4HYRA

Structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
442
structure length
442
Chain Sequence
LVPVITKMEVYPVAGHDSMLLNLSGGHAPYFTRNIVILTDSEGNTGVGEVPGGPKITTALENVSDIVVGTKVSDYRNTLLKVQAELDKSGEKDERGAQTFDLRTGVHVLTAIEAPCLDLLGKALDMPVCRLLGAGQQRDFVRFLGYLFFVGDRKKTDLPYQSEEDSDCEWYRLRNEEAIDAEHVVALCKAAKNKYGFKDFKLKGGVLRGDEEMKVIKAMKKAFPDARMDLDPNGAWHLDDAVRYVADMHGILTYCEDPCGAEDGYSGREIMSEFRRRTGFPTATNMIATDWRQVGHSLESQAVDIILADPHFWTMNGSVRVAQMCHEFGYTWGSHSNNHFDISLAMCVHVGAAVPGEYNALDTHWIWQEGRERLTKEPLKIANGGIKVPDKPGLGVEIDRDQVMKAHELYKKHCLGARNDAITMQYLIPGWKFDAKSPCLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucarate dehydratase
publication title Structure of putative Glucarate dehydratase from Acidaminococcus sp. D21 with unusual static disorder
rcsb
source organism Acidaminococcus sp. d21
molecule tags Lyase
total genus 144
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hyrA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hyrA01
3R1ZA 3I4KA 3B97A 1NELA 3DFYA 3N4EA 1MDLA 2RDXA 1P43A 3BJSA 3UJSA 3D47A 3H70A 3ENLA 1NU5A 3IK4A 1RVKA 3UJFA 3TWAA 4JN8A 3SSZA 4GGBA 3MZNA 1ELSA 2XH4A 2FKPA 2OG9A 1FHUA 3PFRA 3H12A 1R0MA 2PTZA 1WUFA 4H19A 3N6HA 3ZLHA 4HCLA 3QPEA 4GYPA 2ZC8A 1PDYA 2AL2A 2AKMA 2GSHA 3MKCA 2XH7A 4JN7A 4KPLA 3UCDA 3V4BA 2GDQA 3UXKA 2PGEA 3ES7A 3FJ4A 3KUMA 2GGHA 1E9IA 2AL1A 3GO2A 2HXTA 4YWSA 3VCNA 3SJNA 3TOYA 2HNEA 4FI4A 5J04A 4HYRA 4IL2A 3DESA 3QTPA 4K1WA 2AKZA 2NQLA 2PSNA 3MY9A 2QQ6A 5FJOA 5FJTA 3ZVHB 4K8GA 2OO6A 4KWSA 3ES8A 2OZ8A 3TWBA 1KKOA 2PTYA 3MWCA 3EEZA 5ENLA 4MMWA 2QVHA 3CXOA 1R6WA 1BQGA 2PP3A 3UXLA 2MUCA 4GFIA 3IJLA 2FYMA 4IP4A 3SQSA 3S5SA 1SJAA 2PPGA 3RO6A 4E8GA 4IP5A 3NZGA 3CYJA 1PDZA 3QLDA 3IJQA 1TE6A 1SJCA 3OW1A 4GMEA 1WUEA 3R25A 4E4FA 1P48A 1MNSA 1MDRA 4JHMA 4M0XA 2PMQA 2PU1A 2HXUA 3FV9A 3QN3A 4ENLA 1XS2A 3H7VA 4ZA0A 1DTNA 2PTWA 5FJUA 3V5CA 2PGWA 3BSMA 1YEYA 3PK7A 3FYYA 2P0IA 3JW7A 2OFJA 4M6UA 3QKEA 3HPFA 3UJRA 4DHGA 4K2SA 3P93A 2AL2B 3CAWA 2I5QA 2ZADA 3DG3A 2OZTA 4H1ZA 3I6TA 3RR1A 3VCCA 4DN1A 1ONEA 3GY1A 3CB3A 1JPDX 4Z1YA 2XH2A 4KEMA 3STPA 5BOFA 2O56A 4H83A 2QJMA 3VC6A 3OZMA 4G8TA 2POZA 2OX4A 2OPJA 3TW9A 3RCYA 5BOEA 5EU9A 2PCEA 1JDFA 1W6TA 3VA8A 1IYXA 4J3ZA 4DWDA 3EKGA 3T4WA 4A35A 4E6MA 2OZ3A 3OP2A 3K1GA 2PODA 2P3ZA 2PTXA 2QDEA 3PWIA 1L8PA 1JPMA 2XH0A 4IT1A 3R0KA 3DG6A 1EBHA 3PWGA 1EC9A 2HZGA 2OVLA 4HN8A 4DXKA 4EWJA 2ONEA 1MRAA 1JCTA 3FVDA 4HCHA 1SJBA 4MKSA 4IHCA 3DEQA 3P3BA 4E5TA 4FP1A 3TJ4A 3TCSA 3RGTA 3BOXA 3DERA 3FXGA 1EC8A 2P8BA 2PA6A 1KD0A 4H2HA 3NO1A 4A6GA 4DX3A 2GGIA 3VDGA 3JVAA 3V5FA 3OPSA 2GGJA 3JZUA 4HNLA 2QJJA 6ENLA 2GL5A 4ZCWA 2QDDA 4GIRA 3N6JA 3SN4A 3N4FA 2DW7A 4F4RA 3MQTA 3MUCA 3U9IA 1TKKA 4HPNA 2OLAA 2P88A 3NXLA 3FCPA 1ECQA 2PU0A 4Z17A 4GISA 4J1OA 3T8QA 3OZYA 3T6CA 3GD6A 4HNCA 4A3RA 2OQYA 3Q4DA 4GGHA 3TJIA 3ZLFA 3T9PA 1SJDA 3DDMA 5FJRA 3CK5A 2OQHA 2PP0A 3Q45A 2CHRA 1OEPA 3S47A 3R10A 3DGBA 5FJPA 7ENLA 3UGVA 4IZGA 4ROPA 4DYEA 3MSYA 3H8AA 1MUCA 1KKRA 4E4UA 3RITA 2PS2A 4IL0A 3DFHA 3GC2A 1FHVA 3SN0A 2DW6A 3U4FA 3V3WA 2GGGA 2MNRA 3UJ2A 3VFCA 3CT2A 1TZZA 3VC5A 2P8CA 2XSXA 3RRAA 4G7FA 3R0UA 4KT2A 3SN1A 2PP1A 2QJNA 3R11A 1XPYA 4X2PA 3I6EA 3UCCA 3DG7A 3ZVIA 1KCZA 4MGGA 3ZVHA 1EBGA 3UJEA 3D46A 1EC7A 3ZLGA 3TTEA 3OTRA 4GYPC 3SBFA 2XGZA 1BKHA 3DIPA 2GGEA 3TQPA 5IDZA 2OKTA 3IJIA 3THUA 3P0WA 1F9CA 4HCDA 3NFUA 2QGYA
chains in the Genus database with same CATH superfamily
1A3XA 5EMJA 3R1ZA 3RK8A 2Y5JA 4DIAA 3U7VA 2G4JA 3I3BA 4GQGA 2PUZA 1UPMB 4JX6A 5FEXA 3DBPA 4I7VA 4ZL1A 1SB3B 4IWWA 2ZUNA 4OBRA 1GZJA 3B04A 4JHOA 1S39A 2V5DA 1FDYA 1RVKA 4C91A 2EQ8A 1DIDA 4KIEA 2QCGA 1WOAA 1TUFA 4Q4SA 4ACYA 3H4KA 1FP9A 5DN1A 1BXNA 5AC5A 5LA0A 4U33A 2XINA 4H4ZA 1W9PA 2DPEA 2AKMA 3SRFA 1E1CA 1ALDA 3CQKA 3MSGA 2QDHA 4EK7A 5M2FX 3WL1A 1OX4B 3WJWA 4R9XA 2FDSA 2PURA 1B4KA 4IIEA 5J5DA 3M44A 4YWSA 2C8NA 1WZMA 2RH9A 3PZQA 3UYIA 4C7FA 4ZTXA 4GPNA 1Z6KA 1XCWA 3EXSA 2NQLA 3PZGA 4RE4A 4MWAE 5G1YA 2ZOXA 3C56A 1K9TA 5K3VA 1ISYA 3RN6A 3QR0A 4RR4A 3ES8A 3NQ2A 3TWBA 5IBXC 2E8YA 3Q6JA 1YQZA 5IOBA 3NSXA 5CKSA 1ADSA 4EMWA 4ZQNA 4LAUA 1KXHA 3CEPA 4GH3A 1L2QA 3OVRA 1ZALA 3C0LA 1FFQA 4RKAA 3QJAA 1H5VA 3NDZA 1GVFA 1RALA 1LWHA 1GZ1A 3GZAA 1N5WC 4NYUA 3ZT7A 1TE6A 4DZAA 3UZ5A 3GFXA 3QZAA 4PSPA 2Z24A 4ZGYA 1CX9A 3WBEA 3W84A 1XS2A 5GNXA 3KCOA 4QTGA 4EAMA 2VD8A 1KM6A 3U8GA 2VTFA 4BA0A 4MZ1A 5CJ5A 1YDVA 2X8CA 4KQNA 3FYYA 3A7RA 5FS8A 3G3DA 4ROQA 1AK5A 2Z25A 5I3FA 1W9BM 3HG3A 5C2CA 1HVQA 1F2JA 3RM9A 3U7BA 3P82A 1SR9A 2VGBA 3STPA 2GJXA 4KESA 2EPHA 1DJYA 3QQWA 3NO3A 4JOMA 5CPSA 5C9XA 3AXHA 2PDCA 2VCAA 3UR8A 1ZPTA 3LHVA 3HMJG 4J5NA 1TTQA 3EOLA 3WUFA 4UTFA 3U48A 1XRTA 4YCPA 1KM0A 2YCJA 1HX0A 3KHJA 4PCNA 3W1QA 3T4WA 3L0KA 3IARA 1XC6A 2QULA 5MF5A 5C55A 4QE5A 4NU7A 1L8PA 3W1AA 3GHRA 1JEZA 4AXNA 4QP0A 1KV5A 3BURA 5A6LA 1EBHA 3S0CA 4MJZA 1BLIA 5U7SA 2ZXAA 3G24A 1LUCB 3QY8A 2QHAA 3GD3A 4YMZA 4Q22A 1POJA 4Y2WA 3E1F1 3EMQA 5HR7A 2ICSA 3BVJA 1TJ2A 3APTA 4Q8VA 2Y7GA 3TFCA 3A3WA 3MSDA 3NM3A 1P0NA 4WOZA 1JDCA 2QAFA 3LG3A 2W9MA 3OC4A 3W75A 1OJTA 4YTUA 2RJHA 1EO5A 2CWNA 3G0XA 3W7JA 1PO9A 1C92A 1BXBA 3OPSA 3ARTA 2OGYA 3BXWA 2OODA 