4HYRA

Structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
442
structure length
442
Chain Sequence
LVPVITKMEVYPVAGHDSMLLNLSGGHAPYFTRNIVILTDSEGNTGVGEVPGGPKITTALENVSDIVVGTKVSDYRNTLLKVQAELDKSGEKDERGAQTFDLRTGVHVLTAIEAPCLDLLGKALDMPVCRLLGAGQQRDFVRFLGYLFFVGDRKKTDLPYQSEEDSDCEWYRLRNEEAIDAEHVVALCKAAKNKYGFKDFKLKGGVLRGDEEMKVIKAMKKAFPDARMDLDPNGAWHLDDAVRYVADMHGILTYCEDPCGAEDGYSGREIMSEFRRRTGFPTATNMIATDWRQVGHSLESQAVDIILADPHFWTMNGSVRVAQMCHEFGYTWGSHSNNHFDISLAMCVHVGAAVPGEYNALDTHWIWQEGRERLTKEPLKIANGGIKVPDKPGLGVEIDRDQVMKAHELYKKHCLGARNDAITMQYLIPGWKFDAKSPCLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative Glucarate dehydratase from Acidaminococcus sp. D21 with unusual static disorder
rcsb
source organism Acidaminococcus sp. d21
molecule tags Lyase
molecule keywords Glucarate dehydratase
total genus 144
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hyrA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hyrA01
3VCCA 3RR1A 3DIPA 3Q4DA 2OLAA 2QJNA 3CT2A 2PP3A 4E8GA 2QJMA 4JN7A 2XSXA 3I4KA 5FJRA 4X2PA 1KKOA 1P48A 3ZVHB 3FJ4A 4H2HA 3DFYA 3QN3A 1KD0A 4FP1A 2XGZA 4GMEA 3NXLA 1MUCA 1MDRA 3UCCA 2QGYA 2ZADA 1SJCA 1TE6A 2OZ3A 3OTRA 2P8BA 2OG9A 3MZNA 2QDDA 3DERA 3IJLA 3K1GA 4E4FA 1F9CA 4EWJA 4DXKA 3I6TA 1PDZA 4Z1YA 1BQGA 2PP0A 1EBHA 1L8PA 3MSYA 3R11A 3THUA 2CHRA 1JCTA 2GGIA 2NQLA 3N6HA 3R0KA 3SBFA 4MGGA 1ECQA 4H19A 1R0MA 4Z17A 2AL2B 4DN1A 1E9IA 2P3ZA 3QTPA 4HPNA 2OKTA 3FXGA 4IP4A 3VDGA 4KPLA 1BKHA 4KWSA 3BSMA 3DEQA 3R10A 3RRAA 3HPFA 4A6GA 3D46A 2PODA 3STPA 2AKMA 3BOXA 3UXLA 3FVDA 4J3ZA 4GYPA 2AL2A 4K2SA 3TCSA 4HCHA 3CAWA 3V5FA 5BOFA 4HNCA 1EC9A 4ENLA 2PMQA 1NU5A 4E6MA 2MUCA 3B97A 3TWBA 3OP2A 1SJBA 3PWGA 4GGHA 3T4WA 1R6WA 1SJAA 3PK7A 2OZ8A 3RCYA 2QQ6A 4HCLA 3JVAA 3GD6A 4J1OA 3SN1A 3OW1A 2RDXA 3MY9A 4DWDA 3D47A 3TQPA 4KEMA 4JHMA 3VC6A 2GL5A 4A3RA 2PTWA 4IL0A 2XH0A 4G7FA 3VA8A 5FJTA 4A35A 3DDMA 3CK5A 2DW6A 1JDFA 1MNSA 3T6CA 2AKZA 3ZLHA 3MWCA 3QLDA 3DG6A 1EBGA 5BOEA 2OQYA 2GGHA 3U9IA 2PU0A 2ZC8A 3EKGA 4GFIA 3MKCA 1RVKA 3MQTA 3ES8A 2OZTA 2AL1A 2PS2A 2FKPA 3MUCA 3PFRA 3ENLA 3DESA 4GISA 3RITA 1FHUA 3IK4A 7ENLA 4E5TA 3UJ2A 2GGJA 2GGEA 3CXOA 3V4BA 3RO6A 2P0IA 3N4EA 5FJOA 3VCNA 4HYRA 2PTZA 4IHCA 1NELA 2PP1A 3QKEA 4F4RA 3NFUA 3VC5A 2OO6A 2O56A 3SQSA 2OVLA 3T8QA 2PGEA 2PA6A 4MMWA 2PGWA 1EC7A 3T9PA 4ROPA 3UCDA 2PTXA 4K8GA 3R25A 1P43A 3P93A 4JN8A 4H83A 4GGBA 3FCPA 3U4FA 4HN8A 1SJDA 2QJJA 3I6EA 1DTNA 1EC8A 4ZCWA 4H1ZA 2GSHA 2HNEA 2I5QA 3P0WA 1TZZA 3NO1A 2PTYA 3IJQA 3V3WA 4FI4A 2FYMA 3SN0A 1JPDX 2DW7A 1ONEA 3JZUA 2XH2A 2ONEA 3UGVA 3GO2A 3N6JA 3H12A 1KCZA 5J04A 4HNLA 5ENLA 1XS2A 3R0UA 3TJ4A 4ZA0A 1IYXA 4GYPC 1YEYA 3TTEA 4MKSA 4IP5A 3OPSA 4K1WA 3S47A 4DYEA 4GIRA 2XH4A 5FJUA 1WUFA 3N4FA 3H70A 2HZGA 3TOYA 3BJSA 2GGGA 1MDLA 3PWIA 1OEPA 2OX4A 4E4UA 1PDYA 2OFJA 2OPJA 2QVHA 3H8AA 4IZGA 3ZLGA 4KT2A 3SN4A 5IDZA 3EEZA 2PPGA 3ZVHA 1TKKA 1WUEA 3CB3A 3S5SA 1MRAA 3R1ZA 3VFCA 3ZLFA 3H7VA 3UJEA 2GDQA 3Q45A 4DX3A 2PCEA 2XH7A 2OQHA 4G8TA 3SSZA 3TJIA 1ELSA 3DFHA 3UJSA 3OZYA 3FV9A 4IL2A 3UXKA 3V5CA 2HXUA 1FHVA 1JPMA 3IJIA 1XPYA 3UJRA 3ES7A 3TWAA 3ZVIA 4M6UA 3DGBA 4IT1A 3FYYA 2MNRA 4YWSA 4HCDA 3GC2A 6ENLA 2P88A 4DHGA 3GY1A 3SJNA 2PU1A 2PSNA 3QPEA 3DG3A 2HXTA 4M0XA 3CYJA 3NZGA 2P8CA 5FJPA 3TW9A 3JW7A 3OZMA 5EU9A 1W6TA 3P3BA 3KUMA 3RGTA 2QDEA 2POZA 3DG7A 1KKRA 3UJFA
chains in the Genus database with same CATH superfamily
3L2IA 1Q7MA 4LEQA 1XDIA 1N2VA 5AECA 1EFZA 4S1FA 1ZX9A 2QJNA 1AQFA 1EJTC 1RH9A 1ZFJA 1ZP3A 2C6QA 3RNDA 4AF0B 1M53A 1ISXA 1LP6A 3I65A 3TJLA 2PDIA 4UQAA 1SZGA 3SFWA 1ZJBA 3WQVA 2BASA 3SM0A 3WJXA 3ONBA 1HKKA 3TFCA 1E0TA 2Y7GA 3C52A 1NIUA 1OC7A 2E40A 4KERA 2EAWA 1TPFA 1Z42A 2YDQA 4L56A 3K2GA 4CUCA 4K36A 1LL6A 4AZ5A 5CPQA 1EUAA 4UTTA 3OG2A 2CIPA 2HPIA 2OG9A 3OA5A 4XWUA 2IS7A 2PWUA 3WF4A 2Y5JA 4KGLA 4S3KA 4R88A 3CO4A 3PBGA 1R3TA 1EA0A 1MXDA 3ICJA 3B9OA 4RZ5A 2GOKA 1ISVA 5FA5A 1ZB5A 3H23A 2GGIA 2VP8A 1IF2A 1V3JA 3OHIA 3QEZA 3FSTA 3TA6A 1X1ZA 2ZDRA 1I4NA 4U10A 1LRQA 1WKEA 3Q58A 2OKTA 4XZMX 1XBXA 3ZOAA 3DGZA 3W2UA 2TMDA 2C79A 3DKLA 4JTCA 1VPQA 3BSMA 2VZSA 5BW6A 4GYFA 4GABA 4JIRA 2X8HA 2X0HA 1HJWA 3PJWA 3TSDA 1YRRA 4ML4A 4U2YA 1QNVA 3O6YX 4NJJA 3UR8A 2YCJA 3H24A 5LNVA 4L4PA 1EP3A 1GETA 1OSEA 3QSTA 1V3HA 4O11A 1BLIA 2FLIA 4D1JA 4L4LA 3WNKA 2YB1A 1X7FA 3WY1A 2IMRA 4I5RA 3DOPA 3II4A 1MEHA 3UW6A 3A4AA 4AWEA 3UZYA 2JF7A 4GXWA 2PDLA 3SUVA 4PL1A 1YX1A 2X1IA 1XQKA 3CQHA 3TYCA 1EXBA 3SN1A 3DFSA 3OW1A 1VFTA 2PLMA 3GVGA 5J5DA 3KAOA 4NIRA 4ZGYA 2GL5A 2QS8A 1UUMA 1MQPA 3AWNA 1RP9A 2PTWA 1E1CB 1UJQA 2BY2A 5A2CA 1F74A 3AIBA 1IZJA 2WJZA 3UG4A 3V0SA 1LUCA 3HIJA 2PAJA 4MY1A 5RUBA 1MNSA 3BWWA 2AKZA 3YPIA 2PWDA 4Q4PA 3OB8A 1XF0A 1B30A 4M52A 3V18A 2VEIA 5GJPA 4ZOBA 4H4QA 3K4WA 1YDVA 1FKWA 1RALA 4QSHA 3G2GA 2WVTA 4O12A 2DT3A 3IK4A 3OZPA 3RX4A 3AC0A 4JEJA 3ZM8A 4E5TA 3GDMA 3OYZA 1FWCC 1OFDA 4A3HA 1QRQA 3BCDA 1RCQA 4ADSA 3WL1A 3QMSA 4MFDA 2ZFAA 3IIPA 3E3HA 2VZUA 1M3UA 1VFHA 1C29A 2Q01A 1KFJA 2OSXA 3AHTA 1TMLA 3DYMA 4QX4A 2OO6A 4YPJA 4OVXA 5FEWA 1Y5WA 4HOWA 4EWND 1EX1A 1H5YA 2OCZA 3RYSA 3T8QA 1H09A 4JNYA 1GZGA 2CZFA 4RE4A 1GVEA 3N18A 3U4FA 