4HYRA

Structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
442
structure length
442
Chain Sequence
LVPVITKMEVYPVAGHDSMLLNLSGGHAPYFTRNIVILTDSEGNTGVGEVPGGPKITTALENVSDIVVGTKVSDYRNTLLKVQAELDKSGEKDERGAQTFDLRTGVHVLTAIEAPCLDLLGKALDMPVCRLLGAGQQRDFVRFLGYLFFVGDRKKTDLPYQSEEDSDCEWYRLRNEEAIDAEHVVALCKAAKNKYGFKDFKLKGGVLRGDEEMKVIKAMKKAFPDARMDLDPNGAWHLDDAVRYVADMHGILTYCEDPCGAEDGYSGREIMSEFRRRTGFPTATNMIATDWRQVGHSLESQAVDIILADPHFWTMNGSVRVAQMCHEFGYTWGSHSNNHFDISLAMCVHVGAAVPGEYNALDTHWIWQEGRERLTKEPLKIANGGIKVPDKPGLGVEIDRDQVMKAHELYKKHCLGARNDAITMQYLIPGWKFDAKSPCLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative Glucarate dehydratase from Acidaminococcus sp. D21 with unusual static disorder
rcsb
source organism Acidaminococcus sp. d21
molecule tags Lyase
molecule keywords Glucarate dehydratase
total genus 144
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hyrA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hyrA01
2GGEA 5FJUA 1FHUA 4ZCWA 4HNLA 2PTWA 3QN3A 2OLAA 3ENLA 4KWSA 3MQTA 2PTXA 2PPGA 2I5QA 3CK5A 3FYYA 4EWJA 1EC9A 4DHGA 3FJ4A 4X2PA 2NQLA 2XSXA 2HNEA 2GL5A 4GYPC 1EBGA 1R6WA 4IHCA 1JPDX 2OZTA 1JPMA 2OFJA 2P88A 3TQPA 2P3ZA 3PFRA 2FKPA 4ROPA 1KKOA 4E6MA 3H8AA 2OO6A 3Q4DA 3NXLA 2AL2B 4A6GA 1EBHA 2PCEA 3ES8A 3V4BA 4GGBA 1EC7A 3PK7A 3VCCA 3N4EA 3ZVIA 3DG3A 3OZMA 3DEQA 5FJTA 2QJMA 2OPJA 3ZLHA 2OQHA 3DGBA 4J1OA 4GGHA 4GISA 3TW9A 3CT2A 1L8PA 4DN1A 1P43A 1W6TA 4Z1YA 4Z17A 1NU5A 4H2HA 4DX3A 1ONEA 3T4WA 4K8GA 3Q45A 4HN8A 3H12A 2GGGA 3N4FA 5FJPA 4IL0A 2PMQA 2FYMA 4E5TA 3QPEA 1ECQA 4HCDA 2PODA 3FVDA 3OPSA 4HPNA 4ENLA 4IP4A 3ES7A 3GY1A 1SJBA 2GGHA 3IJLA 1JCTA 1ELSA 2OKTA 5BOEA 3UXLA 2AKMA 1P48A 2POZA 1IYXA 4E4UA 3IJQA 4M0XA 4M6UA 3VCNA 1F9CA 3MKCA 5ENLA 1SJCA 2QQ6A 1SJDA 4FI4A 5BOFA 3BSMA 2XH7A 2O56A 3BJSA 2PS2A 3SN4A 3UJEA 4HNCA 1OEPA 3V5CA 4ZA0A 3IJIA 3SN0A 2CHRA 4G8TA 3SSZA 4KT2A 3TOYA 2RDXA 4HYRA 1MNSA 3VFCA 1E9IA 3IK4A 2XGZA 1XPYA 3ZLFA 3JW7A 2QVHA 2MNRA 3I6TA 2QDDA 3ZVHB 1YEYA 3FV9A 3R1ZA 2PU0A 3TWBA 1FHVA 3MSYA 1DTNA 3R25A 3FXGA 2OVLA 2PGEA 3P3BA 4GIRA 6ENLA 2GSHA 3DFYA 2DW7A 2PSNA 4GYPA 3I6EA 3SQSA 2HXUA 4A35A 2XH4A 3MY9A 2AL1A 2GGJA 7ENLA 3R0KA 3UJFA 3CXOA 4K2SA 3JZUA 3OZYA 3T6CA 3SBFA 2MUCA 3ZLGA 4MKSA 2AKZA 2QGYA 1TZZA 3RO6A 3VA8A 3CAWA 3QLDA 3EEZA 3UJRA 3JVAA 3FCPA 3D47A 3B97A 1BKHA 3R11A 3T9PA 2PP1A 1SJAA 1KKRA 3BOXA 4A3RA 2ONEA 3NZGA 4H83A 3PWGA 3GC2A 4IP5A 3UXKA 4MGGA 4H19A 3SJNA 1MRAA 4KEMA 3STPA 4FP1A 3MZNA 3VC6A 3RITA 1JDFA 4GFIA 1KCZA 3GO2A 1NELA 4E4FA 2XH2A 2PU1A 4JHMA 2OZ8A 3PWIA 4MMWA 3CB3A 3CYJA 1R0MA 1MDRA 3EKGA 2GDQA 3UJ2A 2QJNA 1PDYA 1RVKA 3K1GA 3RRAA 2DW6A 3N6HA 3UJSA 2PTZA 3V5FA 4GMEA 3I4KA 3MUCA 2HZGA 4HCHA 4K1WA 2P0IA 3S5SA 3TJIA 3N6JA 4DWDA 1WUEA 5IDZA 1TE6A 2XH0A 1EC8A 2OQYA 3QTPA 4DYEA 2PTYA 3NFUA 3TWAA 3D46A 4KPLA 3SN1A 2PGWA 2HXTA 3DDMA 3RR1A 3HPFA 3H7VA 3UCDA 3VC5A 3T8QA 3MWCA 3TJ4A 3VDGA 2OX4A 2PP0A 3P0WA 3DESA 1KD0A 3U4FA 1WUFA 4IL2A 5EU9A 3UGVA 3KUMA 4IT1A 4J3ZA 3NO1A 3OP2A 4DXKA 3DERA 4G7FA 3P93A 1XS2A 1MDLA 3R0UA 5FJRA 4F4RA 3R10A 3H70A 2ZC8A 5FJOA 3U9IA 2P8CA 2P8BA 3RGTA 1MUCA 1PDZA 1BQGA 3S47A 2QDEA 3RCYA 4E8GA 2PA6A 3ZVHA 2PP3A 3DG7A 5J04A 4HCLA 3V3WA 4JN8A 2QJJA 1TKKA 4JN7A 3DIPA 3DFHA 2ZADA 3DG6A 4YWSA 3TCSA 3OTRA 3QKEA 4IZGA 3GD6A 3TTEA 3THUA 3OW1A 2GGIA 3UCCA 4H1ZA 2OZ3A 2AL2A 2OG9A
chains in the Genus database with same CATH superfamily
