4HYRA

Structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
442
structure length
442
Chain Sequence
b'LVPVITKMEVYPVAGHDSMLLNLSGGHAPYFTRNIVILTDSEGNTGVGEVPGGPKITTALENVSDIVVGTKVSDYRNTLLKVQAELDKSGEKDERGAQTFDLRTGVHVLTAIEAPCLDLLGKALDMPVCRLLGAGQQRDFVRFLGYLFFVGDRKKTDLPYQSEEDSDCEWYRLRNEEAIDAEHVVALCKAAKNKYGFKDFKLKGGVLRGDEEMKVIKAMKKAFPDARMDLDPNGAWHLDDAVRYVADMHGILTYCEDPCGAEDGYSGREIMSEFRRRTGFPTATNMIATDWRQVGHSLESQAVDIILADPHFWTMNGSVRVAQMCHEFGYTWGSHSNNHFDISLAMCVHVGAAVPGEYNALDTHWIWQEGRERLTKEPLKIANGGIKVPDKPGLGVEIDRDQVMKAHELYKKHCLGARNDAITMQYLIPGWKFDAKSPCLVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucarate dehydratase
publication title Structure of putative Glucarate dehydratase from Acidaminococcus sp. D21 with unusual static disorder
rcsb
source organism Acidaminococcus sp. d21
molecule tags Lyase
total genus 144
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hyrA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hyrA01
2O56A 3R25A 3BSMA 3V3WA 3Q45A 3FXGA 1XS2A 4Z1YA 2OKTA 3ES7A 1EBHA 4HCDA 3H8AA 4HYRA 3MKCA 4ENLA 1TKKA 4MKSA 3NFUA 3V5FA 2QGYA 3UJSA 3GD6A 4IP5A 2PP0A 1EC7A 3BOXA 3MQTA 3R0KA 3TJ4A 2MNRA 2OQHA 1R6WA 5FJTA 5BOEA 4H19A 3TWBA 3MUCA 3BJSA 3T4WA 2AL1A 2PP1A 4DX3A 2PCEA 4H83A 3VC5A 2QJMA 4GYPA 2DW7A 3D46A 2P8BA 4HN8A 2GL5A 1SJDA 3R11A 4Z17A 2QJNA 3B97A 2PTXA 1MNSA 4HNLA 1P48A 3UJRA 2PU0A 3DEQA 3U9IA 4E5TA 3NZGA 1SJCA 4IHCA 1ELSA 4K8GA 2ZADA 3CK5A 2OX4A 3H7VA 2HNEA 3H70A 3UGVA 2QQ6A 2QVHA 4H2HA 3RCYA 2AL2A 3RR1A 2XH7A 3MZNA 3S5SA 4E8GA 3SJNA 3CXOA 3QTPA 1MUCA 1JPMA 4E6MA 1IYXA 3U4FA 3EKGA 1KKOA 1P43A 2PGWA 3SBFA 2OLAA 4HCLA 3JVAA 3SN0A 3JZUA 2AKZA 3CYJA 4E4FA 3SQSA 3MY9A 4KPLA 2RDXA 4DHGA 4IZGA 2OZTA 4K2SA 3ES8A 3HPFA 3DERA 3TCSA 3V4BA 3NXLA 3UXKA 3Q4DA 2QJJA 3FVDA 3I4KA 1OEPA 3GC2A 4IT1A 1SJBA 2PSNA 4JN8A 1EBGA 3S47A 3TQPA 3UJFA 3DFYA 3VCNA 2OG9A 3DG3A 1L8PA 3N4EA 4ZCWA 3GO2A 2XH0A 4HNCA 4FI4A 2PP3A 3UXLA 2QDDA 2PPGA 2AKMA 5IDZA 3V5CA 2QDEA 1E9IA 3UJEA 2HZGA 1WUEA 2GGIA 2ZC8A 3RRAA 4A35A 2OFJA 1RVKA 4J3ZA 3ZVHA 2OQYA 3DFHA 3IJIA 1MDRA 3TWAA 2OPJA 2GGEA 3DG6A 3R1ZA 1ONEA 3N6JA 3N4FA 5FJPA 5FJUA 3H12A 3NO1A 3OZYA 3ZLGA 4KT2A 4MMWA 3MSYA 1EC9A 3QPEA 1PDZA 1R0MA 1ECQA 3DDMA 4M6UA 3ZLHA 4A3RA 4FP1A 2HXUA 2OVLA 2PTZA 4GIRA 2PA6A 2PODA 4M0XA 3RGTA 5ENLA 2DW6A 3T9PA 3OPSA 4H1ZA 1FHVA 1FHUA 1KCZA 1BQGA 1NELA 3UCDA 3EEZA 3FJ4A 3OW1A 3PFRA 4A6GA 4E4UA 2GGHA 4J1OA 4DYEA 1MRAA 1KKRA 4JHMA 2P3ZA 2NQLA 3JW7A 1PDYA 4GISA 3N6HA 1W6TA 4IL2A 5FJRA 4JN7A 2PGEA 3MWCA 3ZLFA 3FCPA 1YEYA 3TJIA 2GGJA 3SSZA 3D47A 3OP2A 2P0IA 2I5QA 2GSHA 3R0UA 3DGBA 2FYMA 1F9CA 3CAWA 2AL2B 1WUFA 2ONEA 4G8TA 4G7FA 5EU9A 1EC8A 2PTWA 1JDFA 3P0WA 2CHRA 3FYYA 2XH4A 1TE6A 4MGGA 4K1WA 3VFCA 3TTEA 3R10A 4HPNA 3KUMA 3SN4A 3T8QA 2XGZA 2P8CA 3K1GA 4GFIA 3OTRA 2OZ3A 3DIPA 3VDGA 4X2PA 4DWDA 5BOFA 3ZVIA 2PU1A 1BKHA 3IJLA 4YWSA 1KD0A 2OO6A 3DG7A 3THUA 4DXKA 1NU5A 3FV9A 1JPDX 2GGGA 3UJ2A 2HXTA 3T6CA 4IL0A 3PK7A 3VA8A 2XSXA 2OZ8A 3GY1A 3ZVHB 3P3BA 1DTNA 3VCCA 3RITA 3IK4A 7ENLA 3OZMA 3QN3A 3I6EA 3P93A 2P88A 4ROPA 1JCTA 3TOYA 2PTYA 3TW9A 4KWSA 2POZA 1TZZA 3CB3A 4EWJA 3I6TA 3DESA 1XPYA 4HCHA 3PWIA 3QLDA 3STPA 2FKPA 3SN1A 5J04A 1SJAA 3IJQA 3VC6A 2MUCA 3UCCA 3PWGA 2XH2A 4GGHA 3QKEA 3RO6A 4F4RA 4KEMA 1MDLA 5FJOA 2GDQA 4DN1A 4GMEA 4IP4A 3ENLA 3CT2A 6ENLA 4ZA0A 4GYPC 2PMQA 4GGBA 2PS2A
chains in the Genus database with same CATH superfamily
2ZIDA 3D6NA 5TQLA 4EMIA 1KA9F 2E1WA 5FS9A 2C1GA 2YL6A 5AY7A 1M7PA 1X8CA 6PTDA 2ON3A 5FF7A 3EPNA 2HRWA 2ZA2A 3ES7A 2WMIA 5F4WA 1NH6A 2FFIA 1N82A 4BEQA 1JXJA 5EMJA 2AGKA 1DP0A 4MKSA 1Q6LA 1ZB5A 1Q7MA 3KTXA 2E77A 2X16A 3E38A 6XIAA 5B7YA 1QASA 2PZ0A 1IT0A 2J9YA 2YIHA 2RFGA 2YZ5A 5AFDA 4IMCA 1XP3A 4IFKB 1KBLA 3N14A 4H4TA 2AL1A 2ANUA 2O92A 3WG6A 1W5MA 2ISVA 2FFCA 4DX3A 1IEQA 2YSWA 4DUXA 3ITOA 3KHDA 5HANA 4DM2A 3WDRA 1W3IA 1V0KA 5CAKA 3VILA 2CKSA 3A12A 3NWRA 1WPCA 4DWSA 3MPGA 3O06A 1OX4A 4AX7A 1X8FA 3B97A 4E38A 3UJRA 3G1AA 3ARQA 3WBXA 3QV6A 5GNXA 2V0TA 4JCLA 4DJDC 1B4EA 1AW5A 4RX0A 3AXKA 3QXBA 1VYSX 4NNBA 1JF5A 1XIEA 4YWIA 3H7VA 2A6NA 4M80A 5I3GA 1U5HA 2PDQA 1TV2A 3GUWA 4WD0A 5DANA 4GCAA 4MAZA 2AL2A 1UOKA 4XZWA 2QIWA 2V5BA 2V3FA 2G41A 3MV01 2WBKA 3TYZA 3H2OA 5BWFA 5CPMA 3SFWA 3LHZA 1FCUA 1IWBA 1KKOA 1G6CA 2PRLA 2ZC1A 4HJFA 1OM0A 5GPRA 3LOTA 2HE8A 3U4AA 4OVXA 2VGGA 2GJRA 2J3NA 2C15A 3KOXA 4JX6A 3WUBA 4TVWA 1ME9A 2WLYA 1R2SA 4DELA 2C13A 4DHGA 1J79A 3DC8A 4K6AA 4ZO7A 3ES8A 4P7OA 3PBYA 2EF9A 3NL5A 2A0NA 2Z00A 1V7AA 1B3YA 4EVZA 4DO5A 3A7RA 1HKVA 4JS3A 4BI7A 3M5ZA 1LWIA 2ABAA 3DFSA 4EK7A 3UG8A 2JEPA 3GAKA 6A3HA 4IFOA 1P6CA 1VBHA 2ISFA 1JULA 1UH3A 4J3WA 2IPFA 4HTYA 3NQFA 2HZGA 3RLVA 1Q7QA 4QSFA 4RE4A 4FF5A 4C1KA 3O15A 3LHTA 4UTLA 1FHDA 5EKYA 2QVNA 1EO7A 3WJZA 3FSTA 2QUNA 1OZQA 3URHA 2ZVIA 4IJRA 1XLHA 4FPSA 1VBRA 3H4XA 2VCCA 1L6GA 5KZDA 1GKRA 1OADA 3E2VA 1M6IA 4F8XA 2OSYA 3KVJA 3SR6B 3MSYA 5AVHA 5B7ZA 1FWRA 1U30A 2XIJA 3DDMA 4D6HA 3PZNA 3UETA 3VGGA 4WXYA 1UPPA 4RZ4A 3G8RA 1JZ2A 1TFVA 2ZA3A 4QE5A 1FHVA 2YCEA 4NP7A 1JZ3A 3G1DA 4HSOA 4JPGA 1H49A 4ZTYA 1LDCA 3IS4A 3GHRA 2WPGA 5T26A 2YDAA 2MANA 2QAEA 3TFXA 1LUCB 