1O5KA 2BXVA 1FWDC 4Y9NA 4MPKA 5BRQA 3W7OA 1OX6A 4DBUA 3NWRA 1TKKA 4J9JA 3RM4A 4OUIA 1F05A 4O19A 4EM4A 1TJ1A 3KRBA 1UWTA 2G3JA 2Y85A 8A3HA 3FCPA 3RAOA 1J93A 1IT8A 1YTEA 1N7KA 4BY3A 3PUEA 1AQ0A 1LQ0A 4DWSB 1JZ4A 2O9PA 5BMXA 4CQAA 4LCQA 1STZA 2QAEA 3C2YA 3M0ZA 4IMEA 3UCQA 3WEOA 1ZUAX 2JEQA 4JTIA 3W81A 1EA9C 1UKPA 2Q8XA 4BS0A 2Q6ZA 2VNCA 4RJEA 1Y65A 5GPRA 3B8VA 4ZXLA 1UZHA 1PYFA 1L8NA 4N02A 1V3IA 2D69A 1W1B1 4YIWA 2NUYA 1WKDA 4PEEA 3GTXA 4PUNA 5M03A 2Z4GA 1OX4A 2NWRA 4CUCA 1VCFA 3URHA 1E1FA 4KGLA 1XCXA 2REQB 4WUIA 1WDQA 2VEMA 2Y70A 2PP1A 2QCHA 4Z42C 3DI1A 3KEHA 1S1PA 2J13A 1KCZA 5T9BG 1GYLA 3G1RA 3F4DA 3AALA 2CHOA 5JH1A 3KE0A 5BOOA 2JF7A 3ETRB 2ZFAA 5CJMA 1W5PA 1YE6A 2VURA 5D2XA 3GHSA 1SFLA 1WBHA 2QEZA 3DIPA 4GRTA 3S1GA 5BNKA 3FXYA 4MFDA 1PX8A 1XX1A 4MYAA 1J9YA 3IJIA 5HPOA 3BOLA 1VFHA 4IGHA 3CT7A 1V4YA 3A22A 3S8HA 1NELA 2G41A 1F6KA 1MW1A 4GQQA 4JTCA 4DPQA 4I9TA 4QJ4B 3KWXA 2BGQA 3WUBA 1SO5A 3D47A 3LTSA 4CD7A 3HRDC 1KO0A 4MADA 4YNGA 3S83A 3H4XA 4ERAA 1HKMA 2C19A 1RQEA 5DCDA 5H8PA 2CLPA 2PTZA 1WUFA 4QS5A 2CFFA 3FEMA 1GRAA 1D3HA 1GESA 3H7UA 3F2DA 3HW2A 2WMFA 3QPEA 4GYPA 5D9MA 2Z1XA 3QPYA 5B7ZA 1SU5A 1S5TA 4KPLA 2Y2WA 2X40A 1G6CA 1PIFA 3W37A 5AHFA 4C5YA 4LFYA 1F3XA 4F0HA 1E0XA 3N12A 2GK1B 4KEUA 4O1DA 3SJNA 3RLUA 5BRPA 3W53A 3G2GA 1A5UA 4AWUA 3LS9A 2VELA 4M6VA 3AMKA 2PE4A 4S39A 1O12A 2BXYA 3MY9A 3ZVHB 1ODZA 1Q85A 2TAAA 4OT7A 1UP2A 2BWGA 2TSYA 3TYDA 4QEEA 4I5UA 1BGAA 1J0ZA 4RDWA 3WQWA 3BLIA 3B4UA 1Q6CA 1HKKA 4RK8A 2ZX9A 1SVDA 4E0CA 4R7OA 3UVAA 1VLIA 2OXNA 3OGRA 4H9UA 1TTIA 5GVJA 1XLAA 4MWAB 2ADAA 4DQWA 3L4WA 3MO4A 2PDYA 3NL5A 1J2WA 4DZ5A 3HF3A 2J7FA 1YHTA 2QMJA 3IJQA 3LENA 5DMNA 2GR3A 3ZIZA 1YXYA 2VZTA 4Q7IA 3S4TA 1XYLA 4L1WA 4OTKA 3CZKA 2J25A 4K6AA 2D1ZA 3QQ0A 4UTIA 1Q8AA 3M5XA 3OYZA 3GH5A 4FIRA 3T07A 3DK4A 2IQTA 3EWBX 2DH3A 5D33A 1WO2A 2YA1A 4S3BA 3VU2A 1M04A 5FJJA 5DQPA 1OY0A 1CZ1A 3VABA 1OK6A 3N3MA 1Z69A 1GPFA 3SCNA 4EP8C 4NZ4A 3LNPA 1K1DA 1XQKA 1ONEA 2C91A 4BURA 3OA3A 7A3HA 4BF9A 2XYLA 5D09A 3N2TA 1OCBA 2YFNA 1VR6A 4O18A 3U2ZA 2W55A 5HDRA 4WLCA 1Q6LA 3HPXA 2NPXA 3H2MA 2WSYA 1LRTA 4HOWA 2OX4A 1FWWA 2FB2A 1UZDA 1EWEA 3HGRA 1JCYA 3REQB 5FS6A 1WOBA 4WDXA 4DWSA 5BXSA 1MMFA 4A35A 1CGTA 3THCA 2PWHA 3M07A 1B57A 4HOXA 4X60A 3AS2A 4ADTA 4M19A 5KINA 3N2XA 4B9ZA 1BFNA 1JPMA 3BTNA 3E0WA 4NNAA 4Q4PA 1VZWA 3LLFA 1IE7C 2IS7A 1V97A 1GVEA 2WWCA 5FA5A 3WBAA 4AZBA 1MNZA 1AD1A 3WMSA 4GO9A 2FH8A 3F4WA 4IX2A 2Y88A 5L6UA 4HPGA 3AHZA 3WLOA 2IKGA 1CXHA 3W87A 3UZJA 3TQVA 3B0YA 2REQA 5FL1A 4JYFA 1R9YA 1FWRA 1ZJHA 2WO5A 2VYOA 3UZZA 4FIQA 3TYUA 1H09A 1GRGA 2AAMA 1MYRA 4BI7A 3E0FA 4YN5A 5CPLA 4DX3A 5LNRA 3UQNA 1DNCA 2E25A 3S9YA 4PTNA 2YSWA 3KBNA 4QGCA 3OIXA 2VD9A 4HK6A 1VYSX 1UWQA 1W54A 1GVYA 2PGRA 4AD3A 2FVLA 3IVUA 5DFAA 2VHLA 1US3A 1E56A 1J11A 1QOPA 1K9EA 3QBUA 5A6BA 1E6PA 4J2MA 3W22A 1PTDA 4HPNA 1AL7A 3LK6A 3V36A 5IFTA 1AW1A 4R53A 1ECQA 3I6RA 5HMSA 1W2PA 1S2WA 4ML9A 5FF3A 1RBLA 3HZ3A 2XJ7A 1JCLA 5CC3A 2BY0A 3B8SA 1VFSA 1FHDA 1U1JA 2YVJA 1DXFA 1GVQA 2NX9A 2OB3A 2ZXDA 3PF3A 1IXPA 1XLDA 1MOKA 3IIXA 3A4WA 1DORA 2BODX 3K8MA 3LB0A 1XLBA 1G69A 4M52A 4WJEA 1UWSA 2QUUA 1UZ1A 3PUDA 4PODA 1E43A 2I7GA 3E5PA 1RZMA 3HGSA 3N9KA 3TDFA 1VBHA 1IF2A 2ZUWA 2QV4A 3UWUA 1VRDA 1W5QA 3XISA 3B8UA 2VT0A 1W9UA 2GK1A 1F6YA 1TZZA 1O95A 1VEMA 2NSOA 1IR1A 2BC0A 5D2TA 4GCXA 3UNDA 4PMUA 4G7FA 4H2CA 1BVNP 2X1IA 3R0UA 4XB3A 5DCEA 1ZU8A 5CAKA 2HDJA 1XYFA 4LCRA 4GOAA 3ZVHA 4YTRA 1W2VA 1ZBVA 2XFWA 1ZP4A 5D32A 7XIMA 4PBGA 1JRPA 1DJGA 4O13A 5I78A 3VFLA 4S3CA 4RZ4A 4KCVA 4UTMA 3PBMA 3OG3A 3RDKA 4WKHA 4MWAA 1QI5A 3W86A 2GYIA 6PTDA 3DH9A 3ATYA 2DV0A 1GOKA 2AGTA 2JBMA 2WLZA 4F0LA 2WM0A 3MVTA 2DFAA 1IV8A 1UKQA 1LZOA 4D9PA 4JX5A 2OYLA 3RU8X 1QW9A 1Y7VA 4Q8MA 4DUOA 2VOTA 4UR7A 3URNA 2E0PA 4H4XA 1H7OA 3ABOA 1OSEA 3TN5A 4AAJA 9CGTA 1ZTVA 2I57A 3VGDA 4KGJA 2X50A 3LA4A 3W2JA 1RJRA 3HGJA 4K7VA 1VBUA 3MKCA 1BSLA 2QUMA 4X3ZA 2Z2AA 4Y90A 4Q4MA 4ICNA 1Z7AA 3TR9A 4HP5A 2DH2A 4L64A 4NSBA 3G6LA 3UBPC 2XFYA 3LHUA 3GO2A 1X2HA 1V6UA 1LCOA 5CBJA 4ZSTA 4I9AA 3VMPA 4A3UA 1HKVA 3L67A 4KPRA 1TWSA 1O68A 4W8LA 5H91A 3WFLA 3WK3A 4US5A 3EYPA 4YHEA 3NZQA 5KZMA 5AECA 5HULA 5HMFA 2XG9A 1RP8A 2V63A 4JTQA 3OOQA 3M0LA 4Z2LA 2E6DA 4HA1A 1TVPA 3B9NA 4AWSA 1T99A 3QYQA 4AVFA 3C2RA 1FECA 1DQUA 4KWUA 2Y4SA 2WHJA 4UTWC 4AUBA 2VZUA 1CENA 2JKEA 1X38A 4O4WA 2ZTKA 4H4IA 5IM51 1KN0A 1KCKA 4GMEA 4L7ZA 1VLWA 3PP7A 1SSDA 3FS2A 5FI8A 4OECA 1EJXC 2HXUA 3S5OA 2VFDA 3AJXA 1M1BA 3NGJA 1UUQA 4FZIA 2PTWA 1HKJA 2J4GA 1WKFA 4G56A 1XW8A 1RP9A 2F2KA 1MEHA 4PYSA 3ARWA 4TUFA 3GBDA 4PL2A 1FP8A 1SM9A 2ZKMX 1PV8A 3THAA 4ZMGA 1GQNA 3GDTA 4Q6JA 1J6OA 4Q4KA 1RY0A 2FPTA 4JTLA 2VVNA 1C8QA 3O6CA 4H4SA 3VCCA 5HJLA 3KZSA 1JJKA 1AW5A 4Z1DA 1EP1A 1W3LA 1BWVA 3O6YX 4J35A 4QCEA 5E93A 1G4EA 2BVWA 2OMAA 4OBTA 1SZFA 1OT2A 2POZA 2OPJA 2ZQ0A 3WY1A 5DX7A 3TH6A 3JUGA 4LV9A 1QI4A 1I1WA 4MLJA 2J8TA 4XTIA 3C2OA 3OP2A 1W17A 2GJRA 1ZP3A 1LLZA 2DZXA 5T9CE 2PTXA 4XSMA 1A5BA 4LS0A 3KZPA 1MW2A 1EJRC 4MJ4A 2F84A 1ZJIA 5H8MA 2E9MA 3FAXA 1U33A 1ITXA 3LERA 3PWGA 2HZGA 2OVLA 3VKJA 3QVQA 5C0QA 1RCOB 3EOSA 2W62A 3FOKA 3VOJA 5LA2A 3VZZA 1KQYA 5BZAA 