3DX5A 1OJXA 1H1ZA 2ACRA 4GI8A 1JJKA 3CL8A 1BKSA 3W76A 3P0WA 2GJPA 2Y89A 5DELA 3TSMA 1TZZA 4YHEA 5HMEA 1UUOA 1DKWA 3L4UA 4R9XA 4HK7A 1E6PA 2J7DA 1D7FA 3N2OA 3IIVA 1Q2SA 1Q6LA 3BQ5A 1XICA 5GPRA 1TX2A 1KCZA 2CLOA 4K6AA 4C6FA 1VBUA 3W6YA 1MXSA 1VB9A 2YA1A 2HVMA 4LVFA 1IYXA 3TTEA 1FFUC 3V36A 4ML9A 4CEUC 4J3XA 3W7QA 1EZ2A 1MUWA 2PDQA 2IPJA 5AYYA 4UFIA 2IXVA 1L0PA 4DJDC 1V59A 1GZ1A 1UZ1A 1VFUA 4NNAA 1QUMA 2ZIDA 3NVYB 2FTYA 3L2MA 1X6LA 1KRMA 4P7LA 3GHSA 2HCVA 4GA8A 2BXVA 4M80A 3HM7A 2GVLA 4RXFA 3ZLFA 5HUPA 2PURA 4D8AA 1H7WA 2WOIA 2PCEA 2W55A 2OQHA 2INEA 5I3IA 3B9AA 2Z4GA 1OT1A 3N2BA 4HVXA 3IVUA 5FEZA 3UPWA 3V5CA 4V2XA 3U2ZA 3BOLA 2UZ9A 2Y24A 3BV7A 4L1WA 5D2TA 3LA4A 3C3UA 1LROA 4TR9A 3ZVIA 4EPEC 1J96A 3EKLA 3ARRA 3LY0A 1S46A 4GI9A 3NNTA 1ZXIC 3HGRA 2EEXA 4MB5A 4QG9A 4GINA 1NH6A 1B4EA 3BTNA 3CYVA 2EQ8A 3M0LA 4EPBC 3CC1A 4FLOA 2YZ5A 2VC5A 1KTCA 1LORA 5BZAA 5EU9A 3AMKA 3KP0A 3W1LA 5CC5A 3NPXA 1AQMA 1J2BA 3L23A 2RGLA 4ERIA 1XIIA 4GRTA 5ECUA 4AF0A 5M5DA 3GVVA 5DMMA 4DELA 2Z2UA 3CLMA 1ODUA 4N9BA 1W91A 3W7MA 1TSIA 3VGHA 5FACA 2TYSA 3OQEA 3WQGA 1A0CA 1GRGA 3A7RA 3CHFA 3ABZA 4MUPA 2GDVA 1OGSA 1NDWA 1WDWA 1AUSL 1L6WA 4FP1A 3M0MA 1WOBA 3W87A 1IXPA 1MUCA 4OUEA 7REQA 2YZRA 3FA5A 5FI8A 3HPXA 3GKAA 3CAVA 1Q3NA 4LWWA 4AIBA 3K1GA 1FECA 3W37A 3RX2A 1D3GA 5C9RA 1Q6QA 3L0KA 4PRRA 5D05A 3M41A 3MJYA 1ZS2A 4KEZA 1DVJA 1L8PA 1E5NA 1UBSA 3CHCA 1YBQB 3SCQA 4DWSB 1RBAA 5IDIA 1DWIM 4DZIA 7ODCA 1UR9A 3LCWA 4Z17A 1FA2A 1XYMA 4I8YA 1J5TA 1IE7C 4REQA 3VO0A 4QXIA 1M5WA 3E1F1 1IWAA 4RDVA 1R7AA 2QCHA 1E51A 1RD6A 3WK2A 3M0VA 4J7RA 1JDEA 1CXEA 1J10A 2YFNA 1L6SA 4UZUA 1B54A 1KN0A 1HQTA 1SO6A 3MJMA 4XZIA 3G1VA 1UP0A 2PF8A 3KOYA 5HMFA 2MANA 4AX6A 3C2OA 3LUTA 3LYEA 2AKMA 4CN6A 5K9XA 3W6LA 5LIUX 1V4YA 3KW3A 5TBOA 3LRMA 4K38A 3M47A 2BTMA 4HHHA 3LS9A 1S5MA 4HCHA 1TCMA 1LLWA 3ZXWA 4XVEA 4XISA 4ENLA 2V3FA 3IANA 2QV4A 3DCPA 5G1MA 2FPYA 2VC7A 1XV8A 2JFEX 5H2ZA 4DUVA 1V0MA 5I23A 2JQXA 2ZICA 3W2LA 2WOWA 3KCOA 3OVPA 3NJ3A 5H8PA 4Q6JA 4B90A 1H7NA 3GTNA 3R6IA 4O18A 3VGBA 1RV8A 3TX9A 1XPGA 3FG2P 5CH9A 5CSYA 5D4YA 4LIIA 4V1YA 2C15A 5EGRA 2Z00A 5PTDA 1KO0A 3K46A 2R9ZA 1CCWB 5FJTA 2FGZA 2NSXA 4Y9AA 1I75A 3SCWA 2VFGA 1DORA 5FIPA 3C0QA 2BG5A 1XM3A 1AA1B 3T6CA 4D6GA 3MWCA 4UTIA 5AC6A 1G69A 5TQLA 3SCUA 5TF0A 5LGXA 1TYGA 3CUZA 2WVUA 1FWFC 3P74A 4PFMA 4ZQRA 1SW0A 4X63A 3SCVA 1Z89A 3FKRA 3DYPA 2C7FA 3QZAA 4S3BA 4D6DA 3WSUA 4EQRA 3MS8A 3M64A 3WF1A 2XVGA 4FIQA 5MF5A 4HIBA 1FHUA 5JRBA 1A50A 1TMQA 1IHIA 3N29A 4A4AA 3PB0A 1VLWA 1UR4A 1EQPA 3MCNA 2P0IA 1Q63A 1FQ0A 2WJFA 2GH5A 4GPNA 4B4FA 1MW0A 1GQNA 2KX9A 4B3ZA 2R1NA 4GJIA 1NEYA 4UIOA 3PPGA 1DE6A 3AMCA 1E6QM 2R1LA 4PTMA 3TK7A 1VIZA 1R30A 3AS0A 1WP6A 3F4DA 1XDMA 2GUYA 4ZO8A 3PS7A 3GU9A 1JYXA 3PJTA 3VGDA 1IXOA 2ISSA 4AY7A 4GUJA 6A3HA 2J8FA 4N9DA 3BAXA 1JFHA 1GG1A 7TIMA 3AALA 3GDLA 3WDJA 2R9RA 3NQEA 1W17A 2VUYA 3KBJA 2HE5A 1VFLA 3W70A 3L5LA 1QW8A 2GZXA 2V6AA 4KWOA 2JGQA 4QJ5B 3M6YA 1GRFA 4UTLA 1S5VA 5EMYA 2C19A 3R58A 1E15A 1FWSA 1MXGA 3VOIA 4IPIA 1OGGA 4CVUA 3EANA 3CGEA 1V5XA 2VMFA 4N9CA 1XG3A 2FHCA 1YEYA 4ZQMA 2F61A 3ZSTA 2GK1A 5EMJA 2X8GA 2GLKA 1EUNA 1JPHA 3C86A 2VC9A 4PB3A 3S47A 3H26A 1SU5A 1E1CA 1UWTA 3UA3A 1A0EA 3SRHA 1R3QA 3BUVA 4GCXA 3AI0A 4URIA 2GRTA 2HSAA 4IZGA 5AHEA 4C6BA 3SCTA 3B9NA 4V27A 1TJRA 1CGTA 1TKKA 1HF6A 4GLEA 2F2KA 1QATA 2UBPC 1FX6A 3NQFA 3UJEA 4HTBA 1PPIA 4DX3A 4RXGA 3U48A 1P5BA 4DI9A 3CPGA 4LAMA 2RKXA 2FIQA 1BGGA 1ZBKA 3FV9A 3SJ3A 4IMAA 4AVFA 1U83A 4GXPA 3E0IA 1K70A 2ZRZA 1DTUA 3AZTA 2H6RA 2O7QA 2HDJA 3CASA 4NAFA 3UZZA 4JX4A 4E8DA 1BPLB 5DMLA 3PBYA 2YKKA 2WJDA 3IAPA 3HF3A 2EG7A 3R4IA 3G1YA 1RUSA 5D09A 3FGCB 4A8RA 2ZZ5A 1XKJA 4E4PA 3IIXA 1H1NA 4C6EA 4ZEPA 3QQWA 3GH7A 3QLLA 3LXBA 1A80A 4EQXA 4H6RA 4OZOA 2RAGA 3RPDA 3WMCA 2ZUMA 4PUMA 3MWAA 4W7VA 4IMGA 2YVGA 4W8LA 1DXEA 3TQVA 2WMFA 1OFRA 5CZJA 4JEQA 5DRIA 3QKZA 3BG9A 4B16A 2J7BA 3A9IA 4E8GA 1TMHA 4MOZA 5FESA 4GACA 4ICCX 2X05A 3W53A 4E0CA 4JIEA 3NWRA 2WVVA 3EBVA 3WFZA 2HQAA 5FJJA 1GWJA 3N6QA 3ZVHB 2D24A 2ZX9A 4D8ZA 4LNYA 3EX2A 2F38A 4BV6A 1WZKA 2OYMA 2XWEA 1PWMA 1FXPA 3KM8A 1TTIA 1XIJA 3Q65A 1W8GA 1M6JA 1AMYA 3SCRA 2ASHA 3O06A 2OZ3A 5GRTA 3BLEA 3TZFA 1P4CA 3GXTA 3M0YA 3FYPA 3QMTA 2HRWA 3KDNA 4D6HA 3M0IA 1AJ2A 2P5NA 1HJXA 3TFXA 1B3VA 3C2YA 5TR3A 1UKQA 3GC5A 4D2JA 4H8UA 3C2EA 1QW9A 2AAAA 1WDPA 4MB1A 2WC3A 5IXEA 5MHBA 2DU2A 2X1SA 3JUGA 1P7TA 4NP7A 4H4ZA 4ADTA 2AL2B 2FMOA 3CM4A 2YDAA 1O6IA 4JYDA 3HB9A 4XD4A 3GB6A 1MQRA 4HK5A 3DEQA 5MKGB 1PTDA 3IJ8A 2FVMA 2RGMA 4IF2A 3QHMA 4S38A 3HPFA 1JZ5A 4RL3A 3O8AA 3QRHA 4W9TA 2Q3RA 4RX0A 1QJWA 1B9ZA 3RPMA 4JTRA 1L6GA 1L6FA 2QULA 4IJRA 5CPOA 2BCPA 5A2BA 1BXBA 3A4WA 3C0LA 2PMQA 3TYBA 3S5OA 2FHFA 2OTDA 3OVQA 2ISDA 2ISVA 4O19A 1GKQA 3P14A 2BVTA 4UTUA 1VIWA 3QPYA 1NWTA 1FWGC 2ACUA 2ADAA 3K5XA 4OOUA 4DYKA 5LXEA 3ARTA 1F2JA 2J7CA 1E6NA 4TQTA 1SO5A 1ZZMA 3PTQA 4W84A 4HNTA 2ZRWA 4O17A 4KEMA 2IQDA 3WDPP 1VR6A 3VDAA 3GNRA 5KZ6A 3AHXA 1YQ2A 2IQTA 3MUAA 2Q8LA 3A13A 1AVAA 3NA8A 1DJQA 5HWJA 3QV8A 1X96A 1Y5VA 3QY8A 3CK5A 1C3FA 5DCBA 2WVSA 1PKNA 4F0HA 3EGJA 1E40A 2YDRA 4FOJA 4IMFA 3EKZA 3W71A 2J7HA 3S1VA 3QFBA 4IM4A 2PU0A 