4HYRA

Structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
442
structure length
442
Chain Sequence
LVPVITKMEVYPVAGHDSMLLNLSGGHAPYFTRNIVILTDSEGNTGVGEVPGGPKITTALENVSDIVVGTKVSDYRNTLLKVQAELDKSGEKDERGAQTFDLRTGVHVLTAIEAPCLDLLGKALDMPVCRLLGAGQQRDFVRFLGYLFFVGDRKKTDLPYQSEEDSDCEWYRLRNEEAIDAEHVVALCKAAKNKYGFKDFKLKGGVLRGDEEMKVIKAMKKAFPDARMDLDPNGAWHLDDAVRYVADMHGILTYCEDPCGAEDGYSGREIMSEFRRRTGFPTATNMIATDWRQVGHSLESQAVDIILADPHFWTMNGSVRVAQMCHEFGYTWGSHSNNHFDISLAMCVHVGAAVPGEYNALDTHWIWQEGRERLTKEPLKIANGGIKVPDKPGLGVEIDRDQVMKAHELYKKHCLGARNDAITMQYLIPGWKFDAKSPCLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucarate dehydratase
publication title Structure of putative Glucarate dehydratase from Acidaminococcus sp. D21 with unusual static disorder
rcsb
source organism Acidaminococcus sp. d21
molecule tags Lyase
total genus 144
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hyrA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hyrA01
3P0WA 2QDEA 3CK5A 1KKRA 3VDGA 1P48A 3MZNA 4IL2A 3VC6A 1R6WA 2DW7A 3NZGA 1PDYA 2GL5A 1MDLA 3QKEA 3QPEA 1ELSA 1JCTA 4MMWA 1SJDA 3UJFA 2ZADA 3KUMA 1NELA 4HCDA 1MNSA 3TCSA 3ZLFA 2GDQA 1L8PA 2QDDA 4IP4A 4MKSA 2HZGA 1TE6A 5FJTA 1XPYA 1EC8A 2PA6A 2OKTA 3SJNA 3OTRA 2QJMA 2AL1A 3UCDA 4HN8A 4KWSA 2ZC8A 1OEPA 4GYPC 3TOYA 4DWDA 4IP5A 2PSNA 1JDFA 4IHCA 2OX4A 1R0MA 2QVHA 3DFYA 1W6TA 1BKHA 4M6UA 3GO2A 2MUCA 2POZA 2FYMA 3DDMA 3NXLA 5BOFA 3H8AA 1P43A 2XSXA 5BOEA 3QN3A 2P0IA 1EBGA 4J1OA 3UXKA 3DEQA 3JW7A 3VCCA 4DXKA 2HNEA 3MUCA 5FJUA 3RRAA 3N6JA 2P88A 2OZ3A 3H12A 2P8CA 2QGYA 3D47A 4HNLA 3NFUA 5EU9A 2GGGA 3ES8A 3FV9A 3SSZA 3SN4A 5J04A 3RR1A 2PP0A 4M0XA 4G7FA 2XH7A 3R25A 3H70A 4HCLA 2GGEA 3SBFA 3VFCA 2OQHA 3U4FA 1RVKA 2RDXA 3OPSA 4K8GA 3IJQA 3N6HA 3OZYA 2QJNA 4H1ZA 1JPDX 3ZLGA 1SJBA 2XH0A 3CT2A 3EEZA 3TW9A 4DX3A 2PU1A 3H7VA 3DIPA 3QTPA 3K1GA 4EWJA 3SN1A 3ZVIA 1NU5A 3TWAA 4IL0A 3IK4A 3BOXA 3JVAA 1IYXA 4HNCA 3T6CA 2OVLA 1FHUA 4KT2A 3HPFA 3GC2A 2OLAA 1TZZA 4H83A 2GGIA 3DFHA 3EKGA 2I5QA 5FJRA 3S5SA 3PWGA 2PU0A 3V3WA 2PTZA 3R11A 4H2HA 4G8TA 3I6TA 1MUCA 4Z1YA 2QQ6A 3T9PA 3FJ4A 3IJLA 2PMQA 3VCNA 4A6GA 2PTWA 3UJ2A 4YWSA 1F9CA 1PDZA 3ES7A 4A3RA 1ECQA 3SN0A 4ENLA 4E6MA 3R0UA 2PPGA 3R0KA 2OZ8A 3QLDA 2AL2A 3DGBA 3UGVA 3CYJA 2PCEA 2XH2A 1EBHA 1XS2A 3I4KA 4KPLA 3OW1A 3U9IA 4GGBA 1MDRA 3R10A 3TTEA 1JPMA 4IZGA 1E9IA 3D46A 2OG9A 4H19A 7ENLA 3ZVHA 1YEYA 1SJCA 1KCZA 2AKMA 3RITA 3THUA 2OPJA 2AL2B 3OZMA 3V5FA 4IT1A 4DHGA 2PTXA 3P3BA 3MSYA 2PGEA 2GGJA 4K2SA 1MRAA 3PK7A 1EC7A 2P3ZA 1WUEA 2DW6A 1ONEA 3CAWA 4E4FA 3RO6A 4HPNA 4ZCWA 4HYRA 2OFJA 3VA8A 5FJPA 3ZVHB 3B97A 4E8GA 3UCCA 4E4UA 3RGTA 3PFRA 4K1WA 3MWCA 3BJSA 4MGGA 2OQYA 2GGHA 3IJIA 3OP2A 4FP1A 3UJRA 3V4BA 4GIRA 5IDZA 2HXTA 3P93A 4FI4A 4Z17A 4GGHA 3FVDA 3CB3A 3CXOA 3UXLA 3BSMA 3DESA 2FKPA 3UJEA 3R1ZA 4ROPA 4JHMA 4J3ZA 2GSHA 2PGWA 4A35A 2PP1A 3I6EA 3SQSA 3NO1A 4E5TA 1KD0A 3FXGA 2AKZA 2ONEA 3S47A 1TKKA 3PWIA 3RCYA 2PTYA 3Q4DA 3TJIA 4KEMA 3TWBA 2PODA 3STPA 3V5CA 4JN7A 3TQPA 4GMEA 4GFIA 4GISA 2XH4A 2O56A 1BQGA 6ENLA 3Q45A 1FHVA 1EC9A 1KKOA 3N4EA 2MNRA 3JZUA 1DTNA 2HXUA 3DG3A 3MKCA 2OZTA 3ZLHA 5FJOA 3MY9A 3UJSA 3FCPA 4DYEA 2P8BA 3FYYA 4DN1A 3TJ4A 1SJAA 2NQLA 3T4WA 3DG6A 3ENLA 2PP3A 3N4FA 1WUFA 3GD6A 2PS2A 4JN8A 4GYPA 3DERA 4HCHA 4F4RA 3T8QA 3GY1A 5ENLA 2QJJA 2CHRA 3DG7A 4ZA0A 2XGZA 3VC5A 2OO6A 3MQTA 4X2PA
chains in the Genus database with same CATH superfamily
1FEAA 1SZEA 4H7CA 4XO6A 4AZ6A 4H8UA 4PFMA 2JK6A 1B9BA 2CESA 1HJWA 2WANA 4GQ0A 4QJ4B 3W88A 5AC4A 1BVZA 3AIBA 3WNOA 3WF0A 4PGLA 1CXKA 1PB0A 3QTGA 1JPIA 1CTNA 3S3GA 3E6EA 5D2YA 1IXQA 1W5QA 3I7QA 4GUFA 4XISA 4MKSA 1XYFA 1S1PA 4J2MA 5F1VA 4MLJA 3EWUA 3E0IA 2H6RA 3NGFA 1BSLA 2QJMA 4CN6A 2CBJA 4XZLX 4L4OA 3W1MA 2X7WA 1DJNA 2W62A 1TWDA 3N19B 1JD7A 1JDFA 3A4JA 4JQ4A 4MWAA 1WE5A 3NQBA 5TAOA 1XIHA 1N8FA 4AX7A 1W6TA 3URAA 2YCIX 1A5MC 5HDRA 3H7RA 2EQ6A 1TZ7A 1PTAA 2WOWA 1VPQA 3IGXA 3OZPA 3QY7A 4PUDA 4H4UA 1V3JA 5C2XA 6XIMA 3PF3A 3ATZA 1WKFA 2BG5A 2EO7A 4Y90A 4TVUA 3S2JA 1LG1A 2C13A 3L4ZA 4UTMA 1XLMA 2V3EA 2PWFA 4YL2A 2QJIA 1XR2A 3PG8A 5KZDA 4RE4A 4DWSB 2E9LA 4QLJA 3CZJA 3ZOAA 4N02A 2FVKA 3VX1A 3WDIA 4JDYA 1Z42A 2XIMA 5G2HA 3SM0A 3BCFA 3PZUA 3VXGA 3WNKA 4IP7A 3LBCA 3VGDA 4J28A 4JQAA 4GE8A 3P82A 2R24A 3W2MA 2PDIA 4W7UA 4O8AA 3TC6A 4FIQA 3SW6A 3VNZA 3GG7A 4EKJA 1UUQA 5U25A 1UMYA 3PPHA 1Y5WA 1KFLA 5KMYA 2R1MA 3BLEA 1YHTA 3T55A 3BPWA 2WOVA 3SQPA 1ZJAA 2CKSA 2FTWA 1UR9A 2P1FA 3OU8A 3TZNA 1FKWA 4JFWA 3VE7A 2NT1A 4LRTA 2BTMA 1BTMA 2DZTA 3VAVA 5JQ9A 1KW1A 3H2MA 1KRCC 1EJTC 3SY1A 1EIXA 3U7BA 2D23A 4AMCA 1KXQA 2CLIA 4F0HA 1NFGA 1LYXA 4C6BA 3FJ4A 5AHEA 1EX5A 1TQXA 4M8UA 1YYAA 3Q65A 3EXRA 2VZSA 4YWSA 1GYNA 4KW2A 2KX9A 2YDQA 4GNKB 3ZJ7A 2A8XA 1L6GA 4K3ZA 4LAZA 3NZRA 1KTNA 1TSIA 3SCSA 2PCEA 3NYDA 4QEHA 3WF3A 4UR7A 4CLMA 3U2CA 3N4AA 3MJMA 4NU7A 4TOQA 3G24A 4LEQA 2E77A 3ZYZA 2VYOA 3P2VA 1IHIA 4GUJA 5E09A 2A7PA 4ADWA 4CQBA 4A21A 2V3AA 3GKFA 2ISFA 3NQCA 3LHWA 1ZJBA 1J4EA 4YHEA 1N82A 5D9OA 3SUSA 4DRSA 4JYFA 1DWJM 7ENLA 1YBQA 1UP3A 1S39A 1RQEA 5KZEA 3MT1A 3SUTA 2PWDA 1E1EA 4H4PA 5LHFA 4MB5A 2D2GA 3G6MA 1M6IA 3W2UA 1RBAA 4QAIA 