1PZ0A 2ALRA 3DN5A 3B0UX 5AYYA 5A6MA 3M0KA 3O06A 1I2OA 5AYIA 1LL4A 4Q4RA 3QY6A 3BH4A 2NVKX 3N11A 3PG9A 3GD4A 3TMQA 3BOXA 4CQ8A 1YTDA 2ZBTA 5FOOA 3QH2A 3OLEA 4MY9A 3NQ8A 3PZMA 5K9DA 1DXLA 4LVAA 3CLWA 3NSMA 1LWIA 3UG8A 3MUIA 2IKHA 3FNDA 2OQLA 1OYCA 5D04C 1U1UA 5BYWA 3LSBA 1V0KA 2KX9A 3RX2A 3JU2A 2ZZ5A 3V1HA 1S5MA 1XANA 3BW4A 4DNAA 1RV8A 3QV6A 5F4SA 1Z8AA 1KFWA 4LBRA 1W1PA 3N4FA 3UG4A 3KXQA 2FZBA 1UB3A 6XIAA 4TVDA 2B31A 1Q7ZA 4QLKA 4CVUA 2GSJA 1FKXA 1T0OA 4MZ8A 3M0HA 1J5SA 3ALGA 4OHQA 2FVMA 4EPKA 3C3NA 3DYPA 3T6CA 1LWJA 3DHUA 1EUAA 1ZCOA 3HGOA 4D72A 2DDXA 5A2BA 1TCDA 4AZHA 3OGVA 1TVLA 1YBQB 4DNMA 2NQZA 3CEUA 4NQ1A 2EJAA 3AMDA 4J3SA 3W1TA 1V0LA 1ZY9A 4KIRA 5HQLA 1GKRA 1B9BA 3WF3A 2W6RA 3QGAC 1CXLA 2CETA 4HT3A 3PZUA 1AJZA 1ZQ5A 3UZWA 1M41A 2F2HA 5KVIA 4FF7A 1TRIA 1R87A 3RITA 1N55A 4EXQA 3VX1A 2ZZ2A 4DBDA 4GA8A 5C2XA 4NRRA 3GNNA 1IXQA 4TV6A 1NFGA 3C0JA 2XN1A 2YL5A 1JZ3A 4DELA 1KCXA 3RRAA 2QCFA 1WPCA 3QV8A 5I0DA 2Q01A 4LAKA 2PRLA 2WZEA 2X1SA 3W83A 1GQIA 1E9YB 5G1MA 3Q67A 3W73A 5AZ0A 3C2VA 4GZEA 4ORMA 5EGRA 4D6JA 2QXWA 4LCSA 4MKNA 1W1ZA 4JXCA 1JXKA 3BJTA 1OT1A 2I17A 3CYVA 4YLWA 4GWEA 4LRSA 2ZUVA 2P53A 1NAL1 3K8LA 3EGJA 2YL6A 4MG4A 1IEXA 4H50A 2OT0A 2WNNA 5JIWA 1DJIA 4BV6A 2RJGA 1R3YA 3IVSA 2Q3RA 2NVDA 4DZIA 4LT9A 3P7YA 3VKCA 4UR8A 4XWUA 5AYBA 4JTGA 5EKYA 4UNKA 3O05A 2D0HA 1KM5A 4AQLA 3DC0A 4PTMA 2QPXA 3RRXA 1TPDA 3VINA 1G4TA 2BC1A 2C0HA 1H49A 1R0MA 2WVVA 4U2ZA 1O1ZA 1R9ZA 5AYXA 3KP1A 1J01A 4E2BA 1Q1RA 2NT0A 1TTJA 3SURA 2A3CA 3A24A 2AOSA 3MMTA 1XSKA 4LX4A 4MB1A 4V1XA 3GIYA 4N9DA 4DLFA 3O2LA 4WR3A 1ME9A 3WLJA 3R7MA 1YQ2A 2EG8A 1AQHA 3OZPA 4QDMA 2XGIA 3A4XA 3L5LA 4M5PA 1CLKA 2DQWA 1R9XA 3NRZB 5FESA 1PIGA 4AU0A 3D3FA 1EYEA 2VENA 3SW6A 2IPWA 3WO8A 1H1ZA 4PUDA 3ME3A 4YPJA 2AKZA 3VGBA 3ONBA 2PSNA 1W8SA 3CS2A 2BASA 2QQ6A 2ZRWA 5FJOA 1XYZA 2WJDA 4UQCA 4AH7A 3WF4A 1TRDA 1TWZA 4QJ3B 4MTVA 3HO8A 1V6VA 2PTYA 1PS9A 1Z44A 1K7FA 1FIQB 2J7CA 1NEYA 4IPNB 4A3YA 1LBMA 1XUUA 3OA5A 1GJUA 1HVXA 2ASHA 4J56A 3D3AA 2WKJA 1XV8A 3A23A 3C2EA 3M4HA 1WAWA 1PCKA 1N63C 4FXRA 3CQJA 2V5CA 5FF0A 1V7YA 5CC5A 1TX2A 1E3ZA 4NKCA 3CZEA 3ITXA 3S1VA 3VILA 3GU2A 3WD2A 1XRVA 1P48A 3Q37A 3CIVA 3TXVA 2B7NA 2A5HA 4UC5A 5AC8A 4JHMA 3WMLA 4KCUA 2BCPA 4DB7A 1VS1A 1TYPA 4GG9A 3H7VA 1H6VA 2FIQA 2C1IA 1GORA 3DHPA 1XSJA 5A6TC 2EPLX 2C6QA 1PE1A 3EWZA 1X6UA 2VJXA 1JUEA 2ZXQA 2P0IA 2QF7A 4M6UA 2C14A 1LF1A 2ZZ0A 1UR2A 2ZRZA 3NVZB 4MUZA 3GH4A 3QC3A 4JNMA 3LHTA 3SB0A 3W7GA 3CL8A 4B5UA 3N2BA 1K4HA 3O07A 4AZ6A 5BOFA 2YL8A 3EDJA 1A50A 4LAZA 2QCEA 3TYBA 3SIZA 3V35A 1BZLA 4G8TA 1DIKA 3TW9A 1AQMA 3CM4A 3BICA 4CN6A 3PPGA 1MXGA 1YBQA 4HNNA 3U0HA 3EKGA 3TTQA 3MHFA 4MJMA 3NG3A 3IIPA 5BMWA 5DF0A 5K2ZA 3B05A 3W7NA 2CU0A 3S1WA 4XO6A 1ZZMA 4G1KA 4FSAA 1JCNA 4O1EA 1VHCA 1XRFA 4D71A 4AEEA 4IFKB 1XRSA 4EVZA 6XIMA 4D6CA 2ANUA 4M1RA 3CQHA 5LNVA 3W7QA 2F5ZA 1JAEA 4AG0A 1GPWA 2XSBA 3H2FA 4NAEB 4K1GA 5HNRA 1R3QA 1HTIA 3BGJA 4B3LA 3RGTA 1S5WA 3CWOX 1R8LA 2HVNA 4GI6A 4EPEC 2V5LA 3S5ZA 4ZB5A 3WNKA 3Q94A 1E0WA 3UPMA 2PRMA 1NF7A 3ZS4A 4DJDD 3VIJA 4EXBA 4GIAA 3JZUA 4OU1A 1JF5A 2HE5A 1IIHA 1P4CA 1EQCA 4WGHA 2P3EA 2IPGA 1WZKA 4F0KA 4TVCA 2YYTA 5K4XA 4UQDA 2DGAA 4GACA 4AC1X 1SZNA 1C93A 4RUBA 4JIIX 1RQBA 3BJFA 1NH6A 4JZ5A 3URAA 4TX6A 2OLAA 2W67A 4UFKA 2IUZA 4M7TA 1NJJA 4J3VA 2W54A 2CPUA 3M7SA 1DVJA 4C7DA 3CU2A 1XICA 4Z17A 2GUBA 4IQJA 1UR3M 1PX4A 3IUHA 4S1FA 3A3HA 4V27A 1QUMA 4JBRA 3VD5A 2PDWA 4H9VA 1XCFA 4AZGA 5U25A 2VZSA 3W7PA 4NXSA 4CU6A 4R34A 5ER0A 2G96A 1MUMA 1EDQA 4X2RA 4O0KA 1U5HA 5T8GA 2JGYA 3C8FA 1JGIA 1H4PA 3I65A 4H4WA 1Q3NA 2W91A 3T08A 1OEPA 4LVDA 5CLTA 2Y62A 3R10A 4BF7A 3NOYA 4ZE5A 1ZL1A 4NNBA 4E4UA 4B5SA 5I3IA 1HL2A 1TPH1 4KEZA 3BMVA 1VEOA 1FHVA 1QK0A 1WXYA 4RZBA 3UJ2A 3C0SA 1PWLA 4FX9A 1P6CA 3KVMA 2HSAA 4B5WA 3IIZA 4WKAA 2P8CA 3CC1A 1B3WA 4KT2A 1SO4A 3NYDA 3N6QA 2BTMA 1Y8BA 3MPGA 1TR9A 3UG5A 3GYCA 1PKMA 2WANA 4DPPA 3GR8A 4HHLA 3L4VA 1AH4A 4RV8A 2ACRA 3WKZA 4AWEA 2PBOA 1BKSA 2YGYA 2J6XA 1A0EA 4B92A 3K4DA 5DXYA 5DMLA 4LB4A 4LU0A 2YIHA 5JBDA 3PJXA 4HCDA 4L61A 1RA5A 2CLMA 3ZT5A 1A5MC 1J6PA 4DM2A 2JE8A 3W70A 1ZRQA 4QG9A 4PMOA 2YBTA 1DWHM 2CZEA 4IG2B 3DC8A 3B8WA 3DFYA 1R3TA 5FACA 2J24A 2WAGA 3FYOA 2Q71A 2V3GA 3OIHA 5A69A 4W93A 3UJSA 1ZMDA 3IV3A 3NVWB 3W27A 3GNOA 5ABHA 2HRWA 4UFMA 1UROA 4JN8A 1XBVA 5M17A 4OGZA 3WF0A 4XUYA 2BHUA 3OYXA 1GZGA 3WLTA 2D22A 4HN4A 2CBIA 2A3EA 3VDAA 1T3QC 1GK8A 1H7WA 2WHMA 4ONVA 5FAJA 3KL5A 3W29A 1A53A 4W86A 2HQMA 2R1KA 2ZC8A 1C3FA 3UESA 1PDYA 3H6OA 3MMUA 1KBIA 3FJ4A 5CZKA 2VEGA 4GUFA 4GBDA 4F8XA 3IGSA 2G37A 1JPKA 2Z29A 2BMBA 1R7OA 1XBXA 2RDUA 5J04A 4AZ7A 3VKBA 1OC7A 1UPPA 4ZOEA 3DECA 1I0BA 3P2VA 3W3OA 3MA8A 2CERA 2E6AA 3MC5A 1WB0A 2WC3A 1K8YA 2GVLA 4K8GA 3P5ZA 3AU2A 4WSHA 5EMYA 1OX5A 1UKTA 3CH0A 4B5TA 4HNVA 5TQLA 3UT0A 4WDUA 2C13A 3USBA 4AB4A 4M7SA 2PGFA 3W71A 3STGA 3L8KA 2PC8A 4PZVA 1GHRA 1GT8A 2WM1A 1V5XA 3WDPP 1MEWA 2PF8A 3GB6A 1R47A 4NJGA 3G1VA 1M7OA 2F6UA 2OZ0A 4GJ1A 4GY7A 5G2WA 3VTRA 4QJ1A 3GNDA 4I6KA 1NTHA 1ISZA 4QG6A 3L5MA 3AO0A 4E3VA 4L56A 5I03A 3K2GA 4NAEA 3WH7A 1H51A 1NOFA 2FFIA 4LTSA 4RDVA 3EMZA 2RDTA 3AFBA 4Q8PA 2ZZCA 4NL1A 4O1BA 