1WZMA 2WZIA 1F6KA 4QDWA 4FO4A 2IKJA 4KFPA 4JCLA 3LPGA 3V35A 2G50A 2BS9A 4JTSA 1GVIA 5JH1A 3PFRA 4A2SA 4ZFMA 1LT7A 3QZEA 4Y96A 3BPWA 2QUUA 3O6CA 2JKEA 4MZ1A 3T0AA 1LBMA 3C2RA 4OBRA 3VIKA 3MB9A 3LQGA 3ANYA 3WZ0E 5C2GA 1JDAA 3EMZA 1V93A 4AIOA 4BQ3A 2PTZA 1R85A 4MLJA 1A5LC 2ZXBA 3QKEA 4F4RA 3NFUA 4FB7A 4V33A 4IUGA 5F7UA 5BXRA 3LPPA 4CQCA 3PZIA 4QCFA 5U7SA 3PG9A 3KOXA 1LT8A 2BGNE 1AH0A 4AD4A 2QIWA 3T9PA 3T0CA 4O16A 1M9HA 3LGDA 4IWWA 1V97A 3IPWA 4AHPA 4DLMA 3DN5A 1C93A 1V7AA 2AAMA 3JR2A 3VMPA 2GVGA 4H1ZA 5KINA 3BURA 3K1DA 5DF0A 4JTLA 5DBUA 3WD4A 2D1ZA 3W00A 1PTAA 4MTVA 1NTHA 1H2JA 1ITUA 3W7NA 3GXNA 4F0LA 3W9ZA 2A7RA 5A2AA 2X42A 1ONEA 1GYMA 3JZUA 3HGJA 1W37A 4IOTA 1EDGA 3DH9A 4PGLA 1DYSA 4AAJA 3EWWA 4LF1A 4DI8A 3LEPA 4K7YA 3LPOA 3WD2A 3M1ZA 1UD3A 1YW1A 1GKPA 2GR0A 3S6DA 4PYSA 3NYDA 2Z26A 2JF6A 4JL1A 1RLDA 1UR3M 4XIMA 3LNMA 4FF5A 2W79A 4BWLC 2BGQA 1FDJA 4PMXA 2E8ZA 3TC3A 1F05A 2INZA 4YWOA 3AHZA 2HZGA 4Z2KA 4AMAA 1ZNNA 3MUY1 3EWXA 1ZKQA 4JTUA 3B8DA 4MWAC 2OB3A 3ID7A 1Z32X 3EA2A 4ATLA 3W22A 3TTYA 2DZXA 3VKDA 1ZBVA 2OELA 2OOFA 5DMYA 3WNNA 1H7PA 1TJPA 5D2WA 4AY1A 3GD4A 2VT0A 1XLIA 4H4PA 3H22A 4TV6A 1QR7A 3KVKA 3E0FA 1OX5A 2H3DA 3BK0A 4MAVA 2VNCA 3SSZA 1N8FA 3TJIA 1FDZA 2CLFA 3CIXA 3T78A 3B8WA 4KESA 2YXOA 4DUWA 4PSPA 2DT0A 3UXKA 1H0GA 3AS3A 4NZCA 1NWSA 2WPBA 4QS5A 4U3AA 3W84A 2J74A 3TTOA 4G5DA 2PRHA 1JGIA 4BY3A 4KCVA 5C9WA 1PS9A 3O1NA 2G96A 3L9CA 2QXWA 2HK0A 1EB3A 1G4EA 4NHVA 2WK2A 1YKWA 3NG3A 1YDYA 4PMDA 3NQBA 4AC7C 2FZNA 5I6SA 2HS8A 1YXDA 1QO2A 4Z0SA 4L9YA 3OZMA 1ISZA 2D73A 1XD0A 3LBMA 1G4TA 2W92A 3LOTA 3TP4A 2G3NA 5C7HA 2DH3A 1JF5A 2W0HA 3GKFA 1BWCA 1Z8AA 2YCKX 2W91A 2TRSA 4ZE4A 1E6XM 3ITTA 2VX5A 3W73A 1W1VA 4NEVA 3LM7A 1OGBA 1R5YA 2F6UA 2QJMA 4JN7A 4FNPA 4LVGA 3KHDA 1JRBA 1FUYA 1XL9A 1XRTA 3IRDA 3NXFA 3MI3A 3EB3A 3KRSA 4O28A 1XYAA 5IM51 2PWHA 1FHDA 1FWTA 1E72M 7XIMA 1G5AA 5BROA 1WBJA 4HNUA 5FAGA 2CKRA 3VIOA 3LPFA 1UA7A 5TAOA 3LCHA 4WHBA 2X1RA 2EKGA 3P8IA 4EWJA 1H2IA 5GJMA 3AZRA 4XKYA 2EHHA 5BRBA 1OFPA 3AU6A 3W7OA 4HNNA 2VX4A 3THUA 1TPEA 3KCJA 1K02A 3AUJA 1KFWA 3MSGA 1TPB1 3E12A 4EAMA 3DFOA 2A79A 2QEZA 2ZCGA 1JXJA 1L2UA 1KFLA 5M1TA 1G67A 4C1NA 3BMXA 1G01A 4C91A 2OGJA 3M9YA 3VDGA 5CPTA 4AMCA 4A21A 2A2IA 5JBEA 2W27A 3R10A 3WG6A 3IACA 4LYQA 5AYBA 1W3LA 3S2MA 2V67A 2H90A 4MFEA 5E6ZA 2FVKA 2J7FA 4M5PA 3AIEA 1OVDA 3HG5A 3PAJA 1JEZA 2V3DA 5AYXA 4YWIA 3R07C 4LS2A 3B0XA 3P67A 4XO7A 1M65A 4GIYA 3I7QA 1CDGA 1ZMCA 3R0DA 2GJNA 4RV3A 1VFOA 1TIWA 3HGSA 2WBGA 3UR5A 1E73M 1N5WC 2UV8G 4R7OA 2IKGA 3P2VA 4AD5A 1T7LA 5A6MA 1GEUA 4J56A 3UQNA 2P10A 1NDVA 1A5AA 1FWHC 3M5YA 1XLGA 1KTNA 4OTKA 4ICNA 3WEZA 1WKYA 1V51A 4QEEA 3ZT5A 3R43A 3NPUA 1GRBA 2IXUA 1E71M 4LW7A 1KM5A 2E6AA 2Z6JA 3UG3A 2PDXA 2Y0FA 3MVTA 1RK5A 1W3JA 2YCEA 5G5IA 3OA3A 2YA0A 1JDFA 5DXXA 5HXMA 2HS6A 1GRAA 1FFVC 3PG8A 3SRDA 2EPNA 2WNQA 3EPOA 4PTVA 4O8AA 4CD5A 4DO6A 4GBDA 2WHJA 1JIBA 2GUBA 4OE7A 3U2CA 5EKYA 1VJIA 1V6WA 1RZMA 3MUCA 4EXQA 2IPFA 5CBIA 4BQ5A 1HKJA 1CTNA 2A1YA 3FN9A 2GSEA 3GBDA 3ONCA 4F79A 2J88A 3CXOA 1R2SA 1NFPA 1Q6DA 3B03A 2YL9A 3HPAA 2RUSA 3LHVA 3NVZB 4HZ7A 3EX4A 3Q94A 3UXDA 5HULA 4PMUA 1WPCA 3DFTA 2E3ZA 2ZTJA 4WCJA 1RK6A 3LSCA 3IAQA 3UY7A 1JDDA 1DJXA 5CCZA 1EH9A 2WO5A 4AEEA 5ECVA 3U5UA 3H7UA 3P93A 5DFAA 2WJEA 1PZ2A 3VIFA 5A6JA 4FSAA 3NURA 3BLLA 3VMOA 5TIMA 5HJXA 2GSHA 4XAFA 1GEHA 3B8IA 3E9AA 5AYZA 4DZHA 1S3TC 4HSOA 1H62A 1JNDA 3E5BA 3D0CA 3SADA 3C6CA 1AODA 2ABBA 1GSNA 5BNKA 3GUGA 3TZNA 3M16A 5I77A 2ONEA 3S1UA 1K3UA 1TZ7A 4AD1A 3QXBA 4QLJA 3WENA 1EA9C 1E5JA 4AU0A 4ZA0A 4GY0A 3TLLA 4EP8C 1AQ0A 3KRUA 4QLLA 3EWBX 5I02A 3ZR6A 4DO5A 2CXEA 2QUTA 3QV9A 1M41A 1EJXC 4FX6M 4J5NA 3LLFA 5D38A 2XGIA 1A3WA 3W75A 2NVDA 3PWIA 3FOKA 1XIDA 3ANVA 4GBUA 2VEMA 1VH7A 4FA3A 3H54A 4ORMA 3SCOA 1QI4A 5DMNA 1YNYA 1UG6A 3KXQA 4DF1A 5G2WA 2QDHA 1VJSA 4LAZA 2PB1A 1V08A 3CAKA 4OKDA 1TWIA 4IQLA 1ZU8A 1W1YA 1QVBA 3H4GA 4MG4A 4DJFD 3SQPA 1YPIA 5T9BG 2NXIA 1UJPA 1QASA 3LTSA 1FEAA 1PX4A 1TPH1 1JZ8A 1CPUA 3UJSA 4IL2A 3M0JA 2F5ZA 1TQJA 2ZZ2A 1SPQA 1H51A 4PTNA 4AZGA 1HIZA 1JRPA 4UZSA 3WLKX 3A6OA 3DECA 4LCSA 2EQ7A 4A29A 5G2IA 6ENLA 3QM3A 4PCFA 2Q8XA 4MNLA 2WHLA 1BWLA 3R94A 1GYLA 3GNDA 3EOLA 2PSNA 2I9EA 5CLWA 3QPEA 4EQSA 5D8ZA 1KWKA 3TE9A 1XC6A 3CYJA 4HA1A 1V7YA 3SURA 3V75A 3CGBA 5FJPA 3VABA 4GRSA 3TW9A 3M44A 1KR0A 3BG3A 1NARA 3GYCA 2XN1A 1GJPA 2YVJA 1LDCA 1T5AA 1OFBA 3AIQA 4X3ZA 3TQ0A 3RCMA 4Q8QA 2PDPA 2DJLA 1XBYA 4PMNA 2A6LA 4PRWA 4A05A 3NDZA 4TO8A 4H00A 1AL7A 3CT2A 1ZENA 1CIUA 2PP3A 2BOEX 2DP3A 1VHCA 5DXYA 1RJRA 2EG8A 1A5SA 1CXFA 4OGZA 3E74A 4RLIA 1OM0A 3RO8A 5F2GA 3DFYA 3HN3A 4NILA 6PTDA 2CKSA 1KGUA 2VWSA 1CI1A 3G1HA 4Q4QA 3GXPA 2WMGA 2QPUA 4Z0JA 3CH9A 4GIAA 3LB0A 4ZQCA 1KCLA 1EJ7L 1N62C 2NT1A 1SR0A 2V6OA 3V5OA 1BAGA 4NUWA 1JR1A 2ATSA 2XFYA 5CLTA 3NR0A 3AMGA 2JGYA 2VFFA 3TOPA 2HMCA 3NL3A 1W9BM 1XYZA 2NT0A 1UW9A 2PDNA 3B40A 2QAFA 4Q33A 4WGHA 1HVXA 1NF0A 2NQLA 1PVNA 3D3AA 3VCRA 1E9LA 1R0MA 4LCRA 2YGYA 5GNXA 1E9IA 4F48A 3PULA 5I0DA 3UESA 2YXXA 3DHFA 3LXDA 1ME8A 1K77A 4CNUA 1GJUA 1MRQA 1VRDA 4J3UA 2AMGA 4DLFA 1QFEA 4DXXA 1QPNA 3FEQA 5A6LA 1YMYA 1TE1A 1HO4A 1XSKA 4PSRA 2VEPA 