3PB0A 1I9CB 1OCNA 2IXVA 4BQ4A 1WCGA 3EMQA 4ERGA 2F8QA 1K8ZA 3G1AA 1V6WA 1XWYA 3B0YA 3CK5A 1WDPA 2C3ZA 3NDYA 3TC6A 1EGMA 1Q2RA 3VNDA 4AU0A 3CHVA 2YL5A 1EJXC 3VXGA 2Z4GA 3ZSSA 5CC3A 4A4AA 2ZX9A 1NWUA 3DH7A 3TW6A 2Y7GA 3E9AA 1WZKA 4RR4A 1JYNA 3O1NA 3WDHA 2O92A 4ACYA 1E0VA 1VDVA 3KRSA 4AIUA 1XFCA 2C0HA 1PJ9A 5D03A 3NQDA 4UOJA 1V02E 3AYVA 2I14A 1EF2A 1VFOA 3W6MA 3GG8A 3WLHA 1XX1A 5A8OA 5HMFA 4GISA 1VPYA 1OC6A 3QMRA 2PDYA 4Z17A 3NOYA 4ZO8A 4QLKA 4CNOA 1SZFA 1HO1A 4X0NA 1LDCA 3L4XA 5AYZA 1FXQA 2WZEA 3NURA 4FLSA 1FHDA 4O28A 4E5TA 1ZUAX 4ZVJA 3QFAA 4JKLA 1LRQA 1OY0A 1XGZA 4ENLA 4AD5A 2ZRYA 1M68A 2V5BA 3KVMA 4K68A 2B7QA 4JQ3A 1K9FA 2X2YA 4FXJA 1P48A 3QZ6A 5F7UA 3GTNA 4AWUA 1TPC1 3F5KA 5IFPA 1FP9A 3ID7A 2OYKA 3TE9A 2DUXA 2HJPA 2H8XA 1VLWA 2XWDA 4ZQOA 1QNVA 3MI2A 4JR5A 3FKRA 1IE7C 2WJFA 1OFOA 1KXQA 3V5CA 1O6IA 4IFOA 1MXDA 3MYOA 4JL1A 1LF1A 1UR1A 1DIDA 4C6PA 1OF8A 1WBHA 5E93A 4HGXA 3O0FA 4Y9MA 2E9LA 3EWDA 3NCOA 4LYRA 3QBUA 1IIHA 3C8NA 1LOSA 1A4LA 4E0CA 1X8CA 1YEYA 1UP3A 3KCJA 1BLIA 3M16A 3SIZA 1EJRC 1FWWA 4NAFA 3O63A 4O0KA 5I00A 4XAPA 3NVTA 5I23A 3GDRA 1S1RA 3GU9A 4REQB 3VNYA 3PPGA 5LA1A 2VWTA 1UWSA 3S83A 1XL9A 4X0VA 4JCMA 2DU2A 2J27A 5HA7A 4Q7IA 1KFBA 2AL1A 3TSBA 7ENLA 4A05A 2WMGA 4AZGA 1SSDA 3EPMA 1MMFA 4QDWA 4MWAC 4OHQA 1L9WA 2IXUA 1AQ0A 2VP8A 1Q7MA 2Z0IA 3T6CA 3II1A 4IQLA 1TWSA 3VA8A 3EWBX 4FIQA 1NSJA 3NQAA 4N9CA 3EWCA 3B9EA 4FF7A 2ANUA 4DJDC 5CZKA 1KV5A 1FWIC 4EPDC 3EA2A 1GUVA 1PKNA 2PP1A 4JIEA 3T2OA 1SJAA 3H7RA 1KRBC 4IM4A 1EIBA 1CGUA 3BLIA 3DK9A 2QPUA 2WXDM 2X0HA 3WLIA 2J3NA 1CLVA 3IRSA 1VFTA 2J7FA 2V5CA 1A5UA 1GKPA 1X38A 5DF0A 4AEEA 3KBNA 2BHZA 4GRSA 3CH9A 4IF2A 4CU8A 1A5KC 3AIQA 3LBCA 1Y8BA 2WVTA 4PH6A 5I6SA 2Q01A 1TIMA 1MI3A 2A1YA 4MMWA 4Z2JA 1C29A 1BZLA 3EKGA 3SECA 3IRDA 4H8NA 1OT2A 3EGJA 1OGGA 3UWEA 3GHUA 3LMZA 1CGYA 3ZZ1A 1UC4A 4IPJA 3WQDA 1H51A 1VYSX 5LYRA 1QI3A 3SY8A 1WXJA 3AROA 2V5JA 4GMEA 2OR2A 3M46A 4GI4A 3N19B 1TX2A 2P0IA 1UD4A 1SVDA 3H2FA 2YXGA 4JX6A 1JJKA 3BG5A 3CQIA 3TXZA 2WHKA 2QCCA 2C71A 3PP7A 4LF1A 4UTTA 1PZ3A 4PEKA 4O16A 5H8UA 3S0CA 1V8EA 3PZUA 5T91A 1RBOB 3BLFA 4B91A 3RG6A 4LS1A 3VZYA 1FXPA 1M03A 4X9SA 1GJUA 3AIUA 3M0LA 4AISA 3LG3A 2G5WA 1DIKA 3KUMA 3ECQA 3K46A 3GFYA 1OCQA 4ECLA 1AZ1A 5F4SA 4TVDA 4NAFB 2OODA 1W8SA 3KBVA 3GH4A 1DXIA 1D7KA 3A9IA 3ARXA 2ZTJA 3M43A 3RX3A 1O1HA 1V03A 3BLDA 2R1PA 3NQCA 1ZRQA 1PIFA 1ZBVA 3RLUA 1RV8A 2HMCA 3M0ZA 5FAJA 4ERIA 1JZ8A 1G67A 1RP9A 7ODCA 3DK8A 1Z44A 4NHVA 4XIAA 4DF2A 3UVIA 4C6CA 1GQKA 4AVFA 3WENA 4EIVA 2QF7A 3HG5A 2OCZA 1FFVC 2X50A 2YZRA 4IMDA 4MVAA 3AZRA 3FG2P 4M52A 3DIPA 4RNIA 5DXXA 2FDMA 1J79A 4M1RA 2GVJA 2WVSA 3OW1A 5D4YA 2ZZ0A 3KL5A 1R3RA 1K8YA 4MDPA 2QCMA 3W7LA 3FA4A 2PTWA 2Q09A 4KFNA 6XIMA 1KR0A 5H8PA 3E2SA 4U31A 5AOUA 4AWEA 4KRTA 1U33A 1RA5A 1YXCA 2YBUA 4XZMX 1J6PA 3QQ0A 1JXJA 1DJYA 2Z7GA 3ITVA 4X2PA 4NASA 1EUNA 5ABFB 4GYJA 1E5NA 3R4IA 4JIQA 1JPDX 1O94A 4MB4A 1KN0A 3WUEA 3VGFA 1QI5A 4K8HA 3V1PA 3OOQA 2V3AA 5EBKA 1PTDA 5F4XA 3C2FA 3LXCA 4GH3A 1DJZA 3CH0A 4RK8A 1MFUA 4S3EA 1V3KA 1K8CA 3C2OA 5G1MA 3W1TA 1F07A 4K37A 3FYPA 5IM51 1B4EA 3DEQA 2ISSA 2P76A 4HZMA 3GBDA 1XC6A 3KWSA 3V18A 4J9JA 4L61A 1LP6A 1L8PA 4BK9A 3KHJA 3LENA 1RJQA 3BGJA 6REQB 1HQTA 4Z1AA 4BWLA 1UQZA 3UPBA 3G6MA 2A4AA 1HKMA 1XBYA 4K8GA 2X0SA 4HN8A 1MRQA 3AXXA 1DXFA 1A49A 4HCDA 3OPSA 4HA3A 4JFTA 1JIBA 3M07A 3FX4A 4FNSA 2QLYA 1SJBA 3SGGA 4F2UA 4A22A 5CPOA 5LKYA 4TQTA 4FR6A 3PAJA 1UWRA 4ZSUA 3WFLA 3VKKA 3MKCA 3FEMA 4EK7A 3SY5A 3U7VA 3KVJA 3UR2A 2PWVA 3LSBA 4TX8A 3PSWA 5IBXA 3LK6A 5FI8A 1F2JA 1ZMCA 6TIMA 1DWHM 2PS2A 1AMYA 3NO3A 3E12A 3PZGA 6TAAA 2VC9A 4BI5A 3CV2A 1VEMA 4I5RA 3UYCA 2XWEA 3W29A 1BWKA 4P61A 3IJDA 4AF0A 1EJSC 4D6IA 1V3LA 3T0CA 3BW2A 4GWEA 5C9UA 3AHXA 3XINA 1DHKA 1J01A 3NQ7A 3EWWA 1OK6A 2ISVA 3S8HA 2FMOA 1JOAA 3GTIA 1UKOA 1KGUA 1DTNA 1WKDA 1A5LC 1H63A 4XUYA 1FO4A 1FWTA 1PHQA 4K8DA 1WZMA 5AY7A 1NAL1 2QDHA 2PDIA 4IUGA 5CG7A 4L4PA 4EPBC 1BD0A 1K77A 3KAOA 1ZBKA 1TSIA 3CXOA 4QP0A 2VUNA 1W3LA 2FDSA 2MUCA 3WLMA 3NQBA 4I9AA 4GKLA 1K1DA 4DQWA 1LLOA 3QOKA 5I77A 1OT1A 4AD1A 1JL8A 2G50A 2EPKX 2GUUA 4GVHA 5AECA 4YJ5A 2PZ0A 2PF8A 5XINA 5FJIA 2CIPA 4U3CA 3IANA 1OD0A 