3WQEA 4GIYA 2FZ9A 3FV9A 3LRKA 1ZK7A 5JUVA 3NDYA 1MEIA 3FHAA 4AIOA 4AIBA 2X1RA 2DZVA 2HJPA 1Q6FA 5H8UA 1VCGA 3P5YA 4G5DA 2WC4A 4UQEA 4O1CA 2I14A 1KFJA 3UGRA 4K3ZA 3AISA 4WK9A 3TVAA 1XF0A 4PMJA 2CZDA 4QHRA 3P93A 3MU7A 5AVNA 3KBVA 1HW6A 2DSZA 3A7AA 1J0IA 4MYXA 1OM0A 1QI3A 3OVGA 4JY9A 1C8XA 1ONFA 1I2RA 3LEPA 4KCWA 3ARUA 3H2OA 3ZJ8A 3A9IA 1BWCA 4AD1A 3L2LA 1EJTC 4TV5A 4F40A 3WK0A 4F66A 4RW5A 2XUCA 3LPOA 1G1YA 1EGMA 1M6JA 1JYWA 1PZ2A 2UBPC 1WA3A 1BEUA 3O6AA 3QHNA 4RZ5A 4TTGA 4BWLA 3EPNA 1G67A 3AXMA 1A0DA 2G3MA 2P5NA 4HN8A 1OF6A 1HJVA 1S2TA 5D30A 3UXIA 4IJRA 2QVNA 1OFAA 3HU7A 4HCHA 4HU4A 1V93A 2Z6IA 4Q8WA 2O7SA 1BGGA 1O6IA 1YPIA 5J8LA 4M56A 4N6EA 4IJCA 3G1FA 4IX0A 1RK5A 3CBWA 5JQ9A 3QFBA 3TCSA 8CGTA 4LW7A 3P67A 1KD0A 3GH7A 1TV4A 3WBWA 4K37A 3ABSA 4AIUA 1FA2A 4ATDA 5LYRA 3B9AA 2HK0A 1NPXA 2BOFX 1XFBA 1NARA 3NZ1A 2RABA 3QLLA 4GNJA 3W7KA 4R85A 3WLMA 2GGJA 4FF5A 4IIDA 4BJHA 3KFTA 4E4PA 1FRBA 1R2SA 3LX9A 2TPRA 1N8IA 2GL5A 1YDYA 4GXMA 3FK4A 2PDIA 4BFAA 4ZSUA 5AOUA 3VMNA 3G5EA 4PBEA 2DW7A 4AHOA 4V1YA 3AOFA 3QXBA 2INZA 1V0NA 1QTWA 2ZRXA 2VVSA 3VNZA 1YMYA 4IG2A 4KFNA 4YVPA 4DRSA 2ZX5A 4N9BA 3WK1A 4WX2A 3VM7A 4J1OA 1UH2A 3M0IA 3AROA 1TVNA 3O0KA 3GKFA 2CBVA 1JULA 4RDZA 2GQAA 3KTSA 4JQ9A 4QRNA 4FHAA 2EG6A 4IIHA 3F2BA 3OEXA 3A4JA 5FJRA 3OHIA 5HR6A 2BV9A 1VEPA 4DXXA 1YPFA 1LVLA 2Z2BA 4I6VA 4WXYA 5C7VA 3TEVA 4JKMA 5HANA 2GVJA 5DMYA 4ZFMA 3MANA 4A29A 1LP6A 1S2AA 3UZYA 1A49A 4DBEA 4MNJA 3DKLA 1WZLA 3PPFA 1GW1A 4LUSB 5GNYA 4V28A 3PN8A 4FOUA 1XH0A 3TN3A 2FTYA 2VM8A 3I3EA 3SRDA 1DWJM 1PTAA 4MGGA 3SCVA 3S5NA 4YCOA 3WLHA 1TMLA 1V3HA 2BXZA 3RR4A 3STFA 2B0MA 3K4WA 3VGEA 2R9RA 4KF1A 1J0JA 3GNRA 1HIZA 2DORA 1TPC1 4DBSA 1FX6A 1AJ0A 4L4PA 4GQBA 3IEBA 2VUYA 1E5JA 5BXRA 3LCHA 1W0MA 3WQGA 1ZBWA 2J78A 2DU2A 3I4KA 3VNYA 3B8IA 5CQ1A 3UR5A 2XU2A 3BMXA 5DY2A 4Q6XA 3QMSA 3BZJA 1K8XA 4IP7A 1W9VA 4KERA 7TAAA 5FF7A 1FFVC 4P8VA 2V5BA 4C6MA 1UD3A 3STEA 1KFBA 4NIRA 4JCLA 3WELA 4CQCA 2BDQA 2P76A 1S2CA 3WK2A 2FKPA 5FCZA 2OG9A 1GEHA 3AQUA 3SCSA 3FAWA 3VMOA 1H41A 4RL3A 2DP3A 4Z2GA 1ECEA 1W3HA 1EA0A 3VE9A 3WD3A 1UUMA 2FZDA 4PR4A 5ECVA 4KW2A 1Q6OA 2IPFA 3HOJA 3B9EA 5DBTA 1GUVA 3GLCA 2YL9A 2D2OA 4HU3A 1IEQA 2YCKX 3AHTA 3LBOA 3OGSA 4LB3A 1CCWB 1CGVA 3QM3A 5G2IA 4ACZB 2YXGA 3I7SA 1ZDLA 2Y7DA 1IEVA 4GYJA 3F4NA 2J9ZA 4FO4A 5LIXX 1IGSA 3O0FA 2CXEA 1GG0A 4ZOCA 2CNCA 2B7QA 4AEOA 1R3RA 4ZZ9A 3BLDA 1TPFA 3SUSA 4N9EA 1MRQA 3GAKA 2OCZA 3AC0A 5JCLA 4M6PA 1GYNA 1R6WA 2Y61A 5HWNA 4X9YA 2C7FA 2W0UA 1TR1A 2Q3OA 5I00A 4L9XA 4R88A 1UIOA 4NY2A 1EX5A 4MPQA 3W1RA 3W01A 1BTMA 1E4NA 1AA1B 1K03A 3MUAA 3N25A 2MANA 1F76A 2R6OA 3FKRA 3CLMA 3E6EA 4ECLA 4XAYA 3NOEA 1WYGA 8TIMA 1Q1WA 3B0PA 4QEHA 5AHMA 4ZQCA 3UA4A 5MKGB 5JMUA 1H2JA 3LGEA 3U2CA 1X1ZA 1MVYA 4J7RA 3BAWA 1VFUA 2GSEA 4ZR8A 3TYEA 2PDMA 4KMQA 1IGWA 3TLLA 4P7OA 4QSFA 3HMCA 2WHKA 2OU4A 2HEJA 3FA3A 2WPEA 1UD4A 3OZOA 3R12A 1OWQA 4QE4A 1VYRA 4DN1A 2VRJA 2J3NA 1EJUC 3C0QA 1E73M 1CECA 1ODUA 2YB1A 4HHPA 2YVFA 1DIOA 1H1NA 4JICA 4AF0A 3IAPA 2CW6A 4D2JA 1ZXIC 3CMGA 1XIGA 4NZ3A 3QZ6A 4F2TA 4C60A 4GUHA 2OTDA 2A3BA 2DT3A 5E6ZA 1IYXA 3M5VA 1KBKA 3QOMA 1KR1A 1FY6A 3PR2A 2O55A 2O4QA 1D7FA 4LV4A 4H4RA 3THDA 4IF2A 1SW7A 4O50A 4O1AA 3WFAA 3W7DA 4MY1A 2J7GA 4IT1A 3DG6A 1T41A 3R13A 4UIOA 2QIIA 7PTDA 2FHFA 4S3GA 2WKLA 1SR0A 3PWAA 2ALDA 1E6QM 3SFKA 3UF9A 1GVRA 1UQZA 3E3HA 4PMQA 3NO5A 5K7JA 1HF6A 3H23A 3TC3A 1J0HA 3HURA 4LUSA 1XXXA 3L4TA 4RX0A 3DK9A 2YJQA 4LA1A 1O60A 4H3DA 1B9ZA 2P8BA 4JN6A 3GR4A 3NO1A 3T81A 3H2NA 1I9CB 3O15A 4PCFA 4M51A 1H2IA 4PTWA 1W9DM 1XIJA 3IVTA 1NWTA 1JGMA 3PTQA 3N1AA 3G3MA 5D02A 3TNOA 4AXKA 5HQEA 1B3VA 4HGXA 3B03A 1VB9A 1PKNA 4H6RA 1KM2A 1TCMA 2VCCA 2D23A 3T8LA 1GNXA 3HG5A 1VFOA 2V69A 4X61A 5GQBA 4JTFA 3U9IA 3QZEA 1GCYA 3LM7A 1FWAC 1NHPA 1X6LA 1JDDA 1K70A 4V15A 3PZOA 2OWWA 3ZYZA 1X97A 3HJEA 1ADOA 3G1XA 1JZ6A 3AIRA 1LRQA 4KRUA 2QGHA 4DO7A 2E4TA 2I56A 2NLYA 3GVWA 3FJ6A 1V6YA 3S3GA 1OFDA 4AYSA 1O4UA 1E6NA 5D8ZA 3G18A 1OFQA 3L9CA 1DXEA 4JR5A 1QO5A 3AYSA 1FWTA 1F4HA 2ZZBA 1RVGA 1B31A 1A4MA 3UWQA 2XZ9A 3H8AA 7REQB 1TELA 1NHRA 1Q7QA 1DJQA 2ZICA 1XGZA 5EBKA 3V3WA 2GGGA 2EQ9A 4F0RA 4V33A 1LQAA 3VFCA 3A4AA 4ACZA 1GOQA 2A1YA 3EMCA 2FZ8A 3NQ6A 1H60A 4HZ8A 3GU9A 3EKZA 1OIMA 4GVFA 1E51A 4EX4A 1EGVA 3IRSA 1BYBA 2VO5A 4FEZA 7CGTA 3I6EA 1VQZA 3ANUA 1FVPA 1XIMA 3HQ1A 1BTCA 2YQUA 3UU0A 3SQLA 2J75A 3O1NA 3NVDA 4GIEA 4OJYA 4IM4A 1C8YA 2YXXA 1KB3A 3CASA 1R86A 3ZO9A 2ISDA 3RIKA 4NT0A 1DJXA 1JCMP 3QFAA 2P50A 3K4AA 3VZXA 2ZUUA 1TA3B 3YPIA 1UQYA 3TQPA 3KL0A 4W89A 1KRAC 2E28A 5TNVA 4U31A 2GQ8A 4GNKB 1SFSA 2RKXA 3U6WA 2VEPA 3MJYA 4QAWA 1HL8A 4ADUA 3CV6A 3BG5A 1V08A 3BJSA 5DBUA 5CC7A 3AS0A 1LOSA 1L6WA 2ISWA 3PAOA 3AYVA 5MKGA 4UCGA 5EFDA 3S6DA 5EA9A 1OADA 3E9AA 5C70A 2ZA3A 4INFA 4Q8QA 1IT7A 4ZQMA 4S3KA 3OODA 4HCLA 4RCXA 3HM7A 3NQ7A 2PWUA 1XDMA 3N2MA 4C6CA 4NILA 1Q4NX 2XVPA 4XQ6A 4AWTA 1K7EA 1UR9A 1GXFA 1OGGA 1XHCA 3TLQA 2FMOA 3AIEA 4XD5A 1LOQA 3E2VA 1HUVA 1J4EA 4PE8A 4GI8A 1GONA 3VD4A 3VD7A 3VI2A 4WIWA 3QTPA 4AZIA 5A8NA 1HP5A 3PSWA 1FH8A 3ABQA 2WP5A 1E6SM 2BY2A 4ICMA 1A3WA 2YFOA 1H11A 5GRTA 4ZFCA 3V0UA 4U2YA 5JCKA 4DJEC 4MY8A 3W2KA 