4DUWA 1W1B1 1MZRA 3W27A 1ECEA 2C3CA 4D2JA 4H4IA 3ID7A 1MO9A 1O6IA 3EBVA 4RZ6A 4YLWA 2WMKA 1M3UA 2A3BA 1HQTA 4QDPA 2DH2A 3S42A 5D32A 5FEWA 2EQ9A 3SCWA 1TWSA 2FFIA 1XW8A 4DJEC 2QGHA 4XTDA 4Z17A 4RDVA 3WFZA 1E0TA 3CXOA 4Y9MA 2FLIA 3RN6A 4JTCA 4AU0A 2VEMA 1YDOA 4YHGA 1ISZA 2F38A 5G1MA 3AS3A 2F6XA 4RNJA 1DJYA 4H8VA 4JTIA 1U33A 4JZ5A 3SQSA 2E5AA 1SSDA 1XCFA 1JF6A 1K9FA 3GXTA 4XBSA 4AIOA 1BYAA 2J3NA 5IBXA 5C54A 3QR1A 3ITVA 2YCLA 3TWBA 4NX5A 1OINA 7REQB 1WCGA 3MUY1 3H7UA 1DXIA 2P5NA 4LB3A 5GNZA 4MKNA 1XYAA 3G1HA 1EP3A 4LYPA 4WSKA 4HN4A 2X1TA 3C2FA 1FHVA 4BCEA 1SFLA 1IR2A 3CHVA 5A6LA 1DVJA 2YXGA 4N7QA 2UY3A 1ZTVA 2HXUA 5FS6A 3C2OA 1K77A 1FECA 2NWSA 3MKCA 1I60A 3C0QA 2INEA 4HSHA 4Z1AA 1OD0A 5FJOA 2NQZA 3QC0A 4UMBA 4I7UA 3WJXA 4KCVA 1SO3A 4GOAA 3SAZA 4TTGA 4E3TA 3RO8A 3DG6A 3ONBA 1PIIA 2EGZA 1TPVA 4ZQOA 4E2BA 3BH4A 4YPJA 4UTFA 4S23A 2OYKA 1WYGA 4DLFA 2PS2A 3M0XA 3QHMA 2J7GA 4HIBA 2YDAA 2V30A 1BRLA 2PEVA 3DCPA 2YZ5A 2QT3A 5H6HA 2OO6A 4GQRA 4NILA 2OSXA 1QAPA 4LYRA 2AMGA 2GJNA 2WNZA 4M6VA 1PIFA 4GXMA 4WZHA 3LYEA 1RHCA 2YBUA 1LPFA 4XZIA 1R85A 2X1RA 1ELSA 2R6OA 1CIUA 1UWUA 4NUWA 1SJDA 4CCCA 2QIWA 1W8SA 3PNUA 1FH9A 1FWHC 2BY1A 3PUGA 3UR7A 1P0BA 3SFKA 3CUZA 5FEPA 3GIPA 4GVGA 2HZGA 2C71A 3HG2A 4OHQA 1UZ1A 1XP3A 3DFNA 1K7XA 1TWIA 4O15A 1M6JA 3LGDA 1XD1A 3OTRA 3QPYA 1MQPA 3GHUA 5G1TA 1JXJA 2AL1A 2VO5A 1V0NA 3GNNA 3SIZA 3S6DA 2ZE3A 3G5EA 3ORWA 4NNCA 1RCXB 1PE1A 2J7HA 1YNPA 2FDMA 4JN6A 5DN1A 1RPXA 4KWWA 4HT3A 4GCAA 4IX2A 3DECA 5HULA 5DT5A 1MNZA 3MPGA 6TIMA 3NQ6A 4DNAA 2D2JA 5AYIA 2H3DA 3NPWA 2CWXA 3EOOA 2G96A 5D03A 4AFYA 4B4FA 1T96A 4X9SA 3LQGA 2JBMA 3ARQA 1JUEA 5F4WA 4NAEA 2XU2A 4ICMA 4JY9A 4J3SA 4DXXA 4LGXA 1ZXIC 5M1TA 3PTQA 3T0AA 1H3GA 2DFAA 5EMKA 4S3FA 2POTA 3WD4A 3VTRA 3KCJA 2QJGA 2OOGA 4GPNA 2RUSA 3V18A 2EJAA 4O8RA 4M0XA 3MJYA 3A9BA 5E5CA 1E4NA 4GI8A 4O16A 3LERA 4WXYA 4C7DA 4J5NA 3R7MA 2WQPA 4PCPA 1KBKA 2YFNA 2NVKX 2AQOA 3IARA 4NX0A 2VEFA 3KRBA 4PMJA 3ZSTA 1SB3B 4B5UA 4ACYA 1BG9A 1RAKA 5ABHA 1WV2A 4FLRA 4XAYA 5I7GA 4GCXA 1M53A 3K1DA 1PJ9A 3ZFHA 1KXHA 1V3HA 5G5GB 1XLJA 4UR8A 2IQDA 4QDWA 2QYGA 4WD0A 3UD6A 4HMDA 2X1IA 1UWIA 2G0WA 4ML4A 5EB8A 3ETRB 5DELA 1QBBA 3N73A 4NXKA 3B8UA 1J5SA 1W9BM 1R3YA 3R0DA 4GZIA 4F48A 1VQZA 3W71A 5FA5A 1B4EA 2JE8A 2VM8A 3G3DA 1GVFA 1UBSA 4UTWC 3ERPA 3VO0A 4L9YA 1PDZA 3MVIA 3RMEA 1TIMA 2FTYA 3NNTA 3M44A 3W7DA 3IVSA 2CBVA 1US2A 5K9XA 3CGBA 4PODA 2YB4A 4ZEPA 4GYKA 2VGIA 2XM1A 1EOKA 3DFPA 4F0RA 4AX6A 4D6IA 2GVJA 2VVNA 2VEGA 4GZEA 1FFVC 2KZHA 2CXEA 3TTEA 4RR4A 1L6FA 4MG4A 1E9IA 3E49A 1MW2A 2DJXA 4A4AA 4Y9OA 1DWIM 2UY5A 3THUA 5MHBA 1UA3A 4QG8A 5AHMA 4EF8A 4PULA 4O54A 4GUIA 4OTKA 3W7MA 4KPRA 3HMCA 3P60A 1H4PA 1VCVA 3P81A 5FESA 3FJNA 2BX7A 4Q8MA 4D9PA 2CKRA 2W66A 1D8WA 2A3LA 4P7LA 4KFPA 4H7VA 1KFBA 3B97A 1O1ZA 1IR1A 1P0DA 1NFBA 3SGUA 3QRHA 5T8GA 3DH7A 3LCLA 4EIVA 3PJTA 3ZR4A 5E6YA 4HNVA 1KBLA 4DO7A 1FDZA 1GK8A 7CGTA 2W54A 5IDZA 3BAYA 1UJQA 3M6YA 2O4MA 1EOMA 2CERA 4KETA 4JAWA 4IMFA 3LB0A 2X41A 1VYPX 4OUIA 2BY3A 3W87A 4UFMA 4O4VA 3O06A 2OEMA 3R1ZA 3MHUA 3MP5A 1ZPTA 3AWNA 3NSMA 1PTGA 2PDNA 1E43A 2WP6A 3I6EA 1QWGA 3GVRA 1IV8A 1KD0A 3KOZA 4RCXA 2XIJA 1KFCA 1ZL1A 3S47A 2J62A 1PX8A 4IH3A 2G97A 1TO3A 3EKZA 1RALA 3AYSA 4KEMA 1KQYA 3P5YA 2BV9A 2NXIA 2W63A 3J7HA 1R8LA 1H7WA 3W70A 3V5CA 1MW3A 1EJWC 4UBPC 4HPHA 2VR5A 4XWUA 2B31A 3N3MA 1GVOA 2GOUA 1EGZA 1ODUA 5FJJA 4JDRA 4MB3A 4BY3A 2E4TA 3KHDA 1TCMA 1R2SA 3ZZ1A 2GLKA 2MNRA 1GCYA 2PC8A 1XINA 2XUCA 1OYCA 3NUKA 4QG9A 1GORA 2BGSA 1UWSA 2DT0A 4ICNA 3ZO9A 3CQKA 4K39A 2G50A 4Q8VA 3MMWA 3VK5A 5CZKA 2XSBA 1E73M 2IW0A 4GX8A 3PZQA 1P7TB 1OC7A 3NURA 5C0QA 1S2CA 2PLJA 2PP3A 3WBAA 2WJEA 1VFTA 4LUTA 4GA8A 5ENLA 5EMUA 4O12A 1Z69A 4MZYA 3U4AA 3O05A 2WOQA 3C86A 3II4A 2PDQA 2EQ7A 3LHYA 1LLZA 1KKRA 4CCEA 3DENA 1EJXC 1P6CA 4FNPA 2ZX6A 3EXSA 2QXWA 4XVEA 3OYXA 3KZPA 3DHPA 4WEVX 4AD1A 1A5AA 1E1FA 1LQ2A 1H7PA 3NXFA 3TYBA 3GVVA 2XVPA 4IFOA 2D3LA 4IP4A 2JKPA 3NOYA 2YGYA 3MUIA 4JFVA 1H7XA 4Z1BA 3U2OA 2O9OA 3K8MA 2GR3A 3SJNA 1GOMA 3WDHA 1GREA 5DFAA 2XVLA 2O9PA 3VZXA 1O60A 3KVKA 1UZ4A 2RDWA 3HMJG 4C6DA 4ICCX 4KWSA 3EB2A 3A22A 2ABAA 4WJEA 3VD7A 1TCDA 4HZ6A 1V5XA 3N2BA 5BOOA 4H9ZA 1XPGA 1GJPA 3W73A 3E12A 2O9TA 1Q6DA 2MUCA 2POZA 2DDXA 4D1JA 2B7OA 2I16A 2BOFX 2ZFAA 3N34A 1F3EA 1P43A 3LZ3A 3PUOA 3GNRA 2YDRA 1FH8A 3OVQA 4QSFA 1XC4A 1GPFA 3JW7A 3WQWA 4D6CA 4MWAB 3I7RA 3AFBA 3VOCA 4JTRA 3MUCA 3RRAA 1J5TA 1KM6A 1HTIA 4W85A 3S9IA 3GHSA 2YL8A 1CLKA 1OABA 3RLGA 4CD8A 4G1KA 2PWEA 4K36A 3GH5A 2PP0A 1L8NA 4I5XA 4NYUA 3QFBA 4NP7A 4P8XA 3SSJA 1KM2A 3IJ7A 2C15A 3BAJA 2RDXA 3KBWA 1GOOA 1IIGA 4DQWA 1VBGA 1CX9A 4C1NA 3VOGA 4FAMA 1Q2SA 1PTDA 3K1GA 1EYEA 1ZY8A 2DT3A 1A47A 4HHHA 1AQHA 5I3KA 1BSIA 3I68A 1TPWA 1IT7A 4LC8A 3E0VA 5M17A 2BVTA 1IQ8A 5AC8A 4KEUA 4XUGA 4H6QA 3EB3A 4D6HA 2ZUMA 4H83A 5GNXA 3LX9A 3CUFA 4GYFA 5I3HA 1K8CA 4DI8A 3VILA 2HJPA 4GZJA 4QFUA 3ME3A 3VM5A 1CPUA 4Z1YA 1XIMA 3MBFA 3TKFA 3T9PA 1RJRA 1UKTA 2B7NA 2Z7KA 5JIWA 4R7JA 2Q6ZA 4LAMA 3B9DA 3TYDA 5HWJA 4YYCA 2ZUNA 2SFPA 5LIWX 1GYLA 3CMGA 2QF8A 4AD4A 3L2LA 3SGZA 2NZLA 1QOPA 2Y8UA 4EACA 2NLYA 4JS3A 3NPUA 1EBHA 3SCQA 3AM9A 1KLZA 