3W2UA 3F4VA 4M6VA 5BROA 3LCLA 3LA4A 2JK2A 2PWVA 2VM8A 2FZBA 4AAJA 4N6FA 4LEQA 3CC1A 2ZRWA 2ZZ3A 1JEHA 3VYLA 2W0HA 5HNUA 1NWUA 4KERA 4ATDA 3MW7A 4GUJA 3TXVA 3DXIA 2GGJA 2W62A 1TREA 2GJPA 1TMLA 3N2TA 4B90A 3TXZA 2VD9A 4LRTA 3GNOA 4Z1BA 3WD3A 3CAWA 2FDSA 2W91A 3MS8A 2G37A 2PWGA 1V6TA 3VOJA 3PHAA 1VYRA 4LVAA 4C6FA 2A8XA 3RPMA 3DGZA 2VNCA 4AWTA 1RY8A 4WJXA 4GX8A 4HYWA 1K9EA 2EPKX 1GVEA 1NDZA 3KL3A 3W1TA 1S5NA 4ZB5A 1UJPA 3KLLA 3PTMA 4Z2JA 3FXYA 3SN4A 1UD6A 3O07A 1K7EA 2P8CA 2D73A 3M0MA 2VI0A 3VDGA 3WJWA 1UWUA 3BZGA 1GVYA 3EA3A 3BOLA 4GBDA 2Q09A 4GI6A 1VGAA 3W7IA 4YWSA 3CUJA 4DNAA 5LXEA 2FMOA 4D1IA 2NWSA 3QLLA 3TN3A 1NU5A 3CT7A 4JTEA 3FV9A 2RJHA 1JPDX 4XZ9A 5DQPA 3HRDC 2FGZA 3PUEA 3PZQA 4W86A 3ZVHB 1MVYA 2CEQA 5HNTA 4ACYA 4QISA 3AHTA 3VGEA 1M7XA 5G2WA 2VDHA 1BXCA 4KIEA 4F9DA 3OZMA 1NOUA 2DZPA 4QE1A 1YXDA 1JGMA 1XISA 2WXDM 4PTMA 4DJFC 4B9YA 2WPEA 4DO6A 4Q4OA 4ROPA 1B3VA 2ZOXA 3WUEA 1R86A 1ZLPA 1MUWA 1JCLA 3V18A 2XN1A 3S46A 5I3FA 1GZGA 1UCWA 5BYWA 3LB8A 4JIIX 1XPYA 3CZLA 1EA9C 5CPLA 5TNVA 3MVIA 4FXJA 3QLDA 1MXSA 3LEPA 4A05A 4G56A 2R1NA 3SQPA 1Q6EA 5E70A 1CLXA 2QEZA 4C1NA 3RO6A 1HX0A 3OGSA 2DH3A 3TLLA 1DWIM 4UQ9A 9RUBA 3QF0A 2ZZ0A 3GXFA 4DZ5A 4QJ1A 2IKHA 4GVIA 3UA4A 1IIGA 1TVPA 4LIIA 2OEMA 3RPTA 2X8GA 3NDOA 5IXEA 1NARA 1R2RA 4XO7A 3BSMA 1W8GA 3DFTA 4S3DA 3QGKC 3R43A 1G94A 2IKGA 1E56A 1BD0A 2XVGA 3GZ3A 1QO2A 3VKJA 3WEMA 2QUVA 3NDZA 1Q8AA 3NUKA 3W7CA 2Z1WA 1TX2A 2VGFA 2PRMA 2BGSA 2WWCA 3GTFA 1P0EA 1OYAA 1O95A 4QTGA 3BL3A 3OBAA 3CHFA 3B8DA 3R89A 5BMXA 3QFBA 4HPXA 3WDHA 3CO4A 5LNRA 5BU6A 1R3VA 4NU7A 1ECEA 2SFPA 4MFEA 2YGYA 1Z42A 5D9NA 3TQ0A 4S23A 1VFFA 3AO0A 4MWAD 3RUBL 4WSJA 1TPFA 4AZIA 1NOWA 1CTNA 1LROA 1WZLA 2OOFA 2YVFA 2HTMA 2EJ1A 4LF1A 1BSLA 4DBWA 5DELA 1JPIA 1WKFA 4DIAA 2YFOA 2WMGA 2ZADA 2EQDA 2HNEA 1GJWA 2E5BA 3ABQA 3ARVA 2VZSA 1QI0A 3I68A 1AJZA 3LPOA 1V93A 4OECA 2ZDRA 3L0GA 3CXOA 2QCNA 1EH9A 3T2PA 4F0SA 3LPGA 3C86A 3MKVA 4XKMA 3U4FA 3E9AA 3APGA 3TTQA 4NT0A 4LAZA 3BCFA 4GUFA 1BRLB 2A7NA 3BG3A 2UWFA 3FA3A 4HCLA 3NCOA 5XIMA 1K70A 2P0OA 1GNXA 4UCGA 3RDKA 2OO0A 2QS8A 3FA4A 3W22A 1L6FA 3RMEA 1JRPA 4K2SA 3EOLA 1XR2A 1XLFA 3V4BA 1RUSA 4IMDA 3GHUA 3MCOA 5E0CA 3GC2A 3PZ9A 3M0XA 4DO4A 5J5RA 4ICMA 1SJBA 3VCNA 3VKAA 2CC0A 4IIDA 3Q37A 3NOEA 2A3HA 2WZIA 4GIYA 3SW6A 5F2MA 4ZCWA 2VR5A 1A3XA 4BF7A 1X96A 4H4WA 1UC4A 2WC3A 3OGRA 3OYXA 2YOCA 4HK7A 3E5BA 1C90A 1MO9A 3UZJA 4H50A 2OLHA 2GWNA 2PF0A 1AQHA 4P7LA 2GGIA 3OQEA 1K77A 5SWUA 4ZEPA 2X0SA 1BG4A 4A8LA 5CH9A 1R30A 2HMCA 4HZ6A 3H26A 3FYOA 2X1TA 1F7BA 4IFRA 4WXZA 3HBLA 3H23A 4AIEA 3T08A 3VE7A 3BAIA 1L2UA 4ZTXA 2RH9A 1R3QA 2YVJA 2X0HA 4CQBA 4HMDA 2OYMA 4J3TA 3GC5A 2Z2AA 4XK2A 4GD0A 2PGRA 4PMQA 4I3GA 3PR2A 4KS0A 1ITQA 1K9FA 4N9DA 4JYEA 3R2GA 3A7AA 2VX4A 1QPKA 1XLBA 5F2IA 3TNOA 4UTTC 3HG2A 1YXYA 3KLKA 1KTCA 3CQHA 1QNPA 3VXGA 2VX6A 2W61A 3NRZB 5GNYA 3JW7A 4HOWA 3OIXA 1IWPA 1C9WA 1PZ0A 3QW3A 4K8HA 4LOCA 2D2OA 1EHAA 2Y1HA 3EMZA 1UBSA 4F0KA 8XIAA 2DFAA 4PCPA 3GZAA 1JCJA 3GRTA 1G01A 3LTSA 3MHUA 2ATSA 4HZ7A 5HXMA 3SO7A 2VQTA 2XTKA 2E9LA 3EDEA 4K1GA 3T4CA 3VIMA 1LTDA 2TAAA 5E93A 1A4LA 4DPQA 3M1ZA 4MB1A 1CXIA 3W75A 5CBBA 4UOZA 2XGZA 1XRTA 5TD4A 4YJ5A 3CAQA 4PL1A 1I1WA 2EG6A 2ZX8A 4A22A 4QDPA 5REQA 1SW0A 3A3WA 3QC0A 5EL1A 3SI9A 3FYPA 2GVJA 4JTQA 4DWDA 3XINA 3NZRA 2R1PA 2WPBA 3TE9A 1HFBA 1X39A 3WJYA 3IJLA 3RNMA 2L5HA 2X42A 2E5AA 3IRDA 2GGGA 3CZGA 4XV0A 4ZE5A 5I02A 4QNEA 1YTKA 3EB4A 1LCOA 3AUJA 1I8JA 3W84A 1EEXA 1GEUA 1ADDA 1IHIA 1XDIA 4GI4A 1R3RA 4YMZA 3TAOA 5D2XA 2AAAA 1VEOA 4OV9A 5DRIA 3WK0A 1XPGA 2TRSA 1DPMA 1EOMA 3T0AA 4X3ZA 1UD3A 3MMUA 3L21A 3WNLA 4Y2WA 2FPTA 1TJPA 3HPSA 4B16A 4Q8UA 1E9LA 3A9IA 1LRNA 4WDTA 5LA2A 1LRQA 3E0WA 4JHOA 4MDOA 4PC8A 5U7SA 3BOFA 1T8QA 4KEUA 3VNYA 3PULA 2GWGA 3NO3A 2WHMA 4OZOA 3NVTA 5D9PA 2CLIA 1WKDA 4NNCA 1ISVA 3BLFA 3PUGA 1W1ZA 2FB3A 4MKVA 1I60A 1CIUA 2Y8UA 3LQGA 3KS5A 1OFRA 1W3KA 1XKJA 1MEHA 5I06A 4NXKA 1JVNA 4PMZA 4DZAA 2QV4A 3P14A 4MUPA 3W6LA 1M04A 1DQUA 5G1MA 3PJXA 5HUOA 1B3OA 3VI2A 1V59A 1C8VA 4MOZA 1JZ8A 1I75A 4MWAB 3WD4A 1EGVA 3GR8A 4D9PA 4QCFA 3NGJA 1M53A 5HA7A 5LZLA 4TMBA 1Z69A 3KEHA 2E9BA 1ISZA 2CW6A 3R0DA 1NFPA 5D38A 4C6PA 2W67A 3AI0A 5B80A 1KRMA 1RK6A 4MPKA 5EMMA 4FOJA 4B5WA 2YW4A 3MUXA 2WLZA 3SCPA 2W9MA 5DN1A 2JBMA 4ERGA 3QRHA 1ISYA 1X6NA 4QE4A 1WV2A 2ZFAA 3NEVA 4P7NA 3FNDA 1JAEA 4KFNA 3UU0A 4F79A 2VWSA 4GK8A 4EPDC 4UR9A 3WF3A 2NUWA 2JK6A 4CQAA 3W26A 2I9UA 4UIOA 3W7NA 2QDHA 1W1VA 2P8BA 2HVNA 1EPVA 1O66A 3W83A 1R3YA 1NQ6A 4M52A 4G6CA 3EWDA 3DEQA 3M41A 1QFEA 4HK5A 1E4LA 1DBTA 1BEUA 4WKHA 1OT1A 3CGTA 1N62C 3PG8A 3UGVA 2WNWA 3VIHA 4YN5A 4LW7A 4JEQA 3WEOA 4PA8A 3RILA 1HZYA 1EWDA 4L9YA 4F9JA 2Z4GA 1XH0A 3TA6A 2WO5A 4WX2A 4ZXLA 3CMJA 1UKPA 1Z7AA 3FOKA 1NWTA 4WKFA 5LNUA 1JYXA 4Q4KA 3WQ6A 3M0KA 3N2OA 1QW7A 5CC5A 2XN0A 2CXGA 3KP0A 5A95A 2FZDA 2V5KA 4K7VA 3NQCA 1ZCOA 4CKQA 4RJEA 4Q32A 1QAPA 1M65A 3M0ZA 4GABA 1S39A 3GD3A 1P4CA 4GKTA 4BKNA 1ZQ5A 4IMFA 3LV5A 1MFVA 2BNJA 3SRHA 4P7QA 3RNDA 4YCOA 3VNDA 2PWEA 4DJEA 2WK2A 1GTEA 3EAUA 3NQAA 1IE7C 5I79A 2PPGA 3E2QA 4XAFA 5IDZA 1F8WA 3OOQA 1E6XM 1WE5A 5DBUA 3B03A 3OYZA 1KW1A 4MSSA 1K8CA 4D6FA 