4HYPA

Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
194
Chain Sequence
b'GLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Pyrrolopyrimidine inhibitors of DNA gyrase B (GyrB) and topoisomerase IV (ParE). Part I: Structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase/isomerase inhibitor
total genus 60
structure length 194
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4hypA00
3R4PA 1Y4UA 2XHXA 3G75A 4GFNA 1TILA 1NHJA 3CRLA 4QPKA 2YKIA 2IOPA 3C0EA 3RLRA 4EEHA 1OSFA 2ZDYA 3EHGA 3A0TA 4EGIA 3LPSA 1I5AA 4L8ZA 3G7BA 2Q8HA 4PRXA 1US7A 1AJ6A 4FCPA 3K99A 4L91A 2QFOA 3K60A 1EI1A 3EHFA 4V25A 2BTZA 2YJWA 2Q8IA 4YKXA 2BT0A 1I59A 3GIGB 1Z5CA 1ZXNA 3T0HA 2GFDA 4CWFA 5CPHA 1Y8PA 4FCQA 3U2KA 3B27A 3DGEA 5M4EA 4NH8A 4DZYA 4HZ0A 3PEJA 5M4HA 1R62A 4Q20A 4EFUA 2WI3A 5FNCA 3NMQA 3R92A 3WQ9A 2CCTA 4XCJA 3ZXQA 2YE8A 5D6PA 2XX2A 4L93A 1YT0A 2WI4A 4MB9A 4YKWA 4GQTA 4CE2A 3A0RA 3TTZA 2XDLA 1GKZA 4BXIA 3PEHA 2WI6A 4KTNA 4AWPA 2IORA 4LP0A 1S16A 5D6QA 5IDJA 4XKKA 4YKZA 4ASBA 2VCIA 5CTXA 1Z5BA 1TIDA 1B3QA 4CWNA 3TZ2A 2BRCA 2YKCA 3B28A 4HXZA 2YI5A 4URNA 1UYFA 3A0WA 3B25A 3IEDA 2IWUA 3H80A 3ZKBA 1Z59A 2YI0A 4U7OA 2XJGA 4XIQA 2YE5A 4BQJA 2XX4A 2JJCA 2FWZA 3D2RA 3KE6A 2ZBKB 3R4MA 2XHRA 1UYDA 1Y4SA 1Y8OA 4GEEA 4XD8A 4XITA 4UROA 2E0AA 1KZNA 3TUHA 1ZWHA 2AKPA 4JAVA 4BQGA 2VWCA 1L0OA 4WUCA 4ASAA 2GQPA 2HKJA 2YGAA 3OMUA 2BYHA 2IWSA 3T1KA 3VHDA 1BXDA 1BKNA 3U67A 1UYLA 2PNRA 3D36A 4B6CA 1I58A 3FT5A 4HXWA 4XKAA 3VHCA 5D7CA 2Q2EB 3B24A 3RKZA 3BM9A 1AM1A 2K5BA 4KQVA 5M4KA 3RLQA 4LPBA 1BYQA 1U0ZA 4CWRA 2O1VA 1TH8A 1UY6A 4R1FA 5CTYA 4KSHA 4HYPA 4I5SA 2IWXA 3OPDA 4ZVIA 2C2AA 3VADA 1AMWA 4XIRA 3ZKDA 5CTUA 4O05A 4AWQA 1YETA 5IN9A 3GIFA 3O2FA 2CCUA 5C93A 4L94A 4NH9A 4EFTA 3CRKA 3K98A 4HYMA 4LWGA 2Q8GA 2YGEA 2XABA 2H55A 1I5CA 1UYHA 5FNFA 3EKOA 3EKRA 4NH7A 2IOQA 4EGKA 2QG2A 2YI7A 4P7AA 4AS9A 2XDUA 4GGLA 2BYIA 4E02A 3Q5KA 2YE3A 3OWDA 4AWOA 4EGHA 5CTWA 3TZ0A 3O6OA 4X9LA 3HHUA 2XJJA 2BREA 4LWFA 1UYCA 3EHJA 4MP2A 2YE6A 1H7SA 5M4MA 3INXA 2XHTA 4YKYA 5CF0A 2XK2A 5D7DA 3MNRP 2ESAA 1GJVA 4XKOA 3C11A 2FYPA 2WEQA 2YI6A 2YKEA 1THNA 3K97A 2O1UA 1UY7A 1UYMA 1NHHA 2WI7A 2YEIA 1Y8NA 4BIUA 5GGZA 2YEFA 4GCZA 3JZ3A 1YSZA 5L3JA 1YSRA 2Q8FA 3CGYA 1B63A 3Q5JA 2YK9A 5IDMA 4L90A 4P8OA 2WEPA 4U93A 1ZXMA 4MBCA 4R3MA 4WUBA 5J6AA 1UY8A 4CWTA 4EM7A 3HEKA 4E01A 2HCHA 4PRVA 4CE1A 2JKIA 1ID0A 4HY1A 5F3KA 1YC1A 1TC0A 2CCSA 2VCJA 2XJXA 2YKBA 4CWOA 2YEBA 3O0IA 4V26A 4YKQA 3TZ4A 4H7QA 1YT1A 3ZM7A 2YEJA 2YK2A 4O07A 1MX0A 5BOCA 3GIEA 4XC0A 1S14A 4EMVA 1EA6A 3OW6A 4YKUA 3Q5LA 4H85A 4KSGA 4K4OA 5F5RA 4FMTA 4JASA 4HY6A 1I5BA 4XDMA 2XDSA 5J71A 4KP4A 3QDDA 4CWPA 1YS3A 2WI1A 3HZ1A 1QYEA 4MOTA 2YE4A 1KIJA 2WERA 2ZKJA 2YE2A 2BU5A 3WHAA 2WI2A 4ASFA 1NHIA 2XDKA 4ZKIA 2BZ5A 2FWYA 3R4OA 4H81A 3OWBA 1Z5AA 1YC3A 4MPEA 3EHHA 3FV5A 1YC4A 4W7TA 3R4NA 3CGZA 5FWKA 4BIZA 4HZ5A 3VHAA 1AH8A 4DUHA 4YKTA 1YERA 4XE2A 4B7PA 3LNUA 4LWEA 3ZXOA 2YJXA 1GKXA 2FXSA 2BU8A 3A0ZA 1PVGA 3U2DA 4CWSA 2QG0A 4I3HA 1MU5A 4MPCA 2XCMA 5BODA 4JAUA 5D7RA 2CGFA 4CWQA 3INWA 4LWIA 1B62A 3HZ5A 4PL9A 4R3AA 4O04A 3GIGA 3R91A 1AH6A 1ZW9A 2O1WA 4GT8A 2EXLA 2VW5A 4O0BA 3A0XA 4URLA 1UYIA 