1DORA 3WQ4A 3H4XA 1ZRQA 2HBVA 1CI1A 2NQ5A 1VS1A 3WJWA 3T0CA 5LSMA 2Z29A 3SDOA 4DBSA 4IICA 2RDUA 4ZGYA 1HVXA 2OG9A 4H19A 3G3MA 3UERA 4R9OA 4AG0A 5CPNA 2CHNA 2B7QA 2MANA 5A8OA 1TYTA 3B0XA 4AYSA 4JDBA 3VOHA 1XANA 1MRAA 3ARRA 4URIA 3TTQA 3C0JA 5M3WA 1ZAJA 4IIDA 3EDEA 3HPAA 3TQ0A 1VYRA 2CZFA 4P7OA 1RQHA 2IKGA 3URNA 2WHJA 5BRPA 3OGVA 5CC5A 3TE9A 1YBQB 5CKSA 4C65A 4DWSC 4E4UA 2WC7A 3UWZA 4K1WA 1TJ0A 3VDBA 1P4CA 1X1ZA 3CQJA 3QYQA 4ZO8A 1P0KA 2GGHA 4ACZA 4FP1A 5AHFA 4BV6A 5IFTA 2FGLA 5FOOA 1T8QA 4ALDA 4UFHA 1EDQA 1AD1A 4GGHA 4KRUA 1GYMA 4EANA 3K30A 3LPFA 1C90A 2NUXA 3VD9A 1NF7A 3GRSA 1Z8AA 4REQA 4O18A 1KV5A 1UPPA 4S3CA 4EQRA 1E4MM 1RK6A 1JJKA 4A2SA 3QKZA 4UB9A 2CDUA 1CEOA 3ABXA 4JXCA 4AZHA 4TVCA 1US3A 4BQ2A 2BB0A 3KWSA 3RLUA 3UU0A 1CXEA 1KM3A 2A5HA 1JRPA 1OFQA 4XVDA 3WLLA 3AU6A 1JCMP 3NWRA 3V0UA 4ZSTA 1U2YA 4XX6A 3GDLA 2D0HA 2PURA 3STPA 2BLEA 2Y7FA 1ITXA 2XH4A 4C6EA 4WIWA 3TZFA 4W84A 3RCNA 2Z4GA 1J0ZA 3NVYB 4IMDA 3WQVA 3ZWSA 4L65A 3VNLA 4Z1CA 1UQYA 1AW5A 1ZFJA 2YCLB 1LBLA 4UQEA 3ABSA 4LRSA 3T2QA 3GC4A 2OODA 1DIOA 2VFFA 3U2ZA 3RUBL 5EBUA 3FYYA 4B15A 3W0KA 5KINA 1XBVA 2J8GA 9XIAA 1M9HA 3MB9A 4LVFA 4CVUA 2VT0A 3PPGA 3G0SA 1VFLA 2WPCA 3PTMA 2HVOA 3MU7A 3W53A 2XGZA 5HJXA 3ZJKA 1ALDA 2R1LA 1ADSA 2BXVA 3HV8A 4Q8WA 3G1YA 1OD8A 3FOKA 4WR3A 2QDEA 5AYYA 3UR8A 4ZO7A 5K3VA 2ZA2A 2QULA 1SMDA 4JTSA 1XIDA 4M6QA 5LA1A 2AGTA 1XSIA 4MMWA 4H9MA 1BRLB 5JXQA 1EO7A 1OM0A 1VFFA 4DZAA 3I3DA 4JCLA 1ISVA 1RQBA 2BP1A 2BBFA 3HFTA 2OLHA 2HPIA 1A3HA 3LI1A 1IEQA 2O9RA 4JTAA 2YL6A 3LCIA 1UH3A 2PA6A 2OZ0A 1YADA 4NKCA 1Q6EA 4LBUA 4LANA 1TTJA 2IXUA 1B3OA 3TONA 2W4XA 3VKBA 1XRTA 4FNRA 2J7EA 5CEWA 1MFVA 4JICA 5A2CA 5CCZA 1CECA 3TOYA 3BDKA 4IP5A 4LUSA 1TYPA 1K8XA 4BF7A 4NI3A 5B80A 1BKHA 3V36A 1S2TA 3S46A 4MFEA 3QQ0A 1DV7A 4PUKA 1UG6A 2Y7EA 2HE8A 2XSXA 1UQZA 4NAFA 1EBGA 4XO7A 3AYRA 5CG0A 4AUBA 2VGFA 1VRDA 3LS9A 4RKAA 2ZRYA 1D2KA 2OWXA 5IRPA 5CSRA 2VD9A 1R9YA 2E9MA 3GVWA 3GTNA 4LU0A 3WD3A 4UFIA 1O5KA 3LNPA 2VFIA 3RILA 1S3HA 3CQ0A 4UTHA 4JR5A 5JCKA 1XIGA 4LF1A 1CXLA 3ATYA 1Q6OA 1JF5A 4AF0A 1UR8A 1IWBA 3ALGA 1UCWA 2Y61A 1DIEA 1T7LA 4RJEA 1ICPA 1V0KA 4NAEB 1RJPA 2C1GA 1W54A 4XK2A 3C8NA 4YTSA 2FFCA 4NI8A 5C9RA 1SO5A 4Q7BA 3BL3A 4AH7A 1CGYA 2XH0A 4GRSA 1TJPA 4NL1A 4LV4A 2Z7GA 1EKOA 2B0MA 3N9KA 4GH1A 4A3HA 5HJLA 4GQGA 4PBEA 3QTPA 4CVWA 2VFDA 2YYUA 3APYA 4W89A 4EWJA 3ZVIA 4GG9A 3TLQA 3HGSA 1VRXA 4Q7IA 2CWNA 1DE5A 1F4HA 1X6LA 3F1QA 3FA4A 5DCEA 5DBUA 3LLXA 4H9TA 3K2GA 1NIUA 3EOUA 1H5VA 1H51A 4ATWA 4W87A 2GVYA 1FVPA 2BOEX 4IG2A 4NZJA 4OU1A 4U5KA 3GDMA 2QAEA 2FDSA 4UTKA 4GVIA 4UFLA 3GXMA 3P84A 5K2ZA 4RDWA 1GQKA 4CEXC 1LCOA 1NHQA 1QASA 2ZZ5A 3QHOA 2VQUA 2CLPA 5HR7A 4PMOA 4H6EA 3G22A 1CXFA 3B9AA 1JFXA 2O55A 1X6UA 2OZ8A 2VX7A 4MZ8A 1HVQA 4S3JA 2P3EA 3ARVA 1XYLA 1VCFA 1BWCA 3M9YA 4HU4A 1WBHA 3WLSA 1ESWA 1KTBA 3HO8A 2ZKMX 4Z2KA 4GGBA 3W6MA 2QUTA 3NPVA 4ZVJA 3GXPA 4C6JA 4D8AA 1QO2A 4M3PA 5J8LA 4US6A 1S5VA 4UIOA 1GOXA 1G7UA 3O0KA 3ARYA 5DMLA 4CNPA 3PZGA 4QJ3B 3BMWA 5AYZA 2DT2A 2E6YA 1LRQA 1F8IA 4GACA 3ITTA 4XAGA 1ONFA 1JCJA 1R87A 1PX4A 3WJSA 3N9RA 3FHAA 3PTKA 2E09A 1UWRA 5GNYA 1H62A 1YE6A 3H24A 2EKGA 5I03A 1R3VA 4LAKA 2WSQA 1RSCA 1JPKA 3PFRA 1ZK7A 1N55A 4AISA 3HN3A 4XZWA 1M5WA 2OEKA 1RR2A 1OCQA 3F7JA 5JUVA 2OTDA 1JZ6A 1H2IA 1A4MA 3THQA 4AZGA 2NX9A 2XWEA 2Z6IA 3UXLA 1ITUA 1WZAA 2ATSA 3IV8A 3W86A 3RXZA 2YYTA 3BMVA 1BFNA 2G4JA 3WFAA 3XIMA 2XSAA 3WUEA 1DJIA 5DQPA 3HRDC 1FHLA 1TJ2A 3CZLA 2CETA 2PFHA 2Z1VA 4K38A 4M6PA 4O53A 2DZXA 1UROA 5C8BB 2WZIA 4J2PA 2ONEA 3KL5A 4LT9A 3ZMRA 3E9AA 1GOWA 3E5BA 5GPRA 5LNSA 3LRMA 1FWRA 3OQ8A 3LCGA 3PB0A 3UWQA 4KF1A 5CH9A 3GR8A 3P5ZA 4JN7A 4GFIA 3WBXA 1J96A 2HK1A 2DZVA 2WAGA 3RJYA 2ZCGA 3EOEA 1NDAA 4HU8A 2XFFA 3TFXA 1EC9A 2OJPA 3Q37A 1FWNA 1PKYA 3LY0A 2QDGA 1DWFM 3LG3A 4C6KA 5FJIA 1B9ZA 3W7GA 2GH5A 1OYBA 4PUMA 2ZICA 1THFD 4B3KA 3W85A 4AD3A 3ELFA 3SCOA 1LWHA 4A3UA 4NZ1A 3AI0A 1E3ZA 4Q4SA 3ITCA 3A64A 3N4FA 1X98A 2VZOA 3TTOA 3A3HA 1GZJA 3P80A 3NEHA 2BHUA 2OMAA 3SCRA 2Y88A 1MRQA 2Z25A 2QJJA 3B8TA 4TQTA 2R1NA 1YNYA 1G4EA 3OBEA 1U1JA 2CLFA 1OFEA 3NDYA 4MY1A 3T1GA 4A22A 2J6XA 2DVTA 3CL8A 1AG1O 2WMGA 3KBSA 4HZMA 2ALRA 3VIPA 4ZSUA 3WLNA 4CU6A 5ABEA 2QPSA 2DW7A 1C92A 4LUTB 2A1YA 3JRKA 4WRHA 3QZAA 1VZWA 4PMNA 2EQ8A 1OT2A 2YJQA 3W38A 1F7BA 1H0IA 3CGTA 4HCDA 3EOLA 3KTCA 1A5BA 1L8PA 1I2NA 3GRIA 4Z08A 4HA4A 1FWIC 3CWNA 4LA1A 2Y1HA 4AD0A 1UR2A 1BLIA 2WJZA 6PTDA 4DJFD 2WP5A 4LXFA 1GTEA 4U2YA 2QCGA 2VENA 4LYKA 3RX3A 3LRLA 4AAJA 2ZUVA 2H3BA 1E51A 2CC0A 4OBTA 1J6OA 5G4EA 2J7DA 4W8BA 4TVYA 4O14A 1CCWB 1GETA 4AD5A 2VRJA 4IXXA 3GXIA 3AZSA 4C1LA 3UWEA 3AN1A 1UR3M 1B30A 3KM8A 1AK5A 4C7GA 1UD8A 3CWOX 1FFQA 4FXRA 3UETA 4Q8TA 2BHYA 2UV8G 4LALA 3DK9A 2DZSA 3ABOA 4MJ2A 4EVZA 2NXHA 3TC3A 3A4WA 4ZODA 4S3EA 3DH9A 3OA5A 2HS8A 3EDJA 2PLKA 5HQEA 3W74A 2Y89A 1T41A 3S4TA 3A5FA 5FF3A 2NQJA 2BDQA 3A21A 2YL9A 2I14A 1WXJA 4S3GA 1KV8A 3LUTA 1T5AA 5A5WA 1LM1A 4JY8A 2ZX7A 3FW6A 2GQ3A 3P74A 2R1PA 3P14A 1VD6A 1REQA 2Z6JA 3FA5A 2DUXA 3URHA 2V5CA 2Y24A 3M0ZA 1Z48A 2QJNA 4N9BA 1SJBA 2PDPA 3CT2A 4M56A 3CM4A 4UC5A 1H7NA 5HWNA 3L68A 4CUCA 1LROA 4H04A 4EM4A 2YCJA 4PB5A 