1F3WA 5ENLA 5HPCA 3BCFA 1WDRA 1BQGA 3GXPA 4KCTA 2WVSA 5RUBA 1HO4A 3BAIA 3IJLA 2E6YA 4H8NA 3MJMA 1XM3A 4UMBA 5G5HB 3TMLA 1SW3A 3W85A 3BLOA 1FDJA 4RNJA 1EPVA 1FWGC 3LXCA 3RXZA 1QT1A 1YLVA 3WDQA 5M3WA 1B3ZA 4E4FA 1MDRA 3N18A 4P5UA 1KFEA 3SCQA 1ZBCA 1SUXA 3UVIA 4IGNA 1KXTA 4GUGA 1E55A 3T2QA 2X8HA 5ABEA 1QXLA 2ZC1A 5FEWA 3A13A 1WDSA 4J3UA 1BQCA 1LTDA 4XV0A 2ZX8A 1UCWA 4PB4A 3HPFA 3BPWA 2WJFA 5LGXA 1ICPA 2XIJA 1W1VA 2J62A 1BWKA 4K2SA 4F2UA 1KC7A 4FX8A 2J47A 5XIMA 4UXDA 4ZO7A 1M6IA 3OBEA 3GY1A 3CB3A 3GFZA 2QAPA 1W3JA 1P0DA 2XH2A 4YVXA 1VHNA 4L4MA 2YW4A 4H83A 3Q65A 1WYIA 1T8XA 3TA9A 1RBOB 4Z1BA 4R27A 3R4IA 1TE1A 2B7PA 3VGHA 2WZMA 2BNJA 3B9DA 3P14A 4RV3A 4H4UA 1DJWA 3GHUA 1YXDA 3PB2A 3BSGA 3A7UA 1IR2A 1JR1A 3AYRA 4DUVA 4A8NA 3DHFA 1KCLA 4IXXA 1EDTA 3IS4A 3QW3A 2JKAA 1FCUA 4YWOA 3CUXA 1KFKA 4O17A 3QFEA 1B0IA 4UB9A 2P3ZA 1EEXA 4J2PA 1NQKA 4QM1A 1GTHA 4A2SA 3CPGA 4UUIA 3MP4A 1BVWA 1O66A 3NL6A 2XIQA 7REQA 5CPMA 1B30A 2QIWA 1MRAA 4EAYA 6CGTA 3M0MA 3FSUA 3KS6A 4MAZA 3LDVA 5I3JA 4PCSA 1XLLA 3ANYA 3GC4A 4EWND 4U10A 3DEQA 2Y8VA 3V75A 2BX7A 2I5GA 3PB0A 3P3BA 3DZ1A 4TXEA 2V3EA 5JH2A 2NX1A 4WJXA 3SADA 1H5YA 2INFA 4UCFA 5I24A 1TFVA 2E68A 5C54A 3TV8A 4PULA 4HYVA 5FS9A 3MI3A 1X96A 1P1MA 3QYSA 3KOFA 4XD4A 3QW4B 3V5FA 4U3CA 1Q6RA 1RQHA 1TA3A 3WENA 4WF7A 1CTNA 3UETA 4HA3A 4BWLC 5T26A 3SGUA 4UTTA 3MQTA 1H0IA 4OOUA 1KNWA 3V0TA 4RNIA 3ARSA 5D2VA 5ECUA 1F3TA 1JI2A 2Y24A 2G97A 2XVKA 4JDBA 3CPRA 4GISA 5D9PA 4IIFA 3N29A 2D20A 2PDHA 3LPFA 4AHQA 2A8XA 4Y8FA 3ITLA 1WDDA 1O5XA 1V6TA 3RJYA 2WSPA 3R2GA 4YVVA 4BK9A 1TJRA 4DYJA 2GPTA 2R82A 4HSOA 1JUKA 2X16A 1FXQA 3C61A 3F5KA 1F5ZA 4XD3A 1M9HA 4GY0A 2XM2A 1DHPA 2X1UA 3GUGA 3WNPA 2YA2A 1L6SA 3AHYA 2VZVA 3P74A 5I06A 3BGGA 4QQ3A 1LBFA 3T05A 5LGZA 1HJUA 5EMUA 3DFHA 4NI8A 4PB3A 1M7PA 4HJWA 3W26A 2A6LA 3F7JA 5I3KA 1RPKA 4H9ZA 2DZWA 3F2CA 4X22A 1Q8JA 2DVXA 3N19B 4KWVA 4FNSA 4K8HA 2NXIA 1XPYA 4JTSA 1RCXB 5DCBA 3FDGA 2GFTA 2PC4A 3EA1A 4LYRA 4C6JA 2PWDA 3UJEA 1EJWC 4C6FA 4JTJA 4R7WA 1TG7A 3CUZA 4M29A 4LY4A 2GOKA 1LQ2A 2RHGA 3AYTA 3IANA 4LJ3A 4N0RA 2C3ZA 3TTEA 1YRRA 3VVGA 4IICA 1LDCA 3CZJA 2PDPA 1BKHA 3WBYA 2V6AA 3BZGA 1MW3A 4RLIA 2OKTA 1GVOA 3T2PA 1G01A 1XR2A 3FKKA 1XLCA 2GLKA 2E09A 4LF2A 3VIOA 2D0FA 2HQAA 3CV2A 2ESCA 4G1NA 2DEPA 1K8ZA 1LT7A 4EQRA 3BMWA 1UBPC 2XFFA 3N4EA 4Z0JA 1TYGA 4MUPA 2G3IA 4LPCA 3ERPA 4LUTB 3HIJA 4A2RA 1RR2A 3VCRA 4HU0A 5AZ1A 3GTHA 1LYXA 3PZVA 2QNEA 4DAIA 4IMAA 4ADWA 2OELA 2OWCA 2W66A 1UIPA 2E40A 4IFRA 5KZDA 1NQ6A 4D6HA 1Q2RA 3WJXA 3H24A 5U4NA 1B1YA 1V6XA 1DYSA 4H19A 2Z1VA 4C6KA 4OIFA 1T96A 3ZLHA 1J0KA 3W25A 1VPYA 3EEGA 3HQNA 4PMDA 3HG2A 2GSHA 2QYGA 3LD5A 3UCDA 5LIUX 2OT1A 3SUWA 3AU6A 3RPDA 3HV9A 1AODA 1VH7A 4ZE4A 2JIWA 1NHSA 5ABGA 4R3UA 4FAMA 1ZB5A 1WAUA 3VCNA 1D3GA 1F3PA 4Y7EA 1MXDA 4WHBA 1GSNA 2YPIA 4FI4A 1E9LA 1WX0A 1L9WA 4I5RA 2JK6A 1UYQA 4KKXA 1LOLA 4I7WA 2WPCA 3ZM8A 3TC7A 4UMAA 1D9EA 3I7RA 5HNTA 1QHOA 1HT6A 2NXHA 3LYEA 5HMEA 4P8UA 3GXNA 4XD6A 2A7RA 4MMWA 3WQCA 1FWJC 2WZTA 2E5CA 1T7LA 3SRKA 3UXLA 2ATMA 5A6JA 3T7VA 3IACA 5REQB 4GFIA 4O1FA 3V0SA 5EBUA 2BBFA 4C6DA 2HBXA 3WD1A 4IIBA 5LXEA 4B91A 5HMDA 1R2RA 4UOZA 4GO8A 4F48A 2CBJA 1JAKA 3GDRA 1JVNA 3QLDA 1KGWA 4CD8A 1L0PA 4XZBA 3LV6A 1SJCA 2DY3A 4HZ7A 3D6NA 2ZVRA 3VD9A 4PUUA 2WOIA 3SUTA 2BOEX 3G1HA 4C6QA 3UPBA 2W4XA 4HTBA 2WSKA 3BK0A 4ES4A 3WNNA 3GHTA 2YKKA 3R58A 3L23A 4L65A 3T42A 4CNSA 3USZA 4EXAA 3CXBA 3NGFA 3KLJA 3GVGA 1Y5VA 2E6FA 2XVGA 5I07A 3L0NA 1HKIA 4LC6A 3HN3A 1RAKA 4P8WA 1BYCA 4N7QA 3A21A 4FXFA 3T0CA 2VR5A 3W0KA 1E4LA 3MSRA 1PTGA 3DKJA 2PCEA 1JDFA 3UY8A 3KLKA 2AQVA 4E6MA 1PCWA 2OZ3A 1VDVA 2Y5SA 1D7YA 1KBBA 2GZXA 3CGEA 1A47A 1AZ2A 4GC3A 2RGLA 2BVDA 1EX1A 3HTWA 1KR0A 5DXXA 3URBA 1MZRA 5C5YA 2OSYA 3GXTA 4QNWA 4CVWA 5PTDA 2EPKX 4UFLA 3NJ3A 3QY7A 3NR0A 1XDJA 2ONEA 3NPXA 4XZNX 1B4EA 3W2LA 1JQXA 1VAHA 2G50A 3WF1A 1UUOA 4B2DD 3NXFA 1IIGA 2IMRA 4LIIA 4DF1A 2A6NA 1JDAA 2NVCA 2YDSA 3ITVA 1MI3A 1MFUA 1FWNA 3ZJ6A 4NP7A 1SZGA 4PSRA 2ZTJA 3TTSA 1ISVA 4J27A 1U83A 3VUPA 1GKQA 3GUWA 1QPKA 2ACUA 2F6XA 5K9CA 2VFEA 4FX7A 2J9YA 4H7VA 1J96A 4R33A 3VIKA 1GRTA 3DJGX 1NDYA 4ZTYA 5HINA 4S2CA 3W7RA 2BY3A 1ESWA 1BRLB 4MDPA 3WNOA 1XYCA 1FTXA 3LUTA 3MHGA 1S3TC 3SQPA 1C91A 2QMKA 3ATZA 4LUTA 3UZXA 3WSUA 5F2LA 5AC7A 1CXKA 1GKPA 1GOOA 5CJNA 5XINA 4EOUA 1OG0A 3W1UA 1RJQA 5EMMA 4B16A 1M3UA 1YTKA 1GEQA 4GGHA 3CWHA 4R5EA 1X1OA 3DDMA 3PFMA 3NQBA 4D6FA 1OZQA 5DELA 3KCLA 6TAAA 4JEQA 5HNNA 2VI0A 1ZAHA 3JR2A 3VOCA 2QCNA 5D05A 4H6KA 1AL8A 2Z2UA 3TN4A 1IEIA 3JRKA 3T0BA 4E3TA 1NSJA 3L0GA 4W84A 2PS2A 4Z08A 5I6SA 4TVYA 3R07C 2QV5A 1HL9A 3HB9A 4H9XA 1J8VA 2WJEA 3QF0A 3QR1A 4TTUA 3GZ3A 1R7AA 4X2PA 2V3DA 3DFQA 1GRBA 3G1SA 2J74A 1U22A 3IPWA 1XPGA 3CHVA 4E8DA 2DJLA 2OEMA 4M80A 1EC7A 3ZLGA 4FPSA 2X0YA 1NDWA 1LUCA 1UD5A 2B4GA 3OJGA 4IXHA 2H8XA 3OTRA 4NASA 2H8ZA 3PTKA 4UWMA 1LRNA 2CWXA 5DT7A 1QI2A 4CQ9A 4HA0A 4NHVA 3P0WA 3CZLA 2OKOA 2VZOA 2DSKA 3H4WA 5M5DA 4GZJA 3GVRA 2QGYA 2EEXA 3RM8A 1Q6QA 4LBSA 4AY1A 5M1TA 4L1XA 4H9MA 4JIPA 4H4TA 4G6CA 4JKKA 4KBXA 4HZMA 4CD4A 5LXXA 4Y9OA 2XWDA 3T44A 4ZENA 2C1GA 2WBAA 3VIGA 4RE0A 4Z0SA 2G4FA 3SSZA 3BLKA 2XH4A 2A79A 