4U7NA 3HYYA 2ZDXA 3HYZA 4QPJA 2WI5A 4CE3A 5M4NA 1QY8A 1UYEA 4YKRA 4WUDA 4PU9A 3G7EA 1YESA 4JQLA 4MPNA 5FNDA 1UY9A 3T2SA 2YEGA 2XDXA 4FCRA 2UWDA 3CWVA 3RLPA 2QF6A 1UYGA 2HG1A 5M4PA 1A4HA 1I5DA 2YEDA 2BU2A 2H8MA 3D0BA 3A0YA 3T0ZA 2BU7A 1JM6A 1YT2A 4O09A 4ASGA 3TZ5A 2YEEA 2YKJA 4MP7A 3B26A 1TBWA 1H7UA 2YEAA 2CG9A 4XCLA 2CH4A 4BAEA 4XIPA 4XTJA 4URMA 2YE7A 2YE9A 3BMYA 3H4LA 2XX5A 1UYKA 3SL2A 2BU6A 3QTFA 1QZRA 4LWHA 1TC6A 2BSMA 4E00A 2XD6A 2YGFA 2YEHA 4FPPA 4KFGA 2YECA 3FT8A 1BGQA 3T10A 1U2OA
chains in the Genus database with same CATH superfamily
3R4PA 1Y4UA 2XHXA 3G75A 4GFNA 1TILA 1NHJA 2FTKA 3CRLA 4QPKA 2YKIA 2IOPA 3C0EA 3RLRA 4EEHA 1OSFA 2ZDYA 3EHGA 3A0TA 4EGIA 3LPSA 1I5AA 4L8ZA 3G7BA 2Q8HA 4PRXA 1US7A 1AJ6A 4FCPA 3K99A 3LMMA 4L91A 2QFOA 3K60A 1EI1A 3EHFA 4V25A 2BTZA 2YJWA 2Q8IA 4YKXA 2BT0A 1I59A 3GIGB 1Z5CA 1ZXNA 3T0HA 2GFDA 4CWFA 5CPHA 1Y8PA 4FCQA 3U2KA 3B27A 3DGEA 5M4EA 4NH8A 4DZYA 4HZ0A 3PEJA 5M4HA 1R62A 4Q20A 4EFUA 2WI3A 5FNCA 3NMQA 3R92A 3WQ9A 2CCTA 4XCJA 3ZXQA 2YE8A 5D6PA 2XX2A 4L93A 1YT0A 2WI4A 4MB9A 4YKWA 4GQTA 4CE2A 3A0RA 3TTZA 2XDLA 1GKZA 4BXIA 3PEHA 2WI6A 4KTNA 4AWPA 2IORA 4LP0A 1S16A 5D6QA 5IDJA 4XKKA 4YKZA 4ASBA 2VCIA 5CTXA 1Z5BA 1TIDA 1B3QA 4CWNA 3TZ2A 2BRCA 1F51A 2YKCA 3B28A 4HXZA 2YI5A 4URNA 1UYFA 3A0WA 3B25A 3IEDA 2IWUA 3H80A 3ZKBA 3CYGA 1Z59A 2YI0A 4U7OA 2XJGA 4XIQA 2YE5A 4BQJA 2XX4A 2JJCA 2FWZA 2C1IA 3D2RA 3KE6A 2ZBKB 3R4MA 2XHRA 1UYDA 1Y4SA 1Y8OA 4GEEA 4XD8A 4XITA 4UROA 2E0AA 1KZNA 3TUHA 1ZWHA 2AKPA 4JAVA 4BQGA 2VWCA 1L0OA 4WUCA 4ASAA 2GQPA 2HKJA 2YGAA 3OMUA 2BYHA 2IWSA 5JENA 3T1KA 3VHDA 1BXDA 1BKNA 3U67A 1UYLA 2PNRA 3D36A 4B6CA 1I58A 3FT5A 4HXWA 4XKAA 3VHCA 5D7CA 2Q2EB 3B24A 3RKZA 3BM9A 1AM1A 2K5BA 4KQVA 5M4KA 3RLQA 4LPBA 1BYQA 1U0ZA 4CWRA 2O1VA 1TH8A 1UY6A 4R1FA 5CTYA 4KSHA 4HYPA 4I5SA 2IWXA 3OPDA 4ZVIA 2C2AA 3VADA 1AMWA 4XIRA 3ZKDA 5CTUA 4O05A 4AWQA 1YETA 5IN9A 3GIFA 3O2FA 2CCUA 5C93A 4L94A 4NH9A 4EFTA 3CRKA 3K98A 4HYMA 4LWGA 2Q8GA 2YGEA 2XABA 2H55A 1I5CA 1UYHA 5FNFA 3EKOA 3EKRA 2C1GA 4NH7A 2IOQA 4EGKA 2QG2A 2YI7A 4P7AA 4AS9A 2XDUA 4GGLA 2BYIA 4E02A 3Q5KA 2YE3A 3OWDA 4AWOA 4EGHA 5CTWA 3TZ0A 3O6OA 4X9LA 3HHUA 2XJJA 2BREA 4LWFA 1UYCA 3EHJA 4MP2A 2YE6A 1H7SA 5M4MA 3INXA 2XHTA 4YKYA 5CF0A 2XK2A 5D7DA 3MNRP 2ESAA 1GJVA 4XKOA 3C11A 2FYPA 2WEQA 2YI6A 2YKEA 1THNA 3K97A 2O1UA 1UY7A 1UYMA 1NHHA 2WI7A 2YEIA 1Y8NA 4BIUA 5GGZA 2YEFA 4GCZA 3JZ3A 1YSZA 5L3JA 1YSRA 2Q8FA 3CGYA 1B63A 3Q5JA 2YK9A 5IDMA 4L90A 4P8OA 2WEPA 4U93A 1ZXMA 4MBCA 4R3MA 4WUBA 5J6AA 1UY8A 4CWTA 4EM7A 3HEKA 4E01A 2HCHA 4PRVA 4CE1A 2JKIA 1ID0A 4HY1A 5F3KA 4E72A 1YC1A 1TC0A 2CCSA 2VCJA 2XJXA 2YKBA 4CWOA 2YEBA 3O0IA 4V26A 4YKQA 3TZ4A 4H7QA 1YT1A 3ZM7A 2YEJA 2YK2A 1IXMA 4O07A 1MX0A 5BOCA 3GIEA 4XC0A 1S14A 4EMVA 1EA6A 3OW6A 4YKUA 3Q5LA 4H85A 4KSGA 4K4OA 5F5RA 4FMTA 4JASA 4HY6A 1I5BA 4XDMA 2XDSA 5J71A 4KP4A 3QDDA 4CWPA 1YS3A 2WI1A 3HZ1A 1QYEA 4MOTA 2YE4A 1KIJA 2WERA 2ZKJA 2YE2A 2BU5A 3WHAA 2WI2A 4ASFA 1NHIA 2HHIA 2XDKA 4ZKIA 2BZ5A 2FWYA 3R4OA 4H81A 3OWBA 1Z5AA 1YC3A 4MPEA 3EHHA 3FV5A 1YC4A 4W7TA 3R4NA 3CGZA 5FWKA 4BIZA 4HZ5A 3VHAA 1AH8A 4DUHA 4YKTA 1YERA 4XE2A 4B7PA 3LNUA 4LWEA 3ZXOA 2YJXA 1GKXA 2FXSA 2BU8A 