4EWND 2V5LA 2BS9A 2WPFA 2G3FA 4OE7A 4R53A 1KA9F 2YBVA 5AHNA 1YQ2A 3B04A 5GJNA 3W9ZA 4C1NB 1V7YA 3PWGA 4H8NA 5D38A 4EMWA 3FYPA 5A6BD 3CIVA 2ACSA 1E0UA 1Z6KA 2XDFA 3B0YA 2Q8XA 2JKAA 4H4ZA 4FK9A 3LM7A 5E93A 3IJLA 4O4WA 1Q6CA 3GDBA 1X8FA 4QDMA 2D2HA 1C3FA 1K4HA 4WVXA 3VD4A 1GSNA 3A6OA 3XISA 1XCWA 4CD4A 4UUIA 3OLEA 3IUDA 3WLPA 3R0KA 2PWUA 2XN1A 5HXMA 3UGVA 3L4YA 4A29A 3ARUA 3H2AA 2XH2A 4HKPA 1UH4A 3W00A 3A7UA 3T05A 1OT1A 1I6NA 3GFYA 5HOSA 1UKQA 3E2QA 5A8NA 1A3XA 4BF9A 4ATLA 1V3LA 1AFSA 3GIQA 1OY0A 1V0LA 4Y9AA 3W1AA 2C7FA 4ERAA 5CPLA 5FAGA 2Z24A 3L23A 4BS0A 5EMYA 1N8IA 4PMDA 3W7KA 4RPQA 1QDSA 3MMTA 1XF0A 2BGQA 4GUGA 1AW2A 1LRNA 2A4AA 2ZUUA 4CNTA 3LCHA 5FAJA 4E4FA 2X0YA 4AZ7A 1FO4A 1BXCA 2PI6A 4UTUA 3PBVA 1GKPA 1F6YA 2YCKX 1NOFA 1XH2A 2Z00A 5HA7A 2RGLA 3UZJA 4QLLA 2ZRWA 2ZRUA 5I06A 3N14A 1H7RA 4KWUA 1N5WC 5KVHA 1CBGA 1PVNA 4H6KA 3WLTA 1LDCA 1XG3A 2QHAA 1QPKA 1CGWA 4KQNA 1R7OA 3N3TA 2QJHA 1A5KC 5C71A 2B4GA 3QVQA 3W84A 9RUBA 5DY2A 4IQEA 4GO8A 2ZC1A 3N9SA 1QMLA 3B03A 5MKGA 2AAAA 4JHMA 3WDQA 2C91A 2GSEA 4GH3A 1JPHA 3QQWA 5KEZA 2E28A 4FMVA 1SSGA 3CHDA 1LTDA 4A2RA 1JRCA 3SURA 1XSJA 1TKKA 3SUWA 3UXAA 2VC7A 3SQLA 3KFTA 3UZ5A 2V5BA 4P8WA 3MI2A 5FS8A 4BURA 1XLLA 1HF6A 3T78A 4REQB 3K13A 4KH2A 4L1WA 1Q6RA 1B1YA 3DJGX 3STCA 1I9CB 1V08A 1Q5MA 4ES4A 1J18A 1EGMA 3M41A 1J01A 3UYCA 3WH5A 4DZIA 3D0CA 1Q2RA 1KM5A 3D5HA 1L6SA 4NZ5A 1IGWA 1VLIA 1GZGA 2WHKA 4LWWA 1V0MA 3CEPA 2W91A 1VBRA 3OQEA 4H2CA 2V3FA 3NL3A 3AQUA 3WUBA 4YIWA 3Q67A 1QCWA 4JYDA 1NY1A 1T6MA 4O1BA 2ISSA 2O7SA 1XUUA 4PMVA 3T4WA 2V3BA 1VIWA 1IEWA 1QW8A 5BWAA 5KZ6A 4HOZA 5DRCA 2NSOA 3HPZA 1JR1A 4WDUA 3CQHA 1E15A 2V68A 2ZZ2A 4ZA0A 3G1SA 5E9XA 3KEHA 1B3XA 4Y9PA 2PLMA 2Y5EA 1G5AA 2YLAA 2IUZA 3FNDA 3N15A 3S5NA 1N63C 1TQJA 4WDWA 3L4TA 3UG5A 4MUZA 1GWJA 4L4LA 1XLCA 2A3CA 1XIEA 2JIEA 3BARA 4Q22A 4OQVA 4QS5A 1FDJA 1E0VA 2GR1A 4X61A 3O6DA 1HKJA 1UR1A 1F6KA 1FWGC 2EF9A 2TODA 2W0HA 1NQKA 3W2JA 1H1YA 3FLUA 3FJLA 3E3HA 1DQUA 1TPEA 3UG8A 3W75A 3WMBA 2V38A 1H5YA 4OECA 3SFWA 1W3NA 5I6SA 4PE8A 2ZZ0A 3PS7A 3KWXA 3QGAC 1XIJA 1UYQA 4HN8A 7TIMA 1OEPA 5CJMA 1TV3A 1WKEA 1I75A 4O0ZA 3TA6A 5CSSA 2QVHA 3W1LA 1UZDA 4H9UA 3W1NA 8XIMA 1W1PA 4KS0A 1WOBA 2FYMA 1AQMA 2FB2A 2VC9A 1KM1A 1EXPA 3EWZA 2Y6ZA 2PUZA 5BRBA 3MI3A 3EAUA 1KXTA 3DEQA 3EA2A 1E5JA 3KHJA 4PCNA 1ZALA 2NUWA 4JBRA 2GDUA 3RAOA 5CBIA 5LA0A 1ZSXA 3BGGA 1OIFA 2WZMA 3N6JA 1ZMDA 3GNDA 1W56A 4TMCA 3VVGA 1K9EA 2NPXA 3BJFA 2Q3RA 1NARA 2TPSA 4J4KA 4DF1A 2ZWYA 3NFUA 1L2QA 1FIQB 3M07A 2DSWA 4NAFB 3LCXA 4QM1A 1TX2A 3SCTA 5IBXC 3R25A 3H70A 1GQJA 3LHTA 1XYZA 5BU6A 2GGEA 2PDFA 2DSUA 4PRTA 4NASA 4AMAA 3FDKA 4AIBA 3VIKA 2EBNA 1XBXA 3OIXA 2VVSA 2ZBTA 1QWKA 3L5AA 5FI8A 3FIGA 3RPDA 5FSDC 4KESA 5DT7A 1LG2A 4AF0B 4ZMGA 2VZTA 4HNUA 4QGCA 4PMYA 3AS0A 4ZO9A 3WH9A 3PUEA 4PTVA 4OOZA 1AUSL 1JAKA 3BLPX 2PRMA 3RFAA 3DC8A 1HL8A 2ZE0A 4RW5A 3S83A 3TTSA 1JCLA 1Q6FA 2ZXAA 5ABTA 2OLAA 5FF0A 3PANA 1Q8JA 2HMCA 1ZAHA 5AVHA 3BO9A 1A3WA 1YDYA 2PB1A 4HPGA 4UXDA 2I5QA 3W29A 1AL8A 2XVGA 1QPOA 3ITYA 3VIGA 5E0CA 4N4QA 1VLWA 1FWSA 4JKMA 1WPCA 4YMZA 1KR0A 2V3GA 1IT8A 1YRRA 3CUIA 3TN3A 1MXSA 2A21A 4AZIA 1HGWA 3UJ2A 2ZA3A 1XLBA 3GXDA 2E5BA 3B8SA 1J2WA 4L4PA 1MFUA 1M04A 3KVLA 3SN0A 3AYVA 1T40A 2Z28A 5I09A 3BV7A 1A0CA 1CGUA 4FSAA 2Z1XA 3AROA 4IG2B 3ANYA 8A3HA 3A3XA 3D3FA 4LVGA 3RCMA 5I79A 4PUWA 4LOCA 1N62C 3HG4A 4YJ5A 2RFGA 4RE3A 4I8DA 4Y8EA 4DI9A 4HSNA 1F3TA 1YPFA 1YXCA 4MADA 4W5ZA 2XIOA 3D46A 3GXNA 3T2PA 1TTQA 3TXZA 4XKYB 4LW7A 3ZVHA 3STGA 1KCZA 3USZA 2XVKA 3M0YA 4AQLA 1F3XA 3LHUA 2PDCA 4IT1A 1WBJA 1Y65A 5K9DA 3C8FA 1CLVA 5FD0A 1VYSX 2PWHA 4IUGA 3TW7A 3AMDA 4TMBA 1AH3A 2FMNA 3TSBA 5JBEA 1B31A 4HYRA 3W1XA 1OCJA 5G2WA 1GVYA 3CLMA 3MS8A 4E8GA 4K8EA 4AEOA 1TA3A 3IUIA 4I9JA 1FCQA 1GQNA 4Y7EA 2C6QA 5PTDA 4J3XA 3IJIA 1WQ5A 1W9VA 2E25A 2NQHA 3OP2A 2WM1A 3V4BA 2ZRZA 1WXZA 1LUCA 1EYWA 4UQAA 5DO8A 3GYEA 4PMQA 1OK6A 4PUEA 3STEA 4IQJA 1FWWA 1G6CA 1IEVA 5E9AA 1DKWA 3C56A 2ANUA 4I9MA 4NSBA 2DQXA 2D0FA 1J12A 4A35A 5HWMA 4H3DA 2VELA 4FDCB 3WD0A 4B9YA 4Q4KA 3A4AA 4ZXOA 2A3AA 3MUAA 2D1ZA 3NGJA 3OO2A 3TR2A 4GI4A 1Q1RA 1DWGM 2DEPA 5EY5A 1BTCA 1LVLA 4I8YA 3ARSA 1P0EA 1Y8BA 4GISA 2NV9A 4W4QA 3M0VA 2Y85A 1GXFA 5TNVA 4OJYA 2X99A 2CZVA 4M7SA 3UNTA 1R9XA 3A23A 2GQWA 1H6VA 3DG3A 5DXYA 4JTEA 4PMUA 3AO0A 4JIQA 3IVUA 3G6LA 3GUGA 3TJ4A 1I45A 2WMFA 4C6OA 2P10A 2XIBA 1UB3A 1UH2A 2I9EA 4FOUA 4NJJA 4UWMA 4HVXA 2OGYA 5IHSA 3MHFA 4R9XA 5AB3A 4GRTA 3MP4A 2QCLA 3GDKA 1GT8A 3S1XA 4F4RA 2YFOA 3EOSA 4LCQA 3QMSA 1DQXA 3W1UA 4Z2IA 4JTHA 4E8CA 3NS1B 1O5RA 3CO8A 3HGRA 1U1HA 1YTKA 1X96A 3GS6A 1U83A 4QJ5B 3GD4A 1DHKA 4FF7A 3HG3A 4B92A 4IL2A 5HUPA 3GU1A 3IIPA 2X05A 3LBMA 1PDYA 4MYXA 1DXLA 1YLVA 3CQIA 3M47A 3MW7A 1DIDA 5C55A 2YIHA 1JCTA 2H9AA 4PSPA 2F6UA 4BA0A 1C8YA 4AIUA 4V27A 4L80A 5BMXA 2LLEA 1HG3A 4Z2LA 2OWCA 1ZJIA 1VKFA 2GDQA 2QDDA 3HJEA 3E74A 1TPC1 4C6IA 1OFRA 3W22A 1G1YA 1ZHAA 1XFCA 2OKTA 4BQ5A 4XZHA 2G8ZA 4GXWA 3VDAA 3ECQA 3PZMA 2NVDA 4A3YA 2W3SA 3CT7A 4QITA 4UTIA 3APTA 1KGXA 2QAFA 4MYAA 3L12A 1PHQA 2DZAA 1VENA 4QP0A 2OX4A 4C5ZA 3E2VA 4TU1A 4U3AA 4MJ4A 1J6PA 3B40A 4AIEA 1FXPA 2P50A 3EXTA 1RBLA 4GXPA 