1R7AA 3IVTA 2TMDA 1U5VA 4AYGA 1WKEA 2QCGA 3G0SA 3S9IA 5DT7A 4LAMA 1J0YA 3NQDA 1OIMA 2OPJA 1NDVA 1BYAA 1F3WA 1UMLA 3PBGA 3W7DA 2FTYA 3W73A 1T0OA 1NF7A 1KFJA 1XJBA 4IP7A 2Z28A 4TU1A 2CHNA 2EPMX 1PDZA 3S2MA 4E0CA 1DWFM 3NTYA 1NF0A 3OVPA 3K8MA 3RM9A 4GCXA 2QKFA 4V15A 2OVLA 5GNZA 1OD8A 4FLOA 4UQBA 4LS0A 5CKSA 4AEOA 3NYDA 4RZ5A 1FHUA 3AXXA 5I3HA 3SDOA 4QXIA 4BURA 2GR0A 2VURA 3NA8A 2ACQA 4A6GA 1XLJA 4HMEA 3NM1A 1Q8JA 4WZHA 3E12A 1FDJA 1HIZA 1LOSA 1G4PA 4JHMA 3IGSA 1ONXA 1FP8A 4Q22A 3TK7A 1FWWA 4RPQA 3TC7A 1IXPA 4IPLA 5FJJA 1LG2A 3OZOA 4PFHA 4W84A 2VFHA 4JL1A 1XH2A 3W70A 4F40A 3QQ1A 5DXXA 4XBJA 2PB1A 1B5TA 2NVDA 1GOKA 3M0JA 4NAFB 4R53A 4JFUA 4S2BA 1G0CA 4LS2A 1OG6A 3TTYA 2CETA 1GVRA 4ZB0A 3GM8A 4Q8WA 2NT0A 1IIHA 3GC4A 4G8TA 2Z27A 5DCDA 1K9TA 1ZAHA 3EX1A 3GH5A 3U2ZA 2BC0A 2P5NA 4O53A 1MW1A 2W3ZA 3QJAA 3FDGA 1RXOB 1NFGA 1PZ1A 2ZDSA 2IXVA 2HPIA 5BW6A 3WK3A 1M5WA 4MWAC 5CQ1A 4CCCA 3MDWA 3TH6A 5H1WA 3BDKA 1RHCA 2FZMA 3FN9A 3BC9A 3GVQA 1XRSA 4LYQA 4FLQA 3IV8A 1E55A 4DXKA 3QPZA 5D9MA 1XIDA 1RPXA 3LENA 1ZTVA 7PTDA 1F61A 7TIMA 4S39A 4LYRA 4PMNA 1DTNA 1EF3A 2A85A 1A3HA 3NQ2A 2DIJA 3DI0A 2O9OA 2WVUA 3S6OA 2QCEA 1GRFA 3KBVA 4UR7A 4P2VA 4L4LA 3VIOA 3REQB 1ME7A 4D6DA 3PS7A 2UY2A 5A6BD 2C18A 3SUVA 1TWSA 4DBDA 3TYEA 3A3XA 4KWSA 1XWYA 3B06A 3SY5A 3IRSA 3VNZA 2Q8ZA 2J88A 1HF6A 2F2KA 4WR3A 4X61A 4NJKA 3DESA 3WMSA 4O28A 2ZXQA 3FIGA 2F5ZA 1MUMA 1DIOA 4DNHA 3GDLA 3SUSA 5J04A 4AZ6A 2I57A 4B3KA 2UY3A 4Z1CA 3B9JB 2Y5JA 2YW3A 3VC6A 5A3HA 1AD4A 5IDIA 1R3TA 4OUIA 4KEMA 3HZ3A 2CFFA 5FJOA 5BU9A 2E5DA 1E1CA 5K9DA 4NIRA 1JNEA 4YTQA 4Z0SA 3Q67A 1UP0A 4EWND 1P7TA 2EKGA 3WBEA 2LLEA 4C7FA 1Q1WA 3FSUA 1E15A 1J5TA 1TTJA 3LGDA 4DWSC 3OIHA 3PPGA 2X8CA 1W17A 4TVCA 1HKMA 3PANA 5U25A 1PCWA 2PDJA 3K4WA 2C7FA 4MG4A 5AHMA 3B04A 4FX6M 2X1RA 4PTWA 1G4EA 4MKNA 1AZ1A 4NRSA 1KLZA 1PHQA 3N9RA 1EKOA 4D6CA 1TWDA 1I6NA 4U31A 2PD9A 4GA8A 5I5RA 5JU6A 1RBLA 4M19A 5A8NA 2FVMA 2RABA 2W3SA 3W0KA 2YLAA 5DCEA 2PCEA 1KFKA 4IXXA 2DZAA 2DZBA 4WOQA 5A5WA 1P0KA 2A2IA 1FTXA 3W6MA 2D2JA 4AZBA 4FAMA 3ZJ8A 3PSVA 3LHUA 1EP1A 4LUYA 1R9YA 3TAKA 1N8IA 3G1FA 3FEMA 1MRQA 4GY7A 5CGQA 1Z48A 3KL0A 3P67A 3MCNA 2W63A 4R5EA 1TPB1 3BZJA 4PMYA 4UMAA 4HKPA 1NQKA 3RPDA 4ACZA 1B4KA 1XCXA 4Q3MA 4LT9A 1IV8A 4E8GA 3VKDA 2OJPA 5TIMA 3WSUA 1PV8A 4IGMA 4JTUA 1KFBA 1QW9A 2VP8A 3ID7A 1VH7A 2FHCA 5GJMA 4QFUA 2R6OA 4GOAA 5A6KA 2B0MA 4D1JA 3SY1A 1SMDA 1ZJAA 3GXNA 3SRKA 3GXTA 1MEIA 1ZU8A 3KWXA 1A5BA 1BGGA 4G9PA 3NZQA 1QHOA 4GXPA 5FSEC 2WNZA 3T55A 3TFCA 5AC4A 1ZMCA 4K37A 3NXLA 3UGRA 5AECA 2KX9A 4M6QA 2JE8A 3TYCA 4AHPA 1A5SA 1T7LA 3WZ0E 2X0YA 1S2AA 3BLDA 1J2BA 4EANA 3TA9A 3NPVA 3FEQA 3BGJA 3G1VA 2DT0A 1MZHA 3UXLA 2CLHA 1AH4A 1QI5A 3HIJA 1PX3A 1K8XA 5BZAA 3WLKX 4HVXA 3VIGA 1KCKA 4O1DA 4EM4A 3C2OA 3N34A 3ITVA 5JH2A 5A8OA 1VJZA 1F07A 2WSPA 3C4UA 3KRBA 3CM4A 2VWTA 3LX9A 3V36A 2WOWA 3EX6A 2BS9A 2C79A 1KM5A 1FH9A 3ZFHA 4UMBA 1F6KA 1V3MA 1DWGM 1BTCA 3M5XA 1V6WA 3M43A 2DDXA 3AS0A 3UPBA 4HNUA 3ONBA 3GNNA 1R0MA 4F0LA 3II1A 1E6SM 4OHQA 3IGXA 1MFUA 3IV3A 1VCGA 3RGTA 1SSDA 2VXNA 2HE5A 4HA3A 4G2DA 1IWAA 2VFDA 3UCDA 1ONRA 4TO8A 1C3FA 4WJEA 3SZ8A 1JD9A 3WLIA 1MQRA 4RKAA 1XGEA 3P82A 1M01A 3LLFA 3OQ8A 5EBKA 2Y8KA 3G1RA 3HB9A 4O14A 2OTDA 1F3PA 3GFYA 1E6PA 3TU9A 1HKWA 4PUWA 1JZ4A 5CXPA 2OWXA 3GKFA 4OGZA 1PVNA 4CU6A 2ISWA 2VGIA 4GKLA 2ONEA 4PMJA 1KM1A 1VLWA 3GVVA 3CQIA 4F2UA 4I7WA 4Q7BA 4HSHA 4GJIA 3QH2A 3IVUA 4WIWA 2FHFA 1GQNA 3T78A 1VPQA 3TUUA 1CI1A 3TQKA 2PDXA 1XLGA 4JZ5A 4HOXA 4H2CA 2G96A 2EKCA 1V7YA 4IXHA 1GPFA 1TYPA 2ZUSA 2VZVA 4FXRA 1FWSA 4QITA 4YTRA 3UJ2A 5G1YA 1DEDA 3UG3A 5L9FA 2GYIA 3NQMA 1YQZA 3M0YA 1TVLA 4R9OA 4PYSA 3VCCA 4JTTA 3K13A 5C55A 1J11A 3L65A 4BJHA 1RV8A 3TJLA 3DH9A 4L80A 1AUSL 2REQA 3RX2A 2NV1A 4QIUA 4HNVA 4AEEA 4H9YA 3OLIA 5MF5A 5JVLA 1V6XA 2WVTA 4RL3A 3H6OA 1FFVC 3UG4A 4HNTA 4MNJA 3TOYA 4ZR8A 6TAAA 5ABGA 1TZZA 3KBMA 1QXLA 4Y9OA 1XBXA 4HN4A 5HWJA 1O5RA 3POHA 2Q71A 1OC6A 4Z2GA 1OGBA 4WLCA 1FKXA 1H1ZA 4XKYB 3FY1A 5MKGA 1GOWA 2ZX6A 5I09A 1GW1A 3AXHA 3UCCA 1V3HA 3N2BA 3ABRA 4IPNB 2P1FA 1E6RA 2ZXDA 2XSBA 1LL6A 4ZL1A 3AHXA 1W1YA 3COTA 3GBEA 3VX1A 1U1JA 1MSSA 2OSXA 3A4WA 4CNSA 1NP0A 4A8IA 4XAZA 3EDKA 3MV11 2WKGA 1OGGA 4XUGA 1U22A 1EJRC 3PBMA 2WCGA 4IMEA 2J7DA 1NFBA 4GY0A 1HL2A 1REQB 4XVEA 1RY0A 4TOQA 1XM3A 2B4GA 4H4ZA 1W5PA 3TYAA 3E96A 4U2YA 2VC6A 4O4VA 2FZ9A 2IXUA 2XIMA 3T2QA 4XZIA 5M3WA 1BQCA 4OUEA 2ZX7A 4JIRA 4AYSA 2CZ5A 4L9ZA 2XGIA 4H19A 4HD5A 4PUUA 1UWSA 4GO9A 3LERA 3TQVA 2WMKA 1XGZA 3N9SA 4FEZA 1JI1A 2BVYA 4UFLA 4EIVA 3MI6A 3R11A 1J93A 4WK9A 4AB4A 2YB4A 3V16A 2XVLA 4RNJA 3W2JA 1TG7A 1U1UA 1BF2A 2CIPA 3EXRA 2NUXA 4JKMA 2JEQA 4PMUA 1UD2A 2BHZA 1BWVA 2HK0A 3E74A 3EEGA 2O0TA 2G3IA 3MTWA 4PTNA 3AZSA 3WDPP 5G2HA 5DY2A 1PUDA 2W79A 1TE1A 1OJXA 1N8FA 4NX5A 4KFPA 3U5YA 3C0QA 4RNIA 1H1NA 2G50A 1DL3A 3GU9A 1A5KC 4LALA 3QEZA 3USBA 2INZA 3WMBA 3AICA 3GXIA 1L6YA 1JEZA 1H7WA 1PCKA 4YVXA 1J6PA 1UZDA 3M44A 4R33A 1D9EA 4I7UA 1TJRA 3VNJA 3HW2A 2NQJA 3I4KA 1OEPA 4WSHA 1OFDA 2W6RA 2UY4A 4PBFA 5FACA 1EJXC 2HSAA 3QR3A 2Z7GA 1XX1A 1IT7A 3RXZA 3LI0A 1CGUA 2QDDA 5JXQA 1E43A 4YXGA 2PRHA 1SR0A 1EHNA 5A8QA 3TZFA 