3A0ZA 1PVGA 3U2DA 4CWSA 2QG0A 4I3HA 1MU5A 4MPCA 2XCMA 5BODA 4JAUA 5D7RA 2CGFA 4CWQA 3INWA 4LWIA 1B62A 3HZ5A 4PL9A 4R3AA 4O04A 3GIGA 3R91A 1AH6A 1ZW9A 2O1WA 4GT8A 2EXLA 2VW5A 4O0BA 3A0XA 4URLA 1UYIA 4U7NA 3HYYA 2ZDXA 3HYZA 4QPJA 2WI5A 4CE3A 5M4NA 1QY8A 1UYEA 4YKRA 4WUDA 4PU9A 3G7EA 1YESA 4JQLA 4MPNA 5FNDA 1UY9A 3T2SA 2YEGA 2XDXA 4FCRA 2UWDA 3CWVA 3RLPA 2QF6A 1UYGA 2HG1A 3S5TA 5M4PA 1A4HA 1I5DA 2YEDA 2BU2A 2H8MA 3D0BA 3A0YA 3T0ZA 2BU7A 1JM6A 1YT2A 4O09A 4ASGA 3TZ5A 2YEEA 2YKJA 4MP7A 3B26A 1TBWA 1H7UA 2YEAA 2CG9A 4XCLA 2CH4A 4BAEA 4XIPA 4XTJA 4URMA 2YE7A 2YE9A 3BMYA 3H4LA 2XX5A 1UYKA 3SL2A 2BU6A 3QTFA 1QZRA 4LWHA 1TC6A 2BSMA 4E00A 2XD6A 2YGFA 2YEHA 4FPPA 4KFGA 2YECA 3FT8A 1BGQA 3T10A 1U2OA
chains in the Genus database with same CATH topology
3R4PA 1Y4UA 2XHXA 3G75A 4GFNA 1TILA 1NHJA 3CRLA 4QPKA 2YKIA 2IOPA 3C0EA 3RLRA 4EEHA 1OSFA 2ZDYA 3EHGA 3A0TA 4EGIA 3LPSA 1I5AA 4L8ZA 3G7BA 2Q8HA 4PRXA 1US7A 1AJ6A 4FCPA 3K99A 4L91A 2QFOA 3K60A 1EI1A 3EHFA 4V25A 2BTZA 2YJWA 2Q8IA 4YKXA 2BT0A 1I59A 3GIGB 1Z5CA 1ZXNA 3T0HA 2GFDA 4CWFA 5CPHA 1Y8PA 4FCQA 3U2KA 3B27A 3DGEA 5M4EA 4NH8A 4DZYA 4HZ0A 3PEJA 5M4HA 1R62A 4Q20A 4EFUA 2WI3A 5FNCA 3NMQA 3R92A 3WQ9A 2CCTA 4XCJA 3ZXQA 2YE8A 5D6PA 2XX2A 4L93A 1YT0A 2WI4A 4MB9A 4YKWA 4GQTA 4CE2A 3A0RA 3TTZA 2XDLA 1GKZA 4BXIA 3PEHA 2WI6A 4KTNA 4AWPA 2IORA 4LP0A 1S16A 5D6QA 5IDJA 4XKKA 4YKZA 4ASBA 2VCIA 5CTXA 1Z5BA 1TIDA 1B3QA 4CWNA 3TZ2A 2BRCA 2YKCA 3B28A 4HXZA 2YI5A 4URNA 1UYFA 3A0WA 3B25A 3IEDA 2IWUA 3H80A 3ZKBA 1Z59A 2YI0A 4U7OA 2XJGA 4XIQA 2YE5A 4BQJA 2XX4A 2JJCA 2FWZA 3D2RA 3KE6A 2ZBKB 3R4MA 2XHRA 1UYDA 1Y4SA 1Y8OA 4GEEA 4XD8A 4XITA 4UROA 2E0AA 1KZNA 3TUHA 1ZWHA 2AKPA 4JAVA 4BQGA 2VWCA 1L0OA 4WUCA 4ASAA 2GQPA 2HKJA 2YGAA 3OMUA 2BYHA 2IWSA 3T1KA 3VHDA 1BXDA 1BKNA 3U67A 1UYLA 2PNRA 3D36A 4B6CA 1I58A 3FT5A 4HXWA 4XKAA 3VHCA 5D7CA 2Q2EB 3B24A 3RKZA 3BM9A 1AM1A 2K5BA 4KQVA 5M4KA 3RLQA 4LPBA 1BYQA 1U0ZA 4CWRA 2O1VA 1TH8A 1UY6A 4R1FA 5CTYA 4KSHA 4HYPA 4I5SA 2IWXA 3OPDA 4ZVIA 2C2AA 3VADA 1AMWA 4XIRA 3ZKDA 5CTUA 4O05A 4AWQA 1YETA 5IN9A 3GIFA 3O2FA 2CCUA 5C93A 4L94A 4NH9A 4EFTA 3CRKA 3K98A 4HYMA 4LWGA 2Q8GA 2YGEA 2XABA 2H55A 1I5CA 1UYHA 5FNFA 3EKOA 3EKRA 4NH7A 2IOQA 4EGKA 2QG2A 2YI7A 4P7AA 4AS9A 2XDUA 4GGLA 2BYIA 4E02A 3Q5KA 2YE3A 3OWDA 4AWOA 4EGHA 5CTWA 3TZ0A 3O6OA 4X9LA 3HHUA 2XJJA 2BREA 4LWFA 1UYCA 3EHJA 4MP2A 2YE6A 1H7SA 5M4MA 3INXA 2XHTA 4YKYA 5CF0A 2XK2A 5D7DA 3MNRP 2ESAA 1GJVA 4XKOA 3C11A 2FYPA 2WEQA 2YI6A 2YKEA 1THNA 3K97A 2O1UA 1UY7A 1UYMA 1NHHA 2WI7A 2YEIA 1Y8NA 4BIUA 5GGZA 2YEFA 4GCZA 3JZ3A 1YSZA 5L3JA 1YSRA 2Q8FA 3CGYA 1B63A 3Q5JA 2YK9A 5IDMA 4L90A 4P8OA 2WEPA 4U93A 1ZXMA 4MBCA 4R3MA 4WUBA 5J6AA 1UY8A 4CWTA 4EM7A 3HEKA 4E01A 2HCHA 4PRVA 4CE1A 2JKIA 1ID0A 4HY1A 5F3KA 1YC1A 1TC0A 2CCSA 2VCJA 2XJXA 2YKBA 4CWOA 2YEBA 3O0IA 4V26A 4YKQA 3TZ4A 4H7QA 1YT1A 3ZM7A 2YEJA 2YK2A 4O07A 1MX0A 5BOCA 3GIEA 4XC0A 1S14A 4EMVA 1EA6A 3OW6A 4YKUA 3Q5LA 4H85A 4KSGA 4K4OA 5F5RA 4FMTA 4JASA 4HY6A 1I5BA 4XDMA 2XDSA 5J71A 4KP4A 3QDDA 4CWPA 1YS3A 2WI1A 3HZ1A 1QYEA 4MOTA 2YE4A 1KIJA 2WERA 2ZKJA 2YE2A 2BU5A 3WHAA 2WI2A 4ASFA 1NHIA 2XDKA 4ZKIA 2BZ5A 2FWYA 3R4OA 4H81A 3OWBA 1Z5AA 1YC3A 