3K5O A;  4NYK A;  3SPH A;  2XOK G;  2XAQ A;  2EIK B;  4JYB A;  1VF6 C;  4JI4 B;  4HNA A;  4B7E A;  1BHA A;  1HW7 A;  1D2D A;  3E83 A;  4GKK O;  3HKB A;  3U11 A;  4BR6 A;  1XQ8 A;  4O2B B;  1FXV A;  2ILM A;  3JSN A;  2ZE6 A;  2YS8 A;  2HJF C;  5B1B B;  1XHX A;  1HWY A;  4QNH B;  2HR3 A;  3WG7 C;  4X88 A;  4GX2 A;  2W6J G;  1FFT B;  2P67 A;  1Q6H A;  3KZI Z;  3L9D A;  4FJC C;  1SA0 B;  1PM9 A;  1M4U A;  3L74 H;  2UU9 O;  1RPO A;  3ABL C;  2RMK B;  3BFR A;  5HFL A;  4DR3 O;  1KKD A;  2EX3 A;  1XL4 A;  1AI5 A;  3SYA A;  3CCU V;  3OAA G;  3CEI A;  1F4M A;  2WLM A;  4GX5 A;  3ABT A;  4JI8 B;  3R65 A;  4YJ3 B;  3J7A U;  1BSM A;  2GTA A;  4QPK A;  2CTR A;  4G28 B;  2M7W A;  1GM8 A;  1PKX A;  4JI5 B;  3D36 C;  1FD9 A;  1IDS A;  5LGU A;  3FX7 A;  2VWK A;  5J2U B;  1P7B A;  1P84 F;  1S5H C;  1P7G A;  1NVP B;  3FKS G;  3TJT A;  5A2Q N;  4DV5 O;  4LF9 O;  4X20 A;  3VQX A;  1OCR C;  3W7X A;  3MDS A;  2QTS A;  4O4L A;  2B9Z A;  4C7U A;  3E8F A;  1KP2 A;  5LMN B;  1TVK A;  2W0X A;  2AXT Z;  3S3W A;  1IBK B;  4UFZ A;  5J2T A;  1ZLZ A;  1K4C C;  1PPJ H;  2WLK A;  3DXR A;  2YUA A;  4LF5 B;  4KXR A;  1SQF A;  5JWP A;  3ZHR A;  4DUY O;  2RDC A;  1QVF U;  2YIB D;  4YXW G;  2CH7 A;  2QSA A;  4DR6 O;  4H13 B;  1GTO A;  4RWU A;  4FLU A;  1K97 A;  4JYC A;  4EEQ A;  2IJI A;  4JTA B;  3G4S V;  3JYC A;  4I55 A;  3WB2 A;  4X64 B;  1SZX A;  1XHZ A;  1O9G A;  5J9P C;  5KHI A;  4I9W A;  3CS5 A;  5JCO A;  3HKC A;  4JI1 O;  3D36 A;  1XNR O;  4DV4 B;  1HNZ B;  3E22 A;  4MTX A;  4QE7 A;  3E8B A;  5EZY B;  2XT9 A;  3RBZ A;  5LP6 B;  1DF4 A;  3JD2 A;  3APO A;  3FD9 A;  2F66 C;  1FXK C;  4X1I B;  1XRE A;  1SRY A;  2QR4 A;  3EXA A;  5LMU B;  1S76 D;  2CTW A;  1N36 B;  1RM1 B;  5CMU A;  3X2Q C;  3M7M X;  3AEI A;  1N0N A;  5GW7 A;  4P2Z A;  5D5Q A;  3ZS8 C;  2F23 A;  1UJW B;  2EUL A;  1ZUQ A;  3AG2 C;  4LC1 A;  3NR7 A;  1SZT A;  1NBM G;  3RT3 C;  2L6L A;  1AR4 A;  1VQN V;  4OPA A;  4B08 A;  4DO2 A;  1MZE A;  2Q7E A;  4LF6 B;  4UB6 Z;  1SA0 A;  4W4K A;  2JGD B;  3RWR D;  2XND G;  4EB6 B;  1H2S B;  2UXD O;  4Q6G A;  2ADQ B;  1VQ8 V;  2ZR3 A;  2A06 H;  4JI6 B;  3FB8 C;  3D3I A;  5LA6 B;  4X1K B;  4N23 A;  3JSL A;  3ZRV A;  2ARH A;  2UXN A;  1EM1 A;  4X65 B;  4EKW A;  3VOU A;  1FJG B;  3IGA C;  1VQP V;  3N2K B;  2E76 B;  1K34 A;  3HKE B;  1FYJ A;  2ITD C;  1YSC A;  5IJ9 B;  3RW0 A;  4H37 A;  5DM6 V;  3OEH G;  3MAQ A;  1MA1 A;  4RO2 A;  4DV6 O;  4L8J A;  3JAT A;  3H1J H;  2OT5 A;  3IC7 A;  5J2U A;  2O57 A;  3JD3 A;  3UQ8 A;  1VEW A;  2KKW A;  4QE9 A;  2FML A;  4J9Y B;  1J5E O;  2ZM6 B;  1VF5 B;  3CJH A;  3OTF A;  3B4S A;  4HZ3 A;  4TQF A;  4JZG A;  3WFV A;  1RM1 C;  2ETN A;  1KUQ A;  2N05 A;  4MSW C;  1VP7 A;  1JX9 A;  4G2K A;  2XAH A;  2A0L A;  2Z5U A;  4B3T B;  3RYC B;  4PDL A;  