3N25A 4B91A 3S2NA 5JUVA 2PODA 1ZY8A 2VD8A 4FX7A 4K8DA 1Y65A 5ABGA 4WKHA 3SW6A 4A8NA 1CEOA 4AZCA 2ZZ6A 2IKIA 2ZA3A 2V63A 1QNSA 3AXHA 3W72A 1JQVA 1ICSA 4ZSTA 1JYNA 1NU5A 1VJZA 3KP1A 5A6BA 1CGWA 2BBFA 1Q1RA 3GK0A 1KBLA 3K13A 1A49A 3F5LA 2OLSA 5FMHA 4FNSA 2QPXA 3FY1A 2LLEA 1JD9A 3FJNA 3G18A 4UNIA 2YVFA 1WYGA 3UR2A 4J9JA 2BZNA 4HCLA 3VX1A 3W83A 1TRDA 3V1PA 5HUOA 4CLMA 5KEZA 2RDXA 1L9WA 1W9XA 2AOSA 4RDYA 1EL3A 2X8RA 1GREA 4IL0A 4RV8A 4G56A 2ISFA 3VOCA 1IT0A 4A35A 3G3MA 1OADA 3MCMA 2Y7FA 4I9AA 4MWAE 2W6RA 4QJ3B 4NZ5A 1QO5A 1XIHA 1EPVA 3AAMA 3LZ3A 1H6VA 1D7KA 1QT1A 1HL2A 3BZGA 3KBWA 3IIOA 3COTA 4NZJA 1LZOA 5BOEA 3WDRA 2XIMA 2I17A 3F4WA 3QSRA 4RW5A 4YLWA 4FK9A 4AIEA 5KZMA 3MKCA 2ZVIA 3ES8A 1RJQA 3GVRA 4RPPA 4UCFA 1O12A 1EGZA 7CGTA 1XIGA 2Z7GA 4H4TA 3VD4A 3LMYA 1DHPA 2GGJA 2Q71A 2Z1SA 4OHQA 3W2KA 1ZCOA 3VNZA 1W2PA 1M68A 1BZLA 3S2LA 3W7HA 4LUIA 1W1TA 2UY4A 2GWNA 1Q4WA 4LSBA 2Z0IA 3F4VA 1TQXA 1NQ6A 1VLIA 1QCWA 1X7IA 4BI7A 1XGZA 1E0VA 3N3MA 3EXTA 2H8XA 1OINA 4J3SA 4QCEA 3L4TA 2FB2A 4M19A 1X2GA 1UWUA 3AISA 4WJXA 3TN4A 4Z2IA 2PRLA 1HG3A 3IK2A 4YTQA 4MJ2A 2CBIA 1R47A 4DBSA 4FLRA 4YHGA 1I60A 1CXHA 5ABHA 1IV8A 4M82A 1E0WA 3JS3A 3N19B 5A8NA 2PGFA 4ACYA 3CLWA 4I8DA 2VZTA 1V8EA 1GW9A 4JQAA 2Y63A 1SW3A 3G8RA 1N60C 4GYKA 4CEXC 5AOUA 1KRCC 2XH2A 1WNOA 1JVNA 2A3AA 2HJPA 1OCQA 1O4UA 3C56A 5F1VA 1RBOB 1XS2A 4IGSA 5I3KA 4DF0A 1NOFA 1KCXA 2G0WA 1WXZA 2DVUA 1UMLA 5H6HA 5H8UA 4JXCA 3H70A 4U5KA 1FWRA 3QV7A 3RG6A 1S7MA 5CZKA 1HP5A 1BSLA 1QI3A 2RH9A 2NQZA 3OHMB 3LV6A 5B7ZA 3KOWA 3W6MA 1UH3A 1XLDA 1GXFA 1M1BA 5CJ5A 1MVYA 4CKQA 4NASA 4AC1X 2WP5A 4UQ9A 1QU4A 2Z27A 2XFFA 2A0NA 4NRRA 1ADDA 2IKHA 1LVLA 2V2CA 4PUNA 3HV8A 1H11A 4JTAA 2D3LA 2CLHA 4IQEA 1TA3B 4CU6A 1SMAA 3S0CA 3MP4A 1V79A 3GTHA 4Y9MA 3NOYA 4RR4A 1W9PA 3MHGA 1GQIA 3QYSA 3ARPA 5A5WA 1OIFA 1PX8A 4HU8A 3SUWA 5LHEA 2ZUNA 2BWGA 3ATZA 1HGWA 3LHTA 3DFNA 4NKCA 3TH6A 3DFPA 3EDEA 2NWSA 3FA4A 4N2YA 3W7CA 3DHDA 3GDTA 3UERA 3LADA 5AC8A 5JBDA 3WQFA 1M04A 2VGBA 1YPXA 4Z2GA 3HU7A 1C7SA 2B31A 2YL8A 3AS2A 4Q4SA 2ZA2A 3BSGA 2Y4SA 3W38A 1J6PA 1QK0A 3OGRA 3UR7A 5CPLA 3GBEA 3EOSA 3WH8A 1ZAIA 1FO4A 1BSIA 3KL0A 2VC6A 2VFIA 4UMAA 2WB5A 2XGBA 1JNEA 5CPMA 2FVLA 5CBJA 3VCCA 2QUMA 5D02A 2W62A 2BDQA 4C1KA 5H1WA 1X2HA 2XSBA 1GPFA 3S5NA 3N3TA 1OCJA 4D6JA 4PE8A 1XSJA 2DSVA 4OQVA 5HJYA 1J8VA 3GR8A 4O13A 4Y9PA 4L64A 3OGSA 4NZ3A 4Y6GA 4IMDA 7TAAA 4LUSB 3C8NA 4C6JA 3LRKA 3UPBA 1XCWA 4H6EA 4MKVA 2CHNA 1OC5A 1Z6KA 3UCCA 2V2HA 3WELA 2CBVA 3G6MA 4JTEA 3MUIA 1GVFA 2I7GA 2NV2A 4WOZA 3FVMA 4RCXA 1N7KA 4FR6A 2HISA 2YL5A 3KCLA 4W86A 4ATDA 3LTYA 4AD3A 2FFIA 1UC5A 4HHPA 1BWKA 2ALDA 5E9XA 4ORIA 4BR1A 1BGAA 3GLCA 1GTEA 3IWPA 1RQEA 4NAFB 4JFVA 1RHCA 3ALFA 4EACA 2IPGA 4IX2A 3ARUA 5LNWA 4WX2A 4FOKA 2C91A 3RHGA 1GUVA 2B7OA 1GNXA 4JDBA 1BFNA 1Y0EA 1MNZA 3H2FA 2ABAA 3TYUA 2ZC1A 1DXLA 4PFHA 3M7WA 1W5OA 1KBJA 2YCIX 3WQDA 1I1WA 1UA3A 3FXYA 3UBPC 4E3TA 4UFMA 2XDFA 3N13A 3H55A 1VQTA 1KCKA 1J0JA 3UYCA 4JTIA 3BOXA 3GZ3A 4UQCA 3RF9A 1UCWA 2C0HA 2XM2A 3FVDA 4P7NA 3GHTA 3BAWA 1JZ2A 2GQ9A 1TYTA 3DKJA 7PTDA 1UZ4A 1KFBA 3C4UA 4JTFA 4NI3A 1E6ZA 1I6NA 2Z2BA 4XAPA 4L9ZA 3TLQA 5KZEA 4JY9A 1EZWA 1FWBC 5XIAA 4KH2A 4IGHA 5J8LA 3FJLA 5CPSA 4LV9A 3HO8A 4JQ3A 4BZYA 4L61A 3PZTA 2PLCA 3CMJA 1DL3A 4AWUA 1TA3A 4GJJA 3PK7A 1VBGA 4Q4MA 1U1HA 1LRTA 1GESA 1RM6B 3MANA 3WQ8A 1JROA 4B5SA 1B3ZA 1VEOA 4HKPA 3TQPA 3HW2A 2OO0A 3AROA 3TKFA 4U3CA 1OYCA 3VXGA 4S3CA 3VKCA 3VA8A 1IEVA 4HJFA 4N4PA 4QS6A 2AGKA 1KM4A 4OWGA 3FFSA 3W1QA 1TYPA 1WKFA 1VFSA 1R3SA 3S6OA 3BC9A 2F7FA 4I9MA 1P0KA 5FAJA 5A1AA 5EMMA 3VK5A 3AHVA 1BYBA 3BAJA 1W5MA 4ZFCA 3HQOA 1F8IA 3OQ8A 6TIMA 4HP5A 2X50A 2PE4A 2HROA 3OEXA 3P84A 3LQLA 3IARA 3R89A 1EGMA 4F2UA 1J0ZA 2G37A 2ANUA 1SQ7A 3RO6A 5D03A 5FJOA 3S3GA 2VURA 3S8HA 3PY2A 2VZOA 4UTWA 2B7PA 1KRAC 3F5KA 1F6PA 5D2YA 4HQVA 1B3WA 5EBUA 3SQSA 1FCVA 3BAIA 2W66A 4YTRA 4QIUA 3F1QA 2X7VA 5B80A 3WUGA 5D8WA 2J6XA 4AUBA 4ZXOA 3VE7A 2I14A 1O5QA 3GDBA 4HA3A 1H5VA 3QVQA 3NPVA 3N14A 1XI3A 4WUIA 3MDUA 3TAKA 1TWSA 3DJGX 1WX0A 1YLVA 1UKSA 2NX9A 1HW6A 1JUEA 2FZDA 2HV5A 1W3HA 3CV6A 2FTWA 4P8WA 4W89A 1G7UA 1ONRA 4F9DA 3ECQA 3B05A 2ZZ1A 5EBAA 5C0QA 4RW3A 2ZTKA 2GYIA 5AHNA 3FEMA 3L2LA 4XTDA 2ZX8A 2G3IA 2WCGA 4GY7A 1WZLA 3WBXA 1OFOA 3UGRA 2QF8A 2AGTA 3O7UA 3W0KA 2O4MA 5BCAA 5C7VA 4J57A 5AC4A 4CCEA 1QPQA 3KL3A 3W2MA 1DP0A 1JPKA 1TV8A 3CQJA 1OEPA 1KBKA 4R34A 5BXPA 2G3FA 3KLJA 3AS1A 3SN4A 4GH1A 1FDYA 2D23A 1UQZA 4GYJA 1AJZA 3QC0A 3CB3A 2FZ8A 2CETA 2PFHA 1LG2A 2GDUA 4DWSC 1Q6EA 5FS7A 1WDDA 3OVGA 4I9TA 2ZZ7A 3T8LA 2YFOA 2XH7A 1UKPA 4PUDA 2Y7DA 4C60A 3AMDA 3BZJA 3J7HA 3BLOA 4F0MA 1TUFA 1TV2A 2HBXA 2O55A 2V69A 3C2VA 2ZYFA 1RY8A 4R3UA 2F84A 3GIPA 4TTGA 4GWEA 4REQB 5HNUA 3LXCA 1KFKA 2E9MA 1OCNA 4O1BA 4O52A 2P3EA 3C3NA 4BKNA 1GGOA 1AZ1A 5DY2A 2I9UA 4KCWA 4HCDA 4R27A 2WQDA 2P88A 3WNPA 1XFCA 4S3JA 2AAQA 2XPKA 1BWVA 2XVKA 1W9DM 3W25A 3SECA 2PDJA 1UIPA 3RJYA 3TEVA 3L7RA 4JTTA 5A8PA 2PDYA 1WO2A 4X22A 1A5BA 1S1RA 3W7LA 2OSYA 4KMQA 4K8EA 3WLNA 5HK4A 3A64A 3MC5A 1WA3A 4WF7A 3UJFA 4UTTC 3NEVA 1E0UA 3P8JA 3OLDA 3FS2A 3P81A 1MZHA 1Q2RA 1UQYA 3CL6A 3TIMA 1JCNA 1DV7A 2XYLA 