4MPEA 3EHHA 3FV5A 1YC4A 4W7TA 3R4NA 3CGZA 5FWKA 4BIZA 4HZ5A 3VHAA 1AH8A 4DUHA 4YKTA 1YERA 4XE2A 4B7PA 3LNUA 4LWEA 3ZXOA 2YJXA 1GKXA 2FXSA 2BU8A 3A0ZA 1PVGA 3U2DA 4CWSA 2QG0A 4I3HA 1MU5A 4MPCA 2XCMA 5BODA 4JAUA 5D7RA 2CGFA 4CWQA 3INWA 4LWIA 1B62A 3HZ5A 4PL9A 4R3AA 4O04A 3GIGA 3R91A 1AH6A 1ZW9A 2O1WA 4GT8A 2EXLA 2VW5A 4O0BA 3A0XA 4URLA 1UYIA 4U7NA 3HYYA 2ZDXA 3HYZA 4QPJA 2WI5A 4CE3A 5M4NA 1QY8A 1UYEA 4YKRA 4WUDA 4PU9A 3G7EA 1YESA 4JQLA 4MPNA 5FNDA 1UY9A 3T2SA 2YEGA 2XDXA 4FCRA 2UWDA 3CWVA 3RLPA 2QF6A 1UYGA 2HG1A 5M4PA 1A4HA 1I5DA 2YEDA 2BU2A 2H8MA 3D0BA 3A0YA 3T0ZA 2BU7A 1JM6A 1YT2A 4O09A 4ASGA 3TZ5A 2YEEA 2YKJA 4MP7A 3B26A 1TBWA 1H7UA 2YEAA 2CG9A 4XCLA 2CH4A 4BAEA 4XIPA 4XTJA 4URMA 2YE7A 2YE9A 3BMYA 3H4LA 2XX5A 1UYKA 3SL2A 2BU6A 3QTFA 1QZRA 4LWHA 1TC6A 2BSMA 4E00A 2XD6A 2YGFA 2YEHA 4FPPA 4KFGA 2YECA 3FT8A 1BGQA 3T10A 1U2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4P A;  1Y4U A;  2XHX A;  3G75 A;  4GFN A;  1TIL A;  1NHJ A;  3CRL A;  4QPK A;  2YKI A;  2IOP A;  3C0E A;  3RLR A;  4EEH A;  1OSF A;  2ZDY A;  3EHG A;  3A0T A;  4EGI A;  3LPS A;  1I5A A;  4L8Z A;  3G7B A;  2Q8H A;  4PRX A;  1US7 A;  1AJ6 A;  4FCP A;  3K99 A;  4L91 A;  2QFO A;  3K60 A;  1EI1 A;  3EHF A;  4V25 A;  2BTZ A;  2YJW A;  2Q8I A;  4YKX A;  2BT0 A;  1I59 A;  3GIG B;  1Z5C A;  1ZXN A;  3T0H A;  2GFD A;  4CWF A;  5CPH A;  1Y8P A;  4FCQ A;  3U2K A;  3B27 A;  3DGE A;  5M4E A;  4NH8 A;  4DZY A;  4HZ0 A;  3PEJ A;  5M4H A;  1R62 A;  4Q20 A;  4EFU A;  2WI3 A;  5FNC A;  3NMQ A;  3R92 A;  3WQ9 A;  2CCT A;  4XCJ A;  3ZXQ A;  2YE8 A;  5D6P A;  2XX2 A;  4L93 A;  1YT0 A;  2WI4 A;  4MB9 A;  4YKW A;  4GQT A;  4CE2 A;  3A0R A;  3TTZ A;  2XDL A;  1GKZ A;  4BXI A;  3PEH A;  2WI6 A;  4KTN A;  4AWP A;  2IOR A;  4LP0 A;  1S16 A;  5D6Q A;  5IDJ A;  4XKK A;  4YKZ A;  4ASB A;  2VCI A;  5CTX A;  1Z5B A;  1TID A;  1B3Q A;  4CWN A;  3TZ2 A;  2BRC A;  2YKC A;  3B28 A;  4HXZ A;  2YI5 A;  4URN A;  1UYF A;  3A0W A;  3B25 A;  3IED A;  2IWU A;  3H80 A;  3ZKB A;  1Z59 A;  2YI0 A;  4U7O A;  2XJG A;  4XIQ A;  2YE5 A;  4BQJ A;  2XX4 A;  2JJC A;  2FWZ A;  3D2R A;  3KE6 A;  2ZBK B;  3R4M A;  2XHR A;  1UYD A;  1Y4S A;  1Y8O A;  4GEE A;  4XD8 A;  4XIT A;  4URO A;  2E0A A;  1KZN A;  3TUH A;  1ZWH A;  2AKP A;  4JAV A;  4BQG A;  2VWC A;  1L0O A;  4WUC A;  4ASA A;  2GQP A;  2HKJ A;  2YGA A;  3OMU A;  2BYH A;  2IWS A;  3T1K A;  3VHD A;  1BXD A;  1BKN A;  3U67 A;  1UYL A;  2PNR A;  3D36 A;  4B6C A;  1I58 A;  3FT5 A;  4HXW A;  4XKA A;  3VHC A;  5D7C A;  2Q2E B;  3B24 A;  3RKZ A;  3BM9 A;  1AM1 A;  2K5B A;  4KQV A;  5M4K A;  3RLQ A;  4LPB A;  1BYQ A;  1U0Z A;  4CWR A;  2O1V A;  1TH8 A;  1UY6 A;  4R1F A;  5CTY A;  4KSH A;  4HYP A;  4I5S A;  2IWX A;  3OPD A;  4ZVI A;  2C2A A;  3VAD A;  1AMW A;  4XIR A;  3ZKD A;  5CTU A;  4O05 A;  4AWQ A;  1YET A;  5IN9 A;  3GIF A;  3O2F A;  2CCU A;  5C93 A;  4L94 A;  4NH9 A;  4EFT A;  3CRK A;  3K98 A;  4HYM A;  4LWG A;  2Q8G A;  2YGE A;  2XAB A;  2H55 A;  1I5C A;  1UYH A;  5FNF A;  3EKO A;  3EKR A;  4NH7 A;  2IOQ A;  4EGK A;  2QG2 A;  2YI7 A;  4P7A A;  4AS9 A;  2XDU A;  4GGL A;  2BYI A;  4E02 A;  3Q5K A;  2YE3 A;  3OWD A;  