5JH7 B;  3ZN0 A;  1WB7 A;  3ZRW B;  4YY3 B;  2X7R B;  1QU7 A;  1G8M A;  4KL1 A;  1N34 B;  2EBO A;  1I5X A;  2H8P C;  1Y76 B;  5LYJ B;  3SPC A;  1KB9 F;  2X0L A;  1HR0 B;  2R9I A;  4UV8 A;  1YJN V;  1EN6 A;  4LF7 B;  2A3Q A;  4UVA A;  4CZZ A;  1KQS U;  2K9P A;  2F4V B;  3OUF A;  3GWK C;  4RAI A;  5LHI A;  1DLB A;  1KBH A;  1M57 C;  3THO A;  2HP8 A;  2EIJ B;  4XDK A;  1WN7 A;  2F43 G;  5EZY A;  5A9G A;  4R8C A;  1DGS A;  5LP6 A;  3AG4 B;  2Y0I A;  3K5M A;  4X1I A;  3OT7 A;  3LNN A;  2CGO A;  5IJ0 B;  4FVM A;  2Q9L A;  4ZBM A;  1AP6 A;  4LF4 O;  2P06 A;  1U96 A;  5EBM C;  2LW1 A;  1XL6 A;  1RFY A;  4UCT A;  4ZHQ B;  4CS3 A;  2IJJ A;  2JJ1 G;  2E5L O;  1SQV H;  1Y66 A;  2P5O A;  2IW5 A;  4U3J B;  2JK5 C;  2Q5Z A;  4GX0 A;  2E75 B;  2DOS A;  2HEP A;  1N4C A;  3R66 A;  4J9Z B;  2GV9 A;  5IY5 C;  3I5D A;  3T4Z A;  1U97 A;  1T5E A;  4D7T A;  1HNW B;  2HKO A;  2HFE C;  4PDR A;  4TSF G;  5CN0 A;  2OYQ A;  2JGD A;  4EB6 A;  3ZHU A;  2Y0P A;  3QG5 A;  4FM1 A;  3TET A;  1ROP A;  2LFR A;  3JAR A;  1SQQ H;  3RVY A;  5KX5 B;  5LA6 A;  1Q5O A;  2LO1 A;  4I0X B;  1AJP A;  1IX9 A;  3LSS A;  4XDJ A;  3IFX A;  1BQZ A;  1K5S A;  3N2K A;  2QTO A;  4CH5 A;  1XUQ A;  2JIZ G;  3CP1 A;  3I56 V;  5IJ9 A;  4GKJ B;  1EZV H;  3ABK B;  3K58 A;  1THZ A;  1QR8 A;  2BOB C;  3LDC A;  2AZ2 A;  5IYB O;  1SC5 B;  4F4L A;  1E1R G;  2JRI A;  4PA7 A;  2Q69 A;  2QKA A;  3JCZ A;  1XMQ B;  3W7S A;  4FFK A;  3P32 A;  1Q3E A;  4GCZ A;  4TOI A;  2RQ6 A;  2QWO B;  4Z2W A;  3RYI B;  1HNX O;  2UUA B;  1ZWI C;  3ABM C;  1TUB B;  2R70 A;  2CUG A;  2FB5 A;  3OD4 A;  4K3A A;  5CBG A;  5LMN O;  2W6I G;  5C8Y B;  2F1M A;  4CC5 A;  2YXL A;  3TXQ A;  2W0F C;  4IL6 Z;  2L35 A;  2CDY A;  1EZJ A;  1R6K A;  3RYC A;  4MS2 A;  3EHB B;  1VQL V;  3LNM B;  5K1P A;  2GSM B;  3ZRW A;  4H33 A;  4NXN B;  1BE3 H;  1VQ6 V;  4DUZ B;  2YEV B;  5FPO A;  1Y76 A;  4X66 B;  5LYJ A;  3J81 N;  2ZNJ A;  4JF3 A;  1IBM B;  3UT5 B;  1GN6 A;  1NT2 B;  1XNQ O;  1P49 A;  3SDL A;  3ZHS A;  2IJH A;  1OHH G;  4GUN A;  5CBF A;  2AZ0 A;  4WBN B;  2P90 A;  2HJD A;  4I50 B;  1HNZ O;  3PJS K;  4UVB A;  3L72 H;  3UO3 A;  1I94 B;  1I0H A;  1ORQ C;  3OE7 G;  3B8N A;  1K73 W;  1OCC C;  3ABL B;  1K33 A;  4DR5 B;  1N36 O;  1SQP H;  4ZHQ A;  1H2L A;  1YCI A;  1NH2 B;  1XOU A;  5DED A;  5E1A C;  2AHZ A;  2KG7 B;  2WLI B;  4ABM A;  4CH3 A;  3ZN1 A;  4F6R B;  3IAY A;  3A0H Z;  1AP5 A;  4YHH B;  2GTS A;  3AK3 A;  3SPG A;  2FL4 A;  4WF9 V;  2JVD A;  1GM7 A;  1CPY A;  1PNM A;  2Y4T A;  4P30 A;  1QHT A;  3BPZ A;  2C2A A;  5EIB C;  4LFC B;  3P3N A;  1AVM A;  1OCR B;  3ZMS A;  2DQ0 A;  4LF8 B;  3Q4H B;  5B5E Z;  3KCY A;  3TK1 A;  2CK3 G;  1IBL O;  2WLH A;  3BY6 A;  3C3T A;  1AR1 B;  3K9A A;  3GWO A;  5KX5 A;  4NB5 A;  2AW9 A;  3FYI B;  4I0X A;  