4HYPA

Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
194
Chain Sequence
GLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolopyrimidine inhibitors of DNA gyrase B (GyrB) and topoisomerase IV (ParE). Part I: Structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 60
structure length 194
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4hypA00
2YK9A 4LP0A 3RLQA 4MP2A 2BTZA 1UYDA 4JASA 5F5RA 2JJCA 3CRKA 4B7PA 2YE6A 4KTNA 1YERA 3B27A 4WUCA 3Q5LA 3PEJA 3O6OA 4YKUA 5J71A 3RKZA 1Z5BA 4ZVIA 2YEJA 1GKXA 5CTYA 3A0XA 5CTUA 1PVGA 1EA6A 1BYQA 4BXIA 4HYMA 3K99A 4L94A 1ZXNA 1U0ZA 1TIDA 2YEAA 4JAUA 4CWRA 2FWZA 3R4MA 2O1UA 4XDMA 4XD8A 1Y8PA 3A0YA 3A0ZA 2H55A 1Z5CA 3GIEA 4PU9A 5CTXA 4YKXA 2XDUA 2ZKJA 1I58A 3TZ5A 1THNA 4WUDA 2XD6A 4HZ0A 1UY8A 2C2AA 2WEQA 4MPCA 3A0RA 4EGKA 3T1KA 5GGZA 5D7CA 3O0IA 4HYPA 3R92A 1YT2A 1UYCA 3R4OA 1L0OA 4QPKA 3ZKBA 4P7AA 3EKRA 2YI6A 4EGHA 1TBWA 2BREA 1NHHA 3CWVA 3BMYA 2YGAA 1Z59A 3HZ1A 2XJGA 2BRCA 4HXWA 5M4PA 4LPBA 4XITA 1UY9A 3T10A 4XKOA 3IEDA 3EKOA 3TUHA 4WUBA 3CRLA 4MOTA 2YJXA 4CE2A 4FCQA 1ID0A 4PRXA 4LWIA 3T0ZA 2WERA 1B3QA 4KP4A 1S14A 4AWOA 1U2OA 3T2SA 5IDMA 3HEKA 2HCHA 4MBCA 2YI5A 5CTWA 3C0EA 4CWSA 1UYHA 4EMVA 1TC6A 1KIJA 4I5SA 2WI5A 1I5CA 1AJ6A 1TILA 4U93A 4MPEA 4GCZA 3B24A 4XKKA 4ASAA 2XCMA 1UYFA 3EHFA 2H8MA 1UYLA 4FMTA 1TH8A 4MP7A 4GT8A 2YE5A 3OWBA 2CCTA 4E02A 3U2DA 4MB9A 4FCPA 4CWOA 4EM7A 4YKZA 2E0AA 2YK2A 3VHCA 3GIFA 3T0HA 2EXLA 3QTFA 4ASFA 2IWUA 2XDLA 1BKNA 3HYYA 2Q8IA 5CF0A 4GGLA 3DGEA 3INXA 2YKIA 2WI4A 3NMQA 2YEDA 3OWDA 2Q8GA 5FNFA 1YSRA 4GFNA 2XDSA 4FPPA 3KE6A 2YE3A 4EEHA 2XDKA 1UYGA 1YETA 2VCJA 2VW5A 1AM1A 3Q5JA 4URMA 4LWEA 3B28A 3R4PA 3TTZA 4XE2A 4ASBA 1B62A 4L91A 2BU7A 2FXSA 4AWQA 2Q8FA 1TC0A 5M4HA 4AS9A 4HZ5A 4HY1A 4PL9A 4E00A 4EGIA 2YKJA 3HYZA 1KZNA 3FT5A 4EFTA 2YEBA 5BODA 3VHAA 2YE9A 4DUHA 3WQ9A 4UROA 4YKQA 3FV5A 1AH6A 3MNRP 3RLPA 2YE2A 4XC0A 3EHHA 4CWPA 2O1WA 2O1VA 3U2KA 1UY6A 4I3HA 1I5AA 2YEFA 4MPNA 3U67A 4LWFA 2YEEA 4Q20A 5M4EA 2XX4A 1ZWHA 1BXDA 2QF6A 3OPDA 4BQJA 4O04A 4CWQA 4W7TA 3TZ4A 2BSMA 4BIZA 4DZYA 1AH8A 3EHJA 3R4NA 2CCSA 2JKIA 4XIRA 4BAEA 4XKAA 1H7SA 2WI7A 1QY8A 1NHIA 4FCRA 5M4KA 1YS3A 2GQPA 1Y8OA 2WI3A 4H7QA 4NH9A 4O09A 3INWA 2YJWA 2Q8HA 2YEHA 2BT0A 2YE4A 4R3MA 4ASGA 4YKWA 5F3KA 2BU6A 1NHJA 2UWDA 2CCUA 4CE3A 1UYEA 2ZBKB 3G7EA 3B25A 2FWYA 3D2RA 2ESAA 2CGFA 2YE7A 1US7A 2ZDYA 1EI1A 4XCJA 4URLA 1QZRA 1I5DA 1Z5AA 4V25A 2XX5A 4KFGA 5D6QA 3LNUA 5M4MA 3G75A 2XJJA 4NH8A 3ZXQA 3HHUA 2BYHA 1YC3A 5BOCA 2WEPA 3A0TA 4O0BA 2HKJA 4X9LA 3CGYA 1GKZA 1MX0A 4U7NA 4XIQA 1Y8NA 3K60A 4CWTA 3BM9A 3SL2A 2QFOA 2XHXA 3TZ2A 3H80A 4HY6A 4GQTA 4PRVA 1UYIA 2YECA 3D0BA 3G7BA 3C11A 1Y4UA 4L93A 4QPJA 4CWFA 4L90A 3TZ0A 4BIUA 3VHDA 2XJXA 2YE8A 4HXZA 2HG1A 3Q5KA 2ZDXA 2BU5A 1B63A 2BU8A 2Q2EB 2XDXA 4O05A 1UYMA 2AKPA 3A0WA 3ZKDA 1I5BA 3ZXOA 4EFUA 1AMWA 3R91A 2YEGA 4L8ZA 4R1FA 1UYKA 2XHTA 4LWHA 1OSFA 4JAVA 2XHRA 1H7UA 2YKCA 3OW6A 1R62A 4V26A 4YKYA 4KQVA 1YSZA 2BYIA 4GEEA 2BU2A 5CPHA 2YI7A 2PNRA 4KSHA 1UY7A 1S16A 2XABA 4YKTA 4XIPA 3GIGB 2YI0A 5IN9A 4CE1A 2YKEA 3CGZA 5FNCA 5D6PA 5L3JA 2IORA 3D36A 2QG2A 4BQGA 3HZ5A 2YGEA 4XTJA 4ZKIA 3B26A 5D7RA 2BZ5A 3K98A 5FWKA 2XX2A 1YC1A 2IWSA 4R3AA 3ZM7A 3K97A 2K5BA 1ZW9A 2XK2A 1Y4SA 4H85A 3GIGA 1YT1A 4XCLA 1MU5A 4K4OA 3FT8A 4U7OA 2YEIA 3QDDA 1ZXMA 4JQLA 4KSGA 5J6AA 3RLRA 1QYEA 2IWXA 2WI1A 4LWGA 3PEHA 4AWPA 2VCIA 2WI6A 4O07A 3O2FA 1YT0A 5FNDA 2GFDA 4YKRA 1YC4A 2YGFA 4P8OA 3LPSA 4B6CA 1GJVA 3OMUA 1JM6A 3EHGA 1I59A 5C93A 3JZ3A 1A4HA 5IDJA 2IOQA 4NH7A 3WHAA 2CG9A 2FYPA 4CWNA 4E01A 5M4NA 3VADA 5D7DA 4URNA 2YKBA 2QG0A 2VWCA 2CH4A 2IOPA 1BGQA 3H4LA 4H81A 2WI2A 1YESA