4IGSA 1M7PA 3ITCA 4CD5A 2O55A 3GC2A 4PULA 3U2CA 5CCZA 4O1BA 1LT8A 2YBTA 1HFBA 1Q5MA 1X6LA 3HQOA 4QRNA 1EZ2A 4LW7A 2AAMA 1W3HA 5HULA 1XRVA 4FO4A 1KW1A 4E4FA 3MW7A 4YYFA 2OO0A 5D8WA 2D23A 1VBRA 3L4ZA 1HL2A 4FLQA 4JTLA 1X1OA 3E0FA 3VGHA 3A9BA 1MDRA 1FUYA 2GOKA 1TV8A 3VU2A 1JZ3A 1XIGA 3I3EA 4GNVA 1LWIA 1U83A 4P5UA 4JXCA 4LX4A 4NVTA 3TYZA 2WMIB 3CGEA 1B3WA 1K03A 3QHNA 2PRMA 3QFEA 2G3JA 3C2RA 1CXIA 1JRCA 3C52A 5IFTA 1K3UA 1VFFA 4KMQA 4N4PA 2W61A 4MLRA 3BW3A 4PA8A 4UTHA 3VM5A 3DH9A 1RY0A 3QSTA 1AOGA 5CLWA 2OWXA 3D46A 1QCWA 3EYPA 1E71M 3LQGA 1ZAIA 3UCDA 3LLDA 1R2RA 1SR9A 3KP1A 2VZSA 4WJXA 2QS8A 3F7JA 1K6WA 4DZAA 2JK2A 3N15A 2XVPA 3MANA 3LLXA 2CXGA 5JBDA 1WPCA 1EDQA 1G94A 3Q94A 1YYAA 1ME7A 1PYMA 3O2LA 3W7DA 2EF9A 2F9RA 1I0DA 4EQWA 1R85A 2PE4A 2VJXA 3BVJA 3LBMA 5JUVA 3L5MA 1O5KA 4GIEA 4J3VA 2QCEA 3R10A 2OLHA 3PC0A 2BVYA 2X2GA 2NQ5A 3CLWA 4KRUA 3RF9A 1B90A 1J0ZA 3GUGA 4QLLA 1PDZA 1P6BA 1VH7A 1DJXA 2IQ0A 2Q8ZA 2WMIA 1HNYA 1M04A 1SFJA 4ZODA 4Z2LA 1B3ZA 4H3DA 3IUDA 7REQB 2ISDA 4FSAA 1JNDA 3GDTA 3U48A 3PJWA 3QOMA 4QR6A 2VEIA 2VRQA 1FWDC 5TD4A 4QNWA 4WY0A 3W7CA 4NI3A 4M7TA 1GETA 3H2CA 1KBIA 3PUEA 4WSKA 4RL3A 1NWSA 4XBKA 4DO5A 3BAKA 5KETA 4DVOA 4HNVA 1TCMA 4ZXOA 4ZQNA 1P0EA 4KFPA 1JD7A 3BSHA 3FYYA 3KBWA 3ZIZA 1A5MC 3DFNA 4P7OA 1EJUC 4JTUA 2WHMA 2ISWA 3UWVA 1O1ZA 1BXNA 1N63C 1KM4A 1EBGA 3A6OA 4AAJA 2QKFA 4NT0A 1GOXA 2FB2A 5MHBA 1RM6B 2D2JA 5HNTA 1XHGA 2YIHA 4BY3A 5M3WA 5HWNA 3FY1A 3DFSA 3N25A 3CU2A 1J8VA 3C3NA 4PUUA 2WBAA 3STGA 3LGGA 1XSKA 2DORA 2DZVA 1RSCA 3ARYA 4HK5A 1B9BA 4RLIA 2OSXA 3VTRA 3W83A 3PK7A 2YB1A 2GVGA 1GTEA 1M7XA 1KFWA 3FSUA 2RFGA 2WJEA 1OYCA 3RM9A 3BURA 3EXSA 4TV6A 5D2YA 1UR9A 1T8QA 4KQNA 1PO9A 1YTDA 5DY2A 1XSIA 3L0KA 5J5DA 1H7PA 1O68A 5I24A 1HP4A 1XIHA 2P53A 4IL0A 4GO8A 4FMVA 3HV8A 4AF0B 1DVJA 2R82A 2EO7A 2XFWA 4H4TA 5LGXA 1Q7ZA 2B0MA 5HMSA 2GGHA 2HBVA 2GJXB 3TAOA 3S4TA 1JCTA 4A3YA 4GI9A 4C6JA 3RU8X 3NQFA 1E3XA 1XUUA 5EPDA 1O12A 4FNUA 3SR6B 1H5VA 3E02A 4Y9OA 4Y9AA 2QJIA 3AUOA 1MO0A 3QLLA 4O19A 1VPXA 3BLLA 1OJTA 2OKOA 1OFRA 2I5IA 3G22A 2W4XA 2O56A 1SYTA 1XSJA 4E2DA 2VGBA 2ZWZA 3B9AA 1BVWA 3GR7A 3VX1A 3PG8A 3BL3A 1V6UA 2ZZ2A 4EPEC 4IMCA 1RPKA 2VWSA 3SN0A 3CZJA 4G8TA 3P84A 2GQ9A 4LAUA 4FS9A 3CGDA 3APYA 3T8LA 3NQGA 3GTFA 1J0KA 4I8YA 7TIMA 3EANA 1MOKA 3WK2A 4GZJA 1VQTA 1E9IA 1P0NA 2GK1B 4A8NA 1TJ2A 3C2YA 3GVRA 2ZUNA 1UPMB 4RW5A 4O0QA 3P8JA 2MNRA 2XVGA 4I90A 1HKVA 1JDEA 3GFZA 3VNLA 3R25A 1QPKA 4KCWA 3KW3A 3VIJA 3FGCA 3IAQA 4NI8A 3S2JA 6ENLA 4MYXA 2AAQA 2EG7A 4PCSA 1GRAA 3A3XA 3WD1A 3HGJA 3SQSA 3GAKA 3TN5A 2C1GA 2VFDA 5HNUA 4XAZA 3TYUA 1VRXA 4EMWA 5DXYA 4QDPA 3JZUA 3ITLA 3QW3A 4WKAA 3GD4A 1AJZA 1ZBCA 3QVQA 1M3UA 4AY8A 4H04A 4MKSA 1ICPA 1W91A 4GUGA 4US6A 1E1EA 2I9UA 3AI0A 1AL7A 1JZ2A 4J3SA 2Z1VA 1V59A 4AHPA 1TV5A 1BKHA 3T9PA 2QV5A 3CT7A 3BOXA 3CHCA 5D2TA 3W02A 5KVHA 5EA9A 5HR7A 4BEUA 2ZX5A 3RLGA 1RA0A 1W5MA 3U5UA 1BKSA 5HUOA 4I7WA 1RCOB 2TODA 2QULA 3IIXA 5U25A 4AZ7A 1NELA 1W9PA 1XYLA 2Y1HA 5F1VA 4LWWA 4ADWA 2ZOXA 5C2CA 2W6RA 3HN3A 3SQMA 4YVXA 3W00A 3ITXA 4ZTXA 1EYEA 2PBGA 3UJ2A 1PTGA 2XN0A 3ANYA 2DW6A 4D1JA 3QYSA 4GIAA 3BJFA 4GACA 2B81A 3AALA 4JTSA 2YCJA 2J47A 2FPVA 1WUEA 3IJ6A 3KBSA 4C6BA 1TMQA 3LRMA 3EDJA 4MPQA 2QUTA 1M41A 4QE4A 2YLAA 1UR2A 5KVIA 1KXTA 4DPPA 3VDGA 1J6OA 3OQEA 2ZWYA 4Y96A 1P1XA 3VDBA 4X22A 1EZWA 1TZ7A 1SO5A 1ZLPA 1HN1A 5K9DA 2QAFA 3MA8A 3WBWA 2PWEA 2QDGA 1W1PA 3RPMA 3PULA 3FHQA 4JTHA 4GY0A 2P10A 2H90A 3IGHX 3B05A 3OJGA 1G0CA 3MBFA 4XZHA 1ZJHA 1I2NA 2J4GA 2WVUA 3V0UA 4DUWA 2CFYA 4HOXA 3NYDA 3VUSA 5JCIA 5D37A 4EXBA 3BO9A 5LA2A 4RZBA 2QDEA 1QOXA 3ABZA 3BCDA 3DHFA 1JRPA 3GXDA 4CD8A 5C9WA 3JR2A 2BXVA 1PUDA 3IWPA 4OOZA 1A53A 1LBLA 4MUZA 3W38A 3LPGA 1PZ0A 3OTRA 5G1YA 4O1DA 3EUB3 1YBQB 5C54A 3OGSA 2Y61A 1BRLA 1KTBA 3VKJA 