2YDRA 3RR4A 5FMHA 2V3EA 4FNRA 3TTSA 3UJEA 1QPOA 1AQMA 1PIIA 1LM1A 2CLKA 5FESA 2WOIA 3BW4A 2PDMA 4DAFA 3LV6A 2OQYA 2HNHA 3IJIA 4UFHA 4REQA 1IEIA 2BHUA 3B0PA 6ALDA 4A2SA 1DXFA 1GRHA 3AN1A 4JX5A 3WH9A 1JCMP 3L12A 1CGXA 4MNMA 3SQMA 1BYBA 3R1ZA 5HMFA 1HL9A 1ZMDA 4FO4A 3NSMA 5K4ZA 1X1NA 3LM3A 2F6UA 2Y85A 3G18A 2ZICA 3QPEA 4Z2LA 2OT1A 3ZLHA 5I0DA 1GQJA 2CYGA 2Y2WA 4I8YA 3G24A 3WQ8A 2BC1A 4XZMX 3BLEA 1GORA 1R9ZA 3CL7A 4ZO6A 1EZ2A 1OINA 1DOSA 5T9BG 5HNRA 4PCNA 3M47A 4CEXC 4DYEA 3A23A 4GJ1A 1ZRQA 1YIXA 2P3ZA 1EX1A 5JRBA 3AMZA 4TX8A 3HG5A 5FS7A 2Y4SA 4PCTA 2Z2UA 2ZKMX 1R3WA 3W1AA 4IFKA 1FWEC 1MNZA 1AK5A 3FLUA 1E6NA 5DMYA 1YEYA 3BPWA 1TUXA 4W87A 3W7MA 8XIMA 3O63A 4DI8A 3IAQA 3CHEA 4IJCA 1KFCA 2VOTA 3PPHA 2Q02A 3KXQA 1AMYA 1ZNNA 3D3AA 4KWUA 1WUFA 2DZXA 4DJFA 1GG0A 2ZX9A 1CYGA 3A47A 4H9MA 3GG8A 4TX6A 1S3TC 2DJLA 4HA0A 2WCAA 1XYMA 3DI1A 4NZFA 3QQ0A 2XFRA 1F4HA 3HQNA 5AHFA 3JS3A 1LWJA 3G2GA 5EA9A 2R14A 4X2PA 2NT1A 3MBFA 1Q4WA 3NGFA 1VIWA 2PDLA 4S3EA 3G22A 1BYDA 1DJGA 1M41A 4ZQPA 4ADWA 1E3XA 1OQFA 3IJDA 1P1MA 1B9ZA 3W1RA 2Z26A 1RQBA 4ZOBA 1HT6A 3C6CA 4H4RA 2HBXA 1HKJA 1PL9A 5FEWA 1U1HA 4O13A 3ELFA 1IEXA 2WW5A 3UWYA 7ENLA 3WD1A 1Z9AA 4B5VA 2E0PA 2Z1SA 1Q6DA 4G7EB 3B05A 3U5UA 4S3CA 1JNDA 2E8ZA 1RA5A 3P93A 2A3LA 3Q6JA 1C8XA 5C0QA 4JIQA 4LAKA 1UMYA 4FA3A 2POZA 3Q94A 3GH4A 3CB3A 1G5AA 3I6TA 5LA0A 1WDPA 1ZENA 3W71A 3BMVA 4IPPA 4EQXA 4LAOA 4EP8C 4XAPA 3EWZA 5E0FA 1IGSA 2PC8A 1TQXA 1HG3A 3A64A 5A2BA 3UW6A 3VIPA 2GR2A 3L5LA 5DX7A 1ML1A 3PAOA 3OG2A 1XI3A 1XIGA 3W28A 2ZXAA 4EMJA 3BQ5A 4O4WA 1JUBA 2JQXA 3VIJA 1TRDA 1AZ2A 5HNNA 4V27A 1PE1A 4IX2A 2B31A 3U0HA 4OE7A 5KZEA 4OU1A 4GGBA 4FIQA 2VEMA 1SW3A 3IJ7A 3AC0A 1DVJA 4W7WA 3MZ2A 4RNFA 1ADSA 3FXGA 3UF9A 1GJUA 4AWSA 1EBHA 1LP6A 4MZ8A 3KOFA 4R9XA 2FJUB 2PUZA 2V67A 1EPXA 2H8XA 3WEZA 3V5FA 3QMSA 3IIZA 1XYLA 4IP5A 3Q58A 3B9EA 3L67A 3DJJA 3LU2A 1RD6A 2QMKA 1A0CA 3GXPA 2HCVA 3TWBA 4A3HA 5F1VA 3VM7A 3C56A 1XD1A 5E5CA 3E2RA 1XL9A 3VC5A 4B5XA 3IVSA 1F8MA 2RAGA 4QP0A 4H8NA 1LUCA 8RUCA 3ZIZA 4O1BA 4BZYA 3LM7A 1OX5A 4ECLA 4DF2A 3P6LA 1G7UA 4FXFA 4K8DA 1IXQA 2CBJA 2PU0A 3NZGA 1T3QC 4HA4A 2JF7A 5HR6A 1RH9A 3W24A 1TELA 3DN5A 2QQ6A 3QGAC 3ZT5A 4TV5A 2VQUA 2X1IA 3T2OA 4KWVA 3UBPC 4FNPA 2WYSA 5EBAA 4Q7IA 3N2CA 2J78A 3EYPA 2A4AA 3EKGA 1OT2A 4ZOCA 3UP8A 3GW0A 2J62A 4UC5A 3SJ3A 3I4EA 2EO7A 3SBFA 3QY6A 4DRSA 3LXAA 1NHQA 2WZTA 1V79A 4L5ZA 4OBSA 4TXEA 4DPPA 4EM3A 5AC8A 3SCRA 1E70M 2RDXA 4RR4A 1UD8A 3FGCA 2G4FA 3DERA 3HM7A 4IUOA 1WDDA 3IACA 4UNLA 4ES4A 3BAYA 3CZ8A 5DBTA 4JTGA 3STGA 3ZVHA 3TQPA 1QNSA 3RRXA 3STCA 1TCDA 4FX8A 1TB3A 1I2QA 3VCRA 3BUVA 1X6UA 2V5LA 4HNCA 4FI4A 2QIIA 2Z2BA 4I90A 1TJ1A 4MY1A 2VZTA 3LCIA 4HHHA 1EB3A 4UTTA 2YCLA 4JQ9A 1NM9A 3MHGA 4D71A 4H9TA 2HEJA 2PWDA 3V1PA 4HK6A 3P80A 2X1UA 3URAA 5LHFA 1G4SA 3ZXWA 1WUEA 1KRAC 3LGEA 2J9XA 2OFJA 4J3ZA 4TR9A 2XWEA 5G4EA 1KBJA 1OY0A 4QROA 2KAUC 2QULA 2C1HA 3ECQA 1JXKA 3AHZA 2CPUA 1C9DA 1XYZA 3C3NA 1E0VA 3H2EA 3TX9A 1RM6B 1Y5WA 3WLTA 4O11A 3N6JA 1S2VA 3CQKA 1Q2SA 1KFLA 1EDTA 4IUGA 3VGDA 3E02A 1E72M 4NILA 1EC9A 1HN1A 1RP9A 2IQDA 3LY0A 3GNXA 4IQLA 1UOZA 1QUMA 3MYPA 1JJKA 2PA6A 4EACA 3POCA 1TWZA 5CEWA 1KRBC 1YE6A 3RIKA 1I9CB 1TPEA 3WELA 1FOBA 2A1YA 3OODA 2GOUA 3FJ4A 2B81A 3CV2A 4PCSA 1S2WA 5HDRA 3UZYA 2TYSA 3TROA 1C8YA 1PX4A 5K2ZA 3WF0A 1UUMA 4ATWA 3URNA 4QRNA 4BCEA 2PDKA 1LT7A 3QR0A 4GACA 3HMJG 4LBUA 1V6YA 3W7JA 5K9CA 1MEWA 4RE2A 4ZQRA 1EFZA 3DHDA 2CESA 4BA0A 3QC3A 1DIKA 1F74A 1OF6A 4PB3A 1XBVA 3S5OA 5JCKA 1DJWA 3PB2A 1G69A 4FX9A 3BCJA 3WK1A 4MTVA 1JDCA 4E2OA 1ITUA 4NZ1A 1SO5A 1QHPA 4JTJA 2PZNA 3QFEA 3CUIA 3RU8X 1TYGA 2XIBA 5FF3A 2B7PA 3FFSA 1RK5A 1NIUA 1W37A 3H7RA 1TR9A 2PTWA 4GPNA 1FECA 3DKLA 1JDFA 3NVDA 4H8HA 5M1TA 5MHBA 3P0WA 3FYYA 4AD1A 3Q65A 5AYYA 3VKCA 3VFCA 4CQ8A 3KAOA 1EF2A 2XIOA 4F0MA 1HVQA 3PTQA 3UXDA 1HJSA 1Y5XA 4AUBA 5CC7A 5TR3A 5CPQA 4I8DA 4QDWA 5DY3A 1EP3A 3GNPA 4PUJA 2QNEA 4X22A 1UB3A 4IWWA 3VNMA 4XUYA 3URQA 1S1PA 3LI1A 2YJQA 3A21A 4U5KA 4QEHA 4H4QA 2IPJA 4ZOHB 3PAJA 3BQ6A 3BANA 2OZ8A 1BRLA 3GY1A 1OYBA 1XUUA 5ABTA 1QTWA 5K7JA 2VR2A 2CERA 1L2QA 1E5JA 4W5ZA 1VFUA 2RDTA 3ITYA 3NOYA 3DGRA 4OIFA 2YKKA 1WDWA 1Q3NA 1E71M 4OT7A 2P50A 1V3JA 5XINA 2WPFA 3LCHA 4IPJA 2P88A 4AIBA 2YPIA 4L1WA 2PTYA 1PTAA 1F3EA 3KOYA 1YDOA 1QI2A 4EQSA 3AIQA 3UG5A 4NSBA 2JGYA 2DSVA 3QYSA 3RJXA 4Z2HA 4AFYA 2FH8A 2CZFA 3IK2A 1TCMA 3T42A 5LNWA 2V3BA 3OZPA 5F1UA 3LSBA 1J96A 1RJPA 1JF6A 3NSXA 4UTMA 3NL2A 1YDNA 1R8LA 2FTWA 3AU6A 5U1OA 3MUZ1 5EGRA 1UKOA 4WY0B 1BFNA 4GMEA 3LGGA 4MVAA 2EQ6A 1XLKA 2X7VA 1DJYA 5JCIA 1EYEA 2ACRA 1PBGA 5LIWX 3R25A 2D1ZA 1JCXA 1XFBA 4CCDA 4H00A 2YXOA 3W7RA 2D22A 1IR2A 2GVLA 4GJJA 4GE8A 4LXFA 3U2CA 2XFWA 1XQLA 3LUTA 4O57A 1XV8A 1TKKA 2OGYA 2VEFA 3CMFA 4UFMA 2J8FA 1VHCA 4W9TA 1RA0A 1EC7A 1MZRA 4LANA 5A2CA 1GRAA 1MYRA 1JR1A 3VKBA 1Z89A 1UQZA 1X1ZA 3UA3A 5HJYA 2WHLA 1GKPA 3CZKA 1TPC1 3H4GA 2WBAA 1PKYA 4GIEA 3WUGA 2E28A 4XAGA 3W7EA 1CECA 1A5UA 4YU1A 2ZRXA 3WNKA 3JR2A 1TTPA 1PS9A 4HHMA 2G5WA 1H7PA 4DBUA 3A9BA 1OFPA 4FZIA 2C6QA 2YA0A 4LY4A 1F3TA 4H9UA 2Z0IA 2F38A 3BAJA 1VFTA 1JIBA 2Y24A 1D8CA 4JIEA 3BV7A 1EBDA 3L4XA 2AGTA 2D24A 3UYCA 