chains in the Genus database with same CATH superfamily
2YK9A 4LP0A 3RLQA 4MP2A 2BTZA 1UYDA 4JASA 5F5RA 2JJCA 3CRKA 4B7PA 2YE6A 4KTNA 1YERA 3B27A 4WUCA 3Q5LA 3PEJA 3O6OA 4YKUA 5J71A 3RKZA 1Z5BA 4ZVIA 2YEJA 1GKXA 5CTYA 3A0XA 5CTUA 1PVGA 1EA6A 1BYQA 4BXIA 4HYMA 3K99A 4L94A 1ZXNA 1U0ZA 1TIDA 2YEAA 4JAUA 4CWRA 2FWZA 3R4MA 2O1UA 4XDMA 4XD8A 1Y8PA 3A0YA 3A0ZA 2H55A 1Z5CA 3GIEA 4PU9A 5CTXA 4YKXA 2XDUA 2ZKJA 1I58A 3TZ5A 2HHIA 2C1IA 1THNA 4WUDA 2XD6A 4HZ0A 1UY8A 2C2AA 2WEQA 4MPCA 3A0RA 4EGKA 3T1KA 5GGZA 5D7CA 3O0IA 4HYPA 3R92A 1YT2A 1UYCA 3R4OA 1L0OA 4QPKA 3ZKBA 4P7AA 3EKRA 2YI6A 4EGHA 1TBWA 2BREA 1NHHA 3CWVA 3BMYA 2YGAA 1Z59A 3HZ1A 2XJGA 2BRCA 4HXWA 5M4PA 4LPBA 4XITA 1UY9A 3T10A 4XKOA 3IEDA 3EKOA 3TUHA 4WUBA 3CRLA 4MOTA 2YJXA 4CE2A 4FCQA 2FTKA 1ID0A 4PRXA 4LWIA 3T0ZA 2WERA 1B3QA 4KP4A 1S14A 4AWOA 1U2OA 3T2SA 5IDMA 3HEKA 2HCHA 4MBCA 2YI5A 5CTWA 3C0EA 4CWSA 1UYHA 4EMVA 1TC6A 1KIJA 4I5SA 2WI5A 1I5CA 1AJ6A 1TILA 4U93A 4MPEA 4GCZA 3B24A 4XKKA 4ASAA 2XCMA 1UYFA 3EHFA 2H8MA 1UYLA 4FMTA 1TH8A 3S5TA 4MP7A 4GT8A 2YE5A 3OWBA 2CCTA 4E02A 3U2DA 4MB9A 4FCPA 4CWOA 4EM7A 4YKZA 2E0AA 2YK2A 3VHCA 3GIFA 3T0HA 2EXLA 3QTFA 4ASFA 2IWUA 2XDLA 1BKNA 3HYYA 2Q8IA 5CF0A 4GGLA 3DGEA 3INXA 2YKIA 2WI4A 3NMQA 2YEDA 3OWDA 2Q8GA 5FNFA 1YSRA 4GFNA 2XDSA 4FPPA 3KE6A 2YE3A 4EEHA 2XDKA 1UYGA 1YETA 2VCJA 2VW5A 1AM1A 3Q5JA 4URMA 4LWEA 3B28A 3R4PA 3TTZA 4XE2A 4ASBA 1B62A 4L91A 2BU7A 2FXSA 4AWQA 2Q8FA 1TC0A 5M4HA 4AS9A 4HZ5A 4HY1A 4PL9A 4E00A 4EGIA 2YKJA 3HYZA 1KZNA 3FT5A 4EFTA 2YEBA 5BODA 1F51A 3VHAA 2YE9A 4DUHA 3WQ9A 4UROA 4YKQA 3FV5A 1AH6A 3MNRP 3RLPA 2YE2A 4XC0A 3EHHA 2C1GA 4CWPA 2O1WA 2O1VA 3U2KA 1UY6A 4I3HA 1I5AA 2YEFA 4MPNA 3U67A 4LWFA 2YEEA 4Q20A 5M4EA 2XX4A 1ZWHA 1BXDA 2QF6A 3OPDA 4BQJA 4O04A 4CWQA 4W7TA 3TZ4A 2BSMA 4BIZA 4DZYA 1AH8A 3EHJA 3R4NA 2CCSA 2JKIA 4XIRA 4BAEA 4XKAA 1H7SA 2WI7A 1QY8A 1NHIA 4FCRA 5M4KA 1YS3A 2GQPA 1Y8OA 2WI3A 4H7QA 4NH9A 4O09A 3INWA 2YJWA 2Q8HA 2YEHA 5JENA 2BT0A 2YE4A 4R3MA 4ASGA 4YKWA 5F3KA 2BU6A 1NHJA 2UWDA 2CCUA 3CYGA 4CE3A 1UYEA 2ZBKB 3G7EA 3B25A 2FWYA 3D2RA 2ESAA 2CGFA 2YE7A 1US7A 2ZDYA 1EI1A 4XCJA 4URLA 1QZRA 1I5DA 1Z5AA 4V25A 2XX5A 4KFGA 5D6QA 3LNUA 5M4MA 3G75A 2XJJA 4NH8A 3ZXQA 3HHUA 2BYHA 1YC3A 5BOCA 2WEPA 3A0TA 4O0BA 2HKJA 4X9LA 3CGYA 1GKZA 1MX0A 4U7NA 4XIQA 1Y8NA 3K60A 4CWTA 3BM9A 3SL2A 2QFOA 2XHXA 3TZ2A 3H80A 4HY6A 4GQTA 4PRVA 1UYIA 2YECA 3D0BA 3G7BA 3C11A 1Y4UA 4L93A 4QPJA 4CWFA 4L90A 3TZ0A 4BIUA 3VHDA 2XJXA 2YE8A 4HXZA 2HG1A 3Q5KA 2ZDXA 2BU5A 4E72A 1B63A 2BU8A 2Q2EB 2XDXA 4O05A 1UYMA 2AKPA 3A0WA 3ZKDA 1I5BA 3ZXOA 4EFUA 1AMWA 3R91A 2YEGA 4L8ZA 4R1FA 1UYKA 2XHTA 4LWHA 1OSFA 4JAVA 2XHRA 1H7UA 2YKCA 3OW6A 1R62A 4V26A 4YKYA 4KQVA 