4IXXA 2NX9A 3HU7A 2P50A 1N82A 4TOQA 5ECUA 4GO9A 4PUDA 2VNCA 3K4DA 1X7FA 2XIOA 2BGQA 3BDKA 5G4HC 2V38A 3G1DA 3EA1A 1NDYA 3NJ3A 3IGSA 5L9FA 3PJXA 3LGEA 4L4LA 2EGZA 2V69A 3WDRA 1S3TC 2IUZA 3L12A 3WQGA 1UH4A 4RZ4A 2DZAA 1KRAC 4QX4A 2GLKA 4IHCA 3W72A 5EFDA 1KCLA 1LBMA 3V75A 3L2IA 4Q8UA 2DY3A 4OFCA 5FACA 2JQXA 2VI0A 2YSWA 4F0HA 2Z6IA 3W73A 3F4DA 4J5NA 4HU3A 4M56A 4UFHA 3UGRA 4AMAA 1GG1A 5LIXX 3NQ8A 3GB6A 3ISIX 4ICCX 1DIOA 5AYXA 4DBEA 3F4WA 4AEOA 4HMDA 3MZ2A 4EVZA 1M5WA 1Y5VA 3S1UA 2JE8A 3ZT6A 4PRWA 2J25A 1SUXA 2OQHA 1C3FA 1HKIA 4Y8EA 3CT2A 3GX9A 4AC1X 1W6TA 1D3GA 1Q45A 1IGWA 2JIWA 4YNGA 3LRLA 4DX3A 3AICA 4IPPA 3TQKA 1ONEA 3L67A 5U1OA 3DENA 3TVAA 1TREA 3CQKA 5CPTA 2PMQA 3LV6A 4NEVA 5FL0A 1H2IA 3L2LA 5AHMA 3AHYA 3ATYA 1VYRA 3BWWA 5IDIA 2IPFA 3MC5A 4WRHA 1E72M 1HJSA 2OSYA 4Q8TA 4GZ7A 4KKXA 5BRPA 2BB0A 3PPHA 3U5YA 3G1RA 1X7IA 5DY3A 2X40A 3P61A 4MWAB 4OVXA 4FNPA 4LRSA 2HBXA 1RLDA 3EWYA 3UZ5A 2D1ZA 2E3ZA 4I3GA 2B4GA 5ENLA 4B92A 3PJTA 4XKYB 1SJDA 3H26A 5CXPA 1VS1A 4N02A 2NX3A 2GJNA 3G3DA 4IOTA 2X7VA 4UTFA 2ZQ0A 1F3EA 3WNKA 3N9SA 4JIIX 1TELA 4DUXA 3M0YA 3WH8A 2J9YA 1D9EA 3EOUA 4HJWA 1W9VA 2WC4A 3NYZA 3LTYA 4KRZA 1QFEA 3WQ8A 4G1KA 1WKYA 2CZ5A 3H53A 3WO8A 5M17A 1F05A 1LG1A 2QF8A 2RDXA 1GEQA 2C3CA 1ODUA 4OV9A 3N6QA 2PUZA 5HWMA 1YDOA 3FOKA 1XPYA 5A8GA 1GW9A 5JCNA 5G4WA 3UA4A 4EMJA 4HHMA 3RFAA 3SQLA 3BE7A 1OC7A 4UTLA 1BRLB 1XLFA 3I4EA 3H4WA 1V0NA 4IICA 2WCSA 2HQAA 3JS3A 3RRXA 1E6NA 1RBLA 3WLTA 1HJUA 4PZVA 3MTWA 1QPOA 3WUBA 2E67A 3PTQA 4M19A 1IXPA 3I3BA 1TV3A 1QOPA 2EHHA 5DFAA 1ALDA 3I3DA 4HHPA 4UTKA 1JD9A 4GX9A 4OU1A 3VIHA 4ORMA 1UB3A 2ZFAA 3QY6A 2WHLA 1GRFA 5BOOA 3LHYA 1US3A 2FH6A 5I7GA 1Z8AA 3W7MA 1TV4A 4PTDA 1VRDA 4CD6A 3JVAA 4UTMA 4OWGA 1GYMA 3LPPA 2UBPC 1FKXA 4XWUA 3OHMB 3CPUA 1EXBA 3TLQA 1XP3A 2QCLA 3PFMA 2AQWA 4MGGA 3WQCA 3VIKA 2VUYA 2ZZCA 2JGQA 1QBAA 4HNUA 2WWCA 4PUMA 3HPAA 2IKGA 1KCZA 3RM8A 4YYCA 3GO2A 4IIGA 3R8RA 3AXKA 4JHMA 2QCDA 2OZ8A 2VVSA 3PBGA 1CGVA 2D0FA 1XD1A 3S2LA 3GZAA 5FEPA 3BLEA 4LUJA 2X8HA 2WSPA 4S3GA 2PAJA 2EG8A 3EKLA 1RLCL 3NVWB 5EMMA 5EFFA 4JY8A 3KWXA 4LCRA 4DBDA 2GQWA 1EJWC 4MWAD 2INFA 3B8TA 4MAZA 4HCHA 1LZOA 1N55A 4W7UA 1BYAA 2TSYA 1NHRA 2QUNA 3SSJA 4L7ZA 5I3DA 3UETA 3SJ3A 4JY9A 3MI3A 4K36A 2V68A 3UG4A 3WNLA 4IGMA 4F0LA 4BKNA 4BWLC 3KS5A 3W23A 1PYFA 3IIVA 2OLSA 2PGWA 5FEWA 1VBUA 1HO4A 3NZ1A 2DT2A 3QXBA 3MSRA 1QAPA 1KCKA 4RNJA 3QFBA 2PP0A 1EJ7L 3RDKA 2CLIA 1KD0A 3B8IA 2TMDA 4AX7A 4Z2GA 4S3BA 2Q3RA 4F2TA 1FCQA 1SQ7A 1SZGA 1HGWA 4QSFA 1WE5A 3W1PA 1UWAA 5AHIA 3W1QA 4ZQPA 1TVPA 4G7FA 3R13A 1M65A 3C2VA 4MHBA 4YHGA 5HINA 2ZC1A 1AQHA 1VPQA 4FXFA 2PDPA 1SZEA 2WP6A 2QCDB 3MB9A 3MHGA 4UTIA 3TH6A 2BVDA 3TROA 1MUCA 1XF0A 4DI8A 1XIDA 4S3CA 1FTXA 3NRZB 3SM0A 5FS8A 4B5TA 3M1ZA 4NXSA 1DHPA 3HQNA 3WLPA 2Z00A 2Y5EA 2R9ZA 4J4KA 3ZM8A 1CLXA 1GJWA 1TFVA 2WOIA 1X6NA 1L6GA 3TCSA 5AKQA 3QKEA 4IZGA 3GD6A 4ACZA 3PUGA 5DN1A 1OYBA 1TCDA 3VD3A 2IMRA 4IG2A 2AL2A 1N8FA 1HG3A 5HXMA 4H4WA 1NP2A 2GOUA 4JHZA 1OFAA 2PDXA 3MMDA 4HNLA 4WOZA 3TMQA 3CL8A 2XZ7A 4DYJA 3TU9A 1UD5A 3UZWA 4D6FA 1F8MA 2GVEA 5DBUA 2D2GA 1XLHA 4IUOA 1A4MA 1E40A 3OIXA 4CD4A 5CSUA 3AQUA 3NQVA 3WBEA 3DI0A 1RQHA 4O4VA 4W86A 2YAUA 1W3NA 2CZVA 4HPXA 1TRDA 2WNWA 1H1ZA 2ALDA 4MFEA 4IFRA 1UZDA 3FW6A 4A2SA 1WKFA 3RN6A 4PODA 5DX7A 1LTDA 4ICMA 4QE5A 3GXTA 4GGBA 2ON3A 1QNQA 1VZWA 3N4EA 2WQPA 5D9OA 3NA8A 1JYWA 3TTOA 1FH8A 2IS7A 1UG6A 1GRBA 1JQXA 3WDJA 1EEXA 2DVTA 3BLOA 2CZFA 1JI1A 3VIPA 4H2HA 1UOZA 3W7RA 1TR9A 2ODOA 5I02A 4LSBA 3G1XA 3MO7A 4ZQCA 3LB8A 3O0KA 4LRTA 3VILA 3TTSA 5JU6A 5C9RA 4Q4SA 4O1AA 1CEOA 2Z25A 3EAOA 2CCRA 4N9EA 1XLKA 3BMVA 3L0NA 3BSGA 4DRSA 3STCA 3NDOA 2VCCA 3ES7A 5DCEA 2GQ3A 1PXGA 4S3AA 3UXLA 4A2RA 3QY7A 5KZ6A 1GG0A 3IJQA 5DMLA 4GCXA 3W7NA 1UMLA 1ZJBA 3PSVA 3ARVA 2C1HA 5FESA 