4ERGA 4KPRA 4DJEC 3AFBA 3VZYA 3WMSA 3CWOX 3SUUA 4PUUA 2R24A 5D9OA 2P53A 1S2CA 2FJKA 1AMKA 1RVGA 4C7FA 2WHMA 4A2RA 4S3AA 3VOFA 4TVWA 4WXZA 3VZXA 3PN8A 1KKOA 3PF3A 2QPSA 4XZNX 6CGTA 3VGGA 3KVJA 2TAAA 4NY2A 3FJ4A 3GE7A 4X0NA 2ZZBA 4PUWA 1K8ZA 1MDRA 1R46A 4Z1CA 2FQIA 1SUXA 4EOUA 3MU7A 1SJCA 1XLFA 1E4MM 2EPOA 3IS4A 2GSJA 4LBSA 1TWZA 1EYWA 2G3JA 1UWSA 3URQA 5AZ0A 4O10A 4GKTA 1UHVA 5G5GB 3QY7A 1W3NA 3EX6A 1NDYA 2WOQA 4WJ8A 4DXVA 1IT8A 3UXAA 4H8HA 3HMJG 2DVXA 3S9ZA 3R0KA 3UA4A 4H19A 4I7VA 4MJZA 1XLMA 5LIWX 2ZXQA 2GWGA 5BRPA 4BURA 1EJSC 1VBHA 2NX3A 3QJAA 3CEPA 4HSNA 4BF9A 3ABOA 4LB4A 1CT5A 2QMKA 1S5NA 2E9LA 4LNCA 5HR6A 4HNVA 3UVAA 3QYQA 4IP4A 1A5KC 2Q3OA 2C3DA 4PMJA 3E2VA 3RMJA 1RQBA 4IIGA 5CZ0A 4IFKB 1YXCA 4RZ6A 3APTA 3OBKA 2NV1A 3GVQA 1W5NA 1ZAJA 3VVGA 4H4SA 4HPXA 3UXLA 1JEHA 1UP3A 3G1XA 2AL2A 5CC7A 1SW7A 1VP5A 1SZFA 3V1HA 1FCBA 3F5JA 3NO3A 1O1ZA 3S2CA 4GUIA 2D20A 4R53A 3W82A 5LSMA 3T44A 4HPJA 2WBKA 2VVNA 2DVTA 3DHPA 4GE8A 1ZJIA 3LD5A 3TUUA 3W29A 2CFFA 3MP5A 3WLOA 4KGJA 4IGMA 1KB3A 4WEVX 2Z1VA 5DCDA 5K4ZA 3W23A 4RZBA 1NOUA 1Q6FA 3A5FA 1LOLA 3WLSA 4KCTA 1NJJA 1ZDLA 2J13A 3W2NA 4JCMA 2E4TA 4Q3MA 1NM9A 1GHSA 5JIWA 1V6XA 4A3RA 4EPDC 2E3TA 3BSHA 4H2CA 3UWWA 3WLPA 2RDWA 4C6DA 2V3BA 4C6PA 3DDMA 3U0HA 4UFJA 3A4JA 1IGWA 4H8VA 4HA4A 3BGJA 4DJFC 4FAMA 2YDSA 4F0KA 1AD4A 2DZVA 1JGMA 1PUDA 3QHNA 4AXNA 4MB4A 3EKGA 3HG3A 1XJBA 1H1YA 3I3BA 4GFIA 3SGZA 4QFUA 2NQHA 4ZB2A 1QPKA 1W0MA 3EOOA 2DQWA 4FS9A 2YSWA 3NZQA 1VRXA 1RPXA 5JH2A 2E6FA 2TODA 3NQVA 2VFDA 4J40A 1HVQA 5DEZA 3JU2A 1JXKA 3O16A 1GHRA 4AISA 5AN7A 3NVDA 1FXQA 4WZHA 1Q7QA 4AD0A 2OYLA 9XIAA 2UY5A 4IHCA 5D37A 4QR6A 5CG0A 2QAEA 3EDDA 3NDYA 3VC5A 1EIBA 4QSFA 1GOQA 1JULA 4QE5A 3MZ2A 1JCLA 2Y1HA 5A6BD 1XYBA 4JX5A 3NM3A 3EZ4A 3AM9A 2CERA 1FEBA 5I5RA 2PGWA 4ICMA 1OT2A 2BNJA 4MY8A 1S2TA 3AYTA 1SMDA 1P43A 5D33A 1XINA 3KZPA 4QQUA 2XISA 1ZPTA 3LHWA 2VYOA 3WJSA 4IIBA 1BHGA 1HT6A 3LXAA 2XN2A 4NAEB 3CUJA 4A3UA 2AQOA 2GPTA 3HFYA 2ON3A 1KM6A 2Q6ZA 3D3FA 3T08A 3UWZA 2VOMA 1KC7A 1QPRA 4LFYA 4K37A 3GU1A 3EEGA 2E5BA 1XISA 3HJZA 5EPDA 3GM8A 3B04A 1S38A 2A5HA 4PZVA 1TV4A 4LT9A 3PP7A 4L5ZA 4MYAA 4RDZA 4MKNA 4GIRA 3AIUA 3NQ7A 4DRSA 1CYGA 4BI5A 1NPXA 2XVNA 2WSKA 2OPJA 1U1JA 2QVHA 1FVPA 2CLMA 4Z2HA 3M0XA 1C8YA 5I06A 3LRLA 3PAOA 5H8MA 4KQNA 1R3RA 1OX4B 3PUGA 4YTUA 3VDHA 3AO0A 3ALGA 4TV5A 4M3PA 2CITA 4G8TA 4W8BA 3S5ZA 3CTTA 4GD0A 4H01A 4PBFA 4DNHA 4Y9OA 1MWOA 1KXHA 1F6YA 3BE7A 3LZ5A 1DWAM 3LCLA 3IJDA 3C0SA 1XPYA 1ZRQA 3UJRA 3ABQA 1C9WA 2V5CA 3WEOA 4P8VA 4UTWC 3CBWA 4YWSA 1RA0A 5LIYX 4ECLA 4HPGA 3EOEA 5TNVA 2QR6A 3SJNA 3VYLA 1F8WA 1FWIC 2ZVRA 2CHOA 2NXHA 4OFCA 2Y8UA 4AB4A 4OT7A 5DQPA 3DG3A 4ZMGA 4YCPA 2WCSA 1TPUA 1ZLPA 4NVTA 1DIKA 1VCFA 1VZWA 3NGFA 4WKFA 3IGXA 4O4WA 4NI8A 1EJVC 1OFAA 2KZHA 4DZ5A 2D2OA 3MSDA 1DJIA 3KUMA 5AVHA 3H2AA 1J12A 3LGEA 1FRBA 1OBAA 2A3LA 5BU6A 2GUUA 4Q4RA 4Y90A 2OOGA 5G1TA 2X7WA 1BVNP 2EJ1A 2X1TA 3K8LA 1DXFA 5LZLA 4QG8A 2XIBA 5LIXX 5K9CA 2DZUA 1PKYA 1T99A 3PVFA 4ILSA 4IMEA 1HJQA 1BYAA 2ZWZA 3MHUA 4PB4A 2VGIA 3H53A 1TPDA 1VBRA 1POKA 3P6LA 3MZNA 2CLLA 4GKLA 1VCGA 1VBJA 4CCZA 1CNVA 1UZDA 4X60A 3AUOA 3QY6A 1WKDA 3VOHA 2CU0A 3R8RA 1NOWA 1QNRA 4JPGA 4Q8NA 8A3HA 3VOJA 3E2QA 2OXNA 4F40A 1A3XA 2PP0A 5IBXA 4J3TA 5HBFA 1I2QA 1LL7A 3REQB 2BFGA 4O0KA 2CHRA 2D22A 3ARYA 3C0JA 3DYOA 3PUOA 4JTDA 2V5JA 3G77A 3EXRA 2DIKA 1GQLA 2J9ZA 1PHWA 1YQZA 2YOCA 4JQ4A 2BHYA 4J2PA 4PH6A 4GY1A 1DPMA 4RE0A 1XGEA 1Z69A 1GOIA 4JOMA 3W1AA 4JKLA 3FDKA 3B06A 3MP3A 1G7VA 4N6FA 2RABA 1JUKA 1M7OA 5E9AA 3H21A 1EDQA 2IPWA 4G7EA 1IQ8A 1UIOA 1ZALA 2WZHA 2VUNA 4E3VA 4WRHA 1B1YA 2EPLX 2PDKA 1GVQA 4ZO9A 1GOKA 2XINA 1YNPA 1W5PA 1D2KA 3QZ6A 3EA3A 4ZE5A 2QCNA 2W5FA 4W5ZA 2GQ3A 8TIMA 2VD9A 3KLKA 3U2OA 2PZ0A 2CC0A 1UROA 3EXSA 2PDWA 5EBKA 3SSJA 2OSWA 5IFTA 2WOVA 3INPA 3NAVA 4UMCA 2WNNA 3E38A 1HKIA 2OZ8A 1UYQA 3OG3A 4BWLA 4J1OA 1RBLA 3VAVA 3TW6A 3MY9A 1EDTA 2V3EA 4TVYA 1XIEA 4N02A 3GFZA 1PZ0A 5DT7A 2X8CA 4HZMA 3S4TA 1OABA 3LHUA 1KFCA 3DJJA 5F4XA 3GTFA 4L65A 4K1GA 1UH2A 3SIZA 3HQPA 1Q6CA 3CUGA 1WV2A 4C6QA 1GOXA 2DSZA 3W28A 5CAHA 1J0IA 4LGXA 3D6NA 1ITXA 5E5CA 3VIHA 5U1OA 3IGUA 4GQ0A 1S2VA 2ZUWA 4CQBA 4LYRA 4NYYA 2Y70A 3DESA 1QI5A 2E09A 3CUHA 2UWFA 1DNCA 4C6CA 1IXNA 4M81A 3RCNA 1ADOA 3UJ2A 2CWXA 4O0QA 2AQVA 4HYRA 3L12A 3U6WA 5K9DA 2B4GA 4GHRA 4OBSA 1LPFA 3MPGA 4IPJA 3KWXA 3EB2A 2O56A 1HUVA 3P62A 1B2YA 2PGEA 4LB3A 1XG4A 3TMLA 4JTHA 3PUDA 3FW6A 1Q6OA 3SDOA 1XRSA 4WSKA 4GC4A 4F2BA 3LCGA 1K4QA 1JZ4A 4H4RA 1ECEA 2CBUA 4UQEA 4ZCWA 2QDGA 4H9YA 3BW4A 3PG6A 2G97A 1ZJAA 3VKBA 3B8VA 3C2FA 4LXFA 4DO7A 2PD5A 4GVIA 3V3WA 3N17A 3UWUA 3EYPA 1K8XA 3TCEA 1REQB 1TTJA 5HQEA 1LQ0A 4W85A 4WK9A 5DBTA 1TTQA 2DZSA 3IRSA 4CU8A 4C7DA 5I03A 4PL2A 3KRZA 2J47A 4UMBA 4DBDA 3CNYA 4PMYA 5I79A 1XX1A 4AYSA 2F6KA 2GJXA 4U4MA 2OR2A 4IP5A 2WBAA 1YYAA 1BTCA 4N9EA 2J25A 1VDVA 1BF6A 2PDHA 1XUUA 4FPSA 4OOZA 1LWHA 1PYMA 5FJUA 1QI0A 1WUFA 3IUHA 5BXTA 1KXTA 2EG6A 3NQAA 2R8WA 2OX4A 4LANA 4IPNB 5HPOA 3WUFA 2BHUA 2TPRA 1P6WA 5BMWA 4NXKA 1OX4A 1Q45A 3ITCA 3ZS4A 3S1WA 4L6DA 1TWWA 1WUEA 3TROA 4E8CA 3ZWTA 2Y88A 1W1B1 1THFD 3O0KA 1LL4A 3ETRB 3W24A 4L9XA 5I7GA 