1YSZA 2BYIA 4GEEA 2BU2A 1IXMA 5CPHA 2YI7A 2PNRA 4KSHA 1UY7A 1S16A 2XABA 4YKTA 4XIPA 3GIGB 2YI0A 5IN9A 4CE1A 2YKEA 3CGZA 5FNCA 5D6PA 5L3JA 2IORA 3D36A 2QG2A 4BQGA 3HZ5A 2YGEA 4XTJA 4ZKIA 3B26A 5D7RA 2BZ5A 3K98A 3LMMA 5FWKA 2XX2A 1YC1A 2IWSA 4R3AA 3ZM7A 3K97A 2K5BA 1ZW9A 2XK2A 1Y4SA 4H85A 3GIGA 1YT1A 4XCLA 1MU5A 4K4OA 3FT8A 4U7OA 2YEIA 3QDDA 1ZXMA 4JQLA 4KSGA 5J6AA 3RLRA 1QYEA 2IWXA 2WI1A 4LWGA 3PEHA 4AWPA 2VCIA 2WI6A 4O07A 3O2FA 1YT0A 5FNDA 2GFDA 4YKRA 1YC4A 2YGFA 4P8OA 3LPSA 4B6CA 1GJVA 3OMUA 1JM6A 3EHGA 1I59A 5C93A 3JZ3A 1A4HA 5IDJA 2IOQA 4NH7A 3WHAA 2CG9A 2FYPA 4CWNA 4E01A 5M4NA 3VADA 5D7DA 4URNA 2YKBA 2QG0A 2VWCA 2CH4A 2IOPA 1BGQA 3H4LA 4H81A 2WI2A 1YESA
chains in the Genus database with same CATH topology
2YK9A 4LP0A 3RLQA 4MP2A 2BTZA 1UYDA 4JASA 5F5RA 2JJCA 3CRKA 4B7PA 2YE6A 4KTNA 1YERA 3B27A 4WUCA 3Q5LA 3PEJA 3O6OA 4YKUA 5J71A 3RKZA 1Z5BA 4ZVIA 2YEJA 1GKXA 5CTYA 3A0XA 5CTUA 1PVGA 1EA6A 1BYQA 4BXIA 4HYMA 3K99A 4L94A 1ZXNA 1U0ZA 1TIDA 2YEAA 4JAUA 4CWRA 2FWZA 3R4MA 2O1UA 4XDMA 4XD8A 1Y8PA 3A0YA 3A0ZA 2H55A 1Z5CA 3GIEA 4PU9A 5CTXA 4YKXA 2XDUA 2ZKJA 1I58A 3TZ5A 1THNA 4WUDA 2XD6A 4HZ0A 1UY8A 2C2AA 2WEQA 4MPCA 3A0RA 4EGKA 3T1KA 5GGZA 5D7CA 3O0IA 4HYPA 3R92A 1YT2A 1UYCA 3R4OA 1L0OA 4QPKA 3ZKBA 4P7AA 3EKRA 2YI6A 4EGHA 1TBWA 2BREA 1NHHA 3CWVA 3BMYA 2YGAA 1Z59A 3HZ1A 2XJGA 2BRCA 4HXWA 5M4PA 4LPBA 4XITA 1UY9A 3T10A 4XKOA 3IEDA 3EKOA 3TUHA 4WUBA 3CRLA 4MOTA 2YJXA 4CE2A 4FCQA 1ID0A 4PRXA 4LWIA 3T0ZA 2WERA 1B3QA 4KP4A 1S14A 4AWOA 1U2OA 3T2SA 5IDMA 3HEKA 2HCHA 4MBCA 2YI5A 5CTWA 3C0EA 4CWSA 1UYHA 4EMVA 1TC6A 1KIJA 4I5SA 2WI5A 1I5CA 1AJ6A 1TILA 4U93A 4MPEA 4GCZA 3B24A 4XKKA 4ASAA 2XCMA 1UYFA 3EHFA 2H8MA 1UYLA 4FMTA 1TH8A 4MP7A 4GT8A 2YE5A 3OWBA 2CCTA 4E02A 3U2DA 4MB9A 4FCPA 4CWOA 4EM7A 4YKZA 2E0AA 2YK2A 3VHCA 3GIFA 3T0HA 2EXLA 3QTFA 4ASFA 2IWUA 2XDLA 1BKNA 3HYYA 2Q8IA 5CF0A 4GGLA 3DGEA 3INXA 2YKIA 2WI4A 3NMQA 2YEDA 3OWDA 2Q8GA 5FNFA 1YSRA 4GFNA 2XDSA 4FPPA 3KE6A 2YE3A 4EEHA 2XDKA 1UYGA 1YETA 2VCJA 2VW5A 1AM1A 3Q5JA 4URMA 4LWEA 3B28A 3R4PA 3TTZA 4XE2A 4ASBA 1B62A 4L91A 2BU7A 2FXSA 4AWQA 2Q8FA 1TC0A 5M4HA 4AS9A 4HZ5A 4HY1A 4PL9A 4E00A 4EGIA 2YKJA 3HYZA 1KZNA 3FT5A 4EFTA 2YEBA 5BODA 3VHAA 2YE9A 4DUHA 3WQ9A 4UROA 4YKQA 3FV5A 1AH6A 3MNRP 3RLPA 2YE2A 4XC0A 3EHHA 4CWPA 2O1WA 2O1VA 3U2KA 1UY6A 4I3HA 1I5AA 2YEFA 4MPNA 3U67A 4LWFA 2YEEA 4Q20A 5M4EA 2XX4A 1ZWHA 1BXDA 2QF6A 3OPDA 4BQJA 4O04A 4CWQA 4W7TA 3TZ4A 2BSMA 4BIZA 4DZYA 1AH8A 3EHJA 3R4NA 2CCSA 2JKIA 4XIRA 4BAEA 4XKAA 1H7SA 2WI7A 1QY8A 1NHIA 4FCRA 5M4KA 1YS3A 2GQPA 1Y8OA 2WI3A 4H7QA 4NH9A 4O09A 3INWA 2YJWA 2Q8HA 2YEHA 2BT0A 2YE4A 4R3MA 4ASGA 4YKWA 5F3KA 2BU6A 1NHJA 2UWDA 2CCUA 4CE3A 1UYEA 2ZBKB 3G7EA 3B25A 2FWYA 3D2RA 2ESAA 2CGFA 2YE7A 1US7A 2ZDYA 1EI1A 4XCJA 4URLA 1QZRA 1I5DA 1Z5AA 4V25A 2XX5A 4KFGA 5D6QA 3LNUA 5M4MA 3G75A 2XJJA 4NH8A 3ZXQA 3HHUA 2BYHA 1YC3A 5BOCA 2WEPA 3A0TA 4O0BA 2HKJA 4X9LA 3CGYA 1GKZA 1MX0A 4U7NA 4XIQA 1Y8NA 3K60A 4CWTA 3BM9A 3SL2A 2QFOA 2XHXA 3TZ2A 3H80A 4HY6A 4GQTA 4PRVA 1UYIA 2YECA 3D0BA 3G7BA 3C11A 1Y4UA 4L93A 4QPJA 4CWFA 4L90A 3TZ0A 4BIUA 3VHDA 2XJXA 2YE8A 4HXZA 2HG1A 3Q5KA 2ZDXA 2BU5A 1B63A 2BU8A 2Q2EB 2XDXA 4O05A 1UYMA 2AKPA 3A0WA 3ZKDA 1I5BA 3ZXOA 4EFUA 1AMWA 3R91A 2YEGA 4L8ZA 4R1FA 1UYKA 2XHTA 4LWHA 1OSFA 4JAVA 2XHRA 1H7UA 2YKCA 3OW6A 1R62A 4V26A 4YKYA 4KQVA 1YSZA 2BYIA 4GEEA 2BU2A 5CPHA 2YI7A 2PNRA 4KSHA 1UY7A 1S16A 2XABA 4YKTA 4XIPA 3GIGB 2YI0A 5IN9A 4CE1A 2YKEA 3CGZA 5FNCA 5D6PA 5L3JA 2IORA 3D36A 2QG2A 4BQGA 3HZ5A 2YGEA 4XTJA 4ZKIA 3B26A 5D7RA 2BZ5A 3K98A 5FWKA 2XX2A 1YC1A 2IWSA 4R3AA 3ZM7A 3K97A 2K5BA 1ZW9A 2XK2A 1Y4SA 4H85A 3GIGA 1YT1A 4XCLA 1MU5A 4K4OA 3FT8A 4U7OA 2YEIA 3QDDA 1ZXMA 4JQLA 4KSGA 5J6AA 3RLRA 1QYEA 2IWXA 2WI1A 4LWGA 3PEHA 4AWPA 2VCIA 2WI6A 4O07A 3O2FA 1YT0A 5FNDA 2GFDA 4YKRA 1YC4A 2YGFA 4P8OA 3LPSA 4B6CA 1GJVA 3OMUA 1JM6A 3EHGA 1I59A 5C93A 3JZ3A 1A4HA 5IDJA 2IOQA 4NH7A 3WHAA 2CG9A 2FYPA 4CWNA 4E01A 5M4NA 3VADA 5D7DA 4URNA 2YKBA 2QG0A 2VWCA 2CH4A 2IOPA 1BGQA 3H4LA 4H81A 2WI2A 1YESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK9 A;  4LP0 A;  3RLQ A;  4MP2 A;  2BTZ A;  1UYD A;  4JAS A;  5F5R A;  2JJC A;  3CRK A;  4B7P A;  2YE6 A;  4KTN A;  1YER A;  3B27 A;  4WUC A;  3Q5L A;  3PEJ A;  3O6O A;  4YKU A;  5J71 A;  3RKZ A;  1Z5B A;  4ZVI A;  2YEJ A;  1GKX A;  5CTY A;  3A0X A;  5CTU A;  1PVG A;  1EA6 A;  1BYQ A;  4BXI A;  4HYM A;  3K99 A;  4L94 A;  1ZXN A;  1U0Z A;  1TID A;  2YEA A;  4JAU A;  4CWR A;  2FWZ A;  3R4M A;  2O1U A;  4XDM A;  4XD8 A;  1Y8P A;  3A0Y A;  3A0Z A;  2H55 A;  1Z5C A;  3GIE A;  4PU9 A;  5CTX A;  4YKX A;  2XDU A;  2ZKJ A;  1I58 A;  3TZ5 A;  1THN A;  4WUD A;  2XD6 A;  4HZ0 A;  1UY8 A;  2C2A A;  2WEQ A;  4MPC A;  3A0R A;  4EGK A;  3T1K A;  5GGZ A;  5D7C A;  3O0I A;  4HYP A;  3R92 A;  1YT2 A;  1UYC A;  3R4O A;  1L0O A;  4QPK A;  3ZKB A;  4P7A A;  3EKR A;  2YI6 A;  4EGH A;  1TBW A;  2BRE A;  1NHH A;  3CWV A;  3BMY A;  2YGA A;  1Z59 A;  3HZ1 A;  2XJG A;  2BRC A;  4HXW A;  5M4P A;  4LPB A;  4XIT A;  1UY9 A;  3T10 A;  4XKO A;  3IED A;  3EKO A;  3TUH A;  4WUB A;  3CRL A;  4MOT A;  2YJX A;  4CE2 A;  4FCQ A;  1ID0 A;  4PRX A;  4LWI A;  3T0Z A;  2WER A;  1B3Q A;  4KP4 A;  1S14 A;  4AWO A;  1U2O A;  3T2S A;  5IDM A;  3HEK A;  2HCH A;  4MBC A;  2YI5 A;  5CTW A;  3C0E A;  4CWS A;  1UYH A;  4EMV A;  1TC6 A;  1KIJ A;  4I5S A;  2WI5 A;  1I5C A;  1AJ6 A;  1TIL A;  4U93 A;  4MPE A;  4GCZ A;  3B24 A;  4XKK A;  4ASA A;  2XCM A;  1UYF A;  3EHF A;  2H8M A;  1UYL A;  4FMT A;  1TH8 A;  4MP7 A;  4GT8 A;  2YE5 A;  3OWB A;  2CCT A;  4E02 A;  3U2D A;  4MB9 A;  4FCP A;  4CWO A;  4EM7 A;  4YKZ A;  2E0A A;  2YK2 A;  3VHC A;  3GIF A;  3T0H A;  2EXL A;  3QTF A;  4ASF A;  2IWU A;  2XDL A;  1BKN A;  3HYY A;  2Q8I A;  5CF0 A;  4GGL A;  3DGE A;  3INX A;  2YKI A;  2WI4 A;  3NMQ A;  2YED A;  3OWD A;  2Q8G A;  5FNF A;  1YSR A;  4GFN A;  2XDS A;  4FPP A;  3KE6 A;  2YE3 A;  4EEH A;  2XDK A;  1UYG A;  1YET A;  2VCJ A;  2VW5 A;  1AM1 A;  3Q5J A;  4URM A;  4LWE A;  3B28 A;  3R4P A;  3TTZ A;  4XE2 A;  4ASB A;  1B62 A;  4L91 A;  2BU7 A;  2FXS A;  4AWQ A;  2Q8F A;  1TC0 A;  5M4H A;  4AS9 A;  4HZ5 A;  4HY1 A;  4PL9 A;  4E00 A;  4EGI A;  2YKJ A;  3HYZ A;  1KZN A;  3FT5 A;  4EFT A;  2YEB A;  5BOD A;  3VHA A;  2YE9 A;  4DUH A;  3WQ9 A;  4URO A;  4YKQ A;  3FV5 A;  1AH6 A;  3MNR P;  3RLP A;  