1T0OA 5JIWA 3WH9A 4Y8FA 4GI6A 4GRTA 1VC4A 4EQXA 1RVGA 1G7UA 2ZRVA 4HNCA 1REQA 1F5ZA 2HVNA 4TX9A 2NSOA 3GVQA 3SI9A 4W85A 2BY2A 4E8DA 1FCUA 2A6NA 1ZXIC 4MWAA 4FF5A 1JZ7A 2E5DA 4QCFA 4HSOA 3QGKC 4XTIA 3FDKA 1FECA 7TAAA 2ZZ5A 2NXHA 2OB3A 2ACSA 3VIIA 4A3HA 4GOAA 1DWGM 4IJBA 4UNIA 3W27A 4O50A 2UV8G 4JIPA 5A8QA 1XYBA 3WEOA 3D9XA 1XG3A 3B40A 3MU7A 2CZDA 1YE6A 4TMCA 3O3RA 2VXNA 1EO5A 3VIGA 1DPMA 4QGCA 4K7YA 3UT0A 3OBAA 2PWGA 3TA9A 1XBVA 4BURA 3W25A 1X98A 2VX7A 4K2SA 1TQJA 3PTMA 4FK9A 2IPJA 4X2RA 1E3ZA 1R87A 4DAIA 3SBFA 4CQCA 2EKGA 3IVSA 5BXTA 4O10A 2ZXBA 4JD4A 1GQIA 5BWAA 4R7OA 3O9NA 4M6VA 5ABHA 1Z48A 2WM0A 1ZBWA 4X63A 3NPUA 3S9IA 1E9ZB 1GYLA 1ZKQA 4EM4A 1QNSA 3URHA 4GR1A 3AHZA 1BGAA 2CHNA 4FOJA 1XDIA 4P8VA 2ZRWA 4QJ1A 1FDZA 3PWGA 3NZRA 1MWOA 3CUXA 3URQA 2XU2A 1Q1RA 5F2LA 4FP1A 1W2VA 4JTFA 3PZTA 2Q6ZA 3EPOA 3H2AA 4QSHA 1RK5A 5ABTA 2XFFA 4C6OA 4OV4A 2ZE3A 4J57A 2Z1KA 1BSIA 2XIMA 3ELFA 2A7RA 2VCBA 3AYRA 4WCJA 1X1NA 5BRBA 2YVGA 3M6YA 1V08A 2FMNA 1XISA 2QIWA 1U1JA 2NVDA 2GJLA 4WXYA 4HT3A 1SZRA 1GOKA 1ISZA 3WLNA 3GNPA 1WAWA 3VIMA 4XD5A 3OG2A 2D69A 5TBOA 2W0UA 3ZJKA 3MCNA 1DBTA 2YCLA 4LC6A 4IMFA 3S3GA 2HWGA 4MWAE 1M01A 1AJ2A 4XSMA 1R9ZA 4KERA 3M5YA 2W3RA 3APTA 4CCZA 1DNCA 1SM9A 4AZIA 4DWDA 3GDKA 4HOWA 3L9CA 1MYRA 3CC1A 4HMCA 3OZPA 4O54A 1H61A 4MF4A 1XIEA 1ITCA 3CPRA 4UCFA 2OX1A 4KGJA 4PUWA 4J2PA 3S9YA 2GWNA 2BGNE 3O05A 4PTMA 3H7VA 4PCFA 1BQCA 4P7RA 2VR5A 1NIUA 1Q6DA 2EKCA 2F6UA 4G9PA 4HSNA 1KM6A 4K38A 1UD6A 1UIOA 4QAIA 5JIPA 3MP5A 4MNLA 4GQ0A 1GK8A 1TE1A 3GIYA 5G2IA 2HEJA 3KDNA 2X16A 3QQ1A 5D04C 4DXKA 3NL6A 1UR0A 1DJQA 5E1QA 1XRFA 3CUGA 1J0HA 5FEXA 3R0UA 3NIYA 2Y8UA 2W3ZA 5FF0A 3CV7A 5L6UA 4XO6A 1CX9A 1OB0A 3H70A 5FJOA 3R6IA 1E6ZA 3CQJA 3TX9A 1VAHA 7XIMA 1E43A 3L65A 3LY0A 1L0PA 2D24A 1N61C 5LSMA 2YCLB 2XM1A 3DG7A 3CMFA 4IXHA 5J04A 1ME8A 4JN8A 4JKKA 1AODA 4FNQA 1UJPA 3MV01 3N73A 4L65A 3EB3A 3UXDA 1OG0A 5KEZA 4Y7EA 4DZIA 4UTTC 2W9MA 2ALRA 1D8WA 3UCCA 1XIIA 2VD8A 5FJUA 1QW9A 1YTEA 2IQTA 2DT3A 2YGYA 1YHTA 4KEVA 5CBIA 1BPLB 4D9PA 4AEFA 1CB7B 1QNOA 5MKGA 2I16A 2ZXQA 2Y5SA 3I65A 3LQLA 3E3HA 4W7WA 2WWDA 3I7SA 3R0DA 3W9ZA 1JPMA 3OGVA 1H2JA 4Z1DA 3POCA 5EY5A 4UFIA 3TN4A 1VCVA 4H4PA 3ZR6A 1N8IA 4O52A 3W3OA 1RCQA 4V15A 1PKMA 2XFRA 4A6GA 3FXYA 3I7RA 3ES8A 3WLKX 4HSHA 5FSEC 5FMHA 1HL8A 1EC7A 1UR3M 3W6LA 5AC4A 1RD6A 4B90A 1CLKA 4CQ8A 2QJMA 1TTQA 3GZ3A 5A8NA 2D0GA 2VMFA 3QV7A 3S1VA 4MUPA 5EMJA 1F73A 3BAWA 4M81A 1OWQA 3UZJA 4J3WA 1RJPA 2QPXA 3BH4A 3CV6A 3MCMA 4C7DA 2QCGA 3GQYA 1Q4WA 4DJDA 1AA1B 5FJPA 1LUCA 4S3FA 3G18A 1RBAA 3NVDA 3QPEA 3W1LA 3QJAA 1Q2SA 2G95A 2HISA 1EHNA 4FR1A 4OGZA 3W2JA 1BYDA 4YU1A 4AFYA 4ATLA 3U0HA 3VOHA 1ESWA 1XYZA 2VENA 3NVYB 2OKTA 1KQYA 3AXIA 1HJXA 4JNZA 4GUJA 1FWCC 1MUMA 5CPNA 1JDDA 2Z1XA 2QQ6A 5D8ZA 3KCLA 3OLEA 3IJ9A 3E96A 5DMNA 3BSMA 3UPMA 1W2PA 4R88A 3VD4A 3WCZA 1NTHA 1BF6A 4G1NA 4IFKA 2BHYA 3PPFA 1OZMA 4EQSA 2Q3OA 3GNDA 5I3GA 3M5ZA 5G5HB 1R9XA 3A4XA 3HW2A 3CWOX 4NP7A 3LX9A 3F5JA 4MY8A 2ZZ1A 3TOYA 1FQ0A 1PHWA 1OG6A 3WFAA 1H7WA 3QTGA 2OWCA 3LCIA 4S3JA 3ZLFA 1A47A 2PGFA 3HZ3A 4ADTA 4AZ5A 1MSSA 2G4JA 1UWIA 2FZDA 5IRPA 2PU0A 1FEAA 1OK4A 2EEXA 3RK8A 2OEMA 1L6YA 5M03A 3WBAA 2FGBA 2OVLA 1V6VA 3P3BA 5HPOA 3PUOA 3UZYA 5E5CA 4KS0A 1UJQA 3P74A 2GVLA 2P5NA 3OVRA 5KTLA 2ZX6A 2YXXA 3RR4A 3U2EA 1JDCA 2Y85A 3HOJA 4GBDA 4YVVA 3IIPA 7A3HA 3BGGA 1ZENA 1QRQA 2QJHA 3SGZA 2E6DA 4QJ5B 3F2BA 4IISA 3MSGA 3RX4A 3CAWA 1N2VA 3PBYA 4LUIA 5CZ0A 4V33A 2QXWA 1EDGA 1POJA 3IV8A 1QHPA 4L1WA 3SDOA 3R11A 3T55A 3VK5A 3L4WA 3E5BA 2VOMA 4PB3A 3CS2A 3W2MA 4O13A 4H4UA 4HNTA 1L6WA 2E4TA 2DQXA 4E2OA 2ZA2A 4UR8A 1VENA 4JGDA 4QG9A 4LCQA 2WSYA 3THAA 3ARWA 3WJSA 3A3HA 5CQ1A 2NW0A 3HGRA 1XC4A 3VO0A 4EXQA 2XH2A 4GG9A 4LUTB 1MO9A 1DWFM 2DEPA 3GDBA 4H6KA 4RXGA 3CB3A 4M82A 4PYSA 