1DXIA 4BF5A 3L8KA 2WKLA 2GUYA 4MLJA 3HG3A 4HP5A 1ZJIA 4CD5A 1BVNP 2ALRA 3A24A 4FLRA 5EMUA 1OIFA 3HPAA 4H6KA 2C3DA 1RJRA 4AZ7A 1OC5A 3NQ8A 4H3DA 4HU0A 1I45A 3OJGA 2GJXB 4O1CA 1P43A 2JKAA 4RE3A 2IMRA 1YYAA 3HGRA 3IEBA 2AAMA 3CUFA 4F0RA 4J57A 2J7GA 2DVXA 5C71A 1UJQA 1KC7A 3B9AA 3MI2A 1H2IA 4E4FA 5EPDA 1K1DA 3WLNA 2WP6A 5D33A 4L6OA 4ML4A 3F1QA 1ZBKA 4BFAA 1JGIA 2W55A 1EIXA 2X41A 5DT5A 1AQFA 3VUSA 4H01A 3VGBA 3G0UA 4HB7A 3THAA 1UH4A 3DFYA 3G1SA 3KVLA 3TMLA 4HYVA 1O1HA 1JL8A 1W3NA 3VKKA 3GFZA 3VMNA 3AUOA 2WNQA 1SZNA 4MB3A 1E6ZA 2PURA 1QWKA 3I3EA 5A94A 4J4KA 4MY8A 1V6VA 5CGTA 3WF1A 2O7QA 3SUTA 1DJXA 2V3DA 2ZTJA 2KZHA 3C8NA 4H41A 2VRKA 1W9XA 2WHKA 4QG9A 1LJYA 5T9CE 1GXFA 1UIPA 3A3HA 4TVUA 3AALA 2O4MA 1DV7A 4JR5A 4KF1A 1XYCA 2HISA 2Z24A 3U2OA 3CU2A 3B0XA 4DYJA 1WAWA 1F4AA 3ZR4A 3UPWA 3PPCA 1EQPA 4CN4A 2XG9A 4ZB2A 3W82A 2YCIX 4DBEA 1XG3A 4J27A 3LCWA 5REQB 3VNKA 4GIRA 1KR1A 1ZBVA 3KRZA 4DUOA 2DW6A 5CLTA 3TMQA 2PBGA 1F2JA 3UEQA 3AJXA 1SZEA 1QW8A 4MWAA 5D30A 5I07A 4GVFA 4NZ4A 1FXQA 2VHLA 1FCBA 4GINA 1BSIA 3K46A 3S1GA 5DMNA 1K02A 1HP5A 3II4A 1R7OA 1BHGA 4P7RA 4U5IA 4W8LA 4HHPA 2H9AB 1GCYA 3C2RA 1JRCA 3E0IA 5H8MA 4W8AA 1VJIA 2XWDA 3E0LA 1TPH1 2BVDA 3CWHA 3MT1A 3BAXA 2XIIA 3STFA 3W29A 3ARSA 4FALA 4JNMA 4QHRA 4AW7A 5CPTA 2YBTA 3PM6A 2FGLA 4R88A 1AJ0A 1QK2A 2ZZ5A 3U3HA 3VIIA 5E0KA 5A69A 4L7ZA 2FYMA 4EAMA 2CNCA 3RU6A 3CPRA 1BYCA 4DBSA 3KLJA 1ZCCA 3KRUA 4Q8OA 3ARWA 3FHQA 3W6YA 4FNSA 4MPQA 2JF6A 3VDBA 3EDDA 4MGGA 3HV8A 2O4QA 2ZZCA 4JTRA 2XUCA 3PUDA 2QJIA 4XTIA 3LK6A 4MUZA 2YL9A 4Q6XA 3NM3A 3NQVA 2Z7KA 1IZJA 4PUNA 1EYWA 1X2GA 4WCJA 3LADA 4LX4A 8CGTA 1KD0A 4DEFA 1KTBA 1LYXA 2J25A 2YLLA 3PWAA 3TYUA 3V0SA 2OWWA 2A5HA 4K38A 3DFQA 2QHAA 3BLOA 3GQYA 2DSZA 5D09A 2G4JA 2E25A 3SRDA 3CQJA 2I56A 3PK7A 4CNNA 3P74A 3W1XA 3O9NA 3RHGA 2O9RA 4JFVA 1UHVA 4Z2KA 2ZE3A 2FPYA 1OB0A 2FZNA 3BJTA 3EOSA 1XYAA 1PXGA 2DORA 1V77A 3S8HA 5F4SA 2B7OA 1A3WA 1SR9A 4DVOA 1FDZA 2H6RA 1A0EA 1OG0A 1V5XA 4CD4A 2WZHA 3TW9A 1GJPA 4F2BA 2GVYA 4O10A 3QPYA 1CGWA 1XKYA 4GC3A 1S1RA 1K9DA 3EMQA 3JRKA 3G3MA 5H6HA 4HOZA 3QOKA 1QHZA 2C0AA 3AU2A 4RUBA 1QPRA 1XGDA 4M24A 3PP7A 2QCHA 3PVFA 3KS6A 3DX5A 1RBAA 1I2RA 1U5JA 2WSYA 3AWNA 3H2NA 3PY2A 4JQAA 1VZWA 4GGHA 3GTXA 4A21A 1P0NA 1AH0A 2BVWA 3M16A 1WDRA 4IP4A 5C6MA 4LUIA 1UD5A 4YS1A 1VRDA 1I4NA 3R8HA 1P0BA 2W5FA 4NG3A 2CWNA 3V3WA 1D7KA 2YFNA 3VFLA 1IXOA 4Z1YA 5DFAA 3SUWA 1XUZA 4HTBA 4S38A 2ASHA 2AQVA 4HYRA 2EEXA 1A5CA 4ENLA 1VENA 3H22A 1TIMA 3EZ4A 1GERA 2F2HA 4UNIA 4XAYA 1UASA 4H9ZA 3CMGA 2Y70A 3DK8A 2XFFA 1GG1A 5JH1A 2XM2A 1YNYA 1FHLA 4JTLA 1TPVA 4H8VA 3IIXA 2X1SA 1O12A 2Q01A 3BJSA 2BOGX 5LIKX 1QVBA 4TMCA 2D0FA 3EGJA 1Z44A 2QJMA 5HPOA 3HJZA 1F5ZA 1N7KA 3FG2P 4UTJA 4CQCA 4NNAA 5CSSA 2VFIA 4N02A 4FB7A 1A5MC 2GL5A 3AIUA 1XLLA 2XFYA 1GOXA 4HPGA 2AQWA 2CKRA 4IMGA 1P48A 1WOAA 1GZJA 1TPUA 4NAFA 1A5OC 1LQAA 1QOQA 1W1B1 3JU2A 4RXGA 1B9BA 1ADOA 1ITXA 2PLCA 2NSOA 3LHVA 4HSNA 1JYWA 4QDMA 2CLEA 3SAZA 1XIIA 4GZEA 1S5TA 1UG6A 4LPCA 3M7WA 1CBGA 4B3ZA 1UBPC 1IZKA 1CXFA 3KRSA 3TTOA 5C2GA 2PWHA 4Y7EA 3W2MA 4NAEB 2OLAA 3JVAA 2QUTA 3SN0A 1VBUA 2AKZA 3F2BA 5LA1A 1JI2A 3A4XA 3UD6A 4KPLA 4GQRA 3ZOAA 1XICA 2B7NA 3DYOA 4MJZA 4UCFA 1Z32X 2X40A 4JDYA 2ISDA 2VCAA 1AQ0A 4AC7C 1JZ5A 1C29A 1H7XA 3N3MA 5CSYA 5DO8A 4PB4A 2CBIA 2PSNA 1EBGA 3OB8A 4FX7A 2PAJA 3DG3A 4LUSB 3U7BA 4E8CA 4ZMGA 3GTHA 2NVAA 2PP3A 5G4WA 1MQQA 1SSGA 3EOOA 2OYKA 3REQA 1RQEA 4I9AA 3CV6A 2YBVA 5HK4A 2AKMA 5C7VA 5HQLA 4MFDA 4HT3A 2BCPA 1VEMA 4FMVA 5T8GA 3NVYB 1XIMA 3ZSSA 3BG9A 3NQGA 4K3ZA 3GNRA 4W5UA 4C6NA 1W56A 4NRRA 4IIFA 4HZ8A 1HKIA 1MDRA 1BZLA 2XM1A 4L9XA 5AKQA 3OGVA 2G3JA 2OKOA 4S1FA 2UV8G 3F7JA 3PZUA 3C0JA 1W5OA 4NEVA 5AVNA 4FIRA 3QV8A 1QR7A 3KZPA 4M7TA 3ZLGA 2AOSA 2XVNA 2YL5A 4Q4PA 1VPXA 3F4NA 3N11A 1EIBA 3WQWA 3J7HA 1M6JA 3EDJA 1ONFA 2BTMA 3N4AA 5ABHA 3M5YA 2EXOA 2RHGA 1OD0A 1AW1A 3L66A 3AZTA 1FWHC 1RZMA 5C54A 1BXBA 1KCZA 1NELA 3N1AA 4KGLA 3UR8A 1DWAM 2QUMA 4C5YA 1OFEA 4NYYA 3AHYA 2NVKX 3C3UA 3W2LA 2BASA 2UY5A 4AZ5A 2CBUA 2PDCA 4E3VA 2X8HA 3IANA 1STZA 1EEPA 3VZZA 3E49A 1CEOA 1GUVA 4C6KA 1JG9A 1JCNA 4QGCA 4FNTA 5AC6A 4WY0F 3ZLFA 2R1KA 2HS8A 4ZE4A 2Q6ZA 4V33A 1XH1A 3P61A 2BY1A 4EE9A 2NV2A 4C91A 4LB3A 1TZ7A 4G7FA 4C60A 2J7BA 1KQZA 1DTUA 1FWDC 5FEPA 3W7OA 3CV1A 2Y7FA 3N3TA 2XH4A 4LGXA 1ALDA 5A6AA 3SADA 5A6TC 3RJYA 3T40A 1KM2A 3GTIA 2W3RA 4DQWA 3GVGA 1FWIC 1EA0A 2OEKA 1VB9A 3BAKA 3AMCA 1OCNA 3DKJA 4M29A 4FLSA 3CH9A 5HUPA 2PDIA 3SCWA 4O0ZA 4EOUA 1HXJA 2PU1A 5LKYA 1QT1A 2W66A 9CGTA 2VEGA 1GQLA 4JDRA 2NLIA 3THUA 1SGJA 3E3HA 3UVIA 3L2IA 1B3WA 3IC9A 1LRTA 3BVJA 4B4HA 4UQAA 4FXSA 3UFYA 2NWRA 3RITA 3CAKA 3IK4A 1XYBA 4J35A 5AYIA 2QF8A 4BQ2A 5D2WA 5LIUX 1GOMA 4TQTA 3E6EA 3NVZB 4QS6A 1FBAA 4DF1A 4IOTA 4UTFA 1YLVA 3THDA 3ABXA 4H9XA 1GEQA 4AVFA 1NHRA 4MNLA 4LC8A 3AAMA 4C7DA 4UUIA 1XD0A 4CLMA 1QOPA 1GPWA 4DJDD 1Q6FA 3CHDA 5CG7A 4URIA 3A5FA 4HGXA 4WQ6A 3HA1A 1S5MA 1SPQA 4L64A 3V75A 3LBOA 4QS5A 2GQ3A 1MO0A 2GR1A 1X98A 2Z6IA 4R34A 3VD9A 2FJKA 1R85A 2GDQA 1EJWC 4JL2A 4WRHA 3IAPA 5U4NA 1T6MA 4ML9A 3VVGA 3S0CA 1BXNA 2PD5A 2BXZA 1QJWA 3W74A 3AIBA 1V3LA 1PZ3A 2I16A 4AWUA 3W3OA 2OX1A 