2YE2 A;  4XC0 A;  3EHH A;  4CWP A;  2O1W A;  2O1V A;  3U2K A;  1UY6 A;  4I3H A;  1I5A A;  2YEF A;  4MPN A;  3U67 A;  4LWF A;  2YEE A;  4Q20 A;  5M4E A;  2XX4 A;  1ZWH A;  1BXD A;  2QF6 A;  3OPD A;  4BQJ A;  4O04 A;  4CWQ A;  4W7T A;  3TZ4 A;  2BSM A;  4BIZ A;  4DZY A;  1AH8 A;  3EHJ A;  3R4N A;  2CCS A;  2JKI A;  4XIR A;  4BAE A;  4XKA A;  1H7S A;  2WI7 A;  1QY8 A;  1NHI A;  4FCR A;  5M4K A;  1YS3 A;  2GQP A;  1Y8O A;  2WI3 A;  4H7Q A;  4NH9 A;  4O09 A;  3INW A;  2YJW A;  2Q8H A;  2YEH A;  2BT0 A;  2YE4 A;  4R3M A;  4ASG A;  4YKW A;  5F3K A;  2BU6 A;  1NHJ A;  2UWD A;  2CCU A;  4CE3 A;  1UYE A;  2ZBK B;  3G7E A;  3B25 A;  2FWY A;  3D2R A;  2ESA A;  2CGF A;  2YE7 A;  1US7 A;  2ZDY A;  1EI1 A;  4XCJ A;  4URL A;  1QZR A;  1I5D A;  1Z5A A;  4V25 A;  2XX5 A;  4KFG A;  5D6Q A;  3LNU A;  5M4M A;  3G75 A;  2XJJ A;  4NH8 A;  3ZXQ A;  3HHU A;  2BYH A;  1YC3 A;  5BOC A;  2WEP A;  3A0T A;  4O0B A;  2HKJ A;  4X9L A;  3CGY A;  1GKZ A;  1MX0 A;  4U7N A;  4XIQ A;  1Y8N A;  3K60 A;  4CWT A;  3BM9 A;  3SL2 A;  2QFO A;  2XHX A;  3TZ2 A;  3H80 A;  4HY6 A;  4GQT A;  4PRV A;  1UYI A;  2YEC A;  3D0B A;  3G7B A;  3C11 A;  1Y4U A;  4L93 A;  4QPJ A;  4CWF A;  4L90 A;  3TZ0 A;  4BIU A;  3VHD A;  2XJX A;  2YE8 A;  4HXZ A;  2HG1 A;  3Q5K A;  2ZDX A;  2BU5 A;  1B63 A;  2BU8 A;  2Q2E B;  2XDX A;  4O05 A;  1UYM A;  2AKP A;  3A0W A;  3ZKD A;  1I5B A;  3ZXO A;  4EFU A;  1AMW A;  3R91 A;  2YEG A;  4L8Z A;  4R1F A;  1UYK A;  2XHT A;  4LWH A;  1OSF A;  4JAV A;  2XHR A;  1H7U A;  2YKC A;  3OW6 A;  1R62 A;  4V26 A;  4YKY A;  4KQV A;  1YSZ A;  2BYI A;  4GEE A;  2BU2 A;  5CPH A;  2YI7 A;  2PNR A;  4KSH A;  1UY7 A;  1S16 A;  2XAB A;  4YKT A;  4XIP A;  3GIG B;  2YI0 A;  5IN9 A;  4CE1 A;  2YKE A;  3CGZ A;  5FNC A;  5D6P A;  5L3J A;  2IOR A;  3D36 A;  2QG2 A;  4BQG A;  3HZ5 A;  2YGE A;  4XTJ A;  4ZKI A;  3B26 A;  5D7R A;  2BZ5 A;  3K98 A;  5FWK A;  2XX2 A;  1YC1 A;  2IWS A;  4R3A A;  3ZM7 A;  3K97 A;  2K5B A;  1ZW9 A;  2XK2 A;  1Y4S A;  4H85 A;  3GIG A;  1YT1 A;  4XCL A;  1MU5 A;  4K4O A;  3FT8 A;  4U7O A;  2YEI A;  3QDD A;  1ZXM A;  4JQL A;  4KSG A;  5J6A A;  3RLR A;  1QYE A;  2IWX A;  2WI1 A;  4LWG A;  3PEH A;  4AWP A;  2VCI A;  2WI6 A;  4O07 A;  3O2F A;  1YT0 A;  5FND A;  2GFD A;  4YKR A;  1YC4 A;  2YGF A;  4P8O A;  3LPS A;  4B6C A;  1GJV A;  3OMU A;  1JM6 A;  3EHG A;  1I59 A;  5C93 A;  3JZ3 A;  1A4H A;  5IDJ A;  2IOQ A;  4NH7 A;  3WHA A;  2CG9 A;  2FYP A;  4CWN A;  4E01 A;  5M4N A;  3VAD A;  5D7D A;  4URN A;  2YKB A;  2QG0 A;  2VWC A;  2CH4 A;  2IOP A;  1BGQ A;  3H4L A;  4H81 A;  2WI2 A;  1YES A; 
#chains in the Genus database with same CATH topology
 2YK9 A;  4LP0 A;  3RLQ A;  4MP2 A;  2BTZ A;  1UYD A;  4JAS A;  5F5R A;  2JJC A;  3CRK A;  4B7P A;  2YE6 A;  4KTN A;  1YER A;  3B27 A;  4WUC A;  3Q5L A;  3PEJ A;  3O6O A;  4YKU A;  5J71 A;  3RKZ A;  1Z5B A;  4ZVI A;  2YEJ A;  1GKX A;  5CTY A;  3A0X A;  5CTU A;  1PVG A;  1EA6 A;  1BYQ A;  4BXI A;  4HYM A;  3K99 A;  4L94 A;  1ZXN A;  1U0Z A;  1TID A;  2YEA A;  4JAU A;  4CWR A;  2FWZ A;  3R4M A;  2O1U A;  4XDM A;  4XD8 A;  1Y8P A;  3A0Y A;  3A0Z A;  2H55 A;  1Z5C A;  