2JBMA 4D71A 3THAA 3KTSA 4WD0A 1JYVA 1T3QC 1VS1A 2JK6A 2ZRYA 1WXYA 4BF7A 2ZWYA 4D9PA 2G4JA 3UXIA 3CHDA 4OU1A 1JPMA 1TV7A 1NWUA 5JCNA 3TWAA 4HGXA 4WOQA 1I8JA 5DN1A 1HL8A 2VENA 1MEWA 4QG6A 1ZL1A 2J3NA 3N2XA 4W8AA 3CAQA 5C54A 4B92A 2YYTA 1PWLA 1W1A1 4LS1A 3HZ3A 1F73A 1MZRA 4P7QA 4DB7A 4K7VA 3A21A 3A7AA 3NVWB 5EL1A 4LS0A 4Q8WA 2XSAA 2PI6A 4LALA 2BOFX 4XZ9A 2E5AA 3P3BA 3AMZA 3GRIA 2C71A 4MNMA 2QCCA 4RKAA 1DEDA 5JMUA 3GRTA 5AHLA 4HD5A 4WVXA 4XZHA 2EBNA 2QUNA 4XK2A 4KFNA 3UF9A 3CTLA 1T6MA 4I90A 3QPZA 1AW5A 3VOGA 4M8UA 3QOKA 1NHSA 4WY0B 3M0HA 4PTXA 4JS3A 2B7QA 3O15A 2ZX6A 4YL2A 6TAAA 2XGZA 4RNFA 1OHLA 1NAL1 1OZMA 3W7DA 5IOBA 1V6TA 1F4AA 1U5JA 1M03A 4DIAA 4IPLA 2QGYA 2ZADA 4TMCA 1S39A 2I5GA 2ZRVA 1TRIA 3G5EA 1MFVA 1OG0A 3W85A 4XO6A 3NCOA 3IGSA 2JK2A 4QBXA 3ZR4A 3GHUA 1UWQA 1H61A 1P6CA 2WSPA 2J77A 1RD5A 4ZBCA 3VINA 1J2WA 4NRSA 1QTWA 5HMSA 4V1XA 4W7WA 3LBOA 3KVLA 3MSYA 2EPHA 5M3WA 4LJ3A 4S23A 3GW3A 1A5UA 1US3A 2YQUA 1B9BA 4QEHA 1D3CA 4IISA 3EX3A 1JCTA 3CZ8A 4EXBA 4FNRA 2WP6A 3S1GA 2QJGA 3JZEA 4M1BA 2Z29A 4ZQPA 5L9FA 1ZCCA 3BCFA 3FXGA 3MDWA 2VGFA 3GSMA 3R79A 2CLKA 4G1NA 1H50A 4GFSA 1X8FA 5E70A 1EP1A 1XKYA 2Y5SA 1OX6A 4KKXA 4KWWA 1CLKA 3C5QA 3WF3A 4IIEA 5I09A 5JVLA 1Z44A 3NIYA 3THQA 1K9TA 4LY8A 4JFTA 1ZGDA 4IG2A 3EDFA 3H2MA 5BOFA 4CQAA 5FF4A 6ALDA 3ANUA 4AEOA 3FHAA 4ALDA 5CZTA 3WFLA 1XYLA 3QR3A 2DY3A 1D9EA 2PGRA 4E38A 3PWGA 2WC7A 3L4ZA 3OO2A 4LUSA 3NZ1A 4MSSA 3L5OA 5HNRA 1RCOB 3T4WA 1VYRA 2J24A 2NW0A 3PZOA 1FWNA 1HP4A 1SZNA 5FS8A 1M7JA 4AH7A 1EWDA 1G4SA 2YIHA 3B8UA 1O66A 1P0EA 2NVKX 4DWDA 2PRMA 4YJ5A 2FH8A 2PC8A 3SR6B 4JKKA 3A4XA 1M7XA 3ERPA 3T40A 4UQBA 2XH0A 3PBMA 4J27A 1E6RA 1WQ5A 1OIMA 2BODX 4Z2JA 2DORA 2X0YA 4FIRA 4IPPA 3LGGA 4RK8A 3U7VA 4L1XA 3PANA 1BXCA 3ZLHA 5XIMA 4B5XA 2NPXA 2YLLA 3WH9A 1CZ1A 3PZ9A 1KBIA 2OQYA 1E3ZA 3S42A 2Q8ZA 2ZC8A 2X09A 4YTSA 2WANA 2OZTA 2XZ9A 5XINA 1G4PA 2PWGA 2OEKA 4GISA 2E1DA 3GU2A 5U4NA 4C65A 3SGUA 3ARSA 1J93A 4UBPC 4GO8A 1JF6A 4ZODA 3V4BA 1OCBA 3W1RA 4AHOA 3VCNA 4PC8A 1XR2A 3TAOA 4AIUA 4AVNA 3CEUA 1TPC1 1OF6A 3RIKA 3GXFA 4HZ8A 1WE5A 4HSHA 2BGSA 5C55A 2BOGX 4AZHA 5G5HB 2FDMA 1K9FA 1UWAA 1SSDA 1AG1O 4YYFA 1FKXA 2H9AA 1XQLA 3UCDA 5ABEA 1W56A 3VILA 3RM4A 3NZPA 4AZBA 2H3BA 3HGOA 1EOKA 1M6IA 5E93A 3G3DA 2QJIA 4LUYA 5T26A 5KETA 1Q13A 3RU8X 2J8TA 2AMXA 1N8IA 1RAKA 3IJQA 3QFEA 4I3GA 4FI4A 3SN0A 1NHPA 2TSYA 4GQRA 4B9ZA 4B5VA 4HPHA 4GR1A 1QWKA 4DBUA 2FH6A 3WD0A 4Q8MA 3BMVA 4H41A 4RUBA 3WLIA 5ENLA 3VM7A 4TOQA 3TJ4A 8XIMA 4UFHA 5I3FA 3QW4B 3OPSA 2Z1KA 4WQ6A 3VMNA 1AZ2A 4N4QA 3KBNA 5CJMA 4N42A 3RMEA 5CC3A 1PDYA 4MWAD 3T4CA 1ONFA 2OZ0A 3F2CA 1MOKA 5D9MA 1FY6A 1IZKA 3UNDA 1C7TA 3UEQA 3GX9A 4RNJA 2E0PA 3TR9A 3VFCA 3SO7A 1XBZA 1E1EA 1BYCA 1PIFA 2NLYA 1OK4A 3L68A 4UTJA 2GDQA 3POCA 2Y2WA 2V81A 1W2VA 4GK8A 3T42A 3CQ0A 3RJXA 3G8EA 3RAOA 3LM3A 2ACQA 4GZIA 2PWEA 1K9DA 3LSBA 2CYGA 4MWAA 2QYGA 4JGDA 1E43A 1GOWA 3POHA 4M6UA 1XYCA 3EWYA 2VX6A 3KRBA 3AJXA 4ZZ9A 4NNCA 1P7TB 4EM4A 1ICQA 3UNTA 2DEPA 1LLOA 4U2ZA 5JCIA 1EGVA 2YB4A 4H9TA 4UOQA 5L6UA 1ZJHA 5A8GA 4Q22A 1SVDA 1Q8JA 1XLLA 3G0SA 3U7BA 3WK0A 5T8GA 3OLGA 3BGAA 1EJRC 3MMTA 5A69A 2P1FA 3JW7A 3NSNA 1K7EA 3S5YA 3DC8A 1W6TA 3PBUA 2DZTA 3LHYA 2QDEA 2POZA 3B0PA 4GCAA 4QJ4B 4KCUA 2Y85A 5GNZA 1TVNA 4ZOEA 4W88A 3WD1A 4KIRA 3TQKA 3FHQA 2A7PA 4IH3A 4QAIA 4A22A 3GTXA 1HL9A 3N2CA 2NUWA 1QOPA 3BW3A 3E2RA 1V0LA 2J8GA 3N11A 1QXLA 1RSCA 5C6MA 2E7FA 4I7UA 4UTMA 1KXQA 3T0DA 3SY5A 4CN4A 2XUCA 4KETA 3RRXA 4GMEA 1F3TA 3H7RA 4KEUA 4AZ7A 3NXLA 1H4PA 1XCXA 4PODA 4XQ6A 3WK1A 4CD6A 1B31A 1KRBC 5DX7A 1NDZA 2FFCA 4OV9A 4JN6A 4BJHA 3T05A 4CCCA 3IIZA 4FOUA 2WLZA 4WSJA 4CNPA 2XG9A 4XVDA 3WLRA 4EE9A 4O1CA 4DM1A 4Z1YA 5D32A 1BQGA 1VENA 2X1UA 2ZXAA 2DV0A 4XZLX 3LENA 5CGQA 4WDTA 3LLDA 3GDKA 4C6OA 3CGCA 2OYKA 6REQB 4YVPA 2WMHA 4YXGA 1EYEA 3PHAA 2NVAA 2OWXA 1RCXB 3NQMA 4DN1A 1CLVA 1EHNA 2I57A 3HOJA 4HPNA 2PC4A 3BJFA 1DIEA 4GIEA 5MKGA 4Q7IA 3Q67A 1YE4A 2Q02A 4KS0A 3AIWA 4HOZA 3VNMA 1LOSA 4KWSA 3NPWA 4O15A 3MMWA 4O1EA 2GQ8A 2C8NA 3E0VA 4JTGA 4MPKA 1GOOA 3UCQA 2YCLB 1NP0A 1I9CB 1I0BA 2ODOA 4O54A 4HNCA 3PZGA 1LCOA 5JCMA 1UKTA 1TCDA 2WSYA 4IX0A 1PCKA 4Q4OA 5M17A 4PMVA 2HEJA 1P1MA 3B9JB 5C5YA 1KWGA 4RJEA 5HA7A 1E4NA 3HG4A 3BLIA 3DBPA 2ISWA 4AXKA 1O1HA 4XZBA 3RCYA 3JVAA 3UY8A 3MKVA 4PTWA 4WY0F 1CGYA 2O9PA 3CV1A 5AHMA 3PUEA 1QHZA 3GRSA 1U22A 4XTIA 2REQB 3K8KA 3NS1B 3GDRA 3GNXA 4GVHA 2CXGA 4XG1A 3N9RA 4G7FA 2NVCA 4NT0A 1HZYA 1HKMA 3RM9A 2WNZA 3SI9A 4PUEA 4GZJA 1US0A 2R1MA 2Z1BA 3WN6A 4ZSUA 1UOZA 4O14A 4PN2A 3NEHA 3R12A 4S2BA 3BCJA 3A5VA 3E49A 5IHRA 1XHCA 3W7EA 3GIYA 3B4UA 4HTYA 3V7PA 4RZ4A 1F3PA 1T40A 3IVTA 1H7OA 2PDMA 2JEQA 3OJGA 3H2NA 3VTRA 2Z24A 2QIIA 3SUTA 4OV4A 2ZUTA 2FHBA 3D9XA 3VGFA 4LAUA 4L1GA 4CVWA 5D9PA 4ACZB 1VYPX 3O0HA 2F9RA 3LCIA 3DK8A 3N4EA 2DJXA 5FEXA 3VIMA 3W81A 1B3OA 4H9VA 3TMQA 3OLIA 3WDQA 2YW4A 1X6NA 4HYVA 1I45A 1SFTA 2E9BA 3WCZA 1AW2A 3MMUA 2HPMA 3WNOA 4BCEA 4J28A 1LWIA 1R9XA 2OVLA 1RA5A 3PZVA 2PA6A 3EMQA 3VD7A 4UOJA 3U2EA 1ZSXA 3GR4A 3ITLA 4PTDA 4FR1A 1PL9A 3I6EA 3NO5A 1DTNA 1ZUAX 4UFLA 2VO5A 2QW5A 4GUHA 2QV5A 3TYZA 3VIGA 2WKJA 3VM5A 2PTYA 4CQ9A 5D04C 3FA3A 