4MIMA 3W7QA 1W3HA 3AJ7A 3WQ6A 4W8AA 3ANVA 5U7SA 3RPTA 4H4VA 3DGHA 1PUDA 3BURA 3YPIA 3WUGA 3JS3A 3CASA 3EDKA 1E1CA 4AZBA 4CCZA 2X8GA 2WNNA 3HIJA 3LU2A 4O52A 3M7WA 5D33A 4IGHA 5EBKA 1AJ0A 3BW4A 4JEQA 3H12A 2P8CA 1Z9AA 3IWPA 2PDJA 1X38A 3R2GA 4HNLA 4LS1A 3IC9A 2ZZ3A 3ES8A 4H4TA 5A6AA 4MWAE 2J47A 2YW4A 3W2NA 1NDZA 4AYGA 5J04A 1CGVA 4PEEA 3POCA 4FALA 5D9PA 4HCLA 3OG2A 1V3IA 1H0GA 4ATDA 3WBEA 1W5OA 2OQHA 5HNNA 3WG6A 5C2GA 4XZBA 4BFAA 8TIMA 3AMKA 2GJLA 1J10A 2Y0FA 5AHLA 2E0PA 2IPGA 3DFTA 3BLOA 3T4CA 2RAGA 1ZLPA 5CGMA 1REQB 4U10A 2X8HA 5I3DA 4DVOA 1V7AA 1OBAA 5C70A 3T6CA 3M0KA 4CQCA 3GTHA 3HPFA 6REQA 4X60A 4O0QA 3EGJA 2ASHA 4CQ9A 3V0SA 1S5WA 3D6NA 3GLCA 3TA9A 3V3WA 2PTZA 3O6AA 4PMRA 3DFQA 4J7RA 3EAOA 2Z2BA 4B5XA 3WD2A 2BCPA 2OYMA 3LZ5A 3E96A 4JFSA 1NSJA 3UR2A 4Y8FA 1TYGA 1Q85A 4RLIA 3GVGA 3AC0A 3F2DA 3SUUA 4GBDA 1O68A 3O16A 3NSXA 4D71A 1JYXA 3W7IA 4FNUA 4S3KA 1X39A 3FFSA 1JIBA 2AQWA 1KLYA 4LS0A 1XYMA 1PXGA 4DIAA 2WSPA 2YZRA 2J9ZA 3H4KA 1XYBA 3OW1A 1W3KA 3O6CA 2VEIA 2OR2A 1NHSA 2C19A 1EWDA 1I2PA 1Y5VA 3VDCA 4MAZA 3UVAA 3GYCA 1JZ7A 4B5NA 1XICA 2OKOA 5B7ZA 2BXYA 1DJHA 2GQ8A 4LFYA 3WEOA 1EPXA 4N42A 2EG8A 2ZOXA 5JCIA 1WUEA 4B3LA 1FWTA 4CCDA 4BQ3A 4HPNA 3TVAA 3T2OA 4L64A 1TFVA 1RK5A 3T42A 3A7AA 1XCXA 2REQA 4ADSA 5DCBA 3APGA 3L0KA 3QEZA 1KM4A 3UCCA 3F2BA 3BC9A 1BEUA 3RGTA 4O10A 2Z1SA 3BANA 2VJXA 4ZQNA 2QPUA 3AIEA 1AD4A 3NPXA 1QK0A 3T09A 4Q33A 5EMMA 2WB5A 1NFPA 3VGHA 1IT0A 4GIRA 2X09A 5E0KA 1KC7A 4PYSA 4FLOA 5JCMA 1XRSA 2OYLA 2GDVA 5FS9A 3WQ5A 2PBOA 3LRKA 4HJWA 3VPLA 3RR4A 5HINA 5JH1A 1FOBA 1R3QA 4FX6M 2ZTKA 1W5NA 4P8VA 4XQ6A 5XIAA 2C1IA 3A24A 2GSHA 2PGWA 1IEIA 1W1IE 2D73A 4XKMA 4C6PA 4U2ZA 4RXGA 1J0KA 3KVJA 4ML9A 1UD4A 2DGAA 4GABA 3PWIA 3WH6A 4HNTA 2YVJA 3WF1A 2HVMA 3I6RA 4BZYA 1QI4A 4E3VA 2BVYA 3O0FA 1EF3A 1R86A 5DCDA 1PKNA 5LNWA 2PTDA 3LCFA 1GERA 3GNXA 3GM8A 4F66A 1X1NA 1QW9A 2VC6A 3QZ6A 3UY7A 3EWWA 1RZMA 3VKAA 1UOKA 3WX7A 4OFCA 3C5QA 3UEQA 1WOAA 1G67A 1LZOA 1R46A 4IIFA 2E1WA 1C7SA 4TXEA 2WSKA 4Q8PA 3C3UA 1KWGA 3CMJA 1MW0A 4LIIA 3HTWA 3T81A 1UKSA 3AXIA 4Z0SA 3IJ9A 2FZDA 3PBYA 1SPQA 5M2FX 1TV4A 2JFEX 1VPYA 2O92A 3U2EA 3NIYA 5HUOA 2TMDA 3BE7A 3ZT6A 1WZLA 3UCQA 1XLKA 3LHZA 4LBRA 3CNYA 4GQBA 4XZNX 3NVZB 3DKJA 4O1FA 4GNJA 3VC6A 4Z2HA 5FS7A 3DXIA 4K8DA 3NG3A 3LXCA 4HJFA 3UPWA 1BZLA 4QLKA 3G2GA 4LH8A 3GNPA 3OOQA 4ZR8A 5AC7A 1WDDA 4WLCA 4ZFMA 4ZQPA 4Q4OA 3ABRA 1N8WA 3U48A 3FAWA 3MA8A 5DBTA 3ZLFA 4B9ZA 1EA9C 1FFRA 2QUUA 1BF2A 3ABQA 2X0SA 2TAAA 1QNQA 2V2CA 1L0PA 4XZMX 1S3TC 4K7ZA 3IIXA 4NZFA 5LKYA 5LHEA 2HRWA 3BLFA 4JIPA 4HA3A 4MY8A 4EXBA 2QCNA 4K68A 3VD5A 2Y8KA 5ECVA 3WK0A 4S3AA 2WZHA 4A8NA 3W23A 3DDMA 4DZ5A 1KN0A 5D2WA 4FX9A 1S5NA 3IV3A 1RP8A 4N0RA 3N2MA 4J1OA 3LN3A 3S1GA 2EQDA 3B0UX 3QZEA 5HPCA 1Y5XA 1TUFA 3CMFA 4O57A 2QCEA 3PZVA 2Q3OA 4ORMA 4GC3A 3GIYA 1K4QA 4UNIA 3NDZA 3BQ5A 5KVIA 1GRAA 1ZS2A 1RD5A 2V5DA 3MMUA 3O7UA 2WPGA 5HNUA 2G4FA 3WF4A 2ISVA 2CFFA 1MQRA 3SCNA 2J8TA 3WLIA 3B9EA 1LQ0A 4D72A 2UWFA 3U4FA 3NQEA 2NVCA 4KRZA 4JCMA 4K8GA 1UC5A 3SZ8A 5D2TA 5U1OA 4FXJA 2BHZA 4BKNA 5HNRA 5JIPA 3VM7A 4INFA 3LGGA 4GO9A 3S6TA 3T0TA 4FXFA 1XHCA 4Q4MA 3WEZA 4IIGA 1SU5A 1S2WA 1V3KA 4B5SA 1DNCA 3FGCB 2QUNA 4LY8A 3MKVA 2YXOA 3BAXA 5KITA 2B81A 1ISWA 3WJYA 3CWHA 3VIJA 3CXBA 4GJ1A 3GFXA 5LYRA 3W1QA 4JTFA 4L6DA 4IGSA 4J56A 3VOFA 2PDXA 1KXVA 1UD6A 1FCBA 3TX9A 4A3RA 3OVRA 4LQ1A 4XD6A 2DZBA 2YR1A 3W6YA 1TUXA 4W93A 1JL8A 1VBJA 2PPGA 2GWNA 1ZENA 1CGTA 1Q4WA 1W3LA 2AL2A 4S38A 3UA3A 1RP9A 4PUJA 4MNJA 3DYPA 2H8ZA 3U9IA 5A95A 4DJDD 3KLJA 1LLOA 2R9RA 2QV4A 4QCFA 3R10A 1JI1A 1LP6A 4I5UA 3T08A 4IX0A 3VE9A 4W7WA 2EPHA 2WKJA 1I2OA 5ECUA 3LGEA 3KRZA 5JU6A 4DB7A 3RITA 3KCLA 3KOYA 4F0SA 4DPPA 2Q71A 1JZ8A 1OZQA 1EO5A 3OZMA 4DO6A 1G0CA 1VCGA 4DHGA 2I57A 3ISIX 3RPMA 4LNCA 1HL2A 2WC4A 4M52A 1F76A 3GG1A 2EPKX 2ZVRA 1GG1A 1ONEA 5A94A 1O5XA 3U5YA 2ZRXA 3F4NA 2YKKA 3ALFA 3IJ6A 1OC6A 1SO4A 2UZ9A 4PUUA 3ZVHB 1OG0A 4EOUA 5CAHA 2VZUA 4GKLA 2NSXA 1A5NC 1SVDA 3KL0A 5HMSA 3PSVA 1AH4A 2HQMA 2VD8A 3OB8A 1MOKA 3BAIA 3PR2A 2JQXA 5BNKA 2HXTA 1TWWA 3W7LA 1JD9A 2FHBA 2ZZ1A 3U3HA 4FB7A 1VP5A 1F61A 2I7GA 2XWDA 2PCQA 3M0MA 3BLKA 4Y2WA 4IPJA 3G8RA 3I4EA 2BGNE 1TA3B 4HBKA 4KCWA 3STFA 2WC3A 4J3ZA 4R5EA 1RM6B 2OO0A 1FEBA 2UY2A 1V8EA 4X2RA 1MZHA 1LUCB 1OZMA 6CGTA 1JUKA 3E0LA 3ZT5A 4C6NA 4P7QA 4GUHA 2WK2A 3A47A 4N2YA 4P5UA 2YLLA 3R07C 1WKDA 5F4SA 2ZX9A 4F0LA 3KW3A 3M0HA 2D3NA 3GR7A 1A5UA 4DUOA 3GW0A 2PF8A 2NV1A 3WH8A 3ARXA 3DI0A 1BQGA 1VFOA 4GYJA 5FF2A 3R13A 1YIXA 5CLTA 4QQUA 5SWUA 4GNVA 1E9YB 3T40A 4AVFA 2NUYA 4DF2A 2JIWA 2TSYA 2DIJA 1KGUA 1ONWA 2YQUA 5XINA 3AHZA 1AH0A 1EHNA 3M6DA 4XAZA 5JVLA 4TX6A 1AQ0A 3S2MA 4XIAA 1POKA 3R6IA 3HW2A 3P0XA 4TX8A 3L4VA 1NWTA 3LMZA 3GU9A 3VKJA 1UBPC 3DK8A 3T7VA 4MDPA 2DUAA 1PCWA 4ZOBA 1ITQA 3L5LA 4PCSA 4RUBA 3CZ8A 1TVPA 2E40A 1SO6A 3ITXA 5D30A 4DJDA 1HKWA 1L6YA 2IQ0A 4HA0A 5CPTA 1S5TA 3E0FA 3ZQ9A 5C2CA 1B2YA 1R30A 4UTTA 4MDOA 4UOZA 1GRHA 1XLIA 2EXOA 2GJXA 3CV2A 3QKEA 2BVWA 4D1IA 1W3TA 2DVUA 3VMNA 3TW6A 2EG6A 3A3WA 2BC0A 1BQCA 3TP4A 1EZWA 3BZGA 3C2YA 3KUMA 1K70A 3MC5A 1XGEA 2Y63A 4YXGA 1WB0A 1IF2A 3L4XA 4RDYA 1JVNA 3CV1A 3ZS4A 