1PZ1A 3H12A 2Z00A 2PDFA 2ZRYA 4O52A 3SCUA 3GXDA 4FXJA 4H41A 1TREA 2QF8A 4DI9A 3LADA 3CZGA 2NQ9A 3URQA 2PD9A 4K7YA 4QROA 5A3HA 5CPNA 3WH6A 1M7XA 3DX5A 3LQLA 3ES7A 3KUMA 4NYYA 3GE7A 4C6BA 3VDCA 3TE9A 4JNYA 1X7FA 4W87A 2OYKA 4CU8A 2HBVA 3L66A 1X1NA 4FNUA 3N73A 1TO3A 4X0VA 1GHSA 3DH7A 4KFPA 2AMGA 3EB4A 3AMLA 2P1FA 4HYRA 4DJFC 1XKJA 4DUXA 4K8DA 4C5ZA 1AH0A 4HK5A 1ZAIA 4F0MA 4L6OA 4NNCA 4KWSA 3E0LA 3H2CA 2Z6JA 5EMLA 4AVNA 1B3OA 3L7RA 2X41A 2H9AB 3ZOAA 2XIMA 4QR6A 2O7QA 1JZ2A 1YX1A 4H9YA 4IUGA 1ZX9A 2EJ1A 2YDQA 4GZ7A 2PP3A 3WUGA 3TTYA 3NZRA 3U57A 4PUEA 4OBSA 1LROA 5HNUA 1YE4A 3CZ8A 2PPGA 3LPPA 2PZNA 3NS1B 2V0TA 1TB3A 2X7WA 1BF2A 2WMJA 4IPIA 2V3AA 2UY5A 4DJED 3EOUA 2TMDA 2EAWA 1JD9A 5F7UA 3SJ3A 1VRXA 1X98A 1XL9A 2QPSA 4UMCA 2A2IA 1YXCA 2OOFA 1GOIA 3LLDA 4PRTA 2GH5A 2PDLA 3N14A 7TIMA 4KH2A 4H7CA 4GXPA 1C7SA 4NUWA 3VOFA 4NZ1A 3EA3A 2PGWA 2O9RA 3SR6B 2WMKA 3M0VA 2QJGA 2WLYA 1NVMA 4KRTA 1Z9AA 1T5AA 3BLEA 1LL6A 4DAFA 5AB3A 3WX7A 2ZIDA 1FWCC 4IOTA 2DUZA 3EX6A 3NZPA 5IRPA 1YPXA 1OYBA 4PA8A 2EO7A 1BRLA 2QW5A 1GREA 4H1ZA 3CGTA 1NOWA 1NFPA 3HJZA 6ALDA 4JY8A 1W91A 1H63A 3LRLA 4FLRA 2V2HA 1NDZA 1EL3A 1DV7A 3DGRA 3H2AA 3FJNA 2WNZA 2Z0IA 1HJWA 1UASA 3SCTA 3MBDA 1CNVA 3R6IA 1WDWA 3P8IA 3WFZA 1QJWA 4DWDA 4XAFA 2PRHA 3N34A 4N4PA 2ZUMA 2D2GA 3K1GA 4O11A 3VYLA 4TX9A 3BG9A 4L6HA 1BHGA 4WZHA 3NQCA 1KXVA 3N9RA 2ON3A 3ABXA 2G3NA 4IMCA 3TCEA 3OU8A 4FX6M 2WSRA 4TMBA 2IXVA 5D9NA 4AD0A 1JF6A 4NX0A 4WXZA 3W7HA 2G0WA 1PEZA 3LN3A 1LL7A 1MW0A 2Y7FA 4JD4A 1VD6A 4E5TA 5LIYX 3VOIA 4XZ9A 2NSXA 2E5BA 3KRUA 2YB4A 1Q4WA 2WCSA 5FAGA 1ICSA 1JZ5A 4MVAA 4P7NA 2GGIA 4DZHA 2PWFA 1W3TA 3FLUA 4NJHA 1XBYA 1IZCA 2VP8A 2V8ZA 3SQMA 3EPMA 3EDFA 3AMZA 4CEXC 5EMKA 3WLIA 4GVIA 1NIUA 2V30A 2XZ7A 1EFZA 4DJDA 3V5OA 4GZIA 3MUY1 1E1CB 1UWAA 2PU0A 4XBSA 1MO0A 1VPXA 2J9XA 2PBGA 2Y7EA 3LRMA 4UBPC 3AI0A 5FKYA 2E1WA 2X30A 3S2LA 4MB4A 3UWEA 3GD6A 1GQLA 3SIMA 3WMBA 3TSMA 5EL1A 4DF2A 1AJ2A 4MHBA 1HNYA 3H2EA 2OX1A 1FWBC 3BAXA 2V3BA 2NLIA 2WCGA 1FH7A 1IWPA 3CGCA 2VX4A 4GCAA 3HV8A 5C9WA 5HUOA 4IZGA 4J28A 3WLKX 4XBJA 3W1NA 4ZODA 5G4WA 2C15A 1BD0A 3TX9A 2XIIA 2YDRA 3PULA 1XYBA 4MFEA 2BHZA 5I79A 1BYAA 1QNPA 3REQA 3RPMA 1EQPA 5E9XA 1I8JA 1IQ8A 1UJPA 2EQ6A 3ZSTA 3LCIA 3R11A 4NG3A 5C7HA 3TN6A 3TSDA 3DG7A 1I2PA 1I2QA 1QNRA 4MSSA 3VIFA 1XH1A 1XG3A 3RYSA 1EBGA 5CGTA 3UR7A 1OYAA 4LUIA 3D46A 4MLRA 2R14A 4UNIA 4AMAA 2H9AA 3GU1A 3M6DA 1QATA 2J8GA 1ZKQA 5F4XA 3APYA 3GG7A 4HJFA 4IH3A 1ZBKA 5DT5A 3NEVA 5FSEC 1W3IA 2VDHA 1UA3A 3VK5A 1QWKA 3NPWA 2NQHA 3GDLA 3NFUA 2VFIA 4A8IA 3CV7A 3P81A 3PC0A 2CCRA 4I3GA 3E2SA 3MYOA 3W02A 1JFHA 4CD5A 2VC6A 1Q66A 1TV3A 2NV9A 3G1AA 2LLEA 3ENLA 1WE5A 3W23A 1OCJA 5E70A 2Z1WA 1PZ3A 3M6YA 4AY7A 3B9JB 3GAYA 2GVYA 4L6DA 4O53A 1F8WA 1CEOA 4LC8A 4HMNA 1T40A 1XIFA 1A5NC 4PMRA 1QBAA 3PG6A 3R8HA 3O8AA 1V8EA 4RNFA 2YAUA 3QTGA 1H3GA 1J5TA 3DCPA 5LNUA 5J5RA 2FJKA 2GDQA 3SGZA 2X7VA 3UXKA 4U28A 1EHAA 4ASTA 1UOZA 1K02A 4H6QA 1E9IA 1UZ4A 1ME8A 4W7WA 3QHMA 2OOGA 4FNPA 2GJNA 1TJPA 3TOYA 2HNHA 2D2JA 1BSIA 3ZT6A 3CO4A 2C16A 4QFUA 2Z1BA 3LXAA 2E3TA 3VNKA 4LWWA 3S2MA 2UY4A 3OLGA 1F74A 3ITOA 4C1KA 2J6VA 4BF5A 2UWFA 4HMEA 4QAIA 2RAGA 4HHMA 3ZWSA 1KKOA 5CBBA 4O0QA 3L5AA 2NWSA 1YYAA 1O5QA 3CXOA 3PPCA 3L4XA 1VIZA 3G22A 3BLLA 4L4OA 3TW6A 1EHNA 2BS9A 2C0AA 1Q65A 2WYSA 4IP4A 4PFMA 5AHIA 2V2CA 2QUVA 4E38A 1AQFA 3WLNA 2WNQA 2WV8A 1W37A 5HBFA 2R1LA 3VNLA 3AZTA 3R0DA 4G9PA 2H6RA 1PKYA 4GVHA 1HO1A 3TJLA 3LGGA 3DOPA 3PVFA 1ZJBA 3BWWA 4JPGA 4EANA 1OABA 2PFHA 3MHUA 5A8OA 1GOMA 1QHZA 2PTDA 1ML1A 2DJXA 1GTEA 4TX8A 3AUJA 3GK0A 2OFJA 4LGXA 2HPMA 3VAVA 3RO8A 2ZRUA 3CTLA 1B90A 3NYZA 3CAWA 2X09A 2OZTA 4MDOA 4JTDA 5A2AA 1EWDA 1EF2A 3AIWA 2ZZ7A 4HVXA 1JPDX 1X6NA 4Z1YA 1OFEA 4D6GA 1SGJA 1GOWA 3LNMA 4UTWA 2B7OA 2UY3A 3UWZA 3VC6A 2OLHA 4M3PA 4WQ6A 3NIYA 4B15A 2BLEA 1EOMA 1V3LA 5LHFA 2Y1HA 1DIEA 3N3TA 2IQDA 2PDUA 2TRSA 1H50A 3ARYA 4PEKA 1CT5A 3EOEA 3UWWA 3XIMA 3TU9A 2CLEA 2YYUA 4F9JA 3S2NA 3M46A 3GVVA 1N2VA 4MAVA 2WPFA 1XJBA 2IPJA 3E0VA 2I16A 3L21A 2CXGA 1UR4A 4LRTA 3LGDA 2E5DA 2EBNA 1VBRA 2ZWYA 3EANA 4ADSA 1YNPA 3FX4A 2XSAA 3FVDA 3IUIA 2PCQA 3WLSA 5BWAA 4DBWA 1UP3A 4BZYA 4WRHA 3MV11 4C6IA 5A6SA 3VOHA 1Q5MA 3KHDA 1B2YA 1P0KA 2PLJA 3BL3A 3FXGA 4QXIA 1W56A 4PMNA 3GKAA 2BP1A 3THQA 1V03A 2J8FA 2R24A 2X8GA 1QW8A 3W1LA 3WNLA 3STCA 4HBKA 4PC8A 2J7HA 9XIAA 2XN0A 4JQ4A 2RDWA 4PTVA 3GYEA 3TROA 2PB1A 1A0CA 2GJPA 1K77A 1EZ2A 2AQOA 1EJSC 5JBEA 4IMDA 3MDWA 4TR9A 1I60A 1DE5A 4F0SA 2CC0A 1OINA 2DSUA 4Z2KA 4IPLA 1QFEA 1M65A 4QE1A 3MKKA 1BXCA 4EQXA 1RK6A 2UV8G 8XIAA 4KS0A 4PCPA 1N60C 1AH3A 1FQ0A 2VDGA 3WQ6A 3LU2A 3FA5A 1WNOA 2X0HA 1CGYA 3GW3A 5F2GA 3KOWA 3T9PA 2I5IA 4LYQA 3KOYA 1NM9A 2Z1SA 2E9BA 2QLYA 3AS3A 1HG3A 4LF1A 4J3XA 3UWVA 4DYEA 3MSYA 4HOZA 3CAKA 2ZA2A 3HQPA 1YW1A 1YIXA 5CG7A 5BU9A 1QNVA 3WQOA 1IEWA 2ZE0A 3VDBA 1QPOA 2VL4A 3KRZA 3EXTA 3SSJA 2PDJA 3MTWA 1BYDA 4FOJA 4IQDA 5C9RA 2CLKA 4AW7A 5BXTA 5KZEA 3DXIA 2P10A 3LMZA 3WH9A 1KXQA 3QC0A 1G5AA 5AY7A 2Z7KA 2A3LA 3GXIA 1XSIA 3QOKA 1F4AA 4UOJA 2NV1A 3ABRA 3T2OA 2V68A 5HUPA 3SO7A 1QRQA 4M6QA 1OZMA 4YU1A 1UBSA 1TPWA 1ZGDA 3VXGA 2VGFA 4GYPC 3LCWA 4D8ZA 3SBFA 