3WEMA 5HINA 4MJMA 5K2ZA 4QDPA 1VQZA 3KVMA 2BSLA 3B8SA 4HMEA 4HNLA 2DZWA 3QBUA 2GVYA 4ATWA 4UTHA 1TIMA 5HR7A 2PDFA 1ZBCA 4LC8A 1TB3A 1FWDC 3WH5A 4U5IA 1MDLA 5CBBA 3CGDA 3BJTA 1SFLA 5B7YA 4FXFA 4BA0A 1W9UA 1M7PA 3ZLGA 4KT2A 3WD3A 3O6DA 1JQXA 3FLUA 3S5SA 2CESA 4F66A 1X38A 2VELA 3W01A 3PSVA 3WUEA 2WZTA 3ITYA 2NLIA 3Q45A 4R33A 3SCPA 1VEMA 3P5YA 3TA9A 3W7KA 3WO8A 2W4XA 4ZO7A 1WB0A 3A7UA 4DPQA 3FYOA 5LYRA 2EGZA 2R91A 3XIMA 1XLJA 3ZZ1A 3GVWA 1UB3A 3UFYA 4NJGA 5A94A 5EY5A 1T8QA 4IT1A 4D1IA 3GC2A 4DHGA 3GY1A 4H9UA 1QOXA 1E4IA 1VPXA 3I4EA 4DY1A 2E6DA 2V3GA 2PBGA 4CD8A 2W9MA 2Y8KA 2HXTA 4EF9A 4FXJA 1WDSA 2VRQA 5JU6A 2X99A 1SGJA 2XM1A 1UZHA 3LHZA 1IWPA 7A3HA 1LBLA 2ZUSA 3CUFA 1UWRA 2P0OA 3HPSA 1VHNA 3PJXA 3PC0A 1A4LA 4PB5A 3WLJA 3HA1A 5I3JA 4B5UA 3N73A 4YS1A 5HJLA 3EUB3 3REQA 3MO4A 4OJYA 3RR1A 1TTPA 2W67A 3DIPA 1HKVA 2OMAA 2GVEA 3RUBL 3M43A 4DZAA 2X2YA 3FAWA 3F4NA 2XSXA 1XC4A 1OF8A 3C61A 3M4HA 2FPVA 4N7QA 1F8MA 4ACZA 2A3BA 1OY0A 3DK9A 2CEQA 5HWMA 1OD8A 2HNHA 1SZRA 4JDYA 3T2OA 3VKJA 2WPEA 3STCA 1RQHA 1FH7A 1ICPA 4MNJA 3P0XA 3DERA 1PTGA 4GVGA 2PDGA 4E4FA 3XINA 4LTSA 5I07A 2EF9A 2W0UA 2D2JA 2JIWA 1IWBA 3QQ1A 1CW2A 3FK4A 3QW3A 1PB0A 3BMWA 3R11A 1OK6A 2A3CA 1TJ1A 4HU0A 2PBOA 2OWWA 2VQTA 2VTFA 5AZ1A 4NL1A 2OKOA 3LERA 1V77A 1BVZA 3T0BA 5EFFA 4MWAB 4QRNA 1EWEA 1UD6A 2W3SA 3TN3A 3QQ0A 1V02E 4XB3A 2VDHA 5FEPA 2E5CA 3NUKA 4EK7A 4JFSA 2BY3A 5FSEC 1W3IA 5FKYA 2ZUUA 3KBMA 1GK8A 1Q5MA 8CGTA 3RRAA 3TW7A 1PKMA 4H7CA 5FF2A 1N63C 4ZXLA 3VPLA 5JCLA 3HURA 1JPIA 2WVVB 3MO7A 3SRKA 1PXGA 5DY3A 4S3DA 4K39A 2V82A 4FMVA 1LQ2A 4J3ZA 4GYPA 2VCBA 1HXJA 3CAWA 2J7EA 4NJHA 3N2TA 1CGXA 4TVDA 1E1FA 2O4QA 1I0DA 1Q4NX 1GPWA 4LUTB 5FS6A 3CIWA 2DZPA 4QM1A 3R13A 2MUCA 3S6TA 3H4WA 4FHAA 1F07A 1PYFA 1TUXA 2BLEA 3CHEA 4U31A 4O1FA 1OYBA 1UMYA 4HMCA 3HPZA 1D7YA 3MYPA 4Q32A 1V3KA 2J78A 1PAMA 1R6WA 2A21A 1SJAA 1QDSA 3GG1A 4DUXA 5FF7A 3DFQA 3WYZA 2VR2A 3MV11 3GG8A 4NJKA 1SFJA 4LU0A 1P0NA 3AZSA 3EAOA 5DT5A 1IR2A 1O5XA 3HG2A 3HQ1A 1PZ1A 1B90A 3BANA 1UR8A 4QP0A 3U5YA 4YMZA 4MADA 1V0NA 5BWFA 1E4LA 3UPMA 4HMNA 4XIAA 1S1PA 2QZRA 3ZJ7A 3UZJA 5K7JA 4U28A 4JIQA 2VCAA 1F3WA 1C9DA 4JQ9A 1Q65A 1KA9F 2FKPA 4GQQA 1VPYA 3ENLA 2XVLA 1NY1A 4TVUA 3M0ZA 4G9PA 3WLQA 2VFHA 4PBGA 1R7OA 7ENLA 1GV4A 4LUJA 5REQB 1L8NA 3VDBA 3NL6A 3QC3A 3EPNA 2I1OA 3WBYA 1KM3A 3HTWA 2D2GA 3H2OA 2X41A 3C8FA 1TR9A 4GO9A 3A22A 4Z2LA 5IBXC 3OYXA 4UTKA 1FH9A 1XH2A 3N9SA 3EWCA 4CCDA 4ROPA 5D9NA 1KLZA 3GD3A 2PLJA 4PMRA 2OWCA 3VIJA 3LX9A 4H83A 5CG7A 4GGBA 4XBJA 5LA0A 1JUBA 3E5PA 3B0VC 4JX6A 3H4XA 3WBEA 4BF5A 2HNEA 2A8XA 2P50A 4DJDA 4PCSA 3T09A 4H9MA 5CC6A 2AQWA 1XXXA 3DGHA 2WZEA 1EEPA 4M51A 1X1OA 2OU4A 4XD3A 4LOCA 1NHQA 5K3VA 8XIAA 3N12A 4M6PA 2QJHA 5G4EA 3O07A 3IUIA 3R0UA 2REQA 9XIMA 1D8WA 2GR3A 2W3RA 5LHFA 3T1GA 4AEFA 2EJAA 4D6FA 2O0TA 1YPFA 1DOSA 2C1IA 3LI1A 4RE2A 3IJ6A 4JHZA 2GVJA 3E0WA 1YHTA 2A3EA 3H8AA 4D6IA 4AW7A 2DH2A 2J75A 3SR7A 3RLGA 1XIFA 4FXSA 3BLKA 4AFYA 4LVAA 1KQZA 4TX9A 3VD3A 4CD7A 4MAZA 2G4FA 4I5UA 3EAUA 1TJ0A 3B9DA 3SIMA 1YNQA 1UD8A 3UG5A 2PDBA 3R7MA 1RPKA 2SFPA 1TVPA 3LN3A 4UOZA 2BP1A 3CUXA 1GVYA 4MDPA 1ELSA 4WJEA 5CSRA 2J9YA 1G9HA 1CGUA 1YTDA 1ME9A 1PHQA 4US5A 4ASTA 1K7XA 2O9RA 3CUIA 3DGBA 2GR2A 1DHKA 2MNRA 4C90A 1EPXA 4GNJA 1NFGA 5A6AA 2CBJA 3RXZA 4IFRA 1ZK7A 3MI2A 1GONA 5C70A 1IEIA 4XKYB 1JCMP 5EA9A 4HHMA 3EMCA 5FJIA 1JD7A 2Y6ZA 5FF3A 4ADWA 1PIGA 1REQA 4CNSA 2ACSA 4LVDA 1JAEA 1DXIA 1GG0A 5CAKA 3I3DA 1KW1A 3KBSA 1JCJA 3LK6A 2V3AA 4W93A 3WLHA 4JDRA 3QF0A 3SEPA 2XIIA 3M46A 4IIHA 2DT1A 2B81A 4CQ8A 5HWNA 3Q4DA 2OLAA 3PFMA 2RFGA 1T96A 3IV3A 3T7VA 3QOMA 2R14A 1ONWA 4O8RA 1A4MA 2GJRA 2CNCA 1GVOA 2I5IA 3EWUA 4NZFA 5ABFA 3G6LA 3W7RA 3KL5A 3FJ6A 1KV8A 1GVSA 3PR2A 4JNMA 4P8UA 1ZMDA 1EHAA 2VL4A 1JDCA 3VDCA 3PTMA 1I2RA 4KRZA 2DUAA 2BVYA 4EF8A 3O0FA 4PEKA 4DJED 1F4HA 2VOTA 1N55A 2QDDA 3CQKA 1QI2A 3WF0A 4GI6A 3PM6A 2BVDA 2WWCA 4K3ZA 1PDZA 2VM8A 4RE3A 4JYEA 2JALA 2Z25A 1CXIA 2NX1A 3NVVB 1D8CA 1UPPA 3KS5A 4JIPA 1HNYA 4XUGA 1SFSA 1XW8A 2DFAA 1Q7ZA 3SBFA 1ECQA 4BFAA 3UVIA 5LKYA 1MUMA 5U25A 1ADSA 1CBGA 3KFTA 3OZOA 4WY0A 3ZIZA 1DQXA 4PA8A 4L7ZA 3RN6A 1PX3A 4KWUA 4L80A 1W8SA 5FCZA 1QBAA 4TTUA 2VZVA 3P60A 3VNLA 5HPCA 5KITA 4GC3A 1BKHA 3VNYA 1HJUA 1U5HA 3TNOA 3ZMRA 4PBEA 2YAUA 4HA0A 3STPA 5KVHA 3BVJA 4MLRA 3G24A 2VX7A 4Q7BA 3RDKA 5DRCA 1DJGA 1UR2A 3LG3A 5E0CA 4EMJA 2ZZ0A 1EC9A 5CZSA 3GNPA 2FPTA 3N4AA 3BH4A 2D0FA 3IVSA 1C8VA 4EVZA 5JQ9A 3B0YA 3K30A 4X61A 5BXSA 1E0XA 4JFUA 2Z1WA 3E2SA 4Q7NA 1QMLA 4B5NA 1VEPA 3RLUA 2W54A 1GVRA 3ZFHA 4G6CA 1H0IA 3HMCA 4UWMA 4EAYA 4JY8A 4J3WA 4MHBA 3GC4A 1W1ZA 2WPGA 2WKLA 1QHPA 5LA1A 2DZBA 1W3KA 3ZR5A 1AQHA 4MZYA 4FLSA 4AQLA 4QDMA 2PDCA 4APNA 1YTKA 2DZAA 4RDWA 5G4WA 3GS6A 4H8NA 4I6VA 1EOMA 1VF8A 1AFSA 4MDOA 4QQ3A 1TPWA 4H9ZA 1OB0A 2CWNA 6XIAA 1NVMA 2O9TA 1WDRA 1EBGA 3WMBA 1GORA 1XP3A 3SQLA 3UWVA 1SB3B 2A6NA 1GRHA 3LB8A 4LYPA 1RVKA 1T41A 3KBVA 3SCNA 3HBLA 1DE5A 3KX6A 2PS2A 2WLYA 1Q8AA 2OEMA 5KVIA 3O3RA 1YDNA 3RITA 7REQB 2A3HA 4QGCA 4HT3A 4HJWA 2V2DA 1FP8A 5F2LA 4O53A 5I2UA 1JOAA 1A0DA 4LQ1A 4H4UA 1V3IA 1FBAA 1IR1A 4LAKA 1K6WA 1O68A 1V0KA 1R87A 4CD4A 5FSDC 