2WWW A;  4NXM B;  1EN5 A;  4FLW A;  1KEC A;  2XAJ A;  3HB3 B;  1K8A W;  1PP9 H;  1IVS A;  4MVR A;  2PI5 A;  2VQE B;  4DV7 O;  3E35 A;  2BCC H;  1V55 C;  3SJB C;  2XTA A;  2RNB A;  1NTK H;  4R50 A;  4HAM A;  4ZOL B;  3CCS V;  5L3G A;  2DWD C;  2UXC O;  3T2M A;  1N33 O;  4LR3 A;  4K0K B;  5H6R A;  2UXB O;  3RVZ A;  1SS3 A;  2V4D A;  4BW5 A;  4F6E A;  2RCV A;  1WLE A;  2DN9 A;  2WPD G;  4JAS A;  1WP7 A;  4DR7 O;  1X59 A;  2K1E A;  3RYI A;  3KKY A;  4J42 A;  1TUB A;  4CBC A;  2X6C A;  2ZDI C;  1G1X B;  1KP3 A;  3CCL V;  2ZM6 O;  3FB5 C;  1X4T A;  2QKS A;  5C8Y A;  2Q68 A;  5IYD O;  2PZS A;  4B3M B;  3CCQ V;  1FXK B;  4TWK A;  4WFH A;  3H01 A;  2H3O A;  3CYO A;  5CA1 B;  1WPB A;  3QTC A;  2CGN A;  1GN4 A;  2Y4U A;  4UCO A;  2Q6A A;  2A79 B;  3VQY A;  1MNG A;  3ASO C;  4JI7 B;  4JI2 B;  3X2Q B;  4MTG A;  2YEV A;  1VF6 A;  1ZX3 A;  3JAT B;  3NXS A;  3J80 N;  4LFB O;  2GUZ B;  4FLY A;  3UT5 A;  5LHG A;  4GT1 A;  4KP4 A;  5DN6 G;  2ATK C;  1B04 A;  1LUV A;  2PTM A;  1UPG A;  4WFB V;  2BTO A;  3ASN C;  4FM2 A;  3AG2 B;  3RN4 A;  4Z1V A;  1US6 A;  5JVD B;  3H1L H;  5KLV H;  3CJH B;  3T1Y B;  1GK9 A;  4WBN A;  2UUC O;  4I50 A;  3QF7 A;  2AGA A;  3W7U A;  3K03 A;  4JAU A;  1D5A A;  4AIL C;  2OIE A;  2EIL B;  2QWN B;  4NKG B;  2ZDI A;  2VS0 A;  4MTO A;  1BMF G;  5LL6 Y;  1VQO V;  2EIN B;  4AI8 A;  3QVN A;  4H0L B;  4GYC B;  3K79 A;  2KG7 A;  2WLI A;  1S77 D;  4PI0 A;  4DV3 O;  4O2A B;  4IGG A;  2ZE8 A;  4F6R A;  3ABU A;  3E89 A;  2F93 B;  2YIC A;  2IU3 A;  2RJZ A;  1VMG A;  1NS1 A;  2CAZ C;  1N8R W;  4DW0 A;  4XDL A;  2ZIN A;  2YIA A;  1YJW V;  1WNS A;  4B7K A;  2YI9 A;  4E2L A;  4FZ1 A;  4CC6 A;  3M99 B;  1JCH A;  4K35 A;  4MVO A;  3Q4H A;  4DR1 B;  4B3S B;  3PN1 A;  5B1A C;  4KHP O;  4DW1 A;  1YXB A;  2QDO A;  2ZQM A;  3ZMZ A;  3B77 A;  1F7Y A;  1JJO A;  1G4Y B;  4DV2 B;  2P6J A;  3AK1 A;  1XMO B;  1KC8 W;  2RN9 A;  1S3J A;  1DTO A;  3CPW U;  2DYR C;  2JEX A;  1CEZ A;  5DEC A;  1VQ4 V;  2IJK A;  1MSW D;  2JDI G;  4DV1 B;  4WFE A;  4GZR B;  1AIL A;  5KUK A;  1Q7Y W;  3IJ4 A;  4X62 O;  3OTO O;  1JVM A;  1KU9 A;  3FB6 C;  4J10 A;  5FPR A;  4ZOL A;  5ITZ B;  2OWO A;  4AQY O;  4QPJ A;  4FLX A;  2WSS G;  4FLZ A;  2XHB A;  1VIB A;  3ML0 A;  1YIT V;  1S5J A;  1R1B A;  4DR2 O;  2Q4P A;  5BR8 B;  3TGU H;  2EIL C;  1M57 B;  1PNL A;  2OIG A;  3CC4 V;  4JAA A;  3K59 A;  2DYS C;  3JAR B;  1M56 B;  4ZKI A;  1PV0 A;  3UCS C;  4PDV A;  4BAY A;  5L3B A;  3ETQ A;  5B1O A;  2EIN C;  3T1H O;  1YZB A;  3FB7 C;  5FNV A;  3SJC C;  1LNQ A;  3T4D A;  4B3R B;  1XI1 A;  3DC6 A;  2PUS A;  1FXK A;  3STL C;  2QKC A;  3U10 A;  3JAW B;  2QM7 A;  4DRX B;  1L0L H;  1MMM A;  4DR4 B;  5CA1 A;  4O4I A;  2P22 C;  2IM9 A;  2ZE5 A;  2FKX A;  1O9H A;  2ADP A;  3AK2 A;  1IXM A;  3E2E A;  2GUZ A;  3RYF B;  1VAR A;  4GKK B;  1LUW A;  3OM3 B;  4FLV A;  4JZ2 A;  1H2N A;  3N2G B;  1OJH A;  1Q90 D;  5AG2 A;  5F2V O;  3CRQ A;  4TV8 B;  5JVD A;  2PF4 E;  2GHY A;  5IY5 B;  1SES A;  2Q7H A;  1URF A;  3CCV V;  4RQF A;  2Q67 A;  1E79 G;  4JPR A;  1JMK C;  1G6U A;  2OCH A;  3GVM A;  2F95 B;  2R9R B;  1XBL A;  3SYC A;  2Q73 A;  2DMX A;  3AG7 A;  5EIB D;  2JEU A;  4X9Q A;  4JYA O;  2PYJ A;  2PGG A;  3W7T A;  1Z2G A;  1VQ7 V;  4DXW A;  2CE4 A;  2Q0A A;  1H2G A;  2LJ2 A;  3FFQ A;  1BZK A;  4D7S A;  4OPH A;  4O2A A;  1UFI A;  3CXH F;  1Q6U A;  2QWP B;  5IWA O;  1LR1 A;  1M56 C;  4TUY B;  4HYO A;  5CA3 A;  2UXX A;  4LWS B;  4DV5 B;  4LF9 B;  1OCO C;  1NTZ H;  4PDM A;  3BEH A;  1SQG A;  2AHY A;  2WA3 A;  3ABM B;  3SPI A;  4CS2 A;  5CA0 B;  2HHH O;  4FM0 A;  4LF8 O;  1XEQ A;  4CS4 A;  4J80 A;  4OX9 B;  1TAE A;  1MSD A;  2GDS A;  1L8D A;  3DGE A;  3B09 A;  3EVK A;  3CHX A;  4NXM O;  4DUY B;  1YI2 V;  3DSQ A;  3CX5 F;  4JI4 O;  2LP7 A;  1Q8I A;  1NI8 A;  4DR6 B;  3LSQ A;  4MW3 A;  4K8X A;  2QE7 G;  3BA8 A;  1M93 A;  2N74 A;  1R3K C;  1NH2 D;  1D5N A;  5ITZ A;  2ZR2 A;  2PI4 A;  1PL4 A;  1FXH A;  4DK0 A;  4JAV A;  3K5N A;  2VRZ A;  1VQM V;  1YTF D;  4JI1 B;  4N21 A;  1Q82 W;  2A9H A;  1XNR B;  1ZTE A;  1I7F A;  3E8H A;  4AHC A;  4ZI7 B;  2P4V A;  3B40 A;  3S3X A;  4DYL A;  1OV9 A;  4R6Z A;  3RFR A;  2NNU A;  2Q0O C;  4NTY A;  4FFB A;  1OCZ C;  2XAF A;  4B3M O;  1Y4M A;  3JAW A;  4DRX A;  1JPX A;  1AJQ A;  1Q43 A;  4JI8 O;  1OCC B;  1GH6 A;  3CSX A;  5H5N A;  4I7Z B;  4JI7 O;  4JI5 O;  2EJ7 A;  4IIJ A;  3VBB A;  4DV0 B;  3RYF A;  4YJ2 B;  3BRC A;  3MHH C;  1ZL8 B;  3N2G A;  3O9O A;  3ZHT A;  4TV8 A;  5KUM A;  4FMT A;  3DC5 A;  3CE2 A;  3H1K H;  1JR9 A;  1N32 B;  3HKD B;  4J11 A;  1IBK O;  5H6Q A;  3F7Y C;  3SYO A;  3ZCC A;  2BE3 A;  1KYO F;  3ETE A;  4LF5 O;  4P9O A;  3OEE G;  3UKM A;  1YHQ V;  1R3L C;  2B1G A;  3MHS C;  1Y74 A;  5C93 A;  1K3E A;  4IYI A;  4UCS A;  3EFF K;  4X64 O;  4JTC B;  4NVP A;  3P30 A;  1V55 B;  1MOF A;  1WJZ A;  3VQW A;  1L1F A;  3BVO A;  1ZAU A;  3HR0 A;  3RYH B;  2A7W A;  2YXY A;  4TUY A;  3ZHQ A;  4DV4 O;  5CBH A;  5GON B;  4LWS A;  5GTI Z;  1K4D C;  3D3Q A;  1WPX A;  4JGS A;  4RQE A;  3JAS B;  3A0R A;  1J5E B;  4YIO A;  1CXZ B;  3CRA A;  5CA0 A;  2B5U A;  2NN4 A;  5LMU O;  4BIZ A;  5TIS Z;  5JJN B;  1QNM A;  1JFF B;  3HPL C;  2HVJ C;  4BIU A;  3JD1 A;  5BXZ A;  2WLJ A;  4FLT A;  5EK0 A;  2Z0A A;  3QO5 A;  3WU2 Z;  1ARO P;  2WAM A;  1Z5W A;  1YDX A;  3ZX6 A;  3OR6 C;  3C3S A;  1NJI W;  3ASO B;  2LW7 A;  3SJQ C;  2JGU A;  1K7D A;  4PD4 F;  1YTF B;  1FPO A;  4LCU C;  2WLN A;  3K3W A;  4LH7 A;  1FFX B;  3ZIA G;  3JAK B;  3K9S A;  1YIJ V;  4MVS A;  3FAV B;  3ASN B;  4PJ0 Z;  4LF6 O;  2HLD G;  2KSD A;  3LDD A;  4DK1 A;  3QNE A;  1VQK V;  3LDE A;  2IH3 C;  1I5Y A;  1E1Q G;  3JD4 A;  4ZI7 A;  4JI6 O;  3AG3 C;  1S0V A;  4NTX A;  2P7T C;  4X65 O;  1TUE B;  2QGN A;  3G80 A;  2IU0 A;  3U0Z A;  2LGQ A;  5BZB A;  1FJG O;  3W7W A;  1AJN A;  1V9P A;  4LF4 B;  4CH4 A;  1R6T A;  1NTM H;  1FKA O;  4PV1 B;  1QQC A;  3CD6 V;  4YIP A;  2PYL A;  3H1I H;  4U7O A;  4IYH A;  2E5L B;  2XUM A;  3ETD A;  2EJR A;  3JAM N;  2ZIO A;  4YJ2 A;  1QLN A;  3LSU A;  1ZL8 A;  3ZMU A;  3L71 H;  1QLE C;  3MD0 A;  3CRM A;  3ZBH A;  4IHJ B;  5IT9 N;  5D5P A;  2M6Y A;  5FNV B;  1V54 B;  3HKD A;  5H2F Z;  4JI3 B;  4D6T H;  3OW2 U;  3E86 A;  2ZCE A;  1EBO A;  1MAB G;  2XAS A;  5B1A B;  2Y69 B;  5LOV B;  2PY5 A;  4B3T O;  3M8A A;  4O4I B;  3FYE B;  1NKD A;  2Y48 A;  3K08 A;  3F5T A;  4MW8 A;  4YY3 O;  2DJV A;  5LGN A;  1B06 A;  5B3S B;  2ZT9 B;  2X6A A;  2VQF B;  1N34 O;  4NR1 A;  2DYR B;  1EN4 A;  2ITC C;  3BAB A;  3L73 H;  5JQG B;  1HR0 O;  2EZO A;  4W4L A;  3CCE V;  1SF9 A;  2EZP A;  5LHH A;  1AI7 A;  1QCE A;  3A0B Z;  4LF7 O;  5KHH A;  5JCO C;  4I4T B;  2F4V O;  2CTQ A;  2HVK C;  2IBZ H;  1KD1 W;  3H9V A;  3RYH A;  3SPJ A;  2OCC B;  1GO3 F;  1IZ3 A;  2KQX A;  4J7J A;  5GON A;  4FIP C;  3ZRS A;  5EBL C;  1R3J C;  5BMV A;  1GMG A;  1HNX B;  3JAS A;  3OR7 C;  2DW4 A;  2DYS B;  4H44 B;  3RGB A;  5LBQ A;  4OX9 O;  2WLL B;  3CXC U;  1PL0 A;  1JFF A;  2X6B A;  2EIK C;  3F5W C;  4ICG A;  4JI0 B;  3E8G A;  1MZF A;  4GX1 A;  2D3O W;  3B8M A;  4RUF A;  5B1B C;  5KHG A;  3D8C A;  4PA9 A;  1FFX A;  2QJ1 A;  1V54 C;  2E3C A;  1XNQ B;  3JAK A;  1GKF A;  1HNW O;  3FAV A;  1AB3 A;  1I08 A;  1M90 W;  2XAG A;  1HP8 A;  2ZIM A;  2H94 A;  2FTK A;  3WB1 A;  2Y69 C;  1GN2 A;  4UXN A;  4R7C A;  1NZ6 A;  4XBF A;  1H2M A;  3K57 A;  3OUS A;  1A32 A;  5EYP A;  5BY1 A;  1F23 A;  3DTU B;  5B3S C;  1SER A;  1Z5V A;  2VWJ A;  1COW G;  4UV9 A;  2ZXW B;  5KHJ A;  3QO8 A;  4LNU B;  4KUM A;  4JV5 B;  3WB0 A;  3CRR A;  3BAA A;  4GKJ O;  2MW2 B;  4BW9 A;  4LFA B;  4MVQ A;  4J7K A;  3CCR V;  2OCC C;  1WA8 B;  4DV0 O;  2YXH A;  5IE9 A;  1JA8 A;  1XMQ O;  3CRC A;  3CME V;  1VQ5 V;  1BQ0 A;  4KFM A;  4O2B A;  3T1C A;  4X8A A;  3SGI A;  2UUA O;  5LGT A;  2UUB B;  5L3C A;  4IHJ A;  2EIM B;  1H8E G;  4MTF A;  1F51 A;  5H9C A;  5B1N A;  2LQT A;  1OCO B;  1N32 O;  3G6E V;  2YI8 A;  4FFB B;  2DWE C;  3CMA V;  5CB4 B;  3JAL B;  1IBL B;  5LOV A;  3I55 V;  5EC2 C;  4EFB A;  4Q20 A;  4X1Y B;  2DE0 X;  1PNK A;  5IYZ B;  1B3Q A;  1H2K A;  1FAF A;  1RP3 B;  3LUT B;  1KMI Z;  1NQT A;  3K06 A;  3ZED A;  1Q81 W;  4NXN O;  3OMA B;  4WFG A;  2CTP A;  4IIJ B;  3K0D A;  4DUZ O;  3BCC H;  3OMI B;  4X66 O;  3ZMT A;  3KG2 A;  5JQG A;  1IBM O;  3SJA C;  4DV7 B;  4YJ3 A;  1Y67 A;  1W2B U;  1W0J G;  4ZIB A;  4MT8 A;  1JJ2 U;  2UXC B;  5IDJ A;  4I4T A;  3K04 A;  1N33 B;  3STZ C;  2UXB B;  1H38 A;  3BA9 A;  2FYU H;  4FPP A;  5KA5 A;  1F4N A;  3F7V C;  4Z1M G;  5LP6 C;  4DR7 B;  4U3F H;  4U7N A;  2QM8 A;  4BIO A;  5FL7 G;  4QGP A;  3CCM V;  1NR7 A;  3TXS A;  2UU9 B;  1I94 O;  2ZXW C;  2Q8V A;  4L87 A;  1VQ9 V;  4DR3 B;  3UO2 A;  1K92 A;  1QR9 A;  4G27 B;  2WLL A;  2Q7G A;  5B66 Z;  4DR5 O;  1Y74 B;  1BS3 A;  3SYP A;  2BTQ B;  1OCZ B;  3VQV A;  1XIL A;  1GRJ A;  1R73 A;  2D2C B;  2ZKO A;  3KCX A;  4TV9 B;  2QEX V;  2ZE7 A;  1AI6 A;  2E74 B;  1Q6I A;  3APQ A;  5KAF Z;  3CC7 V;  4QIW F;  1QVG U;  4RUE A;  4UCV A;  4YHH O;  4LFB B;  4I9Q A;  5KAI Z;  5K1X A;  2EIM C;  1XDC A;  1MG1 A;  3TCU A;  5E79 Z;  5JJJ B;  2ZNI A;  3JCU Z;  1P4R A;  1TA8 A;  4UVC A;  2B1I A;  4LFC O;  1BCC H;  4PEL A;  4WCE V;  1OZ0 A;  2WA4 A;  4O4J B;  4UUJ C;  2UUC B;  1AR5 A;  4UB8 Z;  1RSO B;  4UCU A;  1SET A;  1W0K G;  3QO7 A;  2LFS A;  5KA6 A;  1N0J A;  4J7Z A;  4PHZ A;  1B6Q A;  3ZJZ A;  1BL8 A;  3SYQ A;  2KB1 A;  1BT8 A;  2R9A A;  4O4H B;  1VF7 A;  2YID A;  3K5L A;  2VQE O;  4LNU A;  3K0G A;  2BSK B;  1R6N A;  3AG1 B;  4A5U B;  5KHK A;  1SQB H;  1PD3 A;  1W59 A;  1M9N A;  1WA8 A;  4MVZ A;  4DV3 B;  4K0K O;  1K9M W;  2V7Q G;  4ASU G;  3OGC C;  4LP8 A;  3L70 H;  5LXT B;  4X89 A;  4HBN A;  4J41 A;  3P3P A;  4IT5 A;  4LH6 A;  5KMG B; 
#chains in the Genus database with same CATH homology
 3K03 A;  1K7D A;  3RW0 A;  4JAU A;  1YTF B;  4LCU C;  4H37 A;  5DM6 V;  3OEH G;  2EIL B;  4RO2 A;  2WLN A;  3K3W A;  2ZDI A;  2OT5 A;  1J95 A;  3IC7 A;  3ZIA G;  3JD3 A;  4MTO A;  1BMF G;  1VQO V;  1YIJ V;  2EIN B;  4MVS A;  4QE9 A;  2HG5 C;  3ASN B;  5IYC O;  5L3E A;  2HLD G;  3LDD A;  4J9Y B;  3OFN G;  3QNE A;  3W7U A;  1VQK V;  3LDE A;  3K79 A;  2IH3 C;  4HZ3 A;  1S77 D;  1I5Y A;  1E1Q G;  2WLI A;  3WFV A;  1RM1 C;  3JD4 A;  1S0V A;  3AG3 C;  3ABU A;  3E89 A;  4MSW C;  1JX9 A;  4G2K A;  2XAH A;  2P7T C;  2A0L A;  1TUE B;  2IU0 A;  1CP9 A;  2IU3 A;  5BZB A;  3CC2 V;  2Z5U A;  2BOC C;  1N8R W;  3W7W A;  1AJN A;  2EIJ C;  4PDL A;  1EFR G;  2JJ2 G;  1QBZ A;  4XDL A;  1YJW V;  4E2L A;  3ZN0 A;  3ZRW B;  2X7R B;  2YSU B;  3CD6 V;  1G8M A;  3M99 B;  1JCH A;  1DF5 A;  5HFM A;  2EBO A;  3AG4 C;  4JTD B;  4U7O A;  2MK3 A;  4MVO A;  1I5X A;  2H8P C;  5B1A C;  3ETD A;  2EJR A;  2X0L A;  3SPC A;  4QJF B;  2R9I A;  4OXS A;  2ZQM A;  1QLN A;  4UV8 A;  1YJN V;  3ZMZ A;  3B77 A;  3AG3 B;  1G4Y B;  4WFF A;  4TT3 G;  2P6J A;  4UVA A;  4CZZ A;  1KQS U;  1KC8 W;  3OUF A;  4RAI A;  5LHI A;  1S3J A;  1DTO A;  3CPW U;  3ZMU A;  1DLB A;  1S72 V;  1M57 C;  1QLE C;  2Z3Y A;  2DYR C;  3AG1 C;  3MD0 A;  2JEX A;  1CEZ A;  3GB7 C;  2EIJ B;  4XDK A;  1VQ4 V;  1R3I C;  2IJK A;  2F43 G;  1MSW D;  2JDI G;  3UM7 A;  2OTJ V;  1AI4 A;  1V54 B;  4WFE A;  4R8C A;  5KUK A;  1Q7Y W;  3OW2 U;  3E86 A;  3AG4 B;  2DQ3 A;  1JVM A;  1ENV A;  3FB6 C;  1EBO A;  1MAB G;  2XAS A;  5B1A B;  2Y69 B;  1JQ0 A;  4ZBM A;  1GM9 A;  3FYE B;  3G71 V;  4QPJ A;  2WSS G;  1NKD A;  2Y48 A;  1RPR A;  3ML0 A;  1YIT V;  5EBM C;  3K08 A;  4PA3 A;  1XL6 A;  4MW8 A;  5EBW C;  3OMN B;  5LGN A;  3ETG A;  5B3S B;  2X6A A;  2EIL C;  2IJJ A;  1QLE B;  1M57 B;  2DYR B;  1PNL A;  4MVU A;  3CC4 V;  2ITC C;  4WFA V;  2JJ1 G;  1M1K W;  2DYS C;  1Y66 A;  1M56 B;  3WG7 B;  4ZKI A;  2IW5 A;  4PA4 A;  2EZO A;  4PDV A;  4BAY A;  5L3B A;  3CCE V;  5B1O A;  2EZP A;  2EIN C;  5LHH A;  2JK5 C;  3FB7 C;  1AI7 A;  1NVP D;  3ZRX A;  1QCE A;  1LNQ A;  4FK5 C;  3T4D A;  4LBE C;  4GX0 A;  4J9Z B;  1FXK A;  2HVK C;  3STL C;  1KD1 W;  2QM7 A;  5IY5 C;  3T4Z A;  1Q86 W;  3SPJ A;  2OCC B;  1GO3 F;  4FIP C;  2HKO A;  2V1D A;  2HFE C;  3JD0 A;  3ZRS A;  3ZMV A;  5EBL C;  2IH1 C;  4PDR A;  1R3J C;  4TSF G;  1GMG A;  5CN0 A;  3ABK C;  2OTL V;  1FS0 G;  2QA4 V;  2ZD9 A;  1IXM A;  3OR7 C;  3E2E A;  1JOY A;  2DW4 A;  2DYS B;  3TET A;  1ROP A;  2LFR A;  3RVY A;  3OM3 B;  5L3F A;  5LBQ A;  2WLL B;  3CXC U;  1AJP A;  1PL0 A;  3LSS A;  2X6B A;  5EC1 C;  1K5Q A;  2EIK C;  4MVM A;  4PA6 A;  4XDJ A;  2NLJ C;  3IFX A;  2GHY A;  1H8H G;  1SES A;  3F5W C;  5IY5 B;  1K5S A;  3CCV V;  2QTO A;  4RQF A;  3CCJ V;  2Q67 A;  3E8G A;  2JIZ G;  1E79 G;  3CP1 A;  3I56 V;  4JPR A;  4GX1 A;  2D3O W;  3B8M A;  3ABK B;  1THZ A;  4RUF A;  1QR8 A;  5B1B C;  2BOB C;  3LDC A;  4P9P A;  5IYB O;  4F4L A;  1E1R G;  4PA7 A;  2Q69 A;  5L3D A;  4PA9 A;  2R9R B;  1NR1 A;  3JCZ A;  3W7S A;  1BHB A;  3SYC A;  4I5S A;  1V54 C;  3P32 A;  1YJ9 V;  3SPH A;  1GKF A;  2XOK G;  2XAG A;  4GCZ A;  1M90 W;  2JEU A;  2XAQ A;  2EIK B;  4JYB A;  2H94 A;  2FTK A;  1ZWI C;  3W7T A;  3ABM C;  2Y69 C;  1VQ7 V;  4DXW A;  4UXN A;  4R7C A;  1H2G A;  1BHA A;  4XBF A;  5CBG A;  3E83 A;  2W6I G;  3OUS A;  1FXV A;  1F23 A;  3DTU B;  5B3S C;  2W0F C;  2HJF C;  1SER A;  5B1B B;  1HWY A;  4QNH B;  1EZJ A;  1R6K A;  1M56 C;  2HR3 A;  3WG7 C;  4X88 A;  4GX2 A;  2W6J G;  1FFT B;  4MS2 A;  1COW G;  3EHB B;  4HYO A;  2ZXW B;  4UV9 A;  1VQL V;  3LNM B;  5CA3 A;  2UXX A;  2P67 A;  3QO8 A;  1OCO C;  4PDM A;  2GSM B;  4KUM A;  3ZRW A;  4H33 A;  4FJC C;  3BEH A;  1VQ6 V;  2AHY A;  2YEV B;  3ABM B;  3SPI A;  4MVQ A;  3CCR V;  4JF3 A;  2OCC C;  1RPO A;  3DGE A;  3CME V;  3ABL C;  5HFL A;  1VQ5 V;  4KFM A;  3T1C A;  1KKD A;  2IJH A;  1OHH G;  4X8A A;  1YI2 V;  1XL4 A;  5LGT A;  1AI5 A;  2LP7 A;  3SYA A;  5CBF A;  3CCU V;  3LSQ A;  5L3C A;  3OAA G;  2EIM B;  2P90 A;  4MW3 A;  1F4M A;  1H8E G;  4MTF A;  2WLM A;  1F51 A;  3ABT A;  4GX5 A;  2QE7 G;  5H9C A;  3SJQ C;  3R65 A;  5B1N A;  3PJS K;  1OCO B;  4QPK A;  4G28 B;  4UVB A;  2M7W A;  3G6E V;  1R3K C;  1GM8 A;  1PKX A;  2DWE C;  3CMA V;  1NH2 D;  5LGU A;  1ORQ C;  3I55 V;  5EC2 C;  1P7B A;  1S5H C;  4Q20 A;  2ZR2 A;  1PNK A;  3B8N A;  3OE7 G;  1K73 W;  2PI4 A;  1OCC C;  1NVP B;  1FXH A;  3LUT B;  3FKS G;  4JAV A;  3ABL B;  1K33 A;  1NQT A;  3K06 A;  1Q81 W;  1VQM V;  1YTF D;  1OCR C;  4N21 A;  3OMA B;  4WFG A;  3W7X A;  1Q82 W;  2A9H A;  3K0D A;  1NH2 B;  3E8F A;  3OMI B;  3E8H A;  5E1A C;  1KP2 A;  2AHZ A;  3ZMT A;  2WLI B;  3KG2 A;  3ZN1 A;  4R6Z A;  5LHG A;  1W2B U;  1W0J G;  2NNU A;  1K4C C;  4MT8 A;  2WLK A;  1JJ2 U;  5IDJ A;  3SPG A;  3K04 A;  1OCZ C;  2XAF A;  3STZ C;  1Y4M A;  4WF9 V;  1QVF U;  4YXW G;  1GM7 A;  1CPY A;  1PNM A;  1H38 A;  4FPP A;  5KA5 A;  1JPX A;  1AJQ A;  1GTO A;  4P30 A;  1F4N A;  1OCC B;  1K97 A;  2C2A A;  3F7V C;  4JYC A;  4Z1M G;  4U7N A;  3ZMS A;  1OCR B;  2DQ0 A;  2QM8 A;  2IJI A;  4JTA B;  5FL7 G;  3TK1 A;  3CCM V;  1NR7 A;  3VBB A;  2CK3 G;  3G4S V;  3JYC A;  2WLH A;  2ZXW C;  3BY6 A;  4L87 A;  1AR1 B;  1VQ9 V;  3K9A A;  1K92 A;  1QR9 A;  3GWO A;  5J9P C;  4G27 B;  2WLL A;  3MHH C;  4I9W A;  3FYI B;  2WWW A;  1KEC A;  2XAJ A;  3SYP A;  1OCZ B;  5KUM A;  1R73 A;  3HB3 B;  3D36 A;  1K8A W;  4FMT A;  4MTX A;  2QEX V;  4MVR A;  2PI5 A;  4QE7 A;  3E8B A;  1AI6 A;  3E35 A;  3RBZ A;  3CC7 V;  1V55 C;  5H6Q A;  1DF4 A;  3F7Y C;  3JD2 A;  4QIW F;  4R50 A;  1QVG U;  4RUE A;  3SYO A;  4HAM A;  1FXK C;  3CCS V;  3ZCC A;  5L3G A;  2DWD C;  1SRY A;  3ETE A;  3T2M A;  1S76 D;  4P9O A;  3OEE G;  2EIM C;  1MG1 A;  3TCU A;  5H6R A;  3UKM A;  1YHQ V;  3RVZ A;  4BW5 A;  1RM1 B;  5CMU A;  1WLE A;  1R3L C;  2B1G A;  1P4R A;  2WPD G;  4JAS A;  2B1I A;  4UVC A;  3X2Q C;  3AEI A;  3MHS C;  4PEL A;  2K1E A;  4WCE V;  1OZ0 A;  5GW7 A;  5C93 A;  4P2Z A;  4CBC A;  1K3E A;  2X6C A;  2ZDI C;  1KP3 A;  4UUJ C;  3CCL V;  3FB5 C;  3EFF K;  2QKS A;  4JTC B;  1SET A;  1W0K G;  3P30 A;  2Q68 A;  1V55 B;  5IYD O;  3QO7 A;  2LFS A;  5KA6 A;  1MOF A;  1UJW B;  3CCQ V;  1L1F A;  3AG2 C;  4LC1 A;  1B6Q A;  1FXK B;  3ZJZ A;  4TWK A;  1BL8 A;  1SZT A;  3SYQ A;  2KB1 A;  1NBM G;  4WFH A;  3H01 A;  3CYO A;  5CBH A;  1VQN V;  2Q6A A;  1K4D C;  4DO2 A;  2A79 B;  3ASO C;  1WPX A;  4JGS A;  4RQE A;  3X2Q B;  3A0R A;  4MTG A;  3K0G A;  2XND G;  2YEV A;  1R6N A;  3NXS A;  3AG1 B;  2B5U A;  1PD3 A;  1VQ8 V;  2ZR3 A;  1M9N A;  4MVZ A;  3FB8 C;  4GT1 A;  4KP4 A;  3D3I A;  4BIZ A;  2V7Q G;  2ATK C;  3OGC C;  4ASU G;  4N23 A;  5DN6 G;  1K9M W;  4LP8 A;  4WFB V;  3ZRV A;  2UXN A;  3ASN C;  3HPL C;  2HVJ C;  4BIU A;  3VOU A;  4EKW A;  3AG2 B;  3JD1 A;  2WLJ A;  4X89 A;  3IGA C;  1VQP V;  5EK0 A;  3QO5 A;  1ARO P;  2WAM A;  1GK9 A;  1K34 A;  3OR6 C;  1NJI W;  2ITD C;  3ASO B;  1YSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...