2XGBA 3IGHX 1JAKA 4WGXA 4CCZA 3WDJA 3UNDA 2ZZ2A 4ZSTA 4YTUA 1EP2A 2VGBA 4LSBA 3WNPA 2VX7A 4B91A 1H11A 1IGWA 4NJIA 4FR6A 2DGAA 2VC7A 3CAVA 1VF8A 5JBEA 1MW3A 2FIQA 4F3HA 1KBKA 4OOUA 1NDAA 3RN6A 4Y9PA 3G0XA 1US0A 3T4WA 4YCPA 5FIPA 3WMLA 1KM0A 2XSAA 1BTMA 5CPOA 2NX3A 1K8ZA 1BWCA 1UR2A 4AZGA 4HN8A 2YXGA 4Q8PA 4AVNA 2ZUVA 1UR3M 1HKKA 2HWGA 3N18A 2X2YA 4U3CA 4YTTA 1SJCA 2QCCA 4KCTA 4IHCA 1J8VA 1QK0A 4KQNA 2AMXA 3AZRA 4K8GA 2PTDA 3NIYA 2EG8A 3OO2A 4I6KA 3C52A 4KMQA 3QKZA 3T09A 4JTHA 3BG5A 3KVKA 3RCYA 2VD8A 4DI9A 1PKNA 2XH7A 3UZXA 3L4YA 4PBEA 5LHEA 1PTDA 3ZR6A 1NTHA 1ZAIA 1NDWA 3MSDA 3BTNA 3TR2A 5M2FX 3K5XA 3O1NA 4S3GA 1TMHA 1OSEA 4C6DA 3M0HA 1L0PA 3R79A 1J0JA 4UFKA 2NW0A 4KRTA 4XIAA 3LZ3A 3G5EA 5BRPA 2BG5A 4NJGA 2Y5SA 1SZGA 3WH7A 3F2DA 2INEA 1E5NA 1UH2A 2J24A 5I7GA 4U2ZA 2FPVA 4D8AA 3TDFA 1R2TA 3QY8A 3GUGA 1J0IA 1R46A 3DK9A 3EKZA 4ROQA 2J47A 3B9DA 2RDWA 3TSMA 2I5IA 1K8YA 3VNIA 2C91A 4JQ2A 2QDEA 2EQ8A 1K3UA 1PB0A 1S7MA 1Q6GA 2V63A 4DNMA 4DXVA 3VM5A 3VMPA 4N7QA 2IKJA 2DT3A 2C3ZA 4LCQA 2NXHA 3VD3A 3EANA 4NL1A 4XKYA 3DC0A 4JTIA 1GVIA 3S1XA 4DZIA 1M1BA 2BGNE 1H09A 4A3YA 1H41A 3R58A 2WC7A 1ZY9A 3UWUA 3CGEA 3RCMA 4MMWA 2ZE0A 2V9DA 1GVFA 5D05A 2ISSA 5D04C 4RPPA 4J7RA 1T99A 2HXUA 1F76A 1UKTA 4KCUA 2PLMA 4KBXA 4H1ZA 4B5NA 4WKAA 2NQ5A 3T81A 3PFRA 4DJFD 4B4FA 1F3XA 1REQA 2JFEX 2EQ7A 3CUHA 3HURA 5G5HB 2WV8A 2WKJA 4QJ3B 4M7SA 1ZXIC 3B0YA 3GIQA 4JFSA 1D7FA 2ODOA 2ZZ6A 1ICQA 3O7UA 1DORA 4AHOA 2ZX5A 1POJA 3ZT6A 4AD0A 4I5XA 5C9ZA 3FKRA 3R4IA 4GQGA 1FFRA 4DXXA 3I10A 4Y9AA 1JROA 3W85A 1W9VA 2P0IA 5FAGA 2I5QA 4J3VA 2V5JA 1GK8A 5AC5A 4J56A 1R9XA 1Q66A 4TIMA 3W81A 4R7WA 4LV4A 2E1DA 3TW7A 1YPXA 2PE4A 3VINA 4UTKA 3OVGA 4HQVA 4Q6JA 3QV9A 3W53A 1SW7A 3H21A 3KM8A 5IRPA 2Z6JA 4YHGA 4X9SA 4UQCA 1BVWA 1ZKQA 4D6EA 1A5LC 1QPQA 1X1OA 4M82A 4GFIA 7TAAA 3NG3A 3T0TA 4UTWC 2GSJA 2ZUTA 5BRBA 3ZVIA 3IIOA 2A7RA 3ICJA 2IKIA 4QBXA 2A7PA 1YKWA 2V3AA 3MU7A 3R8GA 4K68A 3T6CA 4AZHA 5A6LA 3VA8A 4W93A 5F4XA 1NY1A 2XSXA 3W1MA 3QVQA 5BNKA 2V2HA 2NXGA 5D2VA 5CSUA 3GRIA 3URBA 3TC6A 1ZL1A 4CN1A 1UWRA 1BVZA 3NYZA 3ETRB 3BMXA 3GG0A 4I5RA 2R82A 3KHJA 3DBNA 4PFMA 3GW3A 4R7JA 1Q63A 3I6EA 4O1AA 2FHBA 3PBUA 5TBOA 1KRCC 2QCFA 3UR5A 5DLCA 1NOFA 3R12A 1DXEA 2BY2A 2VEPA 4MYXA 2ESCA 1YTEA 2PBOA 3LHWA 1H7OA 2VTFA 5I03A 1XLEA 4C6IA 4OKDA 2OB3A 4OJYA 1MW2A 1ZSXA 3STPA 1SJAA 1KN0A 1Z8AA 3DHFA 2MUCA 3SY8A 3GIPA 4O50A 2HQMA 1EJUC 3WLOA 1HJVA 2F6KA 1QNQA 4JKKA 5AHLA 4DN1A 1BGAA 3STEA 3AS1A 3CT2A 3PNUA 4MWAE 1RQHA 1J4EA 4O1FA 3L23A 2WPCA 2CZDA 3CGDA 1E4NA 4H4XA 4LEFA 5E09A 2WM1A 4F2TA 5JIWA 3Q45A 4JFWA 1V08A 2QAFA 3VX0A 5AN7A 1XYFA 3NQ7A 5D2TA 3H53A 3NFUA 4BR1A 3S5YA 2QGYA 2PF8A 3GD6A 2J6VA 3PTKA 3BW3A 1KB3A 4LY8A 1IF2A 3N12A 4O0QA 4W7VA 4F0HA 4V1YA 3B0VC 3QZEA 1SQ7A 2VENA 1H2JA 1GZ1A 3FDKA 1Q6QA 4Q7NA 3H2AA 3DFOA 1E9YB 4HU3A 4Z1DA 1B30A 1S2UA 3VIFA 5BOEA 3P62A 3TR9A 5JUVA 3WK2A 4HA1A 5FEZA 2W54A 1CXLA 2PP1A 4PR4A 1XSIA 4QG6A 1A47A 2EAWA 4NEWA 3HPZA 5I3IA 1SJDA 3L4UA 4XBKA 4RZ6A 1QOXA 1WXYA 4X9YA 2QJNA 3HV9A 4IIBA 3VD4A 1MNSA 1HO1A 1V4YA 5LYRA 3WQCA 4QEEA 3OLEA 1CGTA 1VC4A 2QVHA 4L65A 3YPIA 3ISIX 1RLCL 3GAYA 3U2EA 3UXAA 2I7GA 4FF7A 1PSCA 1YBQA 5FF4A 1WXJA 4RK8A 1BWKA 5ER0A 3O3RA 3MZNA 4GZIA 1VFOA 2VC9A 3ANVA 3AROA 4E6MA 3WLHA 3BAWA 3TVAA 3LB0A 1PKLA 5AYZA 3WF4A 3AMKA 3W9ZA 5DRCA 4NVTA 5CAHA 3GWQA 2PGWA 4UOJA 2BBFA 3W88A 1PTGA 5CZKA 4PUKA 3NZPA 1VQZA 1XCFA 2VJXA 1B90A 2OZTA 2VVSA 1TJ2A 1OFQA 4GI9A 4XZNX 2QJJA 3FVDA 3BLIA 3RG6A 3NZ1A 4POCA 3HQ1A 4JXCA 4WSKA 5JQ9A 1V02A 3IUIA 3SCTA 5HJXA 4AIUA 4JN8A 3LXCA 3UJFA 4GZJA 5FL1A 1CDGA 1FIQB 4LC6A 4K7ZA 3EKLA 2VO5A 4G7EA 1PHWA 3ITCA 4RCXA 4LF2A 3UYIA 3SCUA 2QPUA 2QJHA 5IFTA 1LT8A 3NVWB 1KCLA 3LLDA 3VOFA 2YXXA 3V5CA 4GG9A 3FKKA 3LPPA 1MMFA 3DOPA 1SB3B 2ZC8A 1SO3A 3RRAA 1X38A 1RVKA 2BMBA 1CLKA 2YQUA 3P5YA 1US3A 3LZ5A 2OXNA 2POTA 1OHLA 3G6MA 1F05A 1AG1O 1KWGA 3L68A 1Z6KA 3DBPA 1VDVA 2EPNA 3DG6A 2OWCA 1ONEA 3WBAA 2RJGA 6REQB 5FJPA 4LWWA 1A4MA 1EUNA 4X2RA 5HMSA 3W1NA 4KT2A 4ZOAA 2GOKA 1PO9A 1GT8A 4WGHA 4M6UA 3SCOA 4GIAA 2E6AA 2PTZA 4KRUA 3RF9A 1WZKA 4DUVA 1H5YA 1WXZA 3OPSA 5GQBA 5BWAA 5LIYX 2DIEA 2BP1A 4HNOA 1G7VA 3LPFA 1EDQA 4AD4A 4QSHA 5TF0A 2J79A 1F8IA 1VQTA 4Z42C 5M17A 3TYBA 3TEVA 5BRQA 3PPFA 1CXKA 2W4XA 2TPRA 2WSKA 4JYFA 4S3BA 1H60A 4XSLA 3LQLA 2GQ9A 3VAVA 3THQA 3UY8A 1H5VA 2DQWA 2VKZG 4PH6A 3F4CA 3R13A 5LSMA 2OGJA 1KR0A 3SGZA 2V68A 3CWOX 4EXAA 4UWMA 2WB5A 4PGLA 2Y5EA 3KTSA 1HJQA 1XDMA 1A49A 3CNYA 5AHNA 1H4PA 2WSRA 5IFPA 1HP4A 4WHBA 2PDFA 4HPNA 4GXWA 3T7VA 1XFCA 3S9ZA 1HNYA 1PEZA 1QNRA 3WBYA 4C6CA 3DHUA 4MB4A 4A29A 3PZMA 1NWSA 4A4AA 1CX9A 1GYLA 2YX0A 2I17A 3TZNA 1J0KA 2VRQA 4AQLA 2YCJA 1WZMA 1H7NA 1VJSA 3PFMA 1VD6A 3P5ZA 2DEPA 2Y7EA 3C2EA 3VGHA 4E8DA 3B4UA 3NQBA 3QZAA 1B1YA 2QXWA 2WANA 1S2CA 1E3ZA 3SR7A 1MXGA 1WAUA 3B8WA 2HV5A 4XZBA 3HPXA 4QCEA 3A6OA 1D8WA 1X7IA 2NX9A 5HULA 1UZHA 4S3JA 2VEIA 5EFFA 3W01A 2DVUA 4MJ4A 4CD8A 3GYEA 1D3HA 4LVBA 4F66A 4R27A 2CXEA 4X0VA 3QN3A 3CGBA 4RDZA 3EWXA 3WYZA 5BCAA 2XJ7A 3QM3A 2DV0A 4MM1A 4I6VA 1TA3B 1RCXB 4EWJA 4E4PA 4RDVA 4CEUC 3OBKA 5EFDA 3OEXA 3ZJKA 1ZFJA 3VOGA 5C9RA 3RX4A 3UVAA 