4HD5A 3AN1A 2C3DA 1KWKA 1E40A 1ZHAA 4H00A 5FIPA 2GGEA 3WLRA 4PL1A 1V02E 4HZ6A 4UTUA 4F79A 3RMEA 1DJZA 3PJUA 2CLHA 2A7PA 2XM1A 5H6HA 5CPQA 1G4PA 5LIWX 3FFSA 4YYCA 2X0SA 1M68A 2FGBA 2XTKA 2PWGA 1SO3A 3TP4A 2PWVA 1MDLA 1OGSA 3PY2A 1KTNA 1GYMA 1F73A 1LORA 4Q32A 3CIXA 2VRQA 5EYWA 4NF7A 1NP0A 5DMMA 2BSLA 2Z27A 4CD6A 1UOKA 5AHLA 2PD5A 1NU5A 3M0XA 4CLMA 1PPIA 1KRMA 5EPDA 2GDUA 3UYCA 2QZRA 2WVTA 3T78A 1KTCA 5HOSA 3MDUA 2FPVA 4UQAA 3DYOA 4BEUA 3VNMA 5D38A 1WZAA 3BQ5A 3AXIA 1Z42A 4W4QA 4C6NA 4XTDA 5D8WA 2VRKA 4RZ6A 3WH5A 4DO6A 4YTQA 2WMHA 3VUSA 4NEWA 1FEBA 1TJ0A 1M03A 1UD6A 4QLLA 4FDCB 5DEZA 2VEIA 2FDMA 5E09A 3G6MA 1K3UA 1Q2SA 4IMGA 3GIPA 3CJPA 3KVLA 1LG2A 5FSDC 1EB3A 1NOUA 4IIGA 4RDYA 1S7MA 1WQ5A 3G8EA 3GXMA 3GSMA 1RCQA 1JCJA 3BDKA 5LA1A 3OVQA 5D9OA 3PG8A 4WY0F 2OSWA 2PI6A 3N2OA 3DHDA 1QPNA 1Q7MA 4FMVA 1IT0A 2PEVA 3UNTA 1HJXA 2OZ8A 4GKLA 2QKFA 3UR2A 1PHQA 4FS9A 4LQ1A 3WEZA 4IJBA 1CW2A 3MMDA 1EF3A 5HWJA 3KWSA 4DJFD 4PRWA 2JFEX 3GNPA 1E72M 2HK1A 1JIBA 1SJAA 3NURA 1OB0A 3SR7A 1EP2A 2EQDA 3W7MA 2VX6A 4PMYA 3CYJA 3ZZ1A 4Q33A 5G5GB 1PJ9A 1C90A 1XDLA 1SZRA 3O3RA 4K68A 2R1MA 4DWSC 1EPXA 1MNSA 3GW0A 1DWIM 4W8AA 2F7FA 1FCVA 5LHEA 3V5CA 3CUIA 1UA7A 3QMRA 4IMFA 1HFBA 1V77A 4H8VA 3BG3A 1PXGA 2F6KA 2OEKA 4GLEA 3PZTA 4GR1A 3CMFA 3E96A 4HHHA 3JW7A 2QCLA 1V3MA 1GJPA 1X7IA 3M47A 4IQLA 3N17A 1DTUA 4DHGA 3WQPA 3BV4A 2DSWA 4KETA 3GM8A 1RBAA 3GTIA 5A95A 1DJHA 3RCNA 1UJQA 3PS7A 5D37A 1W9XA 3NNTA 1F07A 2QJMA 5CZJA 1ISWA 3LZ3A 1A5LC 4C6EA 2DVTA 3KCJA 4JYDA 4Y8EA 4FNQA 3NVTA 2O0TA 3RHGA 4HPHA 2CBUA 2D73A 3L4ZA 1Z89A 4O8AA 5KETA 2Y0FA 2NW0A 2P0OA 1PKLA 3D0CA 1MQPA 3WUEA 1D3CA 4QISA 3GTNA 4H01A 3VGGA 3HFTA 3PWIA 2E1DA 3BAKA 1U2YA 3AHVA 3VE7A 3QMTA 1BF6A 1F7BA 1OFBA 5LNSA 4PMXA 2HPIA 2GR2A 5AC4A 5MHBA 3ELFA 1F8MA 3KVJA 1XH2A 1N8FA 2PLMA 1N62C 3RMJA 2Y6ZA 3VO0A 1GW9A 4LH8A 5CG0A 2VWSA 2WZIA 2WZHA 4PUJA 3A64A 4BEQA 3O7UA 2R9ZA 1XLFA 1XYAA 1F6PA 3O9NA 1U5VA 3TJ4A 3EUB3 1BG9A 3WJZA 4A6GA 4JTEA 4I9MA 3VX0A 4PB5A 3S6OA 2WHLA 4EM3A 1OFOA 2OWXA 3AIQA 4CQBA 4MB5A 4H4VA 4HNLA 4A8LA 1OVDA 4QX4A 1JOAA 1BPLB 1E71M 4FALA 1UC4A 1R30A 1ENUA 3OLDA 3IIVA 1TIMA 2FGLA 2CLLA 1UH4A 1JYVA 4O28A 1V0MA 2PDGA 1JNEA 3LCGA 3J7HA 3MUCA 1CGWA 2TYSA 5FD0A 1QASA 3C5QA 3V1PA 3E49A 1PVNA 3KBWA 3EWCA 1OJXA 1C8VA 3W7EA 4PBFA 1Q63A 3LBCA 4WGXA 4DYKA 3TAKA 1CLXA 2EG7A 3TK7A 1F8IA 1V7AA 1UR0A 3V16A 3ARXA 3QR3A 2UZ9A 1TQJA 2OQYA 3ZWTA 3ZLFA 1ITCA 1VJSA 1HGWA 5JU6A 2Q02A 3TR2A 1I45A 1JUBA 3AWOA 2YLAA 1E6ZA 3V18A 1FEAA 3UGVA 4AD2A 3AXKA 3AZRA 4P7RA 3L4UA 3CO8A 4MWAC 3VIMA 3GX9A 1MUCA 3T0DA 2R94A 1AMKA 2DZTA 4XIAA 4S23A 2E9LA 4ZVJA 5ABFB 1KRBC 2NQ5A 4UTHA 1FWSA 1KFLA 3RLHA 1OCNA 4GQRA 1VBJA 1O94A 1BG4A 3TTOA 3CT2A 2XWEA 1GEUA 4DJDC 2E5AA 2QPUA 3VC5A 5U1OA 3L4YA 1VENA 4HSNA 4D8AA 2VFHA 3SN1A 5AHEA 2C71A 1CYGA 2PLKA 8RUCA 4P7QA 4PGLA 4P8XA 2VR4A 4URIA 5A6AA 1X39A 5LSMA 4O15A 4AIEA 4PRRA 2I9EA 1SSGA 2DIJA 1E3XA 4O10A 1G7UA 4IFKA 3R79A 4QSHA 4BHYA 3CWNA 3RPTA 1RHCA 1V51A 1QI0A 5A2CA 1FWFC 1UKOA 4LUYA 1FDZA 2HTMA 1N8WA 2BHYA 3M0YA 4GVGA 2FZMA 4H04A 4GH1A 2ZZ6A 1DE6A 1IWBA 1EJVC 1NY1A 4O14A 1FO4A 2WB5A 4BCEA 1VCVA 1OF8A 1ZJAA 2IKJA 4IISA 1CLVA 2ZZ4A 4CCZA 4UFIA 1KTBA 4I9JA 5GJNA 3QGKC 3ECQA 5CLWA 1L6YA 3WJYA 2CLOA 3H55A 3FN9A 4S3FA 3RJXA 3ZFHA 1DP0A 2W27A 2G8ZA 5BCAA 1RD5A 3CGDA 1K4GA 3PFRA 3PZNA 5LIKX 4M82A 1TZ9A 3E0IA 1QPRA 1TV2A 3POCA 4YXGA 3NQMA 2CYGA 3BE7A 3QRHA 3W6MA 4QJ5B 2Z26A 3EB2A 1FWHC 2XH7A 2J27A 1VGAA 2Y8UA 3NVYB 3F1QA 3VIPA 3LTYA 1B3YA 1R3SA 4RPQA 3FG2P 4AD4A 3CHDA 4A8RA 4C90A 5JCIA 1G0CA 3KLLA 2AL1A 1JCXA 3WDIA 3QSTA 4JGDA 2BOGX 1F3EA 2HNEA 3ANVA 1QBBA 4L9YA 4O54A 4Q8OA 4BQ5A 2ZWZA 4B5VA 4RNHA 2FH6A 3RX4A 3DJJA 3P60A 1WBJA 5AVHA 3WCZA 3R89A 4FB7A 1Z41A 4BQ2A 4GABA 1VFFA 1TQXA 1JD7A 4O4VA 2R8WA 1W1IE 4MNKA 2V81A 3TKFA 2R91A 4H4YA 4QDWA 4Q8TA 2DT0A 3S5SA 5A5WA 1ONWA 2XN2A 3II4A 1MFVA 4E8GA 4RE3A 2O92A 4L4LA 1PDZA 3OQ8A 1OHLA 1UP0A 1A3HA 3QPZA 2YZ5A 3TC6A 3K46A 3OW1A 5EBAA 1K8CA 3EWXA 2V9DA 4P7LA 5A8PA 3L5OA 5A8QA 5HQMA 1I2NA 4M0XA 4FA3A 4QCFA 1V3KA 3TJXA 3QN3A 1R46A 2VC7A 2VFFA 4LS2A 3W6LA 3MS8A 4KRZA 4LAMA 2HVMA 1KM1A 1W3NA 3WNMA 3B0XA 2FPYA 3ZMRA 3P0XA 3PK7A 3A47A 1PIIA 1XHGA 1J18A 1E6RA 3SCWA 1RXOB 2CDUA 1HXJA 2HE8A 4ATWA 1XG4A 5FEPA 3MWAA 3K5XA 2I5QA 2A7NA 3DG3A 1S46A 4NZCA 1LM1A 3RR1A 3LCXA 1ITQA 5CZSA 1MO9A 1EXBA 3C3UA 3GNXA 1SFTA 4PN2A 3RNMA 2YOCA 3M41A 3EF6A 3DFPA 3ZJKA 4O8RA 5A8MA 3QSRA 2NVAA 2D2HA 3VKDA 1MXSA 1W6TA 5AC6A 4J3ZA 4RW3A 3B8TA 4I8YA 2ZXBA 1Z32X 2E7FA 1VQTA 2PODA 2PAJA 3VKKA 2F9RA 2E77A 5E0CA 4HNTA 3CUGA 2W3RA 2A21A 1CXIA 1QR7A 4U5IA 3AMCA 1EC9A 1ZFJA 4LANA 3CPUA 3CHFA 4NJKA 5ABFA 1CDGA 4KFOA 2ZZ3A 4IHCA 3W2UA 1ZSXA 1H0GA 2VQUA 3CNYA 1DWFM 4UQBA 1UHVA 1I6NA 5F4WA 2CESA 2CITA 2X42A 2XVNA 1TIWA 5D03A 4ZQOA 3C86A 1VBGA 3CL7A 5C2GA 2WOWA 4XISA 3VNDA 4MJ2A 3VDGA 3U2OA 2ZVIA 3JVAA 4K36A 2CIPA 2Y5EA 1EP3A 1X8CA 2QJJA 3H4GA 4M8UA 3N15A 4ZCWA 4D1IA 2QDDA 4GY1A 1WP6A 2V3FA 4FNRA 2WMIB 4AX6A 1UG6A 2WVVB 4XZWA 1Q6EA 2YVGA 3FEQA 4XVDA 2CFYA 4AZCB 3IIOA 3EX3A 3CL6A 1ZAJA 3CHCA 5BXPA 1WDPA 3EWDA 4MB3A 3FW6A 3NXLA 5CSUA 4EIVA 2I1OA 1U1HA 2ZDSA 