2A6LA 1EGVA 4KIRA 4RNFA 4HOXA 4K1GA 2WLYA 3QC3A 3S2CA 3U7VA 4CU8A 3RK8A 3M43A 4A05A 2F8QA 3L9CA 4Q8QA 3WK1A 3RIKA 4TUFA 3TNBA 1WDSA 2VTFA 2H9AB 3NJ3A 2BWGA 3RG6A 3FG2P 1ZJHA 5BXPA 2C3ZA 1RUSA 3DK4A 3HQOA 3N18A 2VUNA 4BWLA 2FZMA 2VRKA 1M7JA 2QZRA 5G5IA 2ZXQA 1AQFA 1ADOA 1HJQA 3HM7A 4QE5A 4V33A 1ZP4A 2PDGA 1EXBA 1W3JA 1XG4A 4M7TA 5D8ZA 1A53A 2P0IA 5HMEA 1GRTA 4QJ1A 4E2DA 3PP7A 1P0NA 2DY3A 2QS8A 1ZMCA 3INPA 3DHDA 1S5MA 4NJGA 1DQWA 5TBOA 3MSGA 3WL0A 3WH7A 3VNKA 2RKXA 3BOFA 3LV5A 4UNKA 4H6RA 1NEYA 1Y7VA 4U28A 2IS7A 1QI2A 4K7YA 5LIXX 2WNQA 3AAMA 3ITOA 1GVIA 3D47A 1CZ1A 4WKFA 3W72A 1X7IA 1I1XA 3ARTA 4JTTA 3VKKA 4ZE4A 4P7RA 3JU2A 1XDJA 4UTJA 3IAPA 3LDVA 1EBDA 4M51A 1LBMA 3GNOA 2OU4A 3LADA 3H2CA 2YL5A 4ZE5A 4NHVA 2ACRA 1E1CB 4KKXA 4WQ6A 2Y7DA 3IJQA 4GX9A 3NVVB 1JPDX 3ZLGA 1W1ZA 5EFFA 1SW0A 3H2OA 5K4XA 4XBJA 5HR6A 2FZ9A 3C6CA 4M82A 3MUZ1 2GK1A 3WMCA 4WJ8A 2C1HA 4L9XA 4DO4A 1R3RA 1AOGA 1TMQA 2IPFA 1JEHA 1SUXA 3NA8A 3TH6A 1TREA 4JQ3A 1M68A 5CPOA 7A3HA 2V6OA 3WDRA 3GC2A 2FZNA 3VGFA 3GG0A 1H41A 2VR4A 4QE4A 5A8MA 5JBDA 4AB4A 3N25A 1A5CA 3S5SA 1BYBA 2HVNA 4ONVA 3QGVA 5BCAA 1G69A 4FPSA 4JQ1A 2E3ZA 3UWVA 2HWGA 3B3DA 2ON3A 1V79A 1B5TA 3WD1A 1GV4A 3IGSA 1FWCC 2PTWA 3DI1A 3GVQA 1XIIA 6REQB 3BV4A 3IVTA 4H01A 1W2PA 4MAVA 2RGMA 3N2TA 4O0KA 3CHEA 3DYMA 2OCZA 4L7ZA 2O4QA 3SY8A 2GJRA 1IGSA 2ZA1A 1W3IA 1UWQA 1ME7A 1W91A 3WNMA 4AC7C 1GHSA 5I07A 3GR4A 3HQNA 4MF4A 2FJKA 3LB8A 4NZCA 1WA3A 1NDYA 5F4XA 3WKZA 1SFJA 1MDRA 2EEXA 1JZ3A 4JNMA 4WGXA 1G7VA 2EPOA 4AXNA 4JNYA 3UWUA 5D2XA 3NZPA 4EMIA 4ZL1A 3RM4A 1CYGA 3UXIA 4PTMA 4ILSA 2VOTA 1DXEA 1V93A 1X2GA 2GGJA 4RW3A 2ZVIA 3VGBA 1UIPA 1WDQA 4GJJA 3EPOA 1UKOA 1TTIA 5T9CE 3GBDA 1R38A 1W1YA 1PZ1A 1T3QC 1D7KA 4CQDA 2IQTA 1Y0EA 3SRDA 1IZCA 2I5IA 1JQXA 1M7PA 1A0DA 3WNPA 2Z1KA 3PUDA 1OSEA 4FNQA 4AZCA 2E5CA 1LT8A 3IIVA 1KCLA 2ZUWA 1Q7QA 4ROQA 1MQQA 3SRKA 2ABBA 3H6OA 4MUPA 1X97A 2UBPC 1ZUAX 2ZZ7A 1DJGA 3BSMA 3DESA 2CFYA 4FHAA 5BROA 4CNUA 1R7AA 3O0HA 3VUSA 3JZEA 5C9XA 4PMZA 1VPXA 4NQ1A 3L2IA 3RX4A 4D8LA 4EE9A 4F40A 5CSUA 4LS2A 2V2HA 4HPXA 1FUYA 4ZOEA 3TYAA 4H4SA 1H11A 3RNDA 3QPZA 1R3WA 2J78A 3NQVA 4WUIA 1OK4A 1ISXA 2OGJA 4B3ZA 3NCOA 3NZQA 3AYTA 2E68A 3LPPA 1XIFA 3TQPA 1K6WA 1H50A 1EF2A 3MDUA 1TRIA 3QF0A 5H2ZA 1EWEA 3EEGA 3F4CA 1FP9A 1BVNP 1TPH1 3HFYA 3W82A 1ZCCA 1KRBC 5IM51 4WHBA 1HL9A 2OWWA 4JL1A 3NM3A 3EWCA 1S38A 1IXPA 1OQFA 3S2NA 4DN1A 2EAWA 5DRIA 4UCFA 1F8MA 3OG3A 1O4UA 3GXFA 1ODZA 3LSCA 4PUNA 4BI6A 3BG5A 4E38A 4CQAA 1XLGA 2HISA 3IRDA 3OHMB 1TE1A 3MMDA 5CZ0A 4P61A 5HQMA 3WLHA 1OFDA 2GQ9A 2AMXA 2FJUB 4G7EA 1NPXA 4DEFA 3KVMA 3F4DA 3MQTA 4X2PA 3EANA 2WQDA 2ZUSA 2ODOA 2XFWA 3EWDA 2OXNA 3PZTA 5CPMA 1GEUA 5C7HA 1HJXA 2FGBA 4A3QA 2WW5A 3AIQA 3EYPA 8XIAA 1LL7A 5DLCA 2VRQA 1WDWA 3H2EA 2E8ZA 1YNQA 4GVHA 1HKVA 3MUXA 4PH6A 5AZ1A 4DJFC 4KMQA 1GEQA 5JCLA 3PBUA 1TR9A 2IKHA 2GPTA 3CL7A 3AALA 4KGJA 1YX1A 2FGZA 4K7VA 3GUWA 4D8ZA 2Y8VA 1EA0A 2EKCA 3WBYA 3TYUA 1V59A 1F4AA 4OWGA 1I2RA 5E0FA 4EPDC 2VFHA 2W27A 2BMBA 4PB4A 4AWTA 2PSNA 3P61A 1CB7B 3CGCA 4C91A 4NVTA 3VIIA 3IJDA 3KCOA 4UFJA 4KEVA 3VOIA 1UW9A 1BXNA 1RXOB 3IANA 3OYZA 3QH2A 3DBNA 1K02A 1KFWA 5CC6A 2E3TA 2QCFA 2VCBA 1DBTA 2HBXA 1HUVA 2V6AA 3OVGA 2C0AA 1TG7A 1EIBA 3CAQA 1GPWA 3W76A 2CHOA 5I24A 4ZZ9A 3VCCA 2VWSA 2VMFA 3LNMA 1XC6A 3FDGA 4GD0A 2BC1A 4DBUA 1LF1A 1RCQA 4MB1A 3HG5A 4XG1A 1W5PA 4MKVA 1OFOA 1XH1A 3II1A 5LXEA 5BWFA 2VNCA 3QFWA 3CEUA 4HK6A 3SJ3A 3FV9A 1J93A 4DM2A 3GHRA 2R9ZA 3O9NA 2NW0A 3IGHX 5EGRA 3CPGA 3LA4A 3SBFA 4PCTA 1UD3A 2Y7GA 1HXJA 3N6HA 2VZVA 1ZKQA 5IXEA 3KZSA 4N9CA 1JRBA 3S5YA 3TW9A 5FF7A 1IEXA 3ZM8A 4RV8A 4NJIA 3LENA 1VH7A 3NO3A 3R89A 3H7VA 5CJ5A 1L6WA 4JEJA 1HNYA 3OEXA 4FO4A 4N6EA 1E56A 2VR2A 2X2GA 1PSCA 5JH2A 3TWAA 4D6JA 2YVFA 3QOKA 3MSDA 1C91A 1IIHA 4CEUC 1MEWA 3WENA 5BXSA 4O28A 3QFAA 4JPGA 3IRSA 3H4WA 5TD4A 4J3TA 1EDGA 2ISDA 1H09A 1HW6A 4QX4A 3RRXA 1MVYA 1VDVA 4Y9NA 3R11A 1B57A 3BUVA 4G8TA 1H61A 1M7OA 2QV5A 1OJXA 3PN8A 2JKEA 2AAQA 2PDUA 3ITGA 4A6GA 1EPVA 2D24A 4XD4A 5F7UA 4C6CA 3FKRA 3W1RA 1W9PA 3KS6A 1K8ZA 3W6LA 4AVNA 3SY5A 3PULA 4UCGA 1OFBA 2GR2A 3DGBA 1MW1A 4C1KA 3UF9A 2NV2A 2W61A 3EX6A 4ASTA 2CBIA 4Q8OA 2VX4A 3C2VA 3REQA 1CGXA 3M5YA 4C5YA 3DAQA 2QMJA 1TZ9A 4PSRA 1V51A 2WYSA 5IFPA 5HJYA 3Q58A 4O19A 2AKMA 3WELA 2ESCA 1LOSA 4UQ9A 4E4PA 2AL2B 1E55A 4PFHA 4AC1X 2EJ1A 2VDGA 3AXHA 1QHPA 5FIPA 1DOSA 3CZGA 4ZTYA 1K6AA 5HANA 5D02A 3L8KA 4LUYA 1EDTA 2YW3A 4HP5A 1CENA 2NXGA 4DUXA 2HE5A 3L0NA 4MJMA 5FL0A 2CLKA 2XIQA 1TPB1 3KBMA 3VD3A 5M03A 4H4XA 1E5NA 4US5D 2P53A 3UJRA 4GC4A 4DBEA 3WNLA 3OGRA 4RE0A 6XIAA 3DZ1A 5A69A 2W0UA 3PWAA 1E6SM 3CU2A 3NL2A 4FNSA 2A0NA 1QT1A 5BMWA 3QQ1A 3CB3A 2J7BA 1GUVA 4NY2A 3K4WA 3QY6A 4E2VA 1D3HA 3UJEA 4UFKA 2ZIDA 3KOXA 3WJZA 2HK0A 5AKQA 3GHTA 3LI0A 4YNGA 3TAKA 1OYAA 1Q4NX 3NDOA 3O8AA 4X9YA 3A4XA 4LEFA 4S39A 3G1FA 3AMLA 3PG6A 2YPIA 1P1MA 3VIFA 4Z1DA 5EMJA 4OV9A 4FS9A 5DMYA 4C6QA 4AHPA 3GTFA 3NZ1A 5LGXA 3EX2A 1ZU8A 1KRAC 3TCEA 3ZXWA 2E9BA 3ABZA 1T8XA 1FCVA 1PZ3A 3E38A 4YCPA 3AS1A 2CLEA 3OLGA 4UTLA 1OGGA 4HD5A 1YXYA 1LBFA 3Q45A 4DBWA 4LY4A 4OKDA 3VOJA 4EQSA 1CNVA 2VDHA 2FPTA 5HAOA 1RD6A 4BI7A 4S3DA 