4AWO A;  4EGH A;  5CTW A;  3TZ0 A;  3O6O A;  4X9L A;  3HHU A;  2XJJ A;  2BRE A;  4LWF A;  1UYC A;  3EHJ A;  4MP2 A;  2YE6 A;  1H7S A;  5M4M A;  3INX A;  2XHT A;  4YKY A;  5CF0 A;  2XK2 A;  5D7D A;  3MNR P;  2ESA A;  1GJV A;  4XKO A;  3C11 A;  2FYP A;  2WEQ A;  2YI6 A;  2YKE A;  1THN A;  3K97 A;  2O1U A;  1UY7 A;  1UYM A;  1NHH A;  2WI7 A;  2YEI A;  1Y8N A;  4BIU A;  5GGZ A;  2YEF A;  4GCZ A;  3JZ3 A;  1YSZ A;  5L3J A;  1YSR A;  2Q8F A;  3CGY A;  1B63 A;  3Q5J A;  2YK9 A;  5IDM A;  4L90 A;  4P8O A;  2WEP A;  4U93 A;  1ZXM A;  4MBC A;  4R3M A;  4WUB A;  5J6A A;  1UY8 A;  4CWT A;  4EM7 A;  3HEK A;  4E01 A;  2HCH A;  4PRV A;  4CE1 A;  2JKI A;  1ID0 A;  4HY1 A;  5F3K A;  1YC1 A;  1TC0 A;  2CCS A;  2VCJ A;  2XJX A;  2YKB A;  4CWO A;  2YEB A;  3O0I A;  4V26 A;  4YKQ A;  3TZ4 A;  4H7Q A;  1YT1 A;  3ZM7 A;  2YEJ A;  2YK2 A;  4O07 A;  1MX0 A;  5BOC A;  3GIE A;  4XC0 A;  1S14 A;  4EMV A;  1EA6 A;  3OW6 A;  4YKU A;  3Q5L A;  4H85 A;  4KSG A;  4K4O A;  5F5R A;  4FMT A;  4JAS A;  4HY6 A;  1I5B A;  4XDM A;  2XDS A;  5J71 A;  4KP4 A;  3QDD A;  4CWP A;  1YS3 A;  2WI1 A;  3HZ1 A;  1QYE A;  4MOT A;  2YE4 A;  1KIJ A;  2WER A;  2ZKJ A;  2YE2 A;  2BU5 A;  3WHA A;  2WI2 A;  4ASF A;  1NHI A;  2XDK A;  4ZKI A;  2BZ5 A;  2FWY A;  3R4O A;  4H81 A;  3OWB A;  1Z5A A;  1YC3 A;  4MPE A;  3EHH A;  3FV5 A;  1YC4 A;  4W7T A;  3R4N A;  3CGZ A;  5FWK A;  4BIZ A;  4HZ5 A;  3VHA A;  1AH8 A;  4DUH A;  4YKT A;  1YER A;  4XE2 A;  4B7P A;  3LNU A;  4LWE A;  3ZXO A;  2YJX A;  1GKX A;  2FXS A;  2BU8 A;  3A0Z A;  1PVG A;  3U2D A;  4CWS A;  2QG0 A;  4I3H A;  1MU5 A;  4MPC A;  2XCM A;  5BOD A;  4JAU A;  5D7R A;  2CGF A;  4CWQ A;  3INW A;  4LWI A;  1B62 A;  3HZ5 A;  4PL9 A;  4R3A A;  4O04 A;  3GIG A;  3R91 A;  1AH6 A;  1ZW9 A;  2O1W A;  4GT8 A;  2EXL A;  2VW5 A;  4O0B A;  3A0X A;  4URL A;  1UYI A;  4U7N A;  3HYY A;  2ZDX A;  3HYZ A;  4QPJ A;  2WI5 A;  4CE3 A;  5M4N A;  1QY8 A;  1UYE A;  4YKR A;  4WUD A;  4PU9 A;  3G7E A;  1YES A;  4JQL A;  4MPN A;  5FND A;  1UY9 A;  3T2S A;  2YEG A;  2XDX A;  4FCR A;  2UWD A;  3CWV A;  3RLP A;  2QF6 A;  1UYG A;  2HG1 A;  5M4P A;  1A4H A;  1I5D A;  2YED A;  2BU2 A;  2H8M A;  3D0B A;  3A0Y A;  3T0Z A;  2BU7 A;  1JM6 A;  1YT2 A;  4O09 A;  4ASG A;  3TZ5 A;  2YEE A;  2YKJ A;  4MP7 A;  3B26 A;  1TBW A;  1H7U A;  2YEA A;  2CG9 A;  4XCL A;  2CH4 A;  4BAE A;  4XIP A;  4XTJ A;  4URM A;  2YE7 A;  2YE9 A;  3BMY A;  3H4L A;  2XX5 A;  1UYK A;  3SL2 A;  2BU6 A;  3QTF A;  1QZR A;  4LWH A;  1TC6 A;  2BSM A;  4E00 A;  2XD6 A;  2YGF A;  2YEH A;  4FPP A;  4KFG A;  2YEC A;  3FT8 A;  1BGQ A;  3T10 A;  1U2O A; 
#chains in the Genus database with same CATH topology
 3R4P A;  1Y4U A;  2XHX A;  3G75 A;  4GFN A;  1TIL A;  1NHJ A;  2FTK A;  3CRL A;  4QPK A;  2YKI A;  2IOP A;  3C0E A;  3RLR A;  4EEH A;  1OSF A;  2ZDY A;  3EHG A;  3A0T A;  4EGI A;  3LPS A;  1I5A A;  4L8Z A;  3G7B A;  2Q8H A;  4PRX A;  1US7 A;  1AJ6 A;  4FCP A;  3K99 A;  3LMM A;  4L91 A;  2QFO A;  3K60 A;  1EI1 A;  3EHF A;  4V25 A;  2BTZ A;  2YJW A;  2Q8I A;  4YKX A;  2BT0 A;  1I59 A;  3GIG B;  1Z5C A;  1ZXN A;  3T0H A;  2GFD A;  4CWF A;  5CPH A;  1Y8P