1VPQA 3TQKA 1YNYA 4NXKA 2ACQA 3D5HA 1UKSA 5I3GA 3VOGA 5TAOA 4GE8A 4WCJA 4Z2HA 3NA8A 3U2EA 1JEHA 2X99A 1V02A 4WEVX 4JTAA 2AQWA 4OV9A 4XAZA 1KQZA 3TJIA 2B81A 4Q7NA 3GR7A 1SJDA 5E0KA 4YYFA 2DZPA 3AWNA 1EEPA 2W3SA 2D3NA 4LY8A 2Z1KA 3FSTA 1MUWA 3R8RA 4D1JA 5IHRA 1OQFA 5LZLA 1WCGA 4XK2A 1IZJA 1PAMA 1GQJA 2IXUA 3W9ZA 1ISXA 2AAQA 3EAUA 1GWJA 4CCEA 4G7EB 3EPOA 3E74A 1DEDA 4E2DA 1QWGA 2JK2A 2YBVA 3S2JA 5KEZA 3DENA 3MYPA 2HS8A 2EF9A 3WLQA 2FLIA 2NUWA 3UWYA 4A22A 1FUYA 1DOSA 2FFCA 4CQDA 4GINA 3N9SA 1RD6A 1ICQA 3GIQA 3B9OA 2KAUC 4G2DA 4DI8A 1SO6A 5HAOA 3OVPA 4IGMA 4TOQA 1K9DA 4WDTA 1W5NA 1QDSA 1J10A 2J77A 3F4VA 4ZXOA 2DZAA 1PL9A 2W79A 3GQYA 4AMCA 1OD0A 2WBGA 3VDHA 1FFUC 3GWQA 2FQIA 1P5BA 4HTYA 3THUA 4GX9A 5I77A 3VD3A 3TAOA 1F9CA 1M01A 5JXQA 1ONXA 1OC6A 2Q8LA 4NI3A 3B97A 1VC4A 4X0NA 2XVLA 1I0DA 3LHZA 1IXOA 3E38A 5CH9A 5C9ZA 2WSQA 3SECA 1NF0A 3A3XA 2RDXA 3AAMA 2PLCA 3PNZA 1FKWA 3AUOA 4N42A 1QAPA 3IK4A 1YKWA 2WJZA 3PAJA 3LLXA 1ELSA 4RXFA 1BWLA 5EY5A 1CIUA 5LNWA 4X63A 5HK4A 5D2YA 3MBFA 1POKA 1NWRA 4I8DA 2HROA 3MT1A 4P2VA 1MQQA 4A05A 1RSCA 3DGHA 3CAQA 3BLFA 5KMYA 4Q4QA 4JFSA 4JN7A 3AHXA 4O57A 3IRDA 2O9TA 4EMIA 2OGJA 1JI1A 1S3HA 3GDMA 4HIBA 2GGHA 3HFYA 4D8LA 1JDEA 2CKSA 4NVTA 2YDAA 2HXTA 2PDNA 2A3AA 2GDVA 4DXVA 4WY0B 3T0AA 4UZUA 4IL2A 4ATLA 3NPUA 4K1WA 3P61A 2XFRA 1TYTA 3FHQA 3D9XA 4K7ZA 1E4MM 3C8NA 4NJJA 1JQVA 2CZFA 4NX5A 4XZLX 1HKWA 3MCMA 3GTFA 3EEZA 3NQGA 2ZX7A 2VQTA 3TYAA 1MSSA 4JYEA 5TR3A 2FYMA 3W82A 1PYMA 1OBAA 2G3FA 4XAGA 4IP5A 4LUJA 2XIOA 4W85A 5I7GA 4APNA 1V6WA 3EX4A 2E8ZA 3I4EA 3WL0A 3R25A 1HGYA 5IHSA 3EX2A 5HXMA 3KBJA 1TV5A 4EQWA 2F8QA 4LOCA 4AVOA 2PMQA 2PU1A 3DFNA 3EB3A 1W32A 4TIMA 1R38A 1W3KA 3IJDA 4JFTA 3S9IA 4H7ZA 2PDQA 3W4RA 5CXPA 1E0TA 1XC4A 2X1TA 1TZ7A 4B3ZA 4Z1CA 4BI6A 1JZ8A 3QKEA 4HMCA 3UJRA 4DVOA 1PB0A 5JVLA 3CH9A 5IXEA 4DWSD 1OFPA 5CZ0A 2A85A 3ZQ9A 2WMIA 4GHRA 1XYMA 4GNVA 3IGUA 3NTYA 4AZCA 4QIUA 3POHA 3SZ8A 4U4MA 4RE2A 1ZS2A 2EPMX 3KRSA 3LV5A 4IUOA 3BANA 2E3ZA 3EX1A 2A4AA 4W8BA 3KTCA 3W1MA 3EDEA 4LSBA 2ISFA 5BOEA 3MUZ1 4HPXA 4FXSA 4CNNA 4CCCA 2AGKA 3GXFA 1H7NA 2D0GA 2EQ7A 1FBAA 3FIGA 3T4CA 4AYGA 5AFDA 2XH0A 4KWWA 1OC5A 2F38A 1RA0A 4F3HA 4OWGA 1SQ7A 3PBVA 4EWJA 1SMAA 3ITTA 3UW6A 1JCTA 3WN6A 4A3QA 1MWOA 4AFYA 4G7EA 4JIRA 1W31A 3BUVA 3QEZA 1QCWA 4LYPA 1AW2A 1R5YA 3LSCA 3GS6A 3DUGA 3K1DA 2G5WA 5JCMA 2PF0A 5AN7A 3T55A 4NRSA 4FOKA 1YDNA 1SZEA 4JFWA 4FP1A 4JQ2A 1G9HA 1W1TA 2OYMA 2CLIA 5A6BD 1I75A 2ZE3A 4GJIA 3P6LA 4X9SA 4S2BA 4Y9AA 1YADA 3N2CA 5DLCA 1KBLA 1XGEA 1DWAM 1RM6B 2DZUA 6A3HA 5K4ZA 1RPXA 2QUNA 3LBMA 1TMHA 1IXNA 3AS1A 4B2DA 4JTHA 1XUZA 4MKVA 1N61C 1P0EA 1E0VA 3HPSA 1XLHA 4C1LA 4YTSA 3N6JA 3KM8A 2WNWA 4F4RA 1G94A 2GQWA 1H62A 2SFPA 2WK2A 4W7VA 3RCMA 3BSHA 2P88A 2X05A 1E0UA 5F2IA 4ZB2A 1WKEA 4WJ8A 4XZMX 3I7QA 3G0SA 2X2GA 3G1DA 9XIMA 3EAOA 1A5AA 4DEFA 1HN1A 4C6PA 3L68A 2HCVA 2RFGA 3IGHX 4JQ1A 4LEFA 1GVSA 2TODA 4U3AA 1HJQA 4DY1A 3FVMA 4A3RA 3MP3A 4RPPA 1NDVA 4S3DA 2BFGA 4R7JA 1CXEA 1A5OC 1VFTA 2ABBA 2Q09A 3Q45A 2CHRA 5CEWA 2ACSA 2DZBA 2ZUSA 3HA1A 1FH9A 1CPUA 3LHYA 4HB7A 3JZEA 1QO2A 1QK2A 3M0JA 3SY8A 3QFWA 4ERIA 3WD0A 1KKRA 5DANA 3KDOA 4ZO6A 4B3KA 4DO5A 1K6WA 5CPOA 2VUNA 2MNRA 3NL2A 2W92A 1Q6DA 3CV1A 1A4LA 1GQKA 3CB8A 4WY0A 3ALFA 3SCPA 1DPMA 3L2MA 5I2UA 5I3DA 3KBSA 1UWIA 1PBGA 3M5ZA 3HPZA 1R2TA 2DT1A 1N82A 4MWAD 3ZVIA 4D6DA 4C7GA 3BARA 5C8BB 1DXIA 3FY1A 4ZOAA 4C1NB 3S6TA 1TPEA 3SFWA 4JTRA 1S2VA 4QITA 4W88A 4OFCA 4HK7A 4JIQA 2HWGA 5CPTA 3L2IA 4PMZA 5LKYA 3CAVA 1R85A 4NZFA 5IDZA 5I5RA 3PPHA 2VGGA 4Y9MA 4XZHA 2W3ZA 3IGXA 2NXGA 3EBVA 2DT2A 1US0A 4FNTA 4C65A 3ITGA 3SRHA 1U5JA 1C9DA 4QS6A 5FS7A 2WC7A 1VFMA 3W72A 1BAGA 4AHPA 1GV4A 1XDIA 4CNUA 1FCQA 2A3HA 4CKQA 2DIEA 3O6DA 4L1GA 2RGMA 2XISA 3HG4A 1H1YA 3T0TA 4FK9A 4NZJA 1SFJA 3FGCB 3DYMA 5KTLA 2OLSA 3A12A 3RLVA 3MZNA 2YXOA 5G4EA 3M43A 1T6MA 4M1BA 1TV7A 3H21A 1CB2A 3EZ4A 5A1AA 2GJLA 1LBLA 1L6GA 5DRCA 1FCBA 4GI4A 1EGZA 1HP4A 2WQDA 5K9XA 1GRFA 4US5D 3FJLA 5D4YA 2QS8A 3V4BA 5E9AA 1DHKA 4QDPA 5L9FA 5EB8A 2PGEA 1EIXA 3WIJA 3LY0A 2IW0A 2INEA 5AHNA 2YLLA 1P7TB 3NDOA 5I09A 4D6IA 4UTKA 1REQB 2J7DA 2QT3A 4ZOBA 1ZY8A 1RY8A 4U5KA 3WJSA 3WH8A 3W24A 4PH6A 1US2A 3FA4A 1THFD 3NQVA 3S2CA 5BU6A 4REQB 4JAWA 4IGSA 1XLGA 2ZA1A 5FJTA 1D7KA 4K39A 2OO6A 2EPOA 3WZ0E 1UMYA 4B90A 3P80A 1S5VA 1EBDA 4B9YA 3LI0A 2FTWA 1FXPA 3DFTA 1K4QA 4NAFB 2EHHA 2CHNA 9RUBA 3PNUA 2MUCA 1JYNA 5CGQA 3MUXA 3CUFA 2RUSA 4HPJA 3VNIA 3PUOA 1UMLA 4ILSA 2L5HA 2PDXA 2C3CA 2FVKA 3LHWA 3V7PA 4N4QA 4Q3MA 3A5VA 2ZX6A 2WWDA 1P1XA 4RXGA 2GWGA 1AG1O 2GUUA 3FDKA 3F5LA 3KTXA 3VIIA 4OUEA 3ITYA 4TO8A 3BCDA 4ERGA 4GUJA 4W5ZA 4ENLA 4ZA0A 1A5KC 4JNZA 5FF2A 3TXZA 3EA2A 3E5BA 4YS1A 4XZIA 4JKLA 1KGXA 1RUSA 3BSMA 2JIEA 3PJWA 3N4AA 3SGGA 1XIEA 4GX8A 4DJEA 5C71A 3GRSA 1LJYA 3BOFA 3H53A 2AL2B 4ZBCA 5G5IA 2ZADA 3TNBA 5CSRA 3SI9A 1OFRA 3R94A 4JFVA 4S3AA 4AD5A 2FHBA 3H7RA 1J0YA 4W7UA 3LB8A 1SW0A 3P62A 1D8WA 1UH3A 3NQAA 4EPBC 2VKZG 2EGZA 5XIAA 4AX7A 3RCYA 2EXOA 2W5FA 5CSYA 1B3XA 4FLQA 1L2UA 4JTKA 3VA8A 1XIBA 3IWPA 3ONCA 2VDIA 3UP8A 5KSWA 3PSVA 5B7YA 3ARZA 4GFSA 5TF0A 4PTXA 1TPUA 4I7UA 1R3WA 1NFBA 1XFCA 4LS1A 3RF9A