2WBAA 4M5PA 4C90A 3ZLHA 4LTSA 2ACQA 2GRTA 4B90A 4YWOA 1E71M 2ZZBA 2CLMA 4QNEA 3FVMA 4Z0JA 2FMOA 2VURA 2PDKA 2JALA 1O12A 3W28A 3UGRA 3CBWA 4YTTA 4J3UA 1B0IA 2CU0A 4KCUA 4WOQA 5AVNA 3O3RA 3GY1A 4H4WA 2CHRA 3H26A 4MSSA 3BG9A 4GK8A 3EDDA 1KBJA 3GE7A 1FX6A 1SW7A 2BXZA 2EHHA 4L4MA 1MUWA 2J79A 1D9EA 5FMHA 3K4DA 1ONXA 2WZEA 2ZZ4A 3BVJA 2ICSA 3KTXA 3WEMA 3DGZA 3WFLA 1Q66A 5DXXA 2XINA 2JF7A 1B54A 3MZNA 3PB2A 4RE2A 4RZ5A 5C5YA 2INFA 4LUJA 5KSWA 4R7OA 2ZADA 3SCPA 1ZX9A 1DYSA 1JCXA 4I7VA 3R8GA 4KFNA 4MOZA 1IWAA 3PJUA 1MNSA 1UC4A 2GUBA 3C61A 1KM0A 5FJTA 1BGGA 2X42A 2DP3A 1OCBA 5CSYA 2PRLA 1DJZA 1DJXA 3MO7A 1G01A 3TSMA 2WPBA 1UPMB 3PFMA 2GJXB 3UCDA 1LLWA 4KFOA 5EPDA 5H8UA 2FHFA 3TU9A 2JF6A 4WDXA 4HTBA 2VWTA 4IQLA 2E1DA 4US5A 3WBWA 3N17A 3TTYA 4BHYA 4P7NA 2OOFA 3SB0A 4FF5A 5A1AA 4M6UA 3TMLA 4IPLA 2QW5A 3MCMA 2HCVA 3GWQA 1XGZA 4G2DA 2WZTA 4ZOHB 3WLOA 1FQ0A 5CC3A 1CLXA 1JG9A 4JQ2A 4KWOA 4BK9A 3BK0A 1I4NA 2J7CA 3ICJA 3WY1A 2YSWA 1MSSA 1E6PA 4JQ9A 4EPBC 1SYTA 3L7RA 3BW3A 1GW9A 1L9WA 1OC5A 2XFYA 4YS1A 3W7EA 1V6TA 2V3DA 3FSUA 4JX4A 1NDWA 5DANA 3N6QA 5H8PA 3DBPA 1VQTA 3TUUA 5D9MA 1VBUA 3DJJA 2OQLA 1NOWA 2PGRA 4RV3A 2C8NA 4XBKA 2XH7A 1ZB5A 3OODA 3W81A 1F07A 2R14A 3AIUA 1XLFA 4Q8UA 5AZ0A 3QHNA 7PTDA 2QUMA 3TROA 4H1ZA 1NWUA 4YU1A 5CG7A 3TFCA 3CIWA 4CD7A 1RLDA 1XBZA 3CHCA 1RV8A 4I5RA 4IJCA 2PU1A 3HU7A 3SCUA 3UR5A 4U3CA 2VGBA 4ZQCA 1M7XA 4IFRA 4JIEA 1NU5A 1WZMA 4IL0A 2QCHA 4A8IA 4CN4A 4DXVA 1LL6A 2HNHA 2OELA 4LV9A 4JIRA 4BEUA 3RYSA 4QISA 4KT2A 1XSKA 5G2IA 3L65A 5AECA 3CGDA 1EX1A 3NQDA 4DLMA 1LT7A 4O17A 1W5MA 3TV8A 4F0MA 6A3HA 5H91A 4YVVA 5T26A 2GK1B 2R1KA 1EUNA 1GNXA 4YVXA 1OX4A 4O1EA 1W1VA 2QMKA 3PBMA 3HB9A 2WM0A 4I90A 4EX4A 1FWEC 4WCJA 2VL4A 1QATA 2Z2AA 1GVQA 5E6ZA 3ES7A 1SM9A 3BTNA 1XRVA 4RNIA 2VI0A 3EWXA 3M46A 3OLIA 3S0CA 4NZ3A 4I6VA 4QG6A 5IDIA 3ZIZA 2JGQA 1G4TA 4IPPA 1B3YA 3H54A 2YCEA 3B9OA 3I4KA 2DORA 3QYSA 1W2VA 2W79A 2WWCA 2I17A 4QS6A 1OVDA 4O13A 1CT5A 2XGBA 1E6QM 3QSRA 4B91A 3KLKA 4CGTA 2R82A 5J5RA 6TAAA 3AHYA 3C0SA 3ZJ8A 1NWSA 1GKRA 3URQA 3CLWA 4WY0A 3V16A 1ITCA 4B5VA 4QCEA 5TIMA 3PK7A 4KWVA 2J9YA 3OLDA 3RO6A 4LX4A 2A79A 1W31A 4F9DA 3BICA 4M19A 1M03A 5A6JA 1RY8A 5BZAA 2BSLA 2DZUA 3EMCA 5EYWA 3VIHA 4A8RA 3MWCA 2WHLA 1PBGA 2OQYA 5CQ1A 3M0JA 2TYSA 3GD3A 3SGGA 2P0OA 4HSOA 4XIMA 1I1WA 5CGTA 1PCKA 3W2KA 4QNWA 4BEQA 4GR1A 4WDTA 4C6LA 2DSKA 4HU3A 2INZA 1R47A 4JTUA 2J74A 3TN4A 1S46A 3BCDA 5AY7A 3VFLA 4RNHA 4UOJA 5A2AA 4AZCB 1DL3A 3GAYA 4Z2JA 3VKCA 3E02A 5GVJA 4RX0A 1W9UA 4FLSA 4WGHA 2G3IA 3WO8A 4GI6A 3WQDA 1QU4A 3CO4A 2XM2A 4JKLA 1OGSA 4O1CA 2PODA 3B4UA 3OC4A 1S2AA 1TELA 3CPRA 2FHCA 3PJXA 4MJZA 4MNLA 4Q6JA 2ZWZA 3CZKA 5AOUA 4EAMA 2XFRA 3EPNA 3S5OA 2W3RA 1P1XA 4H50A 2YX0A 1ZP3A 4HZ8A 3M4HA 4KIEA 3FN9A 1Q6GA 3LPGA 4QQ3A 3KOWA 3EMQA 4ZB2A 3N4EA 2IPWA 5HATA 3VYLA 2B7PA 2ZX5A 3PJWA 1HIZA 2CZ5A 4Q4QA 1BXBA 3T44A 4JHOA 3WL1A 3AIVA 3PG9A 5I5RA 4OBSA 4PL1A 1JEZA 3CHFA 4DYEA 3TYZA 1HP4A 2FTPA 4S1FA 1JNEA 2ZXBA 4D6DA 2J24A 1QNSA 3N11A 4N9EA 2FZBA 4GIYA 1XD0A 4D6GA 4L6OA 2J75A 3IIZA 1B4KA 3H22A 4AHOA 3JUGA 1HJVA 3QV7A 1W9DM 3GH4A 4EQWA 3T8QA 4IM4A 2NWRA 3KOFA 1WKYA 2WJFA 3UESA 3TQKA 1E72M 1K9TA 4NRSA 4Q4RA 2WSRA 4HGXA 2JEPA 2VQTA 1H60A 3F5JA 1BWKA 3K4AA 4MPKA 4G5DA 4HMNA 3NAVA 1XM3A 3EF6A 4X63A 5L9FA 1QHOA 4H7ZA 2CEQA 4BR1A 2VHLA 3WLQA 2VGGA 3WK2A 1FDYA 4G7EB 2E6AA 3PNZA 1NF0A 3EWYA 3Q6JA 1ZBCA 3TCSA 1E6RA 2EG7A 1UP0A 4XZ9A 4Q8NA 1TE6A 2J8FA 3KLLA 7ODCA 3VZZA 1AMYA 2QKFA 4JIHA 1PKMA 2E6DA 3TDFA 5I0DA 3GRTA 2CLOA 2J6VA 1NVMA 5E1QA 2ZTJA 4TVDA 5A8GA 4GYPC 4DWDA 1FTXA 1JZ2A 3FJ6A 1JDAA 4APNA 4F0KA 3S1WA 1A5LC 1FWBC 2VFGA 4AY7A 2ZZ6A 1V6YA 3G0UA 4H9YA 4AY1A 3BOLA 1Q7ZA 3BCJA 3KBVA 4IJBA 2C0HA 4R88A 1US0A 3L67A 5TF0A 4L9ZA 1QJWA 1FWAC 1GRFA 1A50A 1XYCA 4Q6XA 3OJGA 2QNEA 5DF0A 4DXKA 4EMJA 2HNEA 5LIUX 3PPCA 3HPXA 2F84A 4V28A 2WMJA 1OFPA 3GX9A 3BAKA 4J3VA 3UWYA 1WXYA 3SO7A 1HP5A 3TN6A 3M5VA 4IMEA 1J0JA 1QK2A 5EU9A 4JGDA 3SSZA 1VJSA 1DEDA 2X2YA 1JULA 1MI3A 1OCNA 1SW3A 1X6NA 3NQ2A 1IE7C 3VU2A 4GQQA 4AD2A 3BLDA 4B2DD 1PYFA 1QNVA 1Z32X 3W7JA 1Q65A 1KCXA 4KGLA 4GZ7A 3WLKX 1JGIA 4MWAC 1BGAA 3TQVA 4PB3A 3UZZA 3UVIA 4B5TA 1X7FA 1RA5A 4JYEA 2Q8LA 2X50A 2WVSA 3PTDA 5EA9A 1MO0A 2X1UA 1VHCA 1W1TA 4EAYA 1GOQA 5G5HB 3PBGA 3OGSA 3VGEA 1TIWA 1UASA 3E0WA 3TSDA 2PDHA 4WK9A 2FQIA 5FL1A 4GKTA 1LRTA 3C3NA 4AWSA 4WKHA 3AIWA 4U33A 3FYOA 1ONRA 3CV6A 3JVAA 3VGGA 3AMGA 3VNJA 1FHUA 1UP2A 1NHRA 1TB3A 2GGIA 3DFHA 3EKGA 1WZKA 4KCTA 1AA1B 2ALDA 1R2TA 4PTNA 2XTKA 4QROA 2PU0A 3TJXA 4XUYA 3SR6B 4H2HA 1U22A 2F2HA 5AC6A 1WNOA 3I6TA 3H2NA 4ACZB 3F4WA 2IMRA 3R4IA 2QQ6A 1EP2A 2BNJA 2WHMA 3S2LA 1VF8A 2PMQA 1D7YA 4UOQA 1C8QA 3POHA 3COTA 1NM9A 3NQ7A 3N2XA 3KP0A 4R7WA 3HZ3A 5J5DA 3EB4A 3WQPA 4ADUA 4JTQA 3LTYA 3WLJA 4FEZA 3E2RA 3E5PA 1CDGA 3LPOA 3WCZA 3QLDA 3F2CA 4ECLA 5M5DA 2X1SA 2YB1A 2H90A 2WKLA 4PBGA 5KTLA 1QNRA 4U31A 4YTRA 1VFSA 3W83A 1G94A 3BSGA 5CZSA 3FS2A 1JPMA 3S9ZA 4JIIX 5D04C 2QR6A 3C52A 5TR3A 4FZIA 3NOEA 1TX0A 4BI5A 2Y4SA 2X40A 3WIJA 2CYGA 4DNHA 1W37A 1V6WA 3V5FA 3W1TA 1I2QA 4XD3A 2WVVA 5KETA 3MWAA 2C3DA 4ADTA 1Q8AA 1RBOB 3L4UA 4O1DA 1IZKA 1EQCA 1H63A 