3CYJA 4IIEA 4U28A 1XRSA 4HPJA 3EMCA 3TC7A 2QIIA 5D33A 5I5RA 3BK0A 5BW6A 1MNZA 1QATA 3WZ0E 3W76A 5K2ZA 4NZCA 2WBGA 3P62A 3VDCA 3U2OA 4K1WA 3N6JA 2FVKA 4DUVA 4PN2A 3KLJA 3W81A 1KFCA 1ZGDA 3ABOA 1CYGA 4JBRA 1E0UA 2OQYA 3N4AA 2I57A 2X1TA 4WKHA 3L66A 1ZY8A 2PB1A 4Q8WA 4QEEA 1FOBA 1YDVA 4EE9A 1B30A 4XTDA 3LV5A 5BCAA 2WPBA 5CG0A 2ZUTA 5K4XA 4JEJA 2ZRZA 3SFKA 1XYMA 2Z1SA 4CN1A 4X61A 1JYVA 2JALA 3TQ0A 3B0PA 1ZALA 4UQ9A 3FJ6A 5HWJA 4JX5A 2J9XA 3WF4A 4RXFA 1V02A 4GC4A 2CBJA 1X96A 3JZEA 2PDWA 2ZXDA 4ZXLA 1GQNA 3T44A 4F66A 1R2SA 4B5UA 1P6CA 3CB8A 1XCWA 1X39A 1O4UA 8CGTA 3IJ7A 4CD7A 1V93A 3TUUA 4EF8A 7CGTA 5I0DA 3AHTA 4YLWA 1X97A 4O57A 3SCTA 1F3PA 4JIRA 3HFTA 2P8CA 1XG4A 2HQMA 4D6DA 1XIMA 3B0XA 4LNCA 2AMXA 4CNNA 1WYGA 2A7PA 3E5PA 2INZA 4PMVA 3URBA 1JF6A 1NVMA 4L1GA 5C2GA 2I1OA 3RLVA 4QJ4B 5JBEA 3WK1A 3N9RA 1EB3A 3WMSA 1QMLA 1LOLA 4TVUA 2V3EA 1TJPA 2QMKA 2JK6A 3ZO9A 2ZXAA 3LI0A 5CGQA 2Q71A 1F8IA 5GJNA 1ZP4A 1ITUA 1SW3A 4KWSA 3NDZA 2E0PA 2PPGA 3H24A 4WDXA 1GOMA 3O7UA 2GSJA 3EDDA 1T3QC 3PAOA 2WB5A 3A47A 3WNOA 5FCZA 3OEXA 1HF6A 2X8CA 1EX5A 3IVTA 2OFJA 4KCUA 2ZUSA 3GDMA 2AMGA 4OBSA 2VHLA 2C3DA 4WXZA 3MT1A 2WNQA 3NPWA 1XV8A 2W66A 1LWHA 1ZL1A 3UG3A 5HPCA 1XRTA 4BF9A 1MEIA 4PTXA 2QCNA 1QI0A 1SW0A 1HKKA 1YMYA 3GU2A 4O8AA 5FJTA 3CIVA 1MZRA 2YQUA 1WAUA 2GZXA 1C7SA 1WA3A 3EAUA 4IPLA 4KWOA 3VVGA 5D2VA 4AXKA 3VKAA 3TW9A 4Y9NA 1YXDA 1V6TA 4HYVA 1K4QA 3SCUA 3PM6A 4Z1YA 4Q8QA 1DQXA 4JZ5A 1U5VA 1DEDA 1UMYA 1NU5A 5D02A 3UNDA 1H49A 2HCVA 2PDLA 2YZ5A 3GYCA 3PUDA 1T7LA 2QAPA 4H9UA 1W1IE 4LAZA 4LYPA 3H12A 3N4FA 3RLHA 3SZ8A 2CPUA 2DUZA 1JZ5A 1WDQA 1HGYA 1KGXA 2GR2A 4LH8A 3T0DA 2C8NA 4RJEA 5EGRA 3GY1A 2VOTA 2GK1A 1J93A 4GQQA 3MS8A 2POZA 2WKGA 5LIYX 2NQHA 5HQMA 3UWUA 1E5JA 2RJHA 2DT0A 1C8YA 1R3YA 4H8HA 4A8IA 1SO6A 2BWGA 4NZJA 4F0KA 5FJJA 4YVPA 1UBSA 3T7VA 5AHLA 5AYYA 4NXKA 1XIJA 4LGXA 4C6FA 3HM7A 4LFYA 2VT0A 4GXPA 1OEPA 3T09A 2TPSA 3IJIA 3E0VA 3NL5A 1XHCA 1DORA 4U10A 3AXHA 2O0TA 2J88A 1W0MA 2DH3A 1E9YB 2D0HA 2V3FA 2V5LA 2WSRA 4FZIA 1Q3NA 1W54A 4J28A 5CPQA 3VCRA 1UYQA 1TVLA 5FA5A 4WOQA 2DSUA 4PCNA 1XKJA 2Z27A 2UZ9A 3JW7A 3QGVA 3SCPA 4DJED 4AX6A 1NHQA 1A80A 4I7UA 3FV9A 3DK4A 3FHAA 3C0LA 3C56A 4GD0A 1SGJA 5CLTA 2I5GA 3Q37A 3HMJG 3SCRA 2HS8A 4GIRA 2DP3A 4GZEA 1TJ1A 3D5HA 2A2IA 3M7SA 3AS3A 3SCSA 1CBGA 4P8XA 4HU0A 1W5PA 3TONA 1A5BA 3UJFA 1NPXA 3C86A 2YLLA 1HT6A 1TX0A 1Q66A 1NHSA 2ICSA 3AYSA 4MNMA 3CBWA 3OA3A 2QGYA 3WQ6A 1VGAA 3B8WA 1FFQA 1TPDA 2RDUA 2VEMA 2X7WA 1ZZMA 2XN2A 1GHRA 3CTLA 4C1KA 3IEBA 3KRZA 3KEHA 2XN1A 2VDHA 1W3IA 4QEHA 2DSKA 5AVNA 1O7AA 4DF1A 3DN5A 1EQCA 1AVAA 1P7TA 4Q8MA 2ONEA 4X3ZA 3FNDA 4TR9A 3C4UA 4LAKA 4JOMA 3ERPA 4DO7A 1QK0A 3TJXA 2VFIA 4ZB2A 1MQQA 1J0IA 3LB0A 4CUCA 1H5YA 2UWFA 3THQA 4UNLA 1FCBA 3ABQA 2GJPA 1VKFA 1H0IA 2F6XA 2PU1A 3T42A 1QVBA 4D1IA 2BOFX 3G0XA 5I3KA 2A8XA 2TAAA 4PMXA 3CUJA 4ML9A 2YXOA 3AU2A 3W26A 3NSXA 4DLMA 3NPVA 3LU2A 2PDJA 1F3XA 1QO5A 4YPJA 1VQZA 1GT8A 3SCOA 5H91A 1J5SA 5HAOA 3W1MA 1GRHA 3F2DA 3FA3A 4QM1A 3FEQA 4HPHA 1V3IA 4LVGA 1FWBC 2P0OA 3AIRA 1V0KA 5FS7A 3FK4A 3UVAA 4J3UA 5C7HA 1STZA 3WG6A 4HK6A 4P8WA 4NRSA 4AWTA 1NM9A 4WGHA 4ZR8A 4L56A 1Z9AA 1NDWA 4UTWC 4B3LA 1ICSA 1E70M 4DXXA 5ECVA 3N18A 3S1XA 1OFQA 1VFUA 4QITA 1E55A 1R3WA 3RO8A 3OIHA 3AMCA 5I06A 1O5RA 4DXVA 1XYFA 4AHOA 4RE4A 1TB3A 3R12A 2PLJA 5GQBA 3R7MA 3A4JA 3RU6A 3NO1A 4S2BA 2ZKMX 3PZNA 4TTGA 1LVLA 4WHBA 4MM1A 3DERA 1QU4A 1DJGA 1GW1A 4JNMA 1OBAA 1J11A 2REQA 4K39A 4A3QA 4JKMA 4GI8A 5F1UA 1OVDA 4DJFA 1F4HA 3COTA 1JCLA 2B7NA 4XISA 4AB4A 1W32A 4QG6A 2WVVA 4LIIA 3KBJA 4I7VA 2Y62A 3BQ6A 4JYDA 1BQGA 3G1VA 3UG5A 4U3AA 3T4CA 1GEHA 1OGSA 4E8GA 4TO8A 1JUKA 3W2NA 1GOWA 1TQXA 4NYUA 5I07A 2VZOA 3D3AA 2X8GA 2V6OA 2XIIA 3BZGA 3GXFA 4CNSA 3I6RA 2DIJA 3QPYA 1ME9A 1IF2A 2O9PA 1LRTA 2PBOA 