3DUGA 5CJNA 3USBA 3W86A 4QE4A 4IIDA 3NRZB 1DJWA 1NP2A 1GQKA 2GQWA 2NXGA 1P6BA 4DAIA 3CWNA 1ONXA 1O5RA 2Y7EA 5FD0A 4GH3A 2B0MA 3R25A 3SQMA 1YADA 3MKKA 3URHA 2OT1A 2QCEA 1R3YA 1IT7A 3ORWA 5A6TC 1G94A 1DJHA 1W54A 4ES4A 5FF0A 4JIIX 3WQPA 1GERA 4AZIA 2PD9A 5AHFA 1TX0A 2X30A 2E8YA 2QCDA 4P5UA 1W3TA 2INFA 3MT1A 4US6A 4TMBA 2QVNA 3KHJA 3N6JA 4KW2A 1R3VA 1E9ZB 4LV4A 3WK3A 4Y8EA 3WDHA 4OECA 1LQAA 1US2A 3L0GA 2E68A 4K1WA 3BGGA 5A6KA 3DH7A 1V3LA 1KXVA 1CENA 1EIXA 4JTJA 1J79A 2XH4A 4DJDD 3N4FA 1JI1A 3GNNA 2FB3A 2GGGA 3AIRA 3UWQA 3CXBA 3E02A 1XD1A 1BQCA 1ME7A 4IP7A 4GZ7A 4TXEA 1MQQA 1UD4A 2E28A 2HE8A 3L5MA 1LWJA 1R86A 3WJWA 3I6RA 3KLLA 2OT0A 2VQUA 4UCGA 3TN6A 4S3GA 4YYCA 3IEBA 5LGZA 1C92A 4Q4KA 1I2OA 3RM8A 2A4AA 4W87A 3ABRA 1SO4A 3OZYA 5G2HA 3AIVA 1Y8BA 4PMQA 1IEWA 4ZQNA 3I3EA 2ZKMX 5I3DA 2HXUA 5REQA 3H6OA 2NZLA 3MCOA 1TV5A 4Y7EA 2J4GA 1SR9A 2R82A 5A8OA 3FYYA 4LBUA 1OG6A 1AK5A 3MTWA 2ZA1A 4NJIA 3S9IA 3MV01 2QMJA 4DJEA 5BWAA 5AHIA 3O9NA 3VGEA 2DIJA 1HFBA 4Q8VA 3EA1A 3KEHA 3W1NA 1I2NA 4FALA 2BC0A 3II1A 3M0KA 2C1GA 4L6HA 4EX4A 5I3HA 2WHKA 2YR1A 1D3HA 2VCCA 3DGRA 3W3OA 2P8CA 5C9XA 3ARZA 3G1RA 3TU9A 4LX4A 1UR1A 5CXPA 3E96A 5DO8A 3BW2A 3M5VA 1XIMA 1F61A 4MY9A 3DG7A 2POTA 2E25A 2D0GA 1IEXA 4YVVA 5AFDA 1NHRA 3SAZA 3HJEA 2QKFA 1MW2A 2E67A 4WR3A 1S5WA 5HNNA 3LCFA 1UC4A 4P7RA 3P7YA 1KM2A 1HJVA 1W1IE 3ISIX 4M24A 1EJUC 1O94A 2Z2AA 4YNGA 4X2PA 3KZSA 3H4KA 3O6AA 3MI6A 3ZWSA 1HJSA 1X97A 1K1DA 1FWAC 3QR0A 4JKMA 4NF7A 2DUZA 4HYWA 2VEKA 1WCGA 2NQJA 3THDA 1XLEA 3OTRA 2BY0A 2P8BA 2WAGA 3KE0A 2WPCA 2ZE3A 5E1QA 4JYFA 2I16A 3GXMA 1XUZA 1MSSA 4A3YA 1E9YB 4IFKA 1KV5A 4AD2A 3PBWA 3IGHX 1XWYA 3RLVA 1PEZA 4Q8UA 4PCTA 3VNJA 4MGGA 3WX7A 4FX8A 1J5SA 4DQWA 1DIOA 2PZNA 1BEUA 4J35A 6XIMA 1PBGA 1Z3NA 1S2AA 3MVIA 4NU7A 3TN5A 2BY1A 1LTDA 1YIXA 3CWHA 2PCQA 3KTCA 2VXNA 4MNKA 2FZMA 1EF2A 1JI2A 3PZUA 4DF2A 2Z1XA 3K8MA 5FL0A 2FGLA 5E6YA 2DDXA 3QGAC 2WMJA 2ZOXA 3ARXA 4K2SA 4CGTA 2YPIA 1VCVA 4UR9A 4PUJA 1BRLA 1YXYA 3R8HA 2WMIB 3N2MA 4B9YA 4L6OA 2Z6IA 2O7SA 4IUOA 3RLHA 3K4AA 5C9UA 3GAKA 1I2PA 4MPQA 3G0XA 2ZZ4A 3CZLA 1O5KA 3N04A 3GH5A 1T8XA 4Z08A 3CZGA 2D69A 5KSWA 5IRPA 3WF2A 2O92A 1PSCA 3WQ5A 1K6AA 2ZXDA 3WUBA 1QNOA 4MB3A 1WAUA 2I56A 3MYOA 4PMOA 2WSQA 3PZMA 3AU2A 4JHMA 1NDAA 3W7IA 3KOFA 1PZ3A 3OBEA 1UD2A 1FWEC 4FNUA 2YYUA 3FKKA 4IXHA 4MYXA 3NQ8A 4V28A 1AW1A 3PSWA 1IZCA 2G95A 3DG6A 3OBAA 2TPSA 3L66A 4UR8A 5BU9A 2VR4A 1CWYA 1JZ6A 5J5RA 2WCAA 3UD6A 2D0HA 2PUZA 4BI6A 4DUOA 4GJ1A 2V0TA 3GW0A 3ZSSA 4MF4A 1JL8A 4FF7A 1WXJA 2AL1A 4XBSA 4R7WA 2CDUA 1JAKA 4IMCA 1PKLA 2GFTA 1UH4A 1V6UA 2E1WA 4QISA 3AMLA 2J7GA 4AZCB 1A47A 5HNTA 1K4HA 3EWZA 2EXOA 2J62A 3XISA 1K03A 3DBNA 1VKFA 2QCLA 4RPQA 3GH4A 1LRNA 1MMFA 5F1UA 3PNUA 4NAEA 4LRSA 1XH1A 8RUCA 4ZOCA 1ALDA 3SRFA 1ISYA 1VC4A 4HK6A 4R9OA 1V02A 4S3EA 2F6XA 3PPHA 4MMWA 1EEXA 3DXIA 1XLBA 4R5EA 3I7SA 2XVPA 1H7XA 4JN8A 5M2FX 3WLLA 4YVXA 5E09A 4PCNA 1RXOB 3RR4A 4HMDA 4D8LA 3ELFA 4UNLA 3CPRA 4CQDA 4FXRA 4DJFA 1K7FA 4M7SA 3NO1A 3U4AA 1UASA 3EX1A 1BG9A 4FNTA 1K8YA 2W61A 1SZEA 2PLKA 2QCGA 2VRJA 1BXNA 3SY1A 4D72A 1DJZA 1A5MC 3H12A 3F2DA 4IG2B 1R9ZA 4UFKA 3BO9A 2ZZ3A 3F7JA 2DGAA 4LRTA 3ITVA 3W26A 1CB7B 4I6KA 1FIQB 3L4WA 2PDUA 1KGWA 1XYFA 2WV8A 2EPKX 2HWGA 3OODA 2XHYA 3R5EA 4DWSA 3S9YA 1J01A 4G1KA 2IUZA 4XAGA 4ZTXA 2G3MA 4WDUA 3A3WA 4GZEA 2WPFA 3EEZA 3WMLA 3G1SA 1MRAA 4TU1A 5CSSA 1B4KA 3MUZ1 5HDRA 4RNIA 5GVJA 2YJQA 3S83A 3SY8A 1E55A 2QCFA 1B3XA 2X40A 2R6OA 2QNEA 3NQ2A 4MUZA 3DFHA 4H7VA 4M29A 3PZQA 5ABTA 2J9XA 3P80A 1GKRA 4BQ4A 3VIIA 2CCRA 1FHVA 4MIMA 2Y61A 3KS6A 3ES7A 1UPMB 1KTBA 2JIEA 1RJPA 3TR2A 3WLMA 3Q6JA 4ZOHB 4X9SA 3RU6A 1XSIA 4C7GA 3ZJKA 5HOSA 3ZT6A 4UB9A 1KNWA 1IIGA 2RJGA 1TFVA 1H60A 1Q1WA 1XLCA 2YA2A 1HX0A 2PWVA 5H91A 4K7ZA 4ZTYA 1EP2A 3M6DA 1ODZA 3NM1A 4W4QA 4M0XA 2YBTA 4HB7A 2YBUA 3G1DA 3WQ4A 2VI0A 5A8QA 3N1AA 1X8CA 3M07A 5A3HA 2VFEA 4AYGA 1MW1A 3RGTA 4XD5A 4X0VA 4GI4A 2NV9A 2CZEA 4AZ6A 3AYVA 4GVFA 4E2DA 2C14A 4FNQA 1O7AA 1Q85A 1OZQA 4D6CA 3LMZA 1Y7VA 3WQEA 5AC5A 5C2XA 2F2HA 3LCXA 5SWUA 1R2RA 3EF6A 2V68A 4WSHA 3BOFA 5CKSA 3NOEA 5FJRA 3HFTA 1R38A 4ZL1A 2VKZG 5BRQA 2GK1B 3TYAA 4H2HA 1FWWA 3QV6A 3QN3A 2CZDA 3P82A 1W32A 3U57A 4O4VA 1NWRA 1EX5A 2ALRA 4KFOA 5CGTA 1GCYA 3WIJA 2C16A 3BL3A 3W27A 3URBA 1GTHA 1B0IA 4BK9A 3QFWA 2RDTA 4FX9A 2O9OA 2BC1A 1F9CA 1J6OA 3TVAA 3NGJA 5A6SA 2EQ9A 3I6TA 1R8LA 1XBVA 1DQWA 2V5LA 4GUFA 1H3GA 3ITOA 1XRFA 2R1KA 3MUXA 3STFA 2HTMA 2VVSA 2CLPA 1XFBA 2XN0A 3SGGA 5F2IA 2XIJA 3UETA 2ZUVA 4C6KA 2IQ0A 4K8HA 2ESCA 3W74A 2WM1A 4LCQA 2CLIA 4PCPA 3NZRA 2V5DA 3QH2A 3WQWA 3OVRA 5JXQA 2QUVA 1KFEA 4YCOA 1RP8A 1I1XA 4KPLA 3TV8A 3P61A 4CNTA 3OU8A 3ITXA 4PEEA 2YBVA 2GQAA 4B2DD 5CSUA 2C13A 1EO5A 3APYA 4FLQA 4AY8A 4PUKA 4DM2A 3L21A 3FAXA 2V5BA 4OIFA 2ICSA 1G1YA 3PNZA 3DC0A 4US5D 4ONVA 2WNWA 4NNBA 5FL1A 4C1NB 3CZEA 4KRTA 4B4HA 4E6MA 3VD5A 4HNOA 1GYNA 3VD9A 3DK4A 3ARVA 4GXMA 3CV7A 1M01A 3BARA 2GR1A 4P2VA 3O2LA 5DLCA 1HGYA 1A3HA 4C1LA 2DSUA 2HBVA 3BLDA 3UZXA 1Z48A 1WOAA 4C6NA 1V6VA 2L5HA 4NSBA 4E2VA 1TREA 3GFXA 4IGNA 1U33A 4GX8A 3T0TA 4B5TA 1W9VA 2WWDA 1W1PA 2ZQ0A 2NUXA 5BOOA 1WDQA 2CZVA 2CW6A 3VX0A 4PMZA