1ZP3A 2YYUA 3UWQA 3VIKA 1W1PA 2GPTA 3PNZA 2CITA 5E6YA 1QBBA 5G5IA 3PG9A 3QGVA 4LTSA 3PWGA 4ZO8A 3SCVA 3IJ6A 4LNCA 1AFSA 1MDLA 4W7UA 2QT3A 2TSYA 4JN6A 4X63A 1JDEA 3LBMA 1HQTA 1R3SA 1L8NA 5FF2A 4HPJA 1D7YA 3FW6A 1E40A 3RLUA 1UWAA 3LNMA 2FGBA 4TTUA 3AYVA 3W1LA 3ARPA 3BWWA 4YL2A 2CU0A 3MSRA 4AIOA 4UOQA 3AM9A 3QMTA 1O5QA 2XU2A 1C93A 2D0GA 3VDHA 2DIKA 3I65A 1CNVA 3MSGA 4CUCA 1UUOA 1FH7A 3VE9A 5JBFA 5M5DA 4L61A 3S2CA 2FQIA 1NPXA 3LHYA 4QQUA 4GC4A 2GDUA 4RE0A 4KFOA 1RR2A 1LL7A 1KV8A 4EPEC 4CQ9A 1LOQA 4JNYA 4N6EA 1FX6A 1YHTA 4QAIA 5I23A 3CL6A 3THCA 2OQHA 3BK0A 3FGCB 2G0WA 1OX6A 2Q8XA 5CBJA 4NUWA 5I3JA 1K6AA 1XC6A 2WJEA 5HR7A 1AMKA 2YCKX 1Y65A 4XQ6A 2J6XA 3D46A 3WFZA 1XIBA 3EB2A 1PJ9A 3BGGA 3CTTA 3GFXA 1TV7A 3MCMA 4H7CA 2NZLA 3FAWA 1TIWA 5G2IA 2FLIA 1XRVA 1T96A 2YCLB 3INPA 3VU2A 5HOSA 1K03A 2E5CA 4PN2A 2PDGA 3EX3A 5AHIA 3W7HA 2Z25A 3W07A 3GRSA 3B8UA 4H2HA 1N61C 4J2MA 1Q7ZA 7REQB 3ERPA 1UUQA 3FJLA 4Q4RA 4DY1A 3S3GA 5DEZA 4NJJA 4ZODA 4GXMA 1DIDA 3FHAA 4B2DA 1F6PA 1GOOA 3TOPA 1MUCA 4KPRA 3N2XA 1I0DA 4FOUA 4US5A 1HW6A 4DYKA 3R8RA 5FKYA 3LCFA 3CGCA 3UT0A 4I5UA 1WYIA 3C2VA 1ZUAX 3KTCA 3QFWA 3S83A 5E9AA 3NPUA 3A13A 1CLVA 1L6WA 3QYQA 4I9TA 3RAOA 1MW0A 1H63A 4PMXA 4AMAA 3S4TA 3TSBA 2HPMA 2E8YA 4AMCA 3W38A 7XIMA 1HVXA 3OLDA 1P6BA 3SCQA 1S3HA 1TR1A 3SQLA 1FCVA 4RW3A 1O68A 4ILSA 4C7GA 4IT1A 5HMEA 4DM1A 3QW4B 5AB3A 3GU2A 4RXFA 2OG9A 3OLGA 2J4GA 5JIPA 3QY7A 1J10A 4MJ2A 2IUZA 2WVVB 1E6QM 4MDPA 1W9DM 3GD4A 2YYTA 4GR1A 5JCMA 4AD5A 2B7QA 2Y7GA 3W86A 1AODA 5JMUA 3GHTA 5D32A 1XG4A 3FS2A 2PDWA 1DQXA 1T8XA 2EPLX 4M1BA 1KTNA 3N17A 3TSDA 1Q45A 1YNPA 3WNMA 3PBWA 4A35A 1GQKA 1W1IE 4S3AA 3NL3A 4UMCA 2OR2A 2VUYA 4GNJA 4L56A 5H8UA 1B3ZA 3V1HA 1EGZA 3JUGA 4PMDA 2ZZ4A 3CO8A 3TWAA 5FD0A 3HU7A 4ZQMA 2NVCA 2GGEA 5ECUA 3ZS4A 1FUYA 4U33A 4Y8FA 2VVNA 1QRQA 4IF2A 1N2VA 5DCBA 2QW5A 3H2CA 2V5DA 1W2VA 2G3FA 1ODZA 1OYCA 1M3UA 4WY0A 3WFLA 2GUUA 4FP1A 2DZUA 1SFLA 2PC4A 3FVMA 4H4VA 4D72A 1Y0EA 4PBGA 2AMGA 3O6YX 5ENLA 2X05A 3SURA 4OBTA 3ABZA 1N8WA 1XBZA 4IG2B 4ZFMA 4RNHA 3LNPA 4XTDA 3PTDA 5A8MA 4JCMA 2P3EA 5FOOA 3NPXA 3CHCA 3IWPA 4ZXOA 3W25A 5CZSA 2D2GA 5CCZA 3KDOA 1KKRA 4HJWA 1LORA 1YPIA 2NQLA 1LBLA 2ZUNA 2GK1B 3ZO9A 2D20A 4O1EA 4JTDA 1QI3A 4NHVA 3ZYZA 1W6TA 8TIMA 3NNTA 4IL2A 4H7VA 3SB0A 2YL8A 5FJRA 1SFTA 4B5UA 3W1UA 4BI6A 1ZJBA 3WLJA 1THFD 1QNVA 3SSZA 3D47A 4N4QA 3SUUA 1GV4A 1WOBA 4XD3A 1J5SA 4P61A 3UY7A 3TN6A 4PTXA 3GU1A 3CS2A 3PUOA 1LZOA 2ZZ7A 1X2HA 2Y6ZA 3MKKA 3WQDA 3W02A 1L9WA 2BXYA 4Q8VA 3IPWA 4DWSD 3H2FA 4U4MA 4B5SA 3BW2A 2J7FA 1YX1A 4EXBA 1EXBA 4Z2IA 4UZSA 2OSWA 1JZ6A 1GRTA 2D3NA 5EMKA 3LS9A 4FHAA 3I7QA 3EBVA 4CD7A 3S5ZA 2CDUA 2J75A 3B8VA 4M6PA 2DSKA 3LRLA 3GHSA 1CWYA 1BKHA 3U8GA 5CSRA 3QV7A 4BHYA 3VO0A 3W7KA 2BDQA 4ZQCA 5BXRA 2GJXA 1JCYA 2C14A 3W87A 4Q4QA 1H1YA 2NQZA 2CBVA 1V0MA 3EWUA 1JQVA 1G9HA 4XVDA 4KETA 4L6HA 3ARUA 5IBXC 4OTKA 1H7RA 5A8GA 4MIMA 4PEKA 1XHGA 2JKPA 2E3TA 1WQ5A 1BF6A 2GQ8A 4ZSUA 2Y63A 1CW2A 3AWOA 5KTLA 2E3ZA 4IQEA 1M68A 4Q8NA 1WB0A 3EMCA 3DHPA 1R87A 4CCEA 3RX3A 1GVSA 1DYSA 4ERAA 5L6UA 4XB3A 3DYMA 3SCNA 3CYVA 2ZRVA 4CQDA 2OYLA 2CLLA 2A3AA 3T1GA 1TTQA 3L2MA 2G3MA 1AVAA 4H8UA 2QCDB 2DP3A 1QBAA 4E2VA 3EA2A 4H7ZA 2R9RA 1UPMB 3QZ6A 4C65A 4CNTA 1JFXA 4BS0A 2BZNA 1YE4A 1B57A 1S2TA 4N9BA 4JY8A 3ENLA 1BPLB 6ENLA 4CN6A 2XVPA 4UR8A 3W00A 4BQ4A 3AIWA 2PS2A 2C16A 3XISA 4LUTB 4GI8A 1VFLA 1TPDA 3CEUA 4YYCA 1XIHA 5J5DA 1DHKA 4GH3A 5G4HC 3VPLA 4P5UA 1J0HA 3VDCA 1OK4A 4C90A 4KGJA 2WMFA 1B2YA 3MQTA 3ATZA 2DH2A 5FAJA 3DUGA 1IXNA 1L6SA 2JALA 4IM4A 2WJDA 2G95A 5FI8A 3WLSA 1XC4A 3NPWA 5GRTA 3QHOA 1EQCA 2BOFX 3VNLA 5GJPA 1FWJC 2WZEA 1KO0A 2VUNA 3KDNA 2H9AA 4ADSA 5HAOA 3V35A 4AZCB 5HATA 3FJNA 3H2MA 3KP1A 2PTXA 2QYGA 3LSCA 3IARA 2D2HA 4J3SA 4PUMA 3W27A 2QV5A 1OK6A 2E4TA 1FP9A 3M7SA 4PE8A 1ISXA 1QO5A 4BQ3A 1O7AA 1GYNA 5CBIA 3CQ0A 5M03A 4O52A 3S2NA 1EJVC 3XIMA 3KX6A 4BQ5A 3UXIA 4AU0A 2FB2A 4HBKA 4HNNA 3P7YA 5ABFB 2DUAA 1JD7A 3BE7A 3PZIA 1F73A 1ZALA 4AC1X 3P60A 5F2GA 3SQSA 3RM8A 2AQOA 3PC0A 1J01A 2YA1A 3MY9A 1T41A 1GKQA 1M03A 2IQTA 1WA3A 1TYTA 1B54A 1TV4A 2O9PA 5LXXA 4P8VA 4LBSA 5E1QA 3ITGA 2NUYA 4GYFA 4B92A 1HJXA 1ZS2A 4IIHA 4AF0B 1A0DA 3MP4A 2ZUWA 3D5HA 1XDLA 4GX9A 4NX0A 1GW9A 2PFHA 2XPKA 1R38A 1T5AA 1Q13A 3MI3A 3N6QA 2FVKA 4E3TA 4GBUA 4PUDA 4R3UA 3BMWA 4IICA 5I3DA 1EDGA 5BMWA 1AH3A 1Q6OA 4W8BA 1VBJA 1J6OA 5I6SA 1Q85A 2NX1A 2PLJA 1B31A 3QBUA 3EX4A 2E6DA 2RDUA 2HK1A 3KW3A 1G1YA 1OFBA 1TSIA 3R07C 1BWLA 2JGQA 4A2RA 2HQAA 3H4WA 3CH0A 2QR6A 3LMYA 1FQ0A 2Y61A 3EPOA 5KEZA 3BV4A 3OA3A 1A50A 2WMIB 1Q2RA 3N4FA 3ZSTA 1XHCA 2J9ZA 3NO1A 3OZYA 4CU8A 4NZCA 3LRKA 3EB3A 2R1MA 1BAGA 3LYEA 1ECQA 4YVVA 4A3RA 4M51A 1SM9A 4J5NA 3AS3A 3V7PA 1QU4A 5LNVA 1YW1A 4BY3A 3E1F1 4YTSA 2EJAA 1RALA 2FMNA 3WQOA 1X7FA 1HO4A 1E1EA 3P0XA 4QJ4B 5XIAA 5AZ1A 1JDAA 1MXDA 1JZ7A 2D3LA 1XW8A 4D6JA 2J8TA 4PRTA 4Z08A 3H7UA 3WNNA 3TYDA 2VOMA 4Z0JA 2GGHA 5RUBA 5KETA 4YLWA 4YPJA 3T0DA 4BWLC 4LNYA 1LLOA 1LVLA 4DWSB 1OVDA 1OCQA 3N19B 3AYTA 1OX4B 4KH2A 1UR1A 3L0NA 2ZRZA 1E0WA 4TTGA 1N5XA 3S5NA 4JN7A 3AXIA 3B8SA 4AY1A 2UZ9A 3DECA 2WJFA 2J27A 3FCPA 3W4RA 4FSAA 3CASA 2XZ7A 2VL4A 1UW9A 