4PRTA 2PDUA 1W1YA 1QJWA 2BOEX 2WJZA 4L80A 4ALDA 3QEZA 3GLCA 1XXXA 3S42A 4G56A 4I8DA 3LI1A 3MQTA 3VFLA 1KBLA 1EXPA 5BROA 3UXAA 1SPQA 2FB3A 1BWCA 5GRTA 3WJZA 1P0KA 3QV9A 3FS2A 5D09A 1A3XA 3HJZA 1GPWA 3EOEA 3TQPA 1Q6QA 2VDIA 1EYWA 1XI3A 2AQOA 2H6RA 3GG0A 3LMYA 3SEPA 2ATSA 4UZSA 2ZCGA 2UY5A 3MUY1 2PLCA 1ZTVA 5GJPA 3S46A 3OZMA 3QC3A 4DIAA 4NEWA 1GGOA 4GYKA 2QR6A 1LM1A 1EKOA 2OPJA 5CSSA 5XIMA 4XKYA 4FLOA 2SFPA 2WNNA 4UQAA 3ABSA 2DT1A 3CEUA 2GR3A 3TZNA 1RJRA 3LERA 2PEVA 3NOEA 3II4A 2Y7FA 3LRKA 3L21A 1K9EA 2J8TA 3SGUA 1JPHA 4W8LA 5G5IA 4QDMA 2Z1WA 5JH1A 2WHJA 1KBJA 1MXSA 4WF7A 2W0HA 1OYAA 5IHRA 1GKQA 2GGGA 3OYXA 4FLRA 3M0XA 3UY8A 3ZOAA 3O07A 2POTA 2O9TA 3KX6A 4IP4A 1Z69A 4JFSA 1HJWA 3UPWA 3TA6A 4RX0A 4Y9PA 4OKDA 1PAMA 1IEVA 3K4WA 3AHVA 4XD3A 5CPMA 3GDLA 4PFHA 2OELA 4P7NA 4M0XA 1F9CA 4QTGA 1CDGA 3R43A 4B5VA 5G1TA 1VD6A 3NZQA 1MXGA 1C92A 1ODZA 1CENA 2PD5A 3VNKA 4IIFA 3KVLA 3L2MA 3DU0A 1TPVA 2XSBA 1V7AA 1LL6A 3A13A 1F7BA 4JL2A 3KDOA 4RE2A 4DAFA 1J12A 2MANA 3WELA 4GHRA 1MNSA 1LJYA 1UWUA 1Q4NX 3S5YA 3M7WA 4XSLA 3PZVA 3WIJA 4L6DA 2PC4A 3SCVA 5JCLA 4FX8A 1AG1O 3MSYA 3BOFA 3GHRA 2HE5A 4QIUA 2Q02A 3PVFA 1QNPA 1ZAHA 5M2FX 2PGEA 1W3TA 3NTYA 3NSMA 4MZ1A 2PCQA 3DFYA 5HATA 3QSRA 4GINA 1EWDA 4GPNA 1UR4A 2IPGA 2HXUA 1YNQA 3QHMA 3B9OA 1VHNA 1RY8A 2XH4A 4HJFA 1F8WA 2NLYA 1VR6A 3TLLA 4LAMA 3LZ3A 4FAMA 4A21A 1Q7QA 4BFAA 2X8RA 3GVGA 1V3JA 2NV9A 1Y65A 2VC6A 5DANA 2Z7KA 4N2YA 1REQB 1GVEA 4UNKA 4B5WA 4H7ZA 3SRHA 4M6PA 1FWGC 4JFWA 2WPFA 5REQB 1I60A 2KX9A 3VX0A 4LU0A 1TA3B 4GQRA 4ZE5A 3SRFA 3L23A 5D2XA 3WF1A 3L4VA 1B54A 5I3HA 3ITYA 2A79A 1OADA 1IGSA 3MJYA 4LBUA 4INFA 4W4QA 3BV4A 2NUWA 3VZZA 1IWPA 1NWRA 3MPGA 1UC5A 3VNIA 2PTDA 4C7FA 2JEQA 4JTDA 1B3YA 1S5NA 2W55A 4I5UA 3VC6A 3B4YA 5ABGA 1GONA 1BTCA 1PWMA 4KF1A 1DIEA 2XPKA 4OTKA 2FTWA 5FS6A 4GJJA 1FHLA 4H4SA 3WEMA 4J7RA 5BYWA 3JU2A 2G3NA 2XDFA 3QMSA 4EKJA 1DKWA 1MZHA 3IIOA 3BCJA 3M5XA 4TUFA 3H54A 4MDOA 3AS1A 2W62A 3HIJA 4Q32A 2WPEA 1WXYA 1UKTA 3ANVA 4M7SA 4D71A 4TIMA 4IMAA 1CIUA 4NJKA 2PI6A 2W92A 3VNJA 2PLMA 1WKEA 3H2EA 3CZKA 3AIWA 1EBDA 3U2ZA 3LHZA 1GJPA 4DBUA 4F40A 3EEGA 2E5BA 4MJZA 3MWCA 3T8QA 3LTPA 1OFDA 3UYIA 4Q7BA 1T41A 3FGCB 3TKFA 4W5UA 3PS7A 1QUMA 1E1CA 3E74A 5AHNA 3PZMA 1YLVA 1K7XA 4P2VA 5H6HA 3UGVA 4ZTYA 4CCCA 2FZ9A 5C8BB 3UR8A 1CPUA 1KTCA 4EM3A 2O9OA 3NZPA 3WH7A 3CAVA 1R3TA 3PG6A 1PX4A 2ZDSA 1WOAA 4K6AA 1ZY9A 3RX2A 3S5ZA 1IZKA 5FJRA 3TN3A 3E49A 4WDTA 2JKEA 1UPPA 4JYEA 1AD1A 3VOGA 1SFSA 4ILSA 4KPRA 1P0BA 2V5DA 3CZLA 2XYLA 2XVKA 8A3HA 3R89A 2ZBTA 2ADAA 4GKTA 2CLEA 4IMGA 4O8RA 1CNVA 4AY7A 1Z89A 1LG2A 3LCGA 4WQ6A 2PA6A 3HO8A 1R2TA 1V0MA 3K8KA 1W1A1 3U6WA 1BHGA 2WVVB 1CGTA 4BJHA 3SCQA 3CHDA 3DG6A 2JIEA 1FCVA 2VFFA 2NWSA 1GREA 3TTEA 1S2CA 3AIVA 3M47A 2VFGA 4Q4QA 2E8ZA 4LUSA 1BG9A 1PIGA 3BG3A 5REQA 4H1ZA 1EPVA 3DBNA 3VIFA 4GVIA 3VKCA 1I0BA 5BRQA 3E1F1 3GNRA 2OLAA 3TN6A 1R3SA 2BMBA 4C7GA 3GG1A 1K4HA 3DGRA 4DHGA 4EPKA 4O15A 4Q4PA 1Q85A 1QWKA 2XSXA 3F4VA 4K8EA 1OGBA 1QPQA 1K7EA 3VD5A 3D6NA 3WSUA 2Y63A 3MDWA 3QMTA 1YNYA 2P88A 1UUOA 4LY8A 2WCAA 2A6LA 4PUNA 4OIFA 3W2UA 1WOBA 2FKPA 1ML1A 4MJMA 4UQBA 3FVMA 3GE7A 2KAUC 3V36A 1JUEA 3QW4B 3MI6A 3WQ5A 5FF7A 1GV4A 3VNMA 3KXQA 2EPNA 3QM3A 3V5OA 3W7PA 3M0HA 3TTYA 4ERAA 3UQNA 5BWFA 3VM7A 3BICA 1WP6A 4LBSA 4US5D 1JYXA 1FFRA 3DC8A 2BXYA 3O06A 2OJPA 2A3LA 1U2YA 1GRGA 1H6VA 3UG8A 2NVKX 1OJXA 3BARA 5JVLA 2WM1A 1B0IA 1W31A 2E6YA 2JF6A 1CB2A 2XIJA 3QZEA 1E73M 1TYTA 1K9DA 3R94A 3W87A 4DZ5A 5CJ5A 3UWQA 4HP5A 3VABA 2BSLA 5BOEA 5CH9A 4IPNB 3M41A 1DJHA 2BZNA 4PBEA 1XR2A 3F2CA 2CBVA 5T26A 4B2DD 2GJRA 3LHUA 1NOWA 4DM1A 1EH9A 3CV1A 3W07A 1P4CA 4DO4A 3DYPA 2IQDA 3A5VA 3RM4A 2DIKA 3GC4A 3QPZA 3CWHA 4WR3A 4EAYA 3W84A 4GQBA 5GNXA 1M7JA 4E3TA 4DJEC 1EF3A 4L6OA 4ZA0A 1YDNA 4ZQRA 2RUSA 3WDQA 