A;  4FCQ A;  3U2K A;  3B27 A;  3DGE A;  5M4E A;  4NH8 A;  4DZY A;  4HZ0 A;  3PEJ A;  5M4H A;  1R62 A;  4Q20 A;  4EFU A;  2WI3 A;  5FNC A;  3NMQ A;  3R92 A;  3WQ9 A;  2CCT A;  4XCJ A;  3ZXQ A;  2YE8 A;  5D6P A;  2XX2 A;  4L93 A;  1YT0 A;  2WI4 A;  4MB9 A;  4YKW A;  4GQT A;  4CE2 A;  3A0R A;  3TTZ A;  2XDL A;  1GKZ A;  4BXI A;  3PEH A;  2WI6 A;  4KTN A;  4AWP A;  2IOR A;  4LP0 A;  1S16 A;  5D6Q A;  5IDJ A;  4XKK A;  4YKZ A;  4ASB A;  2VCI A;  5CTX A;  1Z5B A;  1TID A;  1B3Q A;  4CWN A;  3TZ2 A;  2BRC A;  1F51 A;  2YKC A;  3B28 A;  4HXZ A;  2YI5 A;  4URN A;  1UYF A;  3A0W A;  3B25 A;  3IED A;  2IWU A;  3H80 A;  3ZKB A;  3CYG A;  1Z59 A;  2YI0 A;  4U7O A;  2XJG A;  4XIQ A;  2YE5 A;  4BQJ A;  2XX4 A;  2JJC A;  2FWZ A;  2C1I A;  3D2R A;  3KE6 A;  2ZBK B;  3R4M A;  2XHR A;  1UYD A;  1Y4S A;  1Y8O A;  4GEE A;  4XD8 A;  4XIT A;  4URO A;  2E0A A;  1KZN A;  3TUH A;  1ZWH A;  2AKP A;  4JAV A;  4BQG A;  2VWC A;  1L0O A;  4WUC A;  4ASA A;  2GQP A;  2HKJ A;  2YGA A;  3OMU A;  2BYH A;  2IWS A;  5JEN A;  3T1K A;  3VHD A;  1BXD A;  1BKN A;  3U67 A;  1UYL A;  2PNR A;  3D36 A;  4B6C A;  1I58 A;  3FT5 A;  4HXW A;  4XKA A;  3VHC A;  5D7C A;  2Q2E B;  3B24 A;  3RKZ A;  3BM9 A;  1AM1 A;  2K5B A;  4KQV A;  5M4K A;  3RLQ A;  4LPB A;  1BYQ A;  1U0Z A;  4CWR A;  2O1V A;  1TH8 A;  1UY6 A;  4R1F A;  5CTY A;  4KSH A;  4HYP A;  4I5S A;  2IWX A;  3OPD A;  4ZVI A;  2C2A A;  3VAD A;  1AMW A;  4XIR A;  3ZKD A;  5CTU A;  4O05 A;  4AWQ A;  1YET A;  5IN9 A;  3GIF A;  3O2F A;  2CCU A;  5C93 A;  4L94 A;  4NH9 A;  4EFT A;  3CRK A;  3K98 A;  4HYM A;  4LWG A;  2Q8G A;  2YGE A;  2XAB A;  2H55 A;  1I5C A;  1UYH A;  5FNF A;  3EKO A;  3EKR A;  2C1G A;  4NH7 A;  2IOQ A;  4EGK A;  2QG2 A;  2YI7 A;  4P7A A;  4AS9 A;  2XDU A;  4GGL A;  2BYI A;  4E02 A;  3Q5K A;  2YE3 A;  3OWD A;  4AWO A;  4EGH A;  5CTW A;  3TZ0 A;  3O6O A;  4X9L A;  3HHU A;  2XJJ A;  2BRE A;  4LWF A;  1UYC A;  3EHJ A;  4MP2 A;  2YE6 A;  1H7S A;  5M4M A;  3INX A;  2XHT A;  4YKY A;  5CF0 A;  2XK2 A;  5D7D A;  3MNR P;  2ESA A;  1GJV A;  4XKO A;  3C11 A;  2FYP A;  2WEQ A;  2YI6 A;  2YKE A;  1THN A;  3K97 A;  2O1U A;  1UY7 A;  1UYM A;  1NHH A;  2WI7 A;  2YEI A;  1Y8N A;  4BIU A;  5GGZ A;  2YEF A;  4GCZ A;  3JZ3 A;  1YSZ A;  5L3J A;  1YSR A;  2Q8F A;  3CGY A;  1B63 A;  3Q5J A;  2YK9 A;  5IDM A;  4L90 A;  4P8O A;  2WEP A;  4U93 A;  1ZXM A;  4MBC A;  4R3M A;  4WUB A;  5J6A A;  1UY8 A;  4CWT A;  4EM7 A;  3HEK A;  4E01 A;  2HCH A;  4PRV A;  4CE1 A;  2JKI A;  1ID0 A;  4HY1 A;  5F3K A;  4E72 A;  1YC1 A;  1TC0 A;  2CCS A;  2VCJ A;  2XJX A;  2YKB A;  4CWO A;  2YEB A;  3O0I A;  4V26 A;  4YKQ A;  3TZ4 A;  4H7Q A;  1YT1 A;  3ZM7 A;  2YEJ A;  2YK2 A;  1IXM A;  4O07 A;  1MX0 A;  5BOC A;  3GIE A;  4XC0 A;  1S14 A;  4EMV A;  1EA6 A;  3OW6 A;  4YKU A;  3Q5L A;  4H85 A;  4KSG A;  4K4O A;  5F5R A;  4FMT A;  4JAS A;  4HY6 A;  1I5B A;  4XDM A;  2XDS A;  5J71 A;  4KP4 A;  3QDD A;  4CWP A;  1YS3 A;  2WI1 A;  3HZ1 A;  1QYE A;  4MOT A;  2YE4 A;  1KIJ A;  2WER A;  2ZKJ A;  2YE2 A;  2BU5 A;  3WHA A;  2WI2 A;  4ASF A;  1NHI A;  2HHI A;  2XDK A;  4ZKI A;  2BZ5 A;  2FWY A;  3R4O A;  4H81 A;  3OWB A;  1Z5A A;  1YC3 A;  4MPE A;  3EHH A;  3FV5 A;  1YC4 A;  4W7T A;  3R4N A;  3CGZ A;  5FWK A;  4BIZ A;  4HZ5 A;  3VHA A;  1AH8 A;  4DUH A;  4YKT A;  1YER A;  4XE2 A;  4B7P A;  3LNU A;  4LWE A;  3ZXO A;  2YJX A;  1GKX A;  2FXS A;  2BU8 A;  3A0Z A;  1PVG A;  3U2D A;  4CWS A;  2QG0 A;  4I3H A;  1MU5 A;  4MPC A;  2XCM A;  5BOD A;  4JAU A;  5D7R A;  2CGF A;  4CWQ A;  3INW A;  4LWI A;  1B62 A;  3HZ5 A;  4PL9 A;  4R3A A;  4O04 A;  3GIG A;  3R91 A;  1AH6 A;  1ZW9 A;  2O1W A;  4GT8 A;  2EXL A;  2VW5 A;  4O0B A;  3A0X A;  4URL A;  1UYI A;  4U7N A;  3HYY A;  2ZDX A;  3HYZ A;  4QPJ A;  2WI5 A;  4CE3 A;  5M4N A;  1QY8 A;  1UYE A;  4YKR A;  4WUD A;  4PU9 A;  3G7E A;  1YES A;  4JQL A;  4MPN A;  5FND A;  1UY9 A;  3T2S A;  2YEG A;  2XDX A;  4FCR A;  2UWD A;  3CWV A;  3RLP A;  2QF6 A;  1UYG A;  2HG1 A;  3S5T A;  5M4P A;  1A4H A;  1I5D A;  2YED A;  2BU2 A;  2H8M A;  3D0B A;  3A0Y A;  3T0Z A;  2BU7 A;  1JM6 A;  1YT2 A;  4O09 A;  4ASG A;  3TZ5 A;  2YEE A;  2YKJ A;  4MP7 A;  3B26 A;  1TBW A;  1H7U A;  2YEA A;  2CG9 A;  4XCL A;  2CH4 A;  4BAE A;  4XIP A;  4XTJ A;  4URM A;  2YE7 A;  2YE9 A;  3BMY A;  3H4L A;  2XX5 A;  1UYK A;  3SL2 A;  2BU6 A;  3QTF A;  1QZR A;  4LWH A;  1TC6 A;  2BSM A;  4E00 A;  2XD6 A;  2YGF A;  2YEH A;  4FPP A;  4KFG A;  2YEC A;  3FT8 A;  1BGQ A;  3T10 A;  1U2O A; 
#chains in the Genus database with same CATH homology
 3R4P A;  1Y4U A;  2XHX A;  3G75 A;  4GFN A;  1TIL A;  1NHJ A;  3CRL A;  4QPK A;  2YKI A;  2IOP A;  3C0E A;  3RLR A;  4EEH A;  1OSF A;  2ZDY A;  3EHG A;  3A0T A;  4EGI A;  3LPS A;  1I5A A;  4L8Z A;  3G7B A;  2Q8H A;  4PRX A;  1US7 A;  1AJ6 A;  4FCP A;  3K99 A;  4L91 A;  2QFO A;  3K60 A;  1EI1 A;  3EHF A;  4V25 A;  2BTZ A;  2YJW A;  2Q8I A;  4YKX A;  2BT0 A;  1I59 A;  3GIG B;  1Z5C A;  1ZXN A;  3T0H A;  2GFD A;  4CWF A;  5CPH A;  1Y8P A;  4FCQ A;  3U2K A;  3B27 A;  3DGE A;  5M4E A;  4NH8 A;  4DZY A;  4HZ0 A;  3PEJ A;  5M4H A;  1R62 A;  4Q20 A;  4EFU A;  2WI3 A;  5FNC A;  3NMQ A;  3R92 A;  3WQ9 A;  2CCT A;  4XCJ A;  3ZXQ A;  2YE8 A;  5D6P A;  2XX2 A;  4L93 A;  1YT0 A;  2WI4 A;  4MB9 A;  4YKW A;  4GQT A;  4CE2 A;  3A0R A;  3TTZ A;  2XDL A;  1GKZ A;  4BXI A;  3PEH A;  2WI6 A;  4KTN A;  4AWP A;  2IOR A;  4LP0 A;  1S16 A;  5D6Q A;  5IDJ A;  4XKK A;  4YKZ A;  4ASB A;  2VCI A;  5CTX A;  1Z5B A;  1TID A;  1B3Q A;  4CWN A;  3TZ2 A;  2BRC A;  2YKC A;  3B28 A;  4HXZ A;  2YI5 A;  4URN A;  1UYF A;  3A0W A;  3B25 A;  3IED A;  2IWU A;  3H80 A;  3ZKB A;  1Z59 A;  2YI0 A;  4U7O A;  2XJG A;  4XIQ A;  2YE5 A;  4BQJ A;  2XX4 A;  2JJC A;  2FWZ A;  3D2R A;  3KE6 A;  2ZBK B;  3R4M A;  2XHR A;  1UYD A;  1Y4S A;  1Y8O A;  4GEE A;  4XD8 A;  4XIT A;  4URO A;  2E0A A;  1KZN A;  3TUH A;  1ZWH A;  2AKP A;  4JAV A;  4BQG A;  2VWC A;  1L0O A;  4WUC A;  4ASA A;  2GQP A;  2HKJ A;  2YGA A;  3OMU A;  2BYH A;  2IWS A;  3T1K A;  3VHD A;  1BXD A;  1BKN A;  3U67 A;  1UYL A;  2PNR A;  3D36 A;  4B6C A;  1I58 A;  3FT5 A;  4HXW A;  4XKA A;  3VHC A;  5D7C A;  2Q2E B;  3B24 A;  3RKZ A;  3BM9 A;  1AM1 A;  2K5B A;  4KQV A;  5M4K A;  3RLQ A;  4LPB A;  1BYQ A;  1U0Z A;  4CWR A;  2O1V A;  1TH8 A;  1UY6 A;  4R1F A;  5CTY A;  4KSH A;  4HYP A;  4I5S A;  2IWX A;  3OPD A;  4ZVI A;  2C2A A;  3VAD A;  1AMW A;  4XIR A;  3ZKD A;  5CTU A;  4O05 A;  4AWQ A;  1YET A;  5IN9 A;  3GIF A;  3O2F A;  2CCU A;  5C93 A;  4L94 A;  4NH9 A;  4EFT A;  3CRK A;  3K98 A;  4HYM A;  4LWG A;  2Q8G A;  2YGE A;  2XAB A;  2H55 A;  1I5C A;  1UYH A;  5FNF A;  3EKO A;  3EKR A;  4NH7 A;  2IOQ A;  4EGK A;  2QG2 A;  2YI7 A;  4P7A A;  4AS9 A;  2XDU A;  4GGL A;  2BYI A;  4E02 A;  3Q5K A;  2YE3 A;  3OWD A;  4AWO A;  4EGH A;  5CTW A;  3TZ0 A;  3O6O A;  4X9L A;  3HHU A;  2XJJ A;  2BRE A;  4LWF A;  1UYC A;  3EHJ A;  4MP2 A;  2YE6 A;  1H7S A;  5M4M A;  3INX A;  2XHT A;  4YKY A;  5CF0 A;  2XK2 A;  5D7D A;  3MNR P;  2ESA A;  1GJV A;  4XKO A;  3C11 A;  2FYP A;  2WEQ A;  2YI6 A;  2YKE A;  1THN A;  3K97 A;  2O1U A;  1UY7 A;  1UYM A;  1NHH A;  2WI7 A;  2YEI A;  1Y8N A;  4BIU A;  5GGZ A;  2YEF A;  4GCZ A;  3JZ3 A;  1YSZ A;  5L3J A;  1YSR A;  2Q8F A;  3CGY A;  1B63 A;  3Q5J A;  2YK9 A;  5IDM A;  4L90 A;  4P8O A;  2WEP A;  4U93 A;  1ZXM A;  4MBC A;  4R3M A;  4WUB A;  5J6A A;  1UY8 A;  4CWT A;  4EM7 A;  3HEK A;  4E01 A;  2HCH A;  4PRV A;  4CE1 A;  2JKI A;  1ID0 A;  4HY1 A;  5F3K A;  1YC1 A;  1TC0 A;  2CCS A;  2VCJ A;  2XJX A;  2YKB A;  4CWO A;  2YEB A;  3O0I A;  4V26 A;  4YKQ A;  3TZ4 A;  4H7Q A;  1YT1 A;  3ZM7 A;  2YEJ A;  2YK2 A;  4O07 A;  1MX0 A;  5BOC A;  3GIE A;  4XC0 A;  1S14 A;  4EMV A;  1EA6 A;  3OW6 A;  4YKU A;  3Q5L A;  4H85 A;  4KSG A;  4K4O A;  5F5R A;  4FMT A;  4JAS A;  4HY6 A;  1I5B A;  4XDM A;  2XDS A;  5J71 A;  4KP4 A;  3QDD A;  4CWP A;  1YS3 A;  2WI1 A;  3HZ1 A;  1QYE A;  4MOT A;  2YE4 A;  1KIJ A;  2WER A;  2ZKJ A;  2YE2 A;  2BU5 A;  3WHA A;  2WI2 A;  4ASF A;  1NHI A;  2XDK A;  4ZKI A;  2BZ5 A;  2FWY A;  3R4O A;  4H81 A;  3OWB A;  1Z5A A;  1YC3 A;  4MPE A;  3EHH A;  3FV5 A;  1YC4 A;  4W7T A;  3R4N A;  3CGZ A;  5FWK A;  4BIZ A;  4HZ5 A;  3VHA A;  1AH8 A;  4DUH A;  4YKT A;  1YER A;  4XE2 A;  4B7P A;  3LNU A;  4LWE A;  3ZXO A;  2YJX A;  1GKX A;  2FXS A;  2BU8 A;  3A0Z A;  1PVG A;  3U2D A;  4CWS A;  2QG0 A;  4I3H A;  1MU5 A;  4MPC A;  2XCM A;  5BOD A;  4JAU A;  5D7R A;  2CGF A;  4CWQ A;  3INW A;  4LWI A;  1B62 A;  3HZ5 A;  4PL9 A;  4R3A A;  4O04 A;  3GIG A;  3R91 A;  1AH6 A;  1ZW9 A;  2O1W A;  4GT8 A;  2EXL A;  2VW5 A;  4O0B A;  3A0X A;  4URL A;  1UYI A;  4U7N A;  3HYY A;  2ZDX A;  3HYZ A;  4QPJ A;  2WI5 A;  4CE3 A;  5M4N A;  1QY8 A;  1UYE A;  4YKR A;  4WUD A;  4PU9 A;  3G7E A;  1YES A;  4JQL A;  4MPN A;  5FND A;  1UY9 A;  3T2S A;  2YEG A;  2XDX A;  4FCR A;  2UWD A;  3CWV A;  3RLP A;  2QF6 A;  1UYG A;  2HG1 A;  5M4P A;  1A4H A;  1I5D A;  2YED A;  2BU2 A;  2H8M A;  3D0B A;  3A0Y A;  3T0Z A;  2BU7 A;  1JM6 A;  1YT2 A;  4O09 A;  4ASG A;  3TZ5 A;  2YEE A;  2YKJ A;  4MP7 A;  3B26 A;  1TBW A;  1H7U A;  2YEA A;  2CG9 A;  4XCL A;  2CH4 A;  4BAE A;  4XIP A;  4XTJ A;  4URM A;  2YE7 A;  2YE9 A;  3BMY A;  3H4L A;  2XX5 A;  1UYK A;  3SL2 A;  2BU6 A;  3QTF A;  1QZR A;  4LWH A;  1TC6 A;  2BSM A;  4E00 A;  2XD6 A;  2YGF A;  2YEH A;  4FPP A;  4KFG A;  2YEC A;  3FT8 A;  1BGQ A;  3T10 A;  1U2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...