3GIE A;  4PU9 A;  5CTX A;  4YKX A;  2XDU A;  2ZKJ A;  1I58 A;  3TZ5 A;  2HHI A;  2C1I A;  1THN A;  4WUD A;  2XD6 A;  4HZ0 A;  1UY8 A;  2C2A A;  2WEQ A;  4MPC A;  3A0R A;  4EGK A;  3T1K A;  5GGZ A;  5D7C A;  3O0I A;  4HYP A;  3R92 A;  1YT2 A;  1UYC A;  3R4O A;  1L0O A;  4QPK A;  3ZKB A;  4P7A A;  3EKR A;  2YI6 A;  4EGH A;  1TBW A;  2BRE A;  1NHH A;  3CWV A;  3BMY A;  2YGA A;  1Z59 A;  3HZ1 A;  2XJG A;  2BRC A;  4HXW A;  5M4P A;  4LPB A;  4XIT A;  1UY9 A;  3T10 A;  4XKO A;  3IED A;  3EKO A;  3TUH A;  4WUB A;  3CRL A;  4MOT A;  2YJX A;  4CE2 A;  4FCQ A;  2FTK A;  1ID0 A;  4PRX A;  4LWI A;  3T0Z A;  2WER A;  1B3Q A;  4KP4 A;  1S14 A;  4AWO A;  1U2O A;  3T2S A;  5IDM A;  3HEK A;  2HCH A;  4MBC A;  2YI5 A;  5CTW A;  3C0E A;  4CWS A;  1UYH A;  4EMV A;  1TC6 A;  1KIJ A;  4I5S A;  2WI5 A;  1I5C A;  1AJ6 A;  1TIL A;  4U93 A;  4MPE A;  4GCZ A;  3B24 A;  4XKK A;  4ASA A;  2XCM A;  1UYF A;  3EHF A;  2H8M A;  1UYL A;  4FMT A;  1TH8 A;  3S5T A;  4MP7 A;  4GT8 A;  2YE5 A;  3OWB A;  2CCT A;  4E02 A;  3U2D A;  4MB9 A;  4FCP A;  4CWO A;  4EM7 A;  4YKZ A;  2E0A A;  2YK2 A;  3VHC A;  3GIF A;  3T0H A;  2EXL A;  3QTF A;  4ASF A;  2IWU A;  2XDL A;  1BKN A;  3HYY A;  2Q8I A;  5CF0 A;  4GGL A;  3DGE A;  3INX A;  2YKI A;  2WI4 A;  3NMQ A;  2YED A;  3OWD A;  2Q8G A;  5FNF A;  1YSR A;  4GFN A;  2XDS A;  4FPP A;  3KE6 A;  2YE3 A;  4EEH A;  2XDK A;  1UYG A;  1YET A;  2VCJ A;  2VW5 A;  1AM1 A;  3Q5J A;  4URM A;  4LWE A;  3B28 A;  3R4P A;  3TTZ A;  4XE2 A;  4ASB A;  1B62 A;  4L91 A;  2BU7 A;  2FXS A;  4AWQ A;  2Q8F A;  1TC0 A;  5M4H A;  4AS9 A;  4HZ5 A;  4HY1 A;  4PL9 A;  4E00 A;  4EGI A;  2YKJ A;  3HYZ A;  1KZN A;  3FT5 A;  4EFT A;  2YEB A;  5BOD A;  1F51 A;  3VHA A;  2YE9 A;  4DUH A;  3WQ9 A;  4URO A;  4YKQ A;  3FV5 A;  1AH6 A;  3MNR P;  3RLP A;  2YE2 A;  4XC0 A;  3EHH A;  2C1G A;  4CWP A;  2O1W A;  2O1V A;  3U2K A;  1UY6 A;  4I3H A;  1I5A A;  2YEF A;  4MPN A;  3U67 A;  4LWF A;  2YEE A;  4Q20 A;  5M4E A;  2XX4 A;  1ZWH A;  1BXD A;  2QF6 A;  3OPD A;  4BQJ A;  4O04 A;  4CWQ A;  4W7T A;  3TZ4 A;  2BSM A;  4BIZ A;  4DZY A;  1AH8 A;  3EHJ A;  3R4N A;  2CCS A;  2JKI A;  4XIR A;  4BAE A;  4XKA A;  1H7S A;  2WI7 A;  1QY8 A;  1NHI A;  4FCR A;  5M4K A;  1YS3 A;  2GQP A;  1Y8O A;  2WI3 A;  4H7Q A;  4NH9 A;  4O09 A;  3INW A;  2YJW A;  2Q8H A;  2YEH A;  5JEN A;  2BT0 A;  2YE4 A;  4R3M A;  4ASG A;  4YKW A;  5F3K A;  2BU6 A;  1NHJ A;  2UWD A;  2CCU A;  3CYG A;  4CE3 A;  1UYE A;  2ZBK B;  3G7E A;  3B25 A;  2FWY A;  3D2R A;  2ESA A;  2CGF A;  2YE7 A;  1US7 A;  2ZDY A;  1EI1 A;  4XCJ A;  4URL A;  1QZR A;  1I5D A;  1Z5A A;  4V25 A;  2XX5 A;  4KFG A;  5D6Q A;  3LNU A;  5M4M A;  3G75 A;  2XJJ A;  4NH8 A;  3ZXQ A;  3HHU A;  2BYH A;  1YC3 A;  5BOC A;  2WEP A;  3A0T A;  4O0B A;  2HKJ A;  4X9L A;  3CGY A;  1GKZ A;  1MX0 A;  4U7N A;  4XIQ A;  1Y8N A;  3K60 A;  4CWT A;  3BM9 A;  3SL2 A;  2QFO A;  2XHX A;  3TZ2 A;  3H80 A;  4HY6 A;  4GQT A;  4PRV A;  1UYI A;  2YEC A;  3D0B A;  3G7B A;  3C11 A;  1Y4U A;  4L93 A;  4QPJ A;  4CWF A;  4L90 A;  3TZ0 A;  4BIU A;  3VHD A;  2XJX A;  2YE8 A;  4HXZ A;  2HG1 A;  3Q5K A;  2ZDX A;  2BU5 A;  4E72 A;  1B63 A;  2BU8 A;  2Q2E B;  2XDX A;  4O05 A;  1UYM A;  2AKP A;  3A0W A;  3ZKD A;  1I5B A;  3ZXO A;  4EFU A;  1AMW A;  3R91 A;  2YEG A;  4L8Z A;  4R1F A;  1UYK A;  2XHT A;  4LWH A;  1OSF A;  4JAV A;  2XHR A;  1H7U A;  2YKC A;  3OW6 A;  1R62 A;  4V26 A;  4YKY A;  4KQV A;  1YSZ A;  2BYI A;  4GEE A;  2BU2 A;  1IXM A;  5CPH A;  2YI7 A;  2PNR A;  4KSH A;  1UY7 A;  1S16 A;  2XAB A;  4YKT A;  4XIP A;  3GIG B;  2YI0 A;  5IN9 A;  4CE1 A;  2YKE A;  3CGZ A;  5FNC A;  5D6P A;  5L3J A;  2IOR A;  3D36 A;  2QG2 A;  4BQG A;  3HZ5 A;  2YGE A;  4XTJ A;  4ZKI A;  3B26 A;  5D7R A;  2BZ5 A;  3K98 A;  3LMM A;  5FWK A;  2XX2 A;  1YC1 A;  2IWS A;  4R3A A;  3ZM7 A;  3K97 A;  2K5B A;  1ZW9 A;  2XK2 A;  1Y4S A;  4H85 A;  3GIG A;  1YT1 A;  4XCL A;  1MU5 A;  4K4O A;  3FT8 A;  4U7O A;  2YEI A;  3QDD A;  1ZXM A;  4JQL A;  4KSG A;  5J6A A;  3RLR A;  1QYE A;  2IWX A;  2WI1 A;  4LWG A;  3PEH A;  4AWP A;  2VCI A;  2WI6 A;  4O07 A;  3O2F A;  1YT0 A;  5FND A;  2GFD A;  4YKR A;  1YC4 A;  2YGF A;  4P8O A;  3LPS A;  4B6C A;  1GJV A;  3OMU A;  1JM6 A;  3EHG A;  1I59 A;  5C93 A;  3JZ3 A;  1A4H A;  5IDJ A;  2IOQ A;  4NH7 A;  3WHA A;  2CG9 A;  2FYP A;  4CWN A;  4E01 A;  5M4N A;  3VAD A;  5D7D A;  4URN A;  2YKB A;  2QG0 A;  2VWC A;  2CH4 A;  2IOP A;  1BGQ A;  3H4L A;  4H81 A;  2WI2 A;  1YES A; 
#chains in the Genus database with same CATH homology
 2YK9 A;  4LP0 A;  3RLQ A;  4MP2 A;  2BTZ A;  1UYD A;  4JAS A;  5F5R A;  2JJC A;  3CRK A;  4B7P A;  2YE6 A;  4KTN A;  1YER A;  3B27 A;  4WUC A;  3Q5L A;  3PEJ A;  3O6O A;  4YKU A;  5J71 A;  3RKZ A;  1Z5B A;  4ZVI A;  2YEJ A;  1GKX A;  5CTY A;  3A0X A;  5CTU A;  1PVG A;  1EA6 A;  1BYQ A;  4BXI A;  4HYM A;  3K99 A;  4L94 A;  1ZXN A;  1U0Z A;  1TID A;  2YEA A;  4JAU A;  4CWR A;  2FWZ A;  3R4M A;  2O1U A;  4XDM A;  4XD8 A;  1Y8P A;  3A0Y A;  3A0Z A;  2H55 A;  1Z5C A;  3GIE A;  4PU9 A;  5CTX A;  4YKX A;  2XDU A;  2ZKJ A;  1I58 A;  3TZ5 A;  1THN A;  4WUD A;  2XD6 A;  4HZ0 A;  1UY8 A;  2C2A A;  2WEQ A;  4MPC A;  3A0R A;  4EGK A;  3T1K A;  5GGZ A;  5D7C A;  3O0I A;  4HYP A;  3R92 A;  1YT2 A;  1UYC A;  3R4O A;  1L0O A;  4QPK A;  3ZKB A;  4P7A A;  3EKR A;  2YI6 A;  4EGH A;  1TBW A;  2BRE A;  1NHH A;  3CWV A;  3BMY A;  2YGA A;  1Z59 A;  3HZ1 A;  2XJG A;  2BRC A;  4HXW A;  5M4P A;  4LPB A;  4XIT A;  1UY9 A;  3T10 A;  4XKO A;  3IED A;  3EKO A;  3TUH A;  4WUB A;  3CRL A;  4MOT A;  2YJX A;  4CE2 A;  4FCQ A;  1ID0 A;  4PRX A;  4LWI A;  3T0Z A;  2WER A;  1B3Q A;  4KP4 A;  1S14 A;  4AWO A;  1U2O A;  3T2S A;  5IDM A;  3HEK A;  2HCH A;  4MBC A;  2YI5 A;  5CTW A;  3C0E A;  4CWS A;  1UYH A;  4EMV A;  1TC6 A;  1KIJ A;  4I5S A;  2WI5 A;  1I5C A;  1AJ6 A;  1TIL A;  4U93 A;  4MPE A;  4GCZ A;  3B24 A;  4XKK A;  4ASA A;  2XCM A;  1UYF A;  3EHF A;  2H8M A;  1UYL A;  4FMT A;  1TH8 A;  4MP7 A;  4GT8 A;  2YE5 A;  3OWB A;  2CCT A;  4E02 A;  3U2D A;  4MB9 A;  4FCP A;  4CWO A;  4EM7 A;  4YKZ A;  2E0A A;  2YK2 A;  3VHC A;  3GIF A;  3T0H A;  2EXL A;  3QTF A;  4ASF A;  2IWU A;  2XDL A;  1BKN A;  3HYY A;  2Q8I A;  5CF0 A;  4GGL A;  3DGE A;  3INX A;  2YKI A;  2WI4 A;  3NMQ A;  2YED A;  3OWD A;  2Q8G A;  5FNF A;  1YSR A;  4GFN A;  2XDS A;  4FPP A;  3KE6 A;  2YE3 A;  4EEH A;  2XDK A;  1UYG A;  1YET A;  2VCJ A;  2VW5 A;  1AM1 A;  3Q5J A;  4URM A;  4LWE A;  3B28 A;  3R4P A;  3TTZ A;  4XE2 A;  4ASB A;  1B62 A;  4L91 A;  2BU7 A;  2FXS A;  4AWQ A;  2Q8F A;  1TC0 A;  5M4H A;  4AS9 A;  4HZ5 A;  4HY1 A;  4PL9 A;  4E00 A;  4EGI A;  2YKJ A;  3HYZ A;  1KZN A;  3FT5 A;  4EFT A;  2YEB A;  5BOD A;  3VHA A;  2YE9 A;  4DUH A;  3WQ9 A;  4URO A;  4YKQ A;  3FV5 A;  1AH6 A;  3MNR P;  3RLP A;  2YE2 A;  4XC0 A;  3EHH A;  4CWP A;  2O1W A;  2O1V A;  3U2K A;  1UY6 A;  4I3H A;  1I5A A;  2YEF A;  4MPN A;  3U67 A;  4LWF A;  2YEE A;  4Q20 A;  5M4E A;  2XX4 A;  1ZWH A;  1BXD A;  2QF6 A;  3OPD A;  4BQJ A;  4O04 A;  4CWQ A;  4W7T A;  3TZ4 A;  2BSM A;  4BIZ A;  4DZY A;  1AH8 A;  3EHJ A;  3R4N A;  2CCS A;  2JKI A;  4XIR A;  4BAE A;  4XKA A;  1H7S A;  2WI7 A;  1QY8 A;  1NHI A;  4FCR A;  5M4K A;  1YS3 A;  2GQP A;  1Y8O A;  2WI3 A;  4H7Q A;  4NH9 A;  4O09 A;  3INW A;  2YJW A;  2Q8H A;  2YEH A;  2BT0 A;  2YE4 A;  4R3M A;  4ASG A;  4YKW A;  5F3K A;  2BU6 A;  1NHJ A;  2UWD A;  2CCU A;  4CE3 A;  1UYE A;  2ZBK B;  3G7E A;  3B25 A;  2FWY A;  3D2R A;  2ESA A;  2CGF A;  2YE7 A;  1US7 A;  2ZDY A;  1EI1 A;  4XCJ A;  4URL A;  1QZR A;  1I5D A;  1Z5A A;  4V25 A;  2XX5 A;  4KFG A;  5D6Q A;  3LNU A;  5M4M A;  3G75 A;  2XJJ A;  4NH8 A;  3ZXQ A;  3HHU A;  2BYH A;  1YC3 A;  5BOC A;  2WEP A;  3A0T A;  4O0B A;  2HKJ A;  4X9L A;  3CGY A;  1GKZ A;  1MX0 A;  4U7N A;  4XIQ A;  1Y8N A;  3K60 A;  4CWT A;  3BM9 A;  3SL2 A;  2QFO A;  2XHX A;  3TZ2 A;  3H80 A;  4HY6 A;  4GQT A;  4PRV A;  1UYI A;  2YEC A;  3D0B A;  3G7B A;  3C11 A;  1Y4U A;  4L93 A;  4QPJ A;  4CWF A;  4L90 A;  3TZ0 A;  4BIU A;  3VHD A;  2XJX A;  2YE8 A;  4HXZ A;  2HG1 A;  3Q5K A;  2ZDX A;  2BU5 A;  1B63 A;  2BU8 A;  2Q2E B;  2XDX A;  4O05 A;  1UYM A;  2AKP A;  3A0W A;  3ZKD A;  1I5B A;  3ZXO A;  4EFU A;  1AMW A;  3R91 A;  2YEG A;  4L8Z A;  4R1F A;  1UYK A;  2XHT A;  4LWH A;  1OSF A;  4JAV A;  2XHR A;  1H7U A;  2YKC A;  3OW6 A;  1R62 A;  4V26 A;  4YKY A;  4KQV A;  1YSZ A;  2BYI A;  4GEE A;  2BU2 A;  5CPH A;  2YI7 A;  2PNR A;  4KSH A;  1UY7 A;  1S16 A;  2XAB A;  4YKT A;  4XIP A;  3GIG B;  2YI0 A;  5IN9 A;  4CE1 A;  2YKE A;  3CGZ A;  5FNC A;  5D6P A;  5L3J A;  2IOR A;  3D36 A;  2QG2 A;  4BQG A;  3HZ5 A;  2YGE A;  4XTJ A;  4ZKI A;  3B26 A;  5D7R A;  2BZ5 A;  3K98 A;  5FWK A;  2XX2 A;  1YC1 A;  2IWS A;  4R3A A;  3ZM7 A;  3K97 A;  2K5B A;  1ZW9 A;  2XK2 A;  1Y4S A;  4H85 A;  3GIG A;  1YT1 A;  4XCL A;  1MU5 A;  4K4O A;  3FT8 A;  4U7O A;  2YEI A;  3QDD A;  1ZXM A;  4JQL A;  4KSG A;  5J6A A;  3RLR A;  1QYE A;  2IWX A;  2WI1 A;  4LWG A;  3PEH A;  4AWP A;  2VCI A;  2WI6 A;  4O07 A;  3O2F A;  1YT0 A;  5FND A;  2GFD A;  4YKR A;  1YC4 A;  2YGF A;  4P8O A;  3LPS A;  4B6C A;  1GJV A;  3OMU A;  1JM6 A;  3EHG A;  1I59 A;  5C93 A;  3JZ3 A;  1A4H A;  5IDJ A;  2IOQ A;  4NH7 A;  3WHA A;  2CG9 A;  2FYP A;  4CWN A;  4E01 A;  5M4N A;  3VAD A;  5D7D A;  4URN A;  2YKB A;  2QG0 A;  2VWC A;  2CH4 A;  2IOP A;  1BGQ A;  3H4L A;  4H81 A;  2WI2 A;  1YES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...