3H23A 2V3GA 3VUPA 1TPUA 1YXYA 2CLFA 2G96A 3Q65A 5TR3A 5EYWA 1O5QA 3G1FA 1KA9F 4JEQA 5D30A 4HYRA 4Q4MA 1LUCB 4GXWA 1QOQA 3H4KA 1N5WC 2WLZA 4LUTA 2CERA 1QHZA 3CUIA 1W17A 3OLIA 4HA1A 3R1ZA 3TWBA 1EP3A 4MIMA 2G3FA 3QR0A 2J75A 3TSDA 3MKKA 4MJ4A 3C0QA 1F3TA 3GK0A 4ZB0A 1S3HA 3V16A 1OZQA 3I6EA 4I9MA 8XIMA 1QWGA 4DF0A 3VKDA 2DSWA 3MY9A 3AO0A 3BCFA 3N9KA 3UZZA 3R0KA 1VFLA 2G4FA 5DRIA 3LUTA 4UMAA 5DT7A 1QASA 1KFKA 4F3HA 1XUZA 1XLCA 3GNXA 2PWFA 1Z42A 1AH3A 4WLCA 3R2GA 1WDSA 1X1ZA 6CGTA 4UTWA 5J8LA 1C91A 3BV7A 1NFGA 4HA4A 1ZPTA 4JICA 5C9XA 4IX2A 2BY0A 3LCLA 5E9AA 3FLUA 4ZOHB 4IX0A 4OOUA 1KO0A 5FSDC 1FBAA 3G0UA 3TK7A 5KZDA 3EKZA 2XM2A 1ZS2A 2FGZA 3SJNA 1JPKA 1NWTA 3K5XA 1B3OA 1NDVA 4B15A 1QHOA 3RITA 3W7OA 3WLJA 1AD4A 1ZP3A 3W7KA 4G2DA 5A3HA 2PDCA 2YL9A 3KM8A 3H4GA 3KLLA 1VCFA 1M6JA 1XBZA 3ANUA 2FVLA 1Q63A 2PDKA 3PWIA 2HS6A 4NKCA 1R46A 3EWUA 1OIMA 2WSKA 1Q13A 2A7NA 5SWUA 1S38A 4NZ1A 2EXOA 1I8JA 4ACZB 2O9RA 3RRAA 2GVYA 5BNKA 5D38A 4BHYA 1W1TA 2E8YA 2QCHA 4C6DA 4WVXA 3GHTA 1R30A 2C6QA 4OUIA 4PUEA 1TTIA 4IFKB 5C6MA 2ZUWA 2WBKA 4IIHA 4M29A 1AMKA 3KOXA 1TE6A 2VO5A 1GVYA 2XH0A 4HKPA 3EPNA 5EB8A 3UW6A 2Y24A 1Z32X 2EG6A 1YKWA 3DXIA 2EPHA 5AN7A 1KM3A 3RR1A 1KBKA 3N11A 2J13A 4KEUA 4MY1A 1IXQA 5KINA 1FFUC 1UD8A 4FXSA 1QTWA 3H21A 4UTJA 2V0TA 1UKQA 5IXEA 3FFSA 4NZ4A 4IL2A 1YE4A 2PURA 4J3ZA 4ZO7A 1ZX9A 4QAWA 1HJQA 2YCKX 1VIZA 3TOPA 1XBXA 3A5FA 3CEPA 4C90A 4TVCA 3B4UA 3M0VA 2F7FA 4LV4A 2R1KA 1US0A 3KTSA 4XK2A 1MUWA 2G37A 1V3MA 4F4RA 5CC5A 4F8XA 3HGOA 3UWZA 2VQUA 3DBPA 3OYZA 1XIBA 4C6LA 1V6XA 4GABA 2OEKA 2FVMA 3R79A 2PWDA 2YYTA 3CZEA 5CBJA 3GTXA 4O12A 4BI6A 3ZVHA 4NUWA 1Q8AA 5I78A 2B7PA 2D2HA 4ROQA 2F38A 4YTQA 1BXBA 3NUKA 4F9JA 4NJJA 4AYSA 3DFHA 2ZADA 1JAKA 4LYQA 4U2ZA 3A7AA 4L9YA 3GRIA 4OBRA 3NWRA 1B3XA 3NPXA 1KFJA 4NF7A 3UY7A 4RE0A 2NVAA 3CUHA 3W37A 5KMYA 1EQPA 2GGIA 4S38A 4GE8A 1J96A 4R85A 4HMNA 5I3IA 4ZE4A 4PMDA 3Q6JA 1VCGA 1W1ZA 2ZTKA 1J18A 4UMBA 3ATZA 4GY1A 2PTXA 1SZNA 2YOCA 4GUFA 2ASHA 1A50A 2B7OA 3FJ4A 3VGBA 1OFEA 2J7CA 2NQLA 5LNWA 1WYIA 1PS9A 3ZWSA 5CAKA 1QT1A 1JCXA 1E1CB 1ZFJA 3WLRA 4AD2A 5E70A 2WJDA 4C6EA 2XUCA 3H8AA 3GR4A 4EMIA 1M6IA 3HMCA 3LN3A 2J7EA 1W1B1 5XIAA 2ZZ7A 2YL6A 2J6VA 4BQ2A 1CI1A 2BXZA 3ZQ9A 1TUXA 3N3TA 2Z26A 3FJLA 4YMZA 5DMYA 4FEZA 3DHDA 4HHLA 3CL6A 4DN1A 3PN8A 3CASA 4YWOA 1XLBA 5DQPA 2B31A 4E8CA 5FF4A 5AC7A 1DWIM 3BOLA 1PKYA 1Y7VA 4HNNA 1CXEA 4UBPC 5HJXA 1W9UA 3HV9A 3KE0A 3PJUA 4JTAA 3EOOA 2NQJA 4B2DA 3U3HA 4HPNA 3VKBA 4IH3A 4XKMA 4H6EA 1GEUA 3BANA 3D0CA 1ADSA 2YW4A 1ISVA 1IEWA 1TV7A 3LXDA 2YDAA 2ZUVA 3QHOA 3LOTA 2GJXA 1TMLA 2PFHA 1Q6GA 4YCPA 2XTKA 1J5TA 2ABAA 3ARZA 4KW2A 3OQ8A 4IMEA 4RW3A 3WD0A 4CEXC 4H50A 3N12A 1VFHA 3BJSA 3LEPA 3PHAA 1OC5A 3U7BA 3TW7A 3PZ9A 3AS2A 4JHOA 1E6QM 4YCOA 4PBFA 2CHRA 3PTKA 3ZXWA 1O60A 1TV2A 1D7YA 5E6ZA 3V0SA 2XGZA 4PL1A 3MVIA 3DJJA 1QW7A 3G3MA 3HGSA 3R07C 1RAKA 2J7DA 5GNYA 4LC8A 2PZNA 3FXGA 5CGMA 1FDJA 5ER0A 3QV6A 1IEQA 4NZ5A 1WDWA 2GSHA 2DGAA 4PR4A 2DV0A 5G2WA 4Z1BA 3RHGA 3AM9A 2DW7A 4UFLA 1EL3A 2BNJA 1MEHA 3ABXA 4XZNX 5LZLA 2OYMA 4JNYA 4YN5A 4Q4RA 4KETA 1KTNA 1XPGA 1QW8A 1I75A 3KLKA 1PVNA 1YIXA 1XLMA 2ZE0A 4XIMA 1UWQA 3SCWA 3HJEA 4FX6M 1WO2A 2F2KA 2Q8LA 1PPIA 1LBFA 3EEZA 4MB5A 3V7PA 1PZ1A 3P5ZA 1E6XM 1XLJA 4PE8A 1LROA 1MFVA 1KKRA 2CC0A 1JAEA 4BF7A 3CXBA 2CU0A 3OU8A 4UFKA 2P1FA 1S2UA 1ZMDA 3NQ6A 4KEMA 4FOUA 4XVEA 1ISWA 3AMLA 5EMKA 5HBFA 4QLJA 5U7SA 1OINA 1ZK7A 3TCEA 1CTNA 1ZDLA 5HK4A 1YADA 2YA1A 4AYGA 4OT7A 1VBJA 5C5YA 1VIWA 4WGXA 5CKSA 3ITTA 5DCBA 2JGYA 4R9XA 2GR1A 1I1WA 2VZTA 5EL1A 3CAQA 1UP0A 3WN6A 4QQ3A 1BSLA 6PTDA 1GTHA 1R0MA 3PB2A 4XQ6A 3THDA 4ZSTA 3R58A 3BMXA 4LVAA 3N6HA 3ZSTA 4CGTA 4IGHA 1QO2A 3IARA 1AW5A 3O8AA 4PMYA 2EAWA 1VJZA 1FP8A 4G6CA 3HFYA 2D73A 4B5SA 3DHPA 4QS6A 1NY1A 4JTEA 1A5OC 3LPