4HYPA

Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
194
Chain Sequence
GLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolopyrimidine inhibitors of DNA gyrase B (GyrB) and topoisomerase IV (ParE). Part I: Structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 60
structure length 194
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4hypA00
2YI0A 2XK2A 4HZ5A 1UYFA 4FPPA 3TZ2A 3GIEA 4X9LA 2WI3A 1U2OA 2YE2A 2QFOA 2BZ5A 2XJJA 2YJWA 4R3MA 4ASBA 1US7A 3OWBA 4XDMA 3A0YA 2YEDA 2XDLA 4GQTA 2E0AA 1PVGA 4NH7A 2WERA 2UWDA 2WEPA 5M4PA 4URNA 2EXLA 5BODA 1TILA 2YKEA 4XCJA 1NHIA 5IDJA 4FCPA 4KP4A 2BU2A 5D7DA 1H7SA 1TH8A 3FT5A 4YKZA 2YGAA 2YE3A 1UYLA 4E00A 4EMVA 1B62A 2YKIA 5J6AA 3T2SA 3OPDA 4KTNA 2WI2A 3H80A 5M4NA 4CWQA 3OMUA 1YC1A 4HYPA 3INWA 1Y4UA 2YEJA 5D7RA 2WEQA 4R1FA 2YEEA 5CTXA 2YEFA 4YKTA 4MPNA 3LNUA 1BXDA 1AH8A 3B25A 5F3KA 3A0ZA 2YE8A 3INXA 2JKIA 1B63A 4CWRA 1Z5CA 4XIRA 4MOTA 4BAEA 2BU5A 1YT1A 2XDKA 3VHAA 1YESA 3HEKA 4CE3A 1YSRA 4L90A 4MB9A 4E02A 4XIPA 4CWNA 1Y8OA 4URLA 3SL2A 4JAUA 3FV5A 2Q8HA 4B7PA 4HY1A 5D6PA 4UROA 4AWOA 1YT0A 2Q8FA 2CCUA 1NHJA 3R4PA 3ZXQA 3D36A 3ZM7A 3FT8A 1BYQA 3U67A 4CE1A 4DZYA 4U93A 4R3AA 3EHHA 5FNCA 3TTZA 5FWKA 2BU7A 4EM7A 3CGYA 2CG9A 3K97A 4EGHA 2XDSA 4CWOA 3EKOA 2H8MA 3ZKBA 2CGFA 2VWCA 4XC0A 2YE7A 3T0ZA 3KE6A 4LWFA 3R4OA 4XCLA 3O6OA 3GIGA 1UYHA 4NH9A 1TC6A 3T0HA 5FNFA 4HXWA 2YEAA 2YI7A 3QTFA 4AWQA 5C93A 3R4NA 3ZKDA 3ZXOA 4L91A 4LWIA 2QG2A 2XJGA 4XKAA 4O07A 1EA6A 3HZ1A 4P7AA 3HYYA 3U2KA 4ASAA 1ID0A 4H81A 2YI6A 3A0RA 1A4HA 2Q2EB 3O2FA 5F5RA 4ZVIA 3A0XA 3TUHA 1AH6A 4Q20A 4XIQA 3DGEA 3CRLA 5IDMA 3Q5JA 4LP0A 2YEHA 2YKBA 4PL9A 1UYCA 1U0ZA 4FCRA 5J71A 1I5AA 3T10A 4EGIA 3QDDA 2IWXA 2FWYA 4B6CA 3PEJA 4H85A 1Z5AA 4MBCA 3RKZA 4AS9A 1ZXMA 3OWDA 2YI5A 4FCQA 4URMA 4LWHA 3K98A 4CWFA 1Y8NA 4BQGA 2PNRA 2XX4A 3EKRA 4L94A 2YE9A 4XD8A 3D0BA 3GIFA 2XHRA 5M4MA 2YGFA 1H7UA 3R4MA 2XD6A 1I5BA 4XKKA 4PU9A 3BM9A 4HY6A 3RLQA 3VHCA 2O1VA 4JQLA 4GCZA 2ZDYA 1NHHA 1ZXNA 2XX5A 4L93A 1UY6A 1AM1A 3CWVA 2VCJA 1OSFA 3HZ5A 3T1KA 1MX0A 4LWGA 2HG1A 3K60A 4U7NA 3LPSA 4U7OA 2WI1A 5L3JA 2XHTA 3HHUA 1S16A 3G7BA 1JM6A 4YKUA 2BTZA 4XE2A 4XITA 5CTUA 1L0OA 5FNDA 4P8OA 2HCHA 5D6QA 1Z5BA 1I5CA 1TIDA 1I59A 4AWPA 4EEHA 1I5DA 1TC0A 3O0IA 3RLRA 2YE6A 1UYKA 4CWPA 2XX2A 2O1UA 2VCIA 4QPJA 2HKJA 1ZW9A 4WUBA 4E01A 2CCTA 2ZBKB 2CH4A 2BYHA 4JASA 3TZ5A 4DUHA 4W7TA 1QZRA 5CTYA 1QYEA 2YEIA 4FMTA 2C2AA 1ZWHA 1UYIA 5CPHA 2YK9A 3D2RA 2JJCA 4LPBA 4I5SA 4PRVA 1GKXA 1UY7A 4ASFA 2YKJA 4KSHA 1Y4SA 4CWTA 1UYDA 4XTJA 2YGEA 3Q5LA 3A0WA 3EHGA 4HZ0A 4BIZA 4LWEA 1UY9A 1KZNA 3WHAA 3Q5KA 2YJXA 2YKCA 5M4HA 1UYMA 4NH8A 2FYPA 2XDXA 3A0TA 3JZ3A 1EI1A 4V26A 1YC4A 2XABA 1I58A 1GJVA 4PRXA 4MPCA 1KIJA 3BMYA 2IOPA 3B26A 4WUCA 4MP2A 2O1WA 4KSGA 2QG0A 2BT0A 2IWSA 2IORA 2WI4A 4KQVA 4ZKIA 2YE4A 3G75A 1UYEA 2ESAA 2WI5A 4L8ZA 2YEGA 4YKRA 1YERA 2BYIA 2WI7A 4YKYA 4KFGA 3VADA 2AKPA 4O05A 3EHFA 4O04A 4HXZA 4I3HA 1BGQA 5M4EA 3R91A 5GGZA 2IOQA 4BQJA 2FXSA 4ASGA 2Q8IA 1Y8PA 2CCSA 3G7EA 4K4OA 1UYGA 2QF6A 1S14A 1THNA 4O09A 2VW5A 1MU5A 1B3QA 4BIUA 1YS3A 2IWUA 2YE5A 4XKOA 2Q8GA 4CE2A 3C0EA 3U2DA 4GEEA 3TZ4A 3B27A 3HYZA 4YKXA 2BRCA 5M4KA 4GT8A 2GQPA 2YEBA 4H7QA 3R92A 2K5BA 2ZDXA 3PEHA 4V25A 3IEDA 4WUDA 3MNRP 3TZ0A 4MPEA 4YKQA 3CGZA 4JAVA 1BKNA 2BREA 5IN9A 4EGKA 3H4LA 1UY8A 1AJ6A 2FWZA 4EFTA 2XDUA 3VHDA 1R62A 3EHJA 1AMWA 2BU8A 3B24A 2YK2A 4O0BA 2H55A 2BSMA 3GIGB 2WI6A 3RLPA 4HYMA 4GGLA 2ZKJA 2YECA 3C11A 5CF0A 1YC3A 4MP7A 5BOCA 1YETA 2BU6A 2XCMA 3CRKA 5D7CA 1TBWA 5CTWA 4GFNA 4YKWA 3K99A 1Z59A 2GFDA 3B28A 1GKZA 2XHXA 1YT2A 2XJXA 1QY8A 3OW6A 3WQ9A 4QPKA 4BXIA 1YSZA 4EFUA 4CWSA 3NMQA
chains in the Genus database with same CATH superfamily
2YI0A 2XK2A 4HZ5A 1UYFA 4FPPA 3TZ2A 3GIEA 4X9LA 2WI3A 1U2OA 2YE2A 2QFOA 2BZ5A 2XJJA 2YJWA 4R3MA 4ASBA 1US7A 2C1GA 3OWBA 4XDMA 3A0YA 2YEDA 2XDLA 4GQTA 2E0AA 1PVGA 4NH7A 2WERA 2UWDA 2WEPA 5M4PA 4URNA 2EXLA 5BODA 1TILA 2YKEA 4XCJA 1NHIA 5IDJA 4FCPA 4KP4A 2BU2A 5D7DA 1H7SA 1TH8A 3FT5A 4YKZA 2YGAA 2YE3A 1UYLA 4E00A 4EMVA 1B62A 2YKIA 5J6AA 3T2SA 3OPDA 4KTNA 2WI2A 3H80A 5M4NA 4CWQA 3OMUA 1YC1A 4HYPA 3INWA 1Y4UA 2YEJA 5D7RA 2WEQA 4R1FA 2YEEA 5CTXA 2YEFA 4YKTA 4MPNA 3LNUA 1BXDA 1AH8A 3B25A 5F3KA 3A0ZA 2YE8A 3INXA 2JKIA 1B63A 4CWRA 1Z5CA 4XIRA 4MOTA 4BAEA 2BU5A 1YT1A 2XDKA 3VHAA 1YESA 3HEKA 4CE3A 1YSRA 3LMMA 4L90A 4MB9A 4E02A 4XIPA 4CWNA 1Y8OA 4URLA 3SL2A 4JAUA 3FV5A 2Q8HA 4B7PA 2FTKA 4HY1A 5D6PA 4UROA 4AWOA 1YT0A 2Q8FA 2CCUA 1NHJA 3R4PA 3ZXQA 3D36A 3ZM7A 3FT8A 1BYQA 3U67A 4CE1A 4DZYA 4U93A 4R3AA 3EHHA 5FNCA 3TTZA 5FWKA 2BU7A 4EM7A 3CGYA 2CG9A 3K97A 4EGHA 2XDSA 4CWOA 3EKOA 2H8MA 3ZKBA 2CGFA 2VWCA 4XC0A 2YE7A 3T0ZA 3KE6A 4LWFA 3R4OA 4XCLA 3O6OA 3GIGA 1UYHA 4NH9A 1TC6A 3T0HA 5FNFA 4HXWA 2YEAA 2YI7A 3QTFA 4AWQA 5C93A 3R4NA 3ZKDA 3ZXOA 4L91A 4LWIA 2QG2A 2XJGA 4XKAA 4O07A 1EA6A 3HZ1A 4P7AA 3S5TA 3HYYA 3U2KA 4ASAA 1ID0A 4H81A 2YI6A 3A0RA 1A4HA 2Q2EB 3O2FA 5F5RA 4ZVIA 3A0XA 3TUHA 1AH6A 4Q20A 4XIQA 3DGEA 3CRLA 5IDMA 3Q5JA 4LP0A 2YEHA 2YKBA 4PL9A 1UYCA 1U0ZA 4FCRA 5J71A 2C1IA 1I5AA 3T10A 4EGIA 3QDDA 2IWXA 2FWYA 4B6CA 3PEJA 4H85A 1Z5AA 4MBCA 3RKZA 4AS9A 1ZXMA 3OWDA 2YI5A 4FCQA 4URMA 4LWHA 3K98A 4CWFA 1Y8NA 4BQGA 2PNRA 2XX4A 3EKRA 4L94A 2YE9A 4XD8A 3D0BA 3GIFA 2XHRA 5M4MA 2YGFA 1H7UA 3R4MA 2XD6A 1I5BA 4XKKA 4PU9A 1F51A 3BM9A 4HY6A 3RLQA 3VHCA 2O1VA 4JQLA 4GCZA 2ZDYA 1NHHA 1ZXNA 2XX5A 4L93A 1UY6A 1AM1A 3CWVA 2VCJA 1OSFA 3HZ5A 3T1KA 1MX0A 4LWGA 2HG1A 3K60A 4U7NA 4E72A 3LPSA 4U7OA 2WI1A 5L3JA 2XHTA 3HHUA 1S16A 3G7BA 1JM6A 4YKUA 2BTZA 2HHIA 4XE2A 4XITA 5CTUA 1L0OA 5FNDA 4P8OA 2HCHA 5D6QA 1Z5BA 1I5CA 1TIDA 1I59A 4AWPA 4EEHA 1I5DA 1TC0A 3O0IA 1IXMA 3RLRA 2YE6A 1UYKA 4CWPA 2XX2A 2O1UA 2VCIA 4QPJA 2HKJA 1ZW9A 4WUBA 4E01A 2CCTA 2ZBKB 2CH4A 2BYHA 4JASA 3TZ5A 4DUHA 4W7TA 1QZRA 5CTYA 1QYEA 2YEIA 4FMTA 2C2AA 1ZWHA 1UYIA 5CPHA 2YK9A 3D2RA 2JJCA 4LPBA 4I5SA 4PRVA 1GKXA 1UY7A 4ASFA 2YKJA 4KSHA 1Y4SA 4CWTA 1UYDA 4XTJA 2YGEA 3Q5LA 3A0WA 3EHGA 4HZ0A 4BIZA 4LWEA 1UY9A 1KZNA 3WHAA 3Q5KA 2YJXA 2YKCA 5M4HA 1UYMA 4NH8A 2FYPA 2XDXA 3A0TA 3JZ3A 1EI1A 4V26A 1YC4A 2XABA 1I58A 1GJVA 4PRXA 4MPCA 1KIJA 3BMYA 2IOPA 3B26A 4WUCA 4MP2A 2O1WA 4KSGA 2QG0A 2BT0A 2IWSA 2IORA 2WI4A 4KQVA 4ZKIA 2YE4A 3G75A 1UYEA 2ESAA 2WI5A 4L8ZA 2YEGA 4YKRA 1YERA 2BYIA 2WI7A 4YKYA 4KFGA 3VADA 2AKPA 4O05A 3EHFA 4O04A 4HXZA 4I3HA 1BGQA 5M4EA 3R91A 5GGZA 2IOQA 4BQJA 2FXSA 4ASGA 2Q8IA 1Y8PA 2CCSA 3G7EA 4K4OA 1UYGA 2QF6A 1S14A 1THNA 4O09A 2VW5A 1MU5A 1B3QA 4BIUA 1YS3A 2IWUA 2YE5A 4XKOA 2Q8GA 4CE2A 3C0EA 3U2DA 4GEEA 3TZ4A 3B27A 3HYZA 4YKXA 2BRCA 5M4KA 4GT8A 2GQPA 2YEBA 4H7QA 3R92A 2K5BA 2ZDXA 3PEHA 4V25A 3IEDA 4WUDA 3MNRP 3TZ0A 4MPEA 4YKQA 3CGZA 4JAVA 1BKNA 2BREA 5IN9A 4EGKA 3H4LA 1UY8A 1AJ6A 2FWZA 4EFTA 2XDUA 3VHDA 1R62A 3EHJA 1AMWA 2BU8A 3B24A 2YK2A 4O0BA 2H55A 2BSMA 3GIGB 2WI6A 3RLPA 4HYMA 4GGLA 2ZKJA 2YECA 3C11A 5CF0A 1YC3A 4MP7A 5BOCA 1YETA 2BU6A 2XCMA 3CRKA 5D7CA 1TBWA 5CTWA 4GFNA 4YKWA 3K99A 1Z59A 2GFDA 3B28A 1GKZA 2XHXA 1YT2A 2XJXA 1QY8A 3OW6A 3WQ9A 4QPKA 4BXIA 1YSZA 4EFUA 5JENA 4CWSA 3CYGA 3NMQA
chains in the Genus database with same CATH topology
2YI0A 2XK2A 4HZ5A 1UYFA 4FPPA 3TZ2A 3GIEA 4X9LA 2WI3A 1U2OA 2YE2A 2QFOA 2BZ5A 2XJJA 2YJWA 4R3MA 4ASBA 1US7A 3OWBA 4XDMA 3A0YA 2YEDA 2XDLA 4GQTA 2E0AA 1PVGA 4NH7A 2WERA 2UWDA 2WEPA 5M4PA 4URNA 2EXLA 5BODA 1TILA 2YKEA 4XCJA 1NHIA 5IDJA 4FCPA 4KP4A 2BU2A 5D7DA 1H7SA 1TH8A 3FT5A 4YKZA 2YGAA 2YE3A 1UYLA 4E00A 4EMVA 1B62A 2YKIA 5J6AA 3T2SA 3OPDA 4KTNA 2WI2A 3H80A 5M4NA 4CWQA 3OMUA 1YC1A 4HYPA 3INWA 1Y4UA 2YEJA 5D7RA 2WEQA 4R1FA 2YEEA 5CTXA 2YEFA 4YKTA 4MPNA 3LNUA 1BXDA 1AH8A 3B25A 5F3KA 3A0ZA 2YE8A 3INXA 2JKIA 1B63A 4CWRA 1Z5CA 4XIRA 4MOTA 4BAEA 2BU5A 1YT1A 2XDKA 3VHAA 1YESA 3HEKA 4CE3A 1YSRA 4L90A 4MB9A 4E02A 4XIPA 4CWNA 1Y8OA 4URLA 3SL2A 4JAUA 3FV5A 2Q8HA 4B7PA 4HY1A 5D6PA 4UROA 4AWOA 1YT0A 2Q8FA 2CCUA 1NHJA 3R4PA 3ZXQA 3D36A 3ZM7A 3FT8A 1BYQA 3U67A 4CE1A 4DZYA 4U93A 4R3AA 3EHHA 5FNCA 3TTZA 5FWKA 2BU7A 4EM7A 3CGYA 2CG9A 3K97A 4EGHA 2XDSA 4CWOA 3EKOA 2H8MA 3ZKBA 2CGFA 2VWCA 4XC0A 2YE7A 3T0ZA 3KE6A 4LWFA 3R4OA 4XCLA 3O6OA 3GIGA 1UYHA 4NH9A 1TC6A 3T0HA 5FNFA 4HXWA 2YEAA 2YI7A 3QTFA 4AWQA 5C93A 3R4NA 3ZKDA 3ZXOA 4L91A 4LWIA 2QG2A 2XJGA 4XKAA 4O07A 1EA6A 3HZ1A 4P7AA 3HYYA 3U2KA 4ASAA 1ID0A 4H81A 2YI6A 3A0RA 1A4HA 2Q2EB 3O2FA 5F5RA 4ZVIA 3A0XA 3TUHA 1AH6A 4Q20A 4XIQA 3DGEA 3CRLA 5IDMA 3Q5JA 4LP0A 2YEHA 2YKBA 4PL9A 1UYCA 1U0ZA 4FCRA 5J71A 1I5AA 3T10A 4EGIA 3QDDA 2IWXA 2FWYA 4B6CA 3PEJA 4H85A 1Z5AA 4MBCA 3RKZA 4AS9A 1ZXMA 3OWDA 2YI5A 4FCQA 4URMA 4LWHA 3K98A 4CWFA 1Y8NA 4BQGA 2PNRA 2XX4A 3EKRA 4L94A 2YE9A 4XD8A 3D0BA 3GIFA 2XHRA 5M4MA 2YGFA 1H7UA 3R4MA 2XD6A 1I5BA 4XKKA 4PU9A 3BM9A 4HY6A 3RLQA 3VHCA 2O1VA 4JQLA 4GCZA 2ZDYA 1NHHA 1ZXNA 2XX5A 4L93A 1UY6A 1AM1A 3CWVA 2VCJA 1OSFA 3HZ5A 3T1KA 1MX0A 4LWGA 2HG1A 3K60A 4U7NA 3LPSA 4U7OA 2WI1A 5L3JA 2XHTA 3HHUA 1S16A 3G7BA 1JM6A 4YKUA 2BTZA 4XE2A 4XITA 5CTUA 1L0OA 5FNDA 4P8OA 2HCHA 5D6QA 1Z5BA 1I5CA 1TIDA 1I59A 4AWPA 4EEHA 1I5DA 1TC0A 3O0IA 3RLRA 2YE6A 1UYKA 4CWPA 2XX2A 2O1UA 2VCIA 4QPJA 2HKJA 1ZW9A 4WUBA 4E01A 2CCTA 2ZBKB 2CH4A 2BYHA 4JASA 3TZ5A 4DUHA 4W7TA 1QZRA 5CTYA 1QYEA 2YEIA 4FMTA 2C2AA 1ZWHA 1UYIA 5CPHA 2YK9A 3D2RA 2JJCA 4LPBA 4I5SA 4PRVA 1GKXA 1UY7A 4ASFA 2YKJA 4KSHA 1Y4SA 4CWTA 1UYDA 4XTJA 2YGEA 3Q5LA 3A0WA 3EHGA 4HZ0A 4BIZA 4LWEA 1UY9A 1KZNA 3WHAA 3Q5KA 2YJXA 2YKCA 5M4HA 1UYMA 4NH8A 2FYPA 2XDXA 3A0TA 3JZ3A 1EI1A 4V26A 1YC4A 2XABA 1I58A 1GJVA 4PRXA 4MPCA 1KIJA 3BMYA 2IOPA 3B26A 4WUCA 4MP2A 2O1WA 4KSGA 2QG0A 2BT0A 2IWSA 2IORA 2WI4A 4KQVA 4ZKIA 2YE4A 3G75A 1UYEA 2ESAA 2WI5A 4L8ZA 2YEGA 4YKRA 1YERA 2BYIA 2WI7A 4YKYA 4KFGA 3VADA 2AKPA 4O05A 3EHFA 4O04A 4HXZA 4I3HA 1BGQA 5M4EA 3R91A 5GGZA 2IOQA 4BQJA 2FXSA 4ASGA 2Q8IA 1Y8PA 2CCSA 3G7EA 4K4OA 1UYGA 2QF6A 1S14A 1THNA 4O09A 2VW5A 1MU5A 1B3QA 4BIUA 1YS3A 2IWUA 2YE5A 4XKOA 2Q8GA 4CE2A 3C0EA 3U2DA 4GEEA 3TZ4A 3B27A 3HYZA 4YKXA 2BRCA 5M4KA 4GT8A 2GQPA 2YEBA 4H7QA 3R92A 2K5BA 2ZDXA 3PEHA 4V25A 3IEDA 4WUDA 3MNRP 3TZ0A 4MPEA 4YKQA 3CGZA 4JAVA 1BKNA 2BREA 5IN9A 4EGKA 3H4LA 1UY8A 1AJ6A 2FWZA 4EFTA 2XDUA 3VHDA 1R62A 3EHJA 1AMWA 2BU8A 3B24A 2YK2A 4O0BA 2H55A 2BSMA 3GIGB 2WI6A 3RLPA 4HYMA 4GGLA 2ZKJA 2YECA 3C11A 5CF0A 1YC3A 4MP7A 5BOCA 1YETA 2BU6A 2XCMA 3CRKA 5D7CA 1TBWA 5CTWA 4GFNA 4YKWA 3K99A 1Z59A 2GFDA 3B28A 1GKZA 2XHXA 1YT2A 2XJXA 1QY8A 3OW6A 3WQ9A 4QPKA 4BXIA 1YSZA 4EFUA 4CWSA 3NMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YI0 A;  2XK2 A;  4HZ5 A;  1UYF A;  4FPP A;  3TZ2 A;  3GIE A;  4X9L A;  2WI3 A;  1U2O A;  2YE2 A;  2QFO A;  2BZ5 A;  2XJJ A;  2YJW A;  4R3M A;  4ASB A;  1US7 A;  3OWB A;  4XDM A;  3A0Y A;  2YED A;  2XDL A;  4GQT A;  2E0A A;  1PVG A;  4NH7 A;  2WER A;  2UWD A;  2WEP A;  5M4P A;  4URN A;  2EXL A;  5BOD A;  1TIL A;  2YKE A;  4XCJ A;  1NHI A;  5IDJ A;  4FCP A;  4KP4 A;  2BU2 A;  5D7D A;  1H7S A;  1TH8 A;  3FT5 A;  4YKZ A;  2YGA A;  2YE3 A;  1UYL A;  4E00 A;  4EMV A;  1B62 A;  2YKI A;  5J6A A;  3T2S A;  3OPD A;  4KTN A;  2WI2 A;  3H80 A;  5M4N A;  4CWQ A;  3OMU A;  1YC1 A;  4HYP A;  3INW A;  1Y4U A;  2YEJ A;  5D7R A;  2WEQ A;  4R1F A;  2YEE A;  5CTX A;  2YEF A;  4YKT A;  4MPN A;  3LNU A;  1BXD A;  1AH8 A;  3B25 A;  5F3K A;  3A0Z A;  2YE8 A;  3INX A;  2JKI A;  1B63 A;  4CWR A;  1Z5C A;  4XIR A;  4MOT A;  4BAE A;  2BU5 A;  1YT1 A;  2XDK A;  3VHA A;  1YES A;  3HEK A;  4CE3 A;  1YSR A;  4L90 A;  4MB9 A;  4E02 A;  4XIP A;  4CWN A;  1Y8O A;  4URL A;  3SL2 A;  4JAU A;  3FV5 A;  2Q8H A;  4B7P A;  4HY1 A;  5D6P A;  4URO A;  4AWO A;  1YT0 A;  2Q8F A;  2CCU A;  1NHJ A;  3R4P A;  3ZXQ A;  3D36 A;  3ZM7 A;  3FT8 A;  1BYQ A;  3U67 A;  4CE1 A;  4DZY A;  4U93 A;  4R3A A;  3EHH A;  5FNC A;  3TTZ A;  5FWK A;  2BU7 A;  4EM7 A;  3CGY A;  2CG9 A;  3K97 A;  4EGH A;  2XDS A;  4CWO A;  3EKO A;  2H8M A;  3ZKB A;  2CGF A;  2VWC A;  4XC0 A;  2YE7 A;  3T0Z A;  3KE6 A;  4LWF A;  3R4O A;  4XCL A;  3O6O A;  3GIG A;  1UYH A;  4NH9 A;  1TC6 A;  3T0H A;  5FNF A;  4HXW A;  2YEA A;  2YI7 A;  3QTF A;  4AWQ A;  5C93 A;  3R4N A;  3ZKD A;  3ZXO A;  4L91 A;  4LWI A;  2QG2 A;  2XJG A;  4XKA A;  4O07 A;  1EA6 A;  3HZ1 A;  4P7A A;  3HYY A;  3U2K A;  4ASA A;  1ID0 A;  4H81 A;  2YI6 A;  3A0R A;  1A4H A;  2Q2E B;  3O2F A;  5F5R A;  4ZVI A;  3A0X A;  3TUH A;  1AH6 A;  4Q20 A;  4XIQ A;  3DGE A;  3CRL A;  5IDM A;  3Q5J A;  4LP0 A;  2YEH A;  2YKB A;  4PL9 A;  1UYC A;  1U0Z A;  4FCR A;  5J71 A;  1I5A A;  3T10 A;  4EGI A;  3QDD A;  2IWX A;  2FWY A;  4B6C A;  3PEJ A;  4H85 A;  1Z5A A;  4MBC A;  3RKZ A;  4AS9 A;  1ZXM A;  3OWD A;  2YI5 A;  4FCQ A;  4URM A;  4LWH A;  3K98 A;  4CWF A;  1Y8N A;  4BQG A;  2PNR A;  2XX4 A;  3EKR A;  4L94 A;  2YE9 A;  4XD8 A;  3D0B A;  3GIF A;  2XHR A;  5M4M A;  2YGF A;  1H7U A;  3R4M A;  2XD6 A;  1I5B A;  4XKK A;  4PU9 A;  3BM9 A;  4HY6 A;  3RLQ A;  3VHC A;  2O1V A;  4JQL A;  4GCZ A;  2ZDY A;  1NHH A;  1ZXN A;  2XX5 A;  4L93 A;  1UY6 A;  1AM1 A;  3CWV A;  2VCJ A;  1OSF A;  3HZ5 A;  3T1K A;  1MX0 A;  4LWG A;  2HG1 A;  3K60 A;  4U7N A;  3LPS A;  4U7O A;  2WI1 A;  5L3J A;  2XHT A;  3HHU A;  1S16 A;  3G7B A;  1JM6 A;  4YKU A;  2BTZ A;  4XE2 A;  4XIT A;  5CTU A;  1L0O A;  5FND A;  4P8O A;  2HCH A;  5D6Q A;  1Z5B A;  1I5C A;  1TID A;  1I59 A;  4AWP A;  4EEH A;  1I5D A;  1TC0 A;  3O0I A;  3RLR A;  2YE6 A;  1UYK A;  4CWP A;  2XX2 A;  2O1U A;  2VCI A;  4QPJ A;  2HKJ A;  1ZW9 A;  4WUB A;  4E01 A;  2CCT A;  2ZBK B;  2CH4 A;  2BYH A;  4JAS A;  3TZ5 A;  4DUH A;  4W7T A;  1QZR A;  5CTY A;  1QYE A;  2YEI A;  4FMT A;  2C2A A;  1ZWH A;  1UYI A;  5CPH A;  2YK9 A;  3D2R A;  2JJC A;  4LPB A;  4I5S A;  4PRV A;  1GKX A;  1UY7 A;  4ASF A;  2YKJ A;  4KSH A;  1Y4S A;  4CWT A;  1UYD A;  4XTJ A;  2YGE A;  3Q5L A;  3A0W A;  3EHG A;  4HZ0 A;  4BIZ A;  4LWE A;  1UY9 A;  1KZN A;  3WHA A;  3Q5K A;  2YJX A;  2YKC A;  5M4H A;  1UYM A;  4NH8 A;  2FYP A;  2XDX A;  3A0T A;  3JZ3 A;  1EI1 A;  4V26 A;  1YC4 A;  2XAB A;  1I58 A;  1GJV A;  4PRX A;  4MPC A;  1KIJ A;  3BMY A;  2IOP A;  3B26 A;  4WUC A;  4MP2 A;  2O1W A;  4KSG A;  2QG0 A;  2BT0 A;  2IWS A;  2IOR A;  2WI4 A;  4KQV A;  4ZKI A;  2YE4 A;  3G75 A;  1UYE A;  2ESA A;  2WI5 A;  4L8Z A;  2YEG A;  4YKR A;  1YER A;  2BYI A;  2WI7 A;  4YKY A;  4KFG A;  3VAD A;  2AKP A;  4O05 A;  3EHF A;  4O04 A;  4HXZ A;  4I3H A;  1BGQ A;  5M4E A;  3R91 A;  5GGZ A;  2IOQ A;  4BQJ A;  2FXS A;  4ASG A;  2Q8I A;  1Y8P A;  2CCS A;  3G7E A;  4K4O A;  1UYG A;  2QF6 A;  1S14 A;  1THN A;  4O09 A;  2VW5 A;  1MU5 A;  1B3Q A;  4BIU A;  1YS3 A;  2IWU A;  2YE5 A;  4XKO A;  2Q8G A;  4CE2 A;  3C0E A;  3U2D A;  4GEE A;  3TZ4 A;  3B27 A;  3HYZ A;  4YKX A;  2BRC A;  5M4K A;  4GT8 A;  2GQP A;  2YEB A;  4H7Q A;  3R92 A;  2K5B A;  2ZDX A;  3PEH A;  4V25 A;  3IED A;  4WUD A;  3MNR P;  3TZ0 A;  4MPE A;  4YKQ A;  3CGZ A;  4JAV A;  1BKN A;  2BRE A;  5IN9 A;  4EGK A;  3H4L A;  1UY8 A;  1AJ6 A;  2FWZ A;  4EFT A;  2XDU A;  3VHD A;  1R62 A;  3EHJ A;  1AMW A;  2BU8 A;  3B24 A;  2YK2 A;  4O0B A;  2H55 A;  2BSM A;  3GIG B;  2WI6 A;  3RLP A;  4HYM A;  4GGL A;  2ZKJ A;  2YEC A;  3C11 A;  5CF0 A;  1YC3 A;  4MP7 A;  5BOC A;  1YET A;  2BU6 A;  2XCM A;  3CRK A;  5D7C A;  1TBW A;  5CTW A;  4GFN A;  4YKW A;  3K99 A;  1Z59 A;  2GFD A;  3B28 A;  1GKZ A;  2XHX A;  1YT2 A;  2XJX A;  1QY8 A;  3OW6 A;  3WQ9 A;  4QPK A;  4BXI A;  1YSZ A;  4EFU A;  4CWS A;  3NMQ A; 
#chains in the Genus database with same CATH topology
 2YI0 A;  2XK2 A;  4HZ5 A;  1UYF A;  4FPP A;  3TZ2 A;  3GIE A;  4X9L A;  2WI3 A;  1U2O A;  2YE2 A;  2QFO A;  2BZ5 A;  2XJJ A;  2YJW A;  4R3M A;  4ASB A;  1US7 A;  2C1G A;  3OWB A;  4XDM A;  3A0Y A;  2YED A;  2XDL A;  4GQT A;  2E0A A;  1PVG A;  4NH7 A;  2WER A;  2UWD A;  2WEP A;  5M4P A;  4URN A;  2EXL A;  5BOD A;  1TIL A;  2YKE A;  4XCJ A;  1NHI A;  5IDJ A;  4FCP A;  4KP4 A;  2BU2 A;  5D7D A;  1H7S A;  1TH8 A;  3FT5 A;  4YKZ A;  2YGA A;  2YE3 A;  1UYL A;  4E00 A;  4EMV A;  1B62 A;  2YKI A;  5J6A A;  3T2S A;  3OPD A;  4KTN A;  2WI2 A;  3H80 A;  5M4N A;  4CWQ A;  3OMU A;  1YC1 A;  4HYP A;  3INW A;  1Y4U A;  2YEJ A;  5D7R A;  2WEQ A;  4R1F A;  2YEE A;  5CTX A;  2YEF A;  4YKT A;  4MPN A;  3LNU A;  1BXD A;  1AH8 A;  3B25 A;  5F3K A;  3A0Z A;  2YE8 A;  3INX A;  2JKI A;  1B63 A;  4CWR A;  1Z5C A;  4XIR A;  4MOT A;  4BAE A;  2BU5 A;  1YT1 A;  2XDK A;  3VHA A;  1YES A;  3HEK A;  4CE3 A;  1YSR A;  3LMM A;  4L90 A;  4MB9 A;  4E02 A;  4XIP A;  4CWN A;  1Y8O A;  4URL A;  3SL2 A;  4JAU A;  3FV5 A;  2Q8H A;  4B7P A;  2FTK A;  4HY1 A;  5D6P A;  4URO A;  4AWO A;  1YT0 A;  2Q8F A;  2CCU A;  1NHJ A;  3R4P A;  3ZXQ A;  3D36 A;  3ZM7 A;  3FT8 A;  1BYQ A;  3U67 A;  4CE1 A;  4DZY A;  4U93 A;  4R3A A;  3EHH A;  5FNC A;  3TTZ A;  5FWK A;  2BU7 A;  4EM7 A;  3CGY A;  2CG9 A;  3K97 A;  4EGH A;  2XDS A;  4CWO A;  3EKO A;  2H8M A;  3ZKB A;  2CGF A;  2VWC A;  4XC0 A;  2YE7 A;  3T0Z A;  3KE6 A;  4LWF A;  3R4O A;  4XCL A;  3O6O A;  3GIG A;  1UYH A;  4NH9 A;  1TC6 A;  3T0H A;  5FNF A;  4HXW A;  2YEA A;  2YI7 A;  3QTF A;  4AWQ A;  5C93 A;  3R4N A;  3ZKD A;  3ZXO A;  4L91 A;  4LWI A;  2QG2 A;  2XJG A;  4XKA A;  4O07 A;  1EA6 A;  3HZ1 A;  4P7A A;  3S5T A;  3HYY A;  3U2K A;  4ASA A;  1ID0 A;  4H81 A;  2YI6 A;  3A0R A;  1A4H A;  2Q2E B;  3O2F A;  5F5R A;  4ZVI A;  3A0X A;  3TUH A;  1AH6 A;  4Q20 A;  4XIQ A;  3DGE A;  3CRL A;  5IDM A;  3Q5J A;  4LP0 A;  2YEH A;  2YKB A;  4PL9 A;  1UYC A;  1U0Z A;  4FCR A;  5J71 A;  2C1I A;  1I5A A;  3T10 A;  4EGI A;  3QDD A;  2IWX A;  2FWY A;  4B6C A;  3PEJ A;  4H85 A;  1Z5A A;  4MBC A;  3RKZ A;  4AS9 A;  1ZXM A;  3OWD A;  2YI5 A;  4FCQ A;  4URM A;  4LWH A;  3K98 A;  4CWF A;  1Y8N A;  4BQG A;  2PNR A;  2XX4 A;  3EKR A;  4L94 A;  2YE9 A;  4XD8 A;  3D0B A;  3GIF A;  2XHR A;  5M4M A;  2YGF A;  1H7U A;  3R4M A;  2XD6 A;  1I5B A;  4XKK A;  4PU9 A;  1F51 A;  3BM9 A;  4HY6 A;  3RLQ A;  3VHC A;  2O1V A;  4JQL A;  4GCZ A;  2ZDY A;  1NHH A;  1ZXN A;  2XX5 A;  4L93 A;  1UY6 A;  1AM1 A;  3CWV A;  2VCJ A;  1OSF A;  3HZ5 A;  3T1K A;  1MX0 A;  4LWG A;  2HG1 A;  3K60 A;  4U7N A;  4E72 A;  3LPS A;  4U7O A;  2WI1 A;  5L3J A;  2XHT A;  3HHU A;  1S16 A;  3G7B A;  1JM6 A;  4YKU A;  2BTZ A;  2HHI A;  4XE2 A;  4XIT A;  5CTU A;  1L0O A;  5FND A;  4P8O A;  2HCH A;  5D6Q A;  1Z5B A;  1I5C A;  1TID A;  1I59 A;  4AWP A;  4EEH A;  1I5D A;  1TC0 A;  3O0I A;  1IXM A;  3RLR A;  2YE6 A;  1UYK A;  4CWP A;  2XX2 A;  2O1U A;  2VCI A;  4QPJ A;  2HKJ A;  1ZW9 A;  4WUB A;  4E01 A;  2CCT A;  2ZBK B;  2CH4 A;  2BYH A;  4JAS A;  3TZ5 A;  4DUH A;  4W7T A;  1QZR A;  5CTY A;  1QYE A;  2YEI A;  4FMT A;  2C2A A;  1ZWH A;  1UYI A;  5CPH A;  2YK9 A;  3D2R A;  2JJC A;  4LPB A;  4I5S A;  4PRV A;  1GKX A;  1UY7 A;  4ASF A;  2YKJ A;  4KSH A;  1Y4S A;  4CWT A;  1UYD A;  4XTJ A;  2YGE A;  3Q5L A;  3A0W A;  3EHG A;  4HZ0 A;  4BIZ A;  4LWE A;  1UY9 A;  1KZN A;  3WHA A;  3Q5K A;  2YJX A;  2YKC A;  5M4H A;  1UYM A;  4NH8 A;  2FYP A;  2XDX A;  3A0T A;  3JZ3 A;  1EI1 A;  4V26 A;  1YC4 A;  2XAB A;  1I58 A;  1GJV A;  4PRX A;  4MPC A;  1KIJ A;  3BMY A;  2IOP A;  3B26 A;  4WUC A;  4MP2 A;  2O1W A;  4KSG A;  2QG0 A;  2BT0 A;  2IWS A;  2IOR A;  2WI4 A;  4KQV A;  4ZKI A;  2YE4 A;  3G75 A;  1UYE A;  2ESA A;  2WI5 A;  4L8Z A;  2YEG A;  4YKR A;  1YER A;  2BYI A;  2WI7 A;  4YKY A;  4KFG A;  3VAD A;  2AKP A;  4O05 A;  3EHF A;  4O04 A;  4HXZ A;  4I3H A;  1BGQ A;  5M4E A;  3R91 A;  5GGZ A;  2IOQ A;  4BQJ A;  2FXS A;  4ASG A;  2Q8I A;  1Y8P A;  2CCS A;  3G7E A;  4K4O A;  1UYG A;  2QF6 A;  1S14 A;  1THN A;  4O09 A;  2VW5 A;  1MU5 A;  1B3Q A;  4BIU A;  1YS3 A;  2IWU A;  2YE5 A;  4XKO A;  2Q8G A;  4CE2 A;  3C0E A;  3U2D A;  4GEE A;  3TZ4 A;  3B27 A;  3HYZ A;  4YKX A;  2BRC A;  5M4K A;  4GT8 A;  2GQP A;  2YEB A;  4H7Q A;  3R92 A;  2K5B A;  2ZDX A;  3PEH A;  4V25 A;  3IED A;  4WUD A;  3MNR P;  3TZ0 A;  4MPE A;  4YKQ A;  3CGZ A;  4JAV A;  1BKN A;  2BRE A;  5IN9 A;  4EGK A;  3H4L A;  1UY8 A;  1AJ6 A;  2FWZ A;  4EFT A;  2XDU A;  3VHD A;  1R62 A;  3EHJ A;  1AMW A;  2BU8 A;  3B24 A;  2YK2 A;  4O0B A;  2H55 A;  2BSM A;  3GIG B;  2WI6 A;  3RLP A;  4HYM A;  4GGL A;  2ZKJ A;  2YEC A;  3C11 A;  5CF0 A;  1YC3 A;  4MP7 A;  5BOC A;  1YET A;  2BU6 A;  2XCM A;  3CRK A;  5D7C A;  1TBW A;  5CTW A;  4GFN A;  4YKW A;  3K99 A;  1Z59 A;  2GFD A;  3B28 A;  1GKZ A;  2XHX A;  1YT2 A;  2XJX A;  1QY8 A;  3OW6 A;  3WQ9 A;  4QPK A;  4BXI A;  1YSZ A;  4EFU A;  5JEN A;  4CWS A;  3CYG A;  3NMQ A; 
#chains in the Genus database with same CATH homology
 2YI0 A;  2XK2 A;  4HZ5 A;  1UYF A;  4FPP A;  3TZ2 A;  3GIE A;  4X9L A;  2WI3 A;  1U2O A;  2YE2 A;  2QFO A;  2BZ5 A;  2XJJ A;  2YJW A;  4R3M A;  4ASB A;  1US7 A;  3OWB A;  4XDM A;  3A0Y A;  2YED A;  2XDL A;  4GQT A;  2E0A A;  1PVG A;  4NH7 A;  2WER A;  2UWD A;  2WEP A;  5M4P A;  4URN A;  2EXL A;  5BOD A;  1TIL A;  2YKE A;  4XCJ A;  1NHI A;  5IDJ A;  4FCP A;  4KP4 A;  2BU2 A;  5D7D A;  1H7S A;  1TH8 A;  3FT5 A;  4YKZ A;  2YGA A;  2YE3 A;  1UYL A;  4E00 A;  4EMV A;  1B62 A;  2YKI A;  5J6A A;  3T2S A;  3OPD A;  4KTN A;  2WI2 A;  3H80 A;  5M4N A;  4CWQ A;  3OMU A;  1YC1 A;  4HYP A;  3INW A;  1Y4U A;  2YEJ A;  5D7R A;  2WEQ A;  4R1F A;  2YEE A;  5CTX A;  2YEF A;  4YKT A;  4MPN A;  3LNU A;  1BXD A;  1AH8 A;  3B25 A;  5F3K A;  3A0Z A;  2YE8 A;  3INX A;  2JKI A;  1B63 A;  4CWR A;  1Z5C A;  4XIR A;  4MOT A;  4BAE A;  2BU5 A;  1YT1 A;  2XDK A;  3VHA A;  1YES A;  3HEK A;  4CE3 A;  1YSR A;  4L90 A;  4MB9 A;  4E02 A;  4XIP A;  4CWN A;  1Y8O A;  4URL A;  3SL2 A;  4JAU A;  3FV5 A;  2Q8H A;  4B7P A;  4HY1 A;  5D6P A;  4URO A;  4AWO A;  1YT0 A;  2Q8F A;  2CCU A;  1NHJ A;  3R4P A;  3ZXQ A;  3D36 A;  3ZM7 A;  3FT8 A;  1BYQ A;  3U67 A;  4CE1 A;  4DZY A;  4U93 A;  4R3A A;  3EHH A;  5FNC A;  3TTZ A;  5FWK A;  2BU7 A;  4EM7 A;  3CGY A;  2CG9 A;  3K97 A;  4EGH A;  2XDS A;  4CWO A;  3EKO A;  2H8M A;  3ZKB A;  2CGF A;  2VWC A;  4XC0 A;  2YE7 A;  3T0Z A;  3KE6 A;  4LWF A;  3R4O A;  4XCL A;  3O6O A;  3GIG A;  1UYH A;  4NH9 A;  1TC6 A;  3T0H A;  5FNF A;  4HXW A;  2YEA A;  2YI7 A;  3QTF A;  4AWQ A;  5C93 A;  3R4N A;  3ZKD A;  3ZXO A;  4L91 A;  4LWI A;  2QG2 A;  2XJG A;  4XKA A;  4O07 A;  1EA6 A;  3HZ1 A;  4P7A A;  3HYY A;  3U2K A;  4ASA A;  1ID0 A;  4H81 A;  2YI6 A;  3A0R A;  1A4H A;  2Q2E B;  3O2F A;  5F5R A;  4ZVI A;  3A0X A;  3TUH A;  1AH6 A;  4Q20 A;  4XIQ A;  3DGE A;  3CRL A;  5IDM A;  3Q5J A;  4LP0 A;  2YEH A;  2YKB A;  4PL9 A;  1UYC A;  1U0Z A;  4FCR A;  5J71 A;  1I5A A;  3T10 A;  4EGI A;  3QDD A;  2IWX A;  2FWY A;  4B6C A;  3PEJ A;  4H85 A;  1Z5A A;  4MBC A;  3RKZ A;  4AS9 A;  1ZXM A;  3OWD A;  2YI5 A;  4FCQ A;  4URM A;  4LWH A;  3K98 A;  4CWF A;  1Y8N A;  4BQG A;  2PNR A;  2XX4 A;  3EKR A;  4L94 A;  2YE9 A;  4XD8 A;  3D0B A;  3GIF A;  2XHR A;  5M4M A;  2YGF A;  1H7U A;  3R4M A;  2XD6 A;  1I5B A;  4XKK A;  4PU9 A;  3BM9 A;  4HY6 A;  3RLQ A;  3VHC A;  2O1V A;  4JQL A;  4GCZ A;  2ZDY A;  1NHH A;  1ZXN A;  2XX5 A;  4L93 A;  1UY6 A;  1AM1 A;  3CWV A;  2VCJ A;  1OSF A;  3HZ5 A;  3T1K A;  1MX0 A;  4LWG A;  2HG1 A;  3K60 A;  4U7N A;  3LPS A;  4U7O A;  2WI1 A;  5L3J A;  2XHT A;  3HHU A;  1S16 A;  3G7B A;  1JM6 A;  4YKU A;  2BTZ A;  4XE2 A;  4XIT A;  5CTU A;  1L0O A;  5FND A;  4P8O A;  2HCH A;  5D6Q A;  1Z5B A;  1I5C A;  1TID A;  1I59 A;  4AWP A;  4EEH A;  1I5D A;  1TC0 A;  3O0I A;  3RLR A;  2YE6 A;  1UYK A;  4CWP A;  2XX2 A;  2O1U A;  2VCI A;  4QPJ A;  2HKJ A;  1ZW9 A;  4WUB A;  4E01 A;  2CCT A;  2ZBK B;  2CH4 A;  2BYH A;  4JAS A;  3TZ5 A;  4DUH A;  4W7T A;  1QZR A;  5CTY A;  1QYE A;  2YEI A;  4FMT A;  2C2A A;  1ZWH A;  1UYI A;  5CPH A;  2YK9 A;  3D2R A;  2JJC A;  4LPB A;  4I5S A;  4PRV A;  1GKX A;  1UY7 A;  4ASF A;  2YKJ A;  4KSH A;  1Y4S A;  4CWT A;  1UYD A;  4XTJ A;  2YGE A;  3Q5L A;  3A0W A;  3EHG A;  4HZ0 A;  4BIZ A;  4LWE A;  1UY9 A;  1KZN A;  3WHA A;  3Q5K A;  2YJX A;  2YKC A;  5M4H A;  1UYM A;  4NH8 A;  2FYP A;  2XDX A;  3A0T A;  3JZ3 A;  1EI1 A;  4V26 A;  1YC4 A;  2XAB A;  1I58 A;  1GJV A;  4PRX A;  4MPC A;  1KIJ A;  3BMY A;  2IOP A;  3B26 A;  4WUC A;  4MP2 A;  2O1W A;  4KSG A;  2QG0 A;  2BT0 A;  2IWS A;  2IOR A;  2WI4 A;  4KQV A;  4ZKI A;  2YE4 A;  3G75 A;  1UYE A;  2ESA A;  2WI5 A;  4L8Z A;  2YEG A;  4YKR A;  1YER A;  2BYI A;  2WI7 A;  4YKY A;  4KFG A;  3VAD A;  2AKP A;  4O05 A;  3EHF A;  4O04 A;  4HXZ A;  4I3H A;  1BGQ A;  5M4E A;  3R91 A;  5GGZ A;  2IOQ A;  4BQJ A;  2FXS A;  4ASG A;  2Q8I A;  1Y8P A;  2CCS A;  3G7E A;  4K4O A;  1UYG A;  2QF6 A;  1S14 A;  1THN A;  4O09 A;  2VW5 A;  1MU5 A;  1B3Q A;  4BIU A;  1YS3 A;  2IWU A;  2YE5 A;  4XKO A;  2Q8G A;  4CE2 A;  3C0E A;  3U2D A;  4GEE A;  3TZ4 A;  3B27 A;  3HYZ A;  4YKX A;  2BRC A;  5M4K A;  4GT8 A;  2GQP A;  2YEB A;  4H7Q A;  3R92 A;  2K5B A;  2ZDX A;  3PEH A;  4V25 A;  3IED A;  4WUD A;  3MNR P;  3TZ0 A;  4MPE A;  4YKQ A;  3CGZ A;  4JAV A;  1BKN A;  2BRE A;  5IN9 A;  4EGK A;  3H4L A;  1UY8 A;  1AJ6 A;  2FWZ A;  4EFT A;  2XDU A;  3VHD A;  1R62 A;  3EHJ A;  1AMW A;  2BU8 A;  3B24 A;  2YK2 A;  4O0B A;  2H55 A;  2BSM A;  3GIG B;  2WI6 A;  3RLP A;  4HYM A;  4GGL A;  2ZKJ A;  2YEC A;  3C11 A;  5CF0 A;  1YC3 A;  4MP7 A;  5BOC A;  1YET A;  2BU6 A;  2XCM A;  3CRK A;  5D7C A;  1TBW A;  5CTW A;  4GFN A;  4YKW A;  3K99 A;  1Z59 A;  2GFD A;  3B28 A;  1GKZ A;  2XHX A;  1YT2 A;  2XJX A;  1QY8 A;  3OW6 A;  3WQ9 A;  4QPK A;  4BXI A;  1YSZ A;  4EFU A;  4CWS A;  3NMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...