3REQB 2GR0A 1HZYA 3FHQA 3UT0A 4IFKA 4GY7A 3N13A 3CH0A 3VA8A 5A6SA 1VC4A 2DJLA 5C9WA 4N6FA 4XSMA 5CZTA 3R43A 1PZ2A 4WXZA 3W7NA 3VMPA 4OOUA 3GDRA 2O0TA 3B8IA 5LIYX 5RUBA 4TR9A 2NX1A 3SI9A 4DELA 2KAUC 4GVFA 5I3IA 3AISA 3NQMA 3AICA 3TOPA 1K7EA 3UBPC 3IGUA 2YA2A 4JFTA 4JTJA 3HQ1A 1G4PA 3N12A 2FKPA 3PM6A 1AW1A 4FOKA 3S5ZA 4HNOA 1CXHA 3R79A 4ORIA 5EMLA 3KE0A 4DJED 5AC5A 5D09A 4B2DA 1FWDC 4LSBA 4HMCA 3OA3A 1E6NA 4QBXA 2VEPA 1W8GA 3A13A 5LIKX 5U4NA 4LC6A 4PTWA 2ZZCA 4J3WA 4HK7A 1JQVA 2CLHA 4K37A 1F3PA 2VX5A 1LOQA 1GVSA 4A8LA 3QLLA 1D3GA 3PAOA 4DAIA 1C8VA 4WJXA 3QM3A 3BQ6A 4XB3A 3IK2A 2NX3A 2VCAA 4AZ5A 2Y62A 3VI2A 1E40A 3UA4A 2YBTA 3HA1A 3URBA 3E1F1 1R3SA 5CZJA 5GRTA 4AXKA 1KKOA 2D69A 2ZRVA 2J77A 4Q7NA 2FH8A 5MF5A 4M81A 3VNDA 3LK6A 4H4RA 1PO9A 4YTQA 2RH9A 4LUSB 1QPQA 5DMNA 1SFSA 1IXOA 4HPJA 4K6AA 3B06A 1VB9A 2WO5A 1QI3A 4LBSA 3ENLA 1A0EA 1SZGA 3PZNA 1N61C 5CJNA 5F2MA 2L5HA 4UQCA 2G3NA 5C9ZA 1FRBA 2AQVA 3B8DA 4HHLA 1RLCL 3V5OA 2F6KA 1BWVA 4KERA 3GZ3A 2CPUA 1XL9A 1RY0A 3ARPA 4CN1A 2ISWA 2OSYA 3CZEA 3UNDA 1F6PA 4EXAA 3QOMA 1TMLA 1SR9A 5A6MA 1QUMA 3CAKA 5D8WA 4JOMA 4WOZA 1A80A 3UJFA 2A3HA 2OT0A 3U5UA 2H8XA 3QY8A 1KFEA 2Z1WA 1W1A1 4R85A 1F5ZA 4V1XA 1EJSC 3THAA 4Q32A 3P6LA 3KAOA 1MYRA 3AXKA 4WSJA 3VIOA 1Q3NA 3QR3A 3GC5A 2HS6A 3N2CA 4LNYA 1OJTA 2WOIA 1YKWA 4LCRA 1TJ1A 3WQGA 2WPEA 4YYFA 4PC8A 1C8XA 2VOMA 2W92A 3O2LA 3ZR6A 3TAOA 1BYCA 2BFGA 2GJPA 2YVGA 4QAWA 1C9DA 3AU2A 1QR7A 4HU0A 1VIZA 2V9DA 4GIAA 1R0MA 3DFYA 3NTYA 1ZNNA 4X22A 3T07A 4NJHA 1XWYA 3QFEA 3GO2A 2GSJA 4CU7A 2TRSA 1EB3A 2G3MA 3B4YA 3GG8A 3G1AA 1HO4A 1MEIA 3CPUA 5FSEC 5BOFA 1JCNA 3WMLA 3WK3A 4DJEA 3UXKA 1UUMA 2WKGA 1TTPA 3CUHA 2F9RA 3BWWA 4EPKA 2P76A 3GTXA 5KZMA 1DJQA 2QEZA 3C2EA 2WXDM 2A7RA 5TQLA 3L21A 4I7WA 5BXTA 2XPKA 3MDWA 1ADDA 4L61A 4DY1A 2YDSA 2GGGA 1CW2A 2FIQA 4F2UA 2RJGA 1M1BA 1J8VA 5ABFA 4QEEA 3TR9A 3RJXA 1QHZA 2NVAA 4UR9A 1VHNA 1KCKA 1ISYA 4POCA 3MSRA 3VFCA 1ZAIA 1FCUA 1VEOA 3XINA 5JBFA 4RDZA 2PLCA 1DIKA 2X8RA 2I9UA 4M80A 4XV0A 2Y5JA 1ZQ5A 1JCYA 2GYIA 3EEZA 4DX3A 1HX0A 1OHLA 4WSHA 1R3TA 2Z2UA 3GU2A 3GKAA 3FX4A 2VKZG 3UYIA 5I00A 5FEXA 3A5VA 2DSVA 3IK4A 1PPIA 2NQ9A 4HNCA 3TXVA 4V2XA 4F3HA 1PL9A 4W9TA 1B3WA 1PAMA 3RF9A 1AZ2A 1RPKA 3EMZA 1F73A 2VCCA 4B16A 4LAUA 1AZ1A 3MCOA 3UG4A 2F61A 4KRTA 1B3VA 3MBDA 1TR1A 1KWKA 3WQFA 1UD2A 2A3EA 2CCRA 2R8WA 4GIEA 2HROA 4H41A 1VFHA 1PV8A 4DJDC 4O11A 3L0GA 1TPFA 4G56A 3SIMA 4E6MA 1GG0A 4UTTC 2OB3A 5T91A 4JL2A 1XKYA 2FVLA 1OX4B 2CXGA 1XS2A 1SZRA 3AWOA 3KBNA 1E4LA 2Z1BA 4KPLA 1V97A 3HGOA 1EEPA 1KB3A 2C79A 2EPMX 2GVEA 2BZNA 2I56A 3WDPP 4X0NA 1AJ2A 4HQVA 1BWLA 1IWPA 3BZJA 3GAKA 3PVFA 4K8HA 1SJCA 2DT1A 4DYJA 1GKQA 1BAGA 3V0TA 3EX1A 2RHGA 4I6KA 3W7CA 2PTXA 3LOTA 3MANA 4K2SA 3GK0A 3NO5A 4Z2GA 3CUGA 3WNNA 3LMYA 2QUVA 1EH9A 1CWYA 2P3ZA 2XZ7A 4LB4A 1KQZA 4FA3A 4KEZA 3ARZA 3W26A 1DP0A 3G0XA 3UZXA 1PYMA 7XIMA 5FJPA 2GWGA 3QW3A 3R8RA 5LGZA 2C18A 3WQEA 5D2VA 4WY0B 3D3AA 4BWLC 4J35A 5GJPA 4RXFA 1H7OA 3V75A 2PZ0A 3M5XA 4AEEA 4LYQA 3UWWA 3ZSSA 1RVGA 4HHMA 3B9NA 1UWTA 3VMOA 3AIRA 4D6EA 1HKMA 4DM1A 3FVDA 1YE4A 4LAOA 5BRQA 1LQAA 1HKIA 1E0XA 2Y70A 5EFDA 3P7YA 4JTKA 4HOWA 1POJA 3M64A 4F9JA 2J88A 1QFEA 3KDOA 3CH9A 3CIXA 2E7FA 4S2BA 4ROPA 3HURA 5D37A 1TPDA 2E67A 1KBBA 3EA3A 4J57A 3DOPA 1J2BA 2EPNA 3AZTA 3LSBA 3WF2A 1PS9A 4GY1A 3W7OA 2Z27A 4M29A 1M65A 2AKZA 3O1NA 1YTDA 3MYPA 2PDWA 3RCYA 3DN5A 1UMLA 3TJIA 4XKYA 1C9WA 1KR1A 3F4VA 1EL3A 3WLMA 3G77A 3L4WA 1EFZA 3HQPA 1JYVA 4N9DA 1V02E 5GQBA 2VC5A 3NVDA 2RJHA 4OV4A 4H4QA 2FPVA 1QNOA 4ZO6A 4C6FA 4UQDA 1KRMA 2I5GA 4IF2A 2PE4A 3KX6A 3DC0A 3E2SA 1S7MA 3BG3A 4JKKA 1VEMA 1WDRA 2OZTA 2UY4A 5H1WA 3FCPA 3GW3A 4IGNA 1EP1A 3USBA 1UJPA 1K03A 4MZ1A 4PTDA 1PKLA 2CIPA 5JCNA 2NQLA 1NQ6A 5AFDA 1FWFC 3BLIA 4RZBA 3FY1A 3VINA 1DTUA 3VIMA 3GD6A 3I3EA 3N2OA 4HCHA 3RNMA 4CNNA 4HNNA 1A4LA 4E0CA 3DG7A 1L2UA 5DY3A 4UTWA 3TK7A 1OADA 3CGEA 1BG4A 1JGMA 1WP6A 3O63A 4IIEA 3TJLA 1VGAA 1KFKA 2XZ9A 3B8VA 3LTSA 4WY0F 1W17A 4IJRA 3P0WA 3CK5A 1FBAA 2QF7A 4J27A 4QR6A 1GW1A 4IPNB 1XDIA 4H00A 3M5ZA 1Q1WA 1TPUA 3NZGA 2QCMA 1NAL1 1MDLA 4HK5A 1N5XA 3Q2DA 5I3GA 2OT1A 2VXNA 1V77A 1NDVA 5CPSA 2ZDRA 3NL6A 1P6BA 3DFOA 4FOJA 1VAHA 4NG3A 5BW6A 4ERIA 3PAJA 4PR4A 2JGYA 2A85A 4HMEA 1EC8A 4TO8A 5G4WA 1UZHA 1TV2A 4I9AA 4EXQA 4M1RA 4NZ4A 2E8YA 1LOLA 1U5VA 4F2TA 6ALDA 3MHGA 4IIBA 5HBFA 1K1DA 2GVGA 3PHAA 2A2IA 1ZGDA 3W01A 9XIMA 5HNTA 1QPNA 1QVBA 1F8WA 1E9ZB 4L6HA 4Z42C 4PL2A 4M24A 4G1NA 3UW6A 1TVNA 5F2LA 2WVTA 1K7FA 3QMRA 3FSTA 1NP0A 1SZNA 3O15A 2WMIA 4NXSA 3WYZA 3PC0A 1MXDA 4NNAA 4DPQA 1V4YA 1U5JA 3W1PA 1E6ZA 1JUBA 2X0HA 2C14A 3EWBX 3UP8A 2PZNA 2J66A 3WLRA 1JXKA 1V03A 4ZBCA 5BYWA 2P88A 4Y6GA 2OZ3A 4TV5A 1V6XA 5FCZA 3SN4A 3KDNA 3RR1A 4NF7A 4MVAA 2YAUA 3U8GA 2AAMA 1JZ4A 4AEFA 1ZBWA 1F2JA 3R58A 3BMXA 2WMHA 2PDBA 3H4GA 2X30A 2I1OA 1PZ0A 4WF7A 2DV0A 3CL6A 4HTYA 2QDHA 3PPFA 3IUHA 1UOZA 4JTGA 4UMCA 2OLSA 1E0WA 3TIMA 2QAPA 5JRBA 1ZCOA 1V02A 1JDEA 1QNPA 1XGDA 4C6MA 3TEVA 1O5QA 2QPXA 5F2GA 3THDA 3PBWA 3PZOA 4PCFA 1QBAA 2CNCA 4I3GA 3W02A 3RDKA 4FR1A 4JHZA 3IPWA 1B90A 4FNTA 2BY2A 3K5XA 1MUCA 2XHYA 1X8CA 3QV8A 1AVAA 3S6OA 5E70A 4MHBA 2YA1A