1KGUA 4O16A 1MI3A 2AL2B 2ZVRA 1KGXA 2I5GA 1KXQA 2V69A 3L2LA 3IJ9A 5C2CA 1G67A 4EX4A 3EUB3 2A3EA 2GH5A 1JDDA 2J74A 1YMYA 2VFFA 3E0VA 3TTEA 3R10A 2BODX 3GH7A 1MWOA 3JZEA 5HQEA 4M56A 2V6AA 3BICA 1JPHA 2OCZA 2CZEA 4MADA 2OZ3A 2GUBA 1DJIA 3DFPA 1A5AA 3MUY1 3CUZA 3EXTA 3K2GA 1V02E 3UZZA 1O5XA 5D03A 3MMDA 4HIBA 2P53A 2BWGA 3MP5A 3O05A 1ZBWA 1U2YA 3GYCA 2HXTA 1N60C 3WJSA 5I2UA 2A3BA 1R5YA 3DYPA 1SFSA 3K4AA 4GQQA 1VFMA 3P3BA 5CZJA 2TODA 1E0XA 4NAEA 1FO4A 1KGWA 4I7VA 3AMDA 3MA8A 2V38A 2Y88A 1LBMA 2WVSA 2X09A 5ECVA 1GREA 4INFA 3AYSA 4FNUA 1DE5A 3ONCA 4N0RA 3C8FA 4UNKA 4LCRA 4IQDA 1ICSA 1F6YA 5CJNA 3EOUA 1CT5A 2YDSA 5HPCA 4QLLA 2ACSA 3N13A 2BLEA 5FSDC 4L4MA 2OU4A 3AHVA 5C9UA 1AA1B 4GUIA 4LUSA 1GEHA 2INFA 1E4MM 1C8QA 1K4GA 1XLMA 3BGAA 2XVKA 4PL2A 5CC3A 3V5OA 4L1XA 1VS1A 2F7FA 4OWGA 3R94A 4ADTA 2P76A 3WQEA 4B5TA 2YZRA 4HU4A 3NXFA 3ZZ1A 5GVJA 4ICCX 3VUPA 1W3JA 1LBFA 3QHMA 3CWNA 4HHLA 2RUSA 3M46A 4ZA0A 4MZYA 2G97A 1DJNA 1UYQA 1W31A 1XDJA 4JGDA 3GVRA 3NQEA 2OOGA 3NO5A 4LJ3A 1K7XA 4ORMA 2QPSA 3E5PA 1FWCC 3VOHA 4HCDA 1PZ2A 1WKYA 2HS6A 3H8AA 3GR4A 3PZOA 3P2VA 5CC6A 1XQKA 3WQ4A 4XO6A 4KW2A 4HZMA 3M0LA 2WJZA 3HOJA 4NZ5A 1KV5A 1CENA 1H0IA 3R0KA 4MJMA 3TJ4A 2MNRA 1XLCA 2R1LA 3B9OA 1TTIA 3ANYA 3WL1A 2GJNA 5KITA 4H83A 2GLKA 4KESA 5D2YA 4L4PA 4JQ1A 3LTPA 2WOQA 1P6WA 4UB9A 3A4JA 1ZBCA 4Z17A 1SU5A 2E6FA 5E6ZA 5JBDA 1UA3A 1W9BM 3SECA 3CV7A 5GJNA 4LVFA 4E5TA 2ZWYA 4AXKA 3AS2A 1EJ7L 1FA2A 5FCZA 3AMLA 3L7RA 2E09A 4JQ3A 1UP3A 1ZGDA 4PB5A 3O0KA 3H70A 1CGYA 1JUEA 4V28A 4DB7A 2PLKA 4ZBCA 3CLWA 4GYKA 2HJPA 3PJTA 2WBGA 4L6DA 1Y5VA 4YHEA 4XD5A 3LDVA 2C0HA 4PUEA 3QTPA 3UNTA 3UR2A 3U48A 1GRBA 2Y62A 1JPMA 3OHMB 7A3HA 2D23A 1FXPA 4D6IA 4J40A 2BVTA 1XIFA 4W4QA 2W27A 3I7SA 3TIMA 3KCOA 4U10A 1ONWA 1QDSA 5H91A 2DY3A 4A8RA 2QDGA 4P8UA 4MYAA 4CNUA 2ZBTA 3CYJA 4CU7A 4H4SA 5E9XA 2GQWA 2I14A 4UQDA 1CXEA 1Q65A 3MP3A 5CJ5A 2OMAA 4GYJA 3S6TA 2H90A 1XLAA 3WL0A 3BURA 3O0HA 2ZZBA 2JIWA 2X8RA 1EUAA 3WDIA 3ARZA 1E1FA 3HQOA 3ZQ9A 1AL7A 4JTKA 2YVGA 4S3KA 2XH0A 4JTSA 4TX9A 1KLYA 5EYWA 4JBRA 1Q1RA 3ARRA 4A3UA 4ZGYA 1BLIA 3I7RA 3GXMA 4C1NB 5CLWA 3KBSA 3A4AA 3UCQA 1RP8A 3SRFA 4MLRA 2NSXA 1TMQA 4QLKA 2CLOA 5F2LA 1W5NA 3B4YA 2TPSA 4YIWA 2YR1A 3TW6A 1DWJM 1O6IA 4MF4A 1GQIA 3L4TA 1SFJA 4PULA 4N9CA 3RM4A 2HVMA 3M07A 1RD5A 4RDWA 3W1QA 2CLPA 3NSNA 3VK5A 3OHIA 3UESA 4B3LA 1FKWA 4BV6A 5FS6A 1EL3A 4M0XA 1E0TA 2EG7A 4ADUA 3H55A 3SGGA 4LFYA 5C2XA 1SZRA 1DJHA 4GNKB 3WKZA 1RSCA 2VFGA 3ITLA 1H51A 4E4UA 3O16A 3CUXA 4UTWA 4JHZA 2XHYA 2BSLA 4A3QA 1RPKA 3F5LA 1H3GA 1VCFA 3W37A 1WX0A 4G1KA 3N6HA 2PDPA 1C91A 4IPIA 4O8RA 4UTHA 3MVTA 1ZX9A 2H8ZA 2PGEA 3F5KA 3MJMA 2G8ZA 3MWCA 4IISA 3S42A 1YXCA 2R91A 1VCVA 4JNZA 3TJIA 4C6QA 3WUFA 5HMDA 1EX5A 2P10A 2VMFA 3F4DA 3QSTA 1DQWA 4IGHA 1F9CA 1KBIA 1OCBA 5I77A 4HMCA 4AG0A 4PSRA 2Z1VA 5EU9A 2PDNA 3HQPA 4NXSA 3UERA 3EOEA 3RMJA 3WLRA 1WBJA 3LTYA 3KUMA 2BGQA 3I3DA 2PEVA 3T8QA 1AOGA 3S1WA 1W8SA 1V3KA 2DZVA 1US2A 1GHSA 3MHFA 3K1GA 3GX9A 1OFOA 2Q3OA 1VRXA 4Q8QA 3AFBA 4YNGA 2RGLA 3R7MA 4PMVA 3B8TA 1BG9A 5I00A 3GKAA 2C19A 4O0KA 4L4OA 3LN3A 2JIEA 1VP5A 3HFTA 3TN4A 4IL0A 3WQVA 1XXXA 1PKMA 5KVIA 2OELA 2QPXA 4FOKA 2VR4A 4FDCB 4K7YA 3IJ8A 4QM1A 3L4WA 2FZ8A 2Z1KA 1N5WC 4DAIA 1E4IA 3HGSA 3W7GA 3CXBA 3CIVA 1E9ZB 4EAYA 1O5KA 3IIPA 1W3HA 3RO8A 3ZJ6A 1V97A 4JD4A 4PRWA 4G1NA 1DIEA 2BB0A 3WDQA 5I24A 2R94A 3MO7A 1Q6CA 3K8KA 4O18A 1FWGC 4OBRA 5HQMA 1HJWA 5CJMA 1ESWA 3OVRA 2IQ0A 3WD0A 2NV9A 2QUUA 3AIVA 5KINA 4GLEA 4HCHA 4ASTA 3PWIA 4FR1A 3G8EA 1UKSA 2ZZ1A 1TQJA 4EXQA 5JCLA 4CVWA 3WF2A 5ABEA 1VBGA 1UZ4A 9XIAA 4DJED 3VMOA 4MB5A 3IJQA 1G4TA 4S3FA 2ZYFA 1LQ2A 2F9RA 3BARA 2XH2A 3B8IA 3QKEA 1OCJA 4TVDA 1NSJA 2PCQA 3M0IA 4ZFCA 1QWGA 4QR6A 2VYOA 4XSMA 2PMQA 2DQXA 5FS8A 1XCWA 2WQDA 3B40A 1LOLA 4CVUA 3GTNA 1OWQA 3TNBA 5H8PA 4JEJA 4AY8A 1XS2A 5KZ6A 3GSMA 4R7OA 1GETA 3WY1A 2J13A 1GTHA 3RLHA 3TP4A 2V6OA 1VPYA 3SIZA 3LD5A 1V03A 3N73A 2WHJA 4O54A 1OABA 1LPFA 5HWNA 2BX7A 4K36A 2PDUA 4Y8EA 4QAWA 1ZDLA 4BK9A 1IQ8A 3VOCA 1YNQA 2YDQA 4EF9A 1VHNA 4C6MA 4CNOA 4F48A 3EWYA 3O2LA 1UIOA 1TV5A 3CL8A 1EOKA 2WNNA 1DHPA 2WC4A 3G1XA 1K4HA 4M3PA 4GYPA 2DW7A 1H61A 2WCSA 4GHRA 4XWUA 4Q33A 3N9KA 2DZTA 1GESA 3CZEA 5JCNA 1KBBA 3SFKA 1EXPA 3APYA 5BXTA 1YPFA 4EF8A 4FS9A 1UP2A 5AYBA 3UWEA 3TJXA 1MOKA 5T91A 1ELSA 1I2OA 2WM0A 2OQLA 2E9MA 4QLJA 1KNWA 3MC5A 3N2MA 3BSGA 4Z1AA 2ALDA 2J77A 2J7HA 3QR1A 1KM4A 3ABOA 4Q8TA 3ME3A 4ORIA 1JYVA 4D8LA 1PYFA 4KKXA 1FWBC 4LB4A 4RV3A 1IYXA 3O6CA 4LV9A 3MWAA 4QJ5B 3AIRA 4PMOA 1Y7VA 2EBNA 2I1OA 4L1GA 1LF1A 2X7WA 1ENUA 2EPOA 4LRSA 3WBWA 1TZ9A 4YVPA 1WBHA 4IZGA 4DJDA 3OU8A 2WAGA 1FFUC 1K7FA 4NKCA 4TVYA 3UXKA 3Q4DA 3CPUA 1GSNA 5A6JA 4H4IA 2R8WA 3B3DA 4GZ7A 4C6JA 3QHNA 4EPBC 1TUFA 3ANUA 1CPUA 1L8PA 1LLWA 2Q3RA 3N4EA 1YADA 4BF9A 4UZUA 3GO2A 5A1AA 3PZVA 3LBCA 3TCEA 4KRZA 2WMJA 2IPGA 3KZSA 3LRMA 2V81A 4OOZA 3O8AA 4C1LA 4WVXA 3F5JA 1E9IA 5FJIA 1NEYA 4JY9A 3SSJA 1XBYA 1JQXA 1WP6A 1S38A 3AIEA 1LLZA 1MQPA 1ZAJA 3F2CA 3KBNA 3MBDA 4AY7A 3I3BA 3WLLA 1N55A 3DJGX 3M6DA 3WQ5A 3D9XA 2GVEA 3HMCA 4NYUA 3KBWA 2GZXA 5A2AA 4ERIA 2BXVA 3GG1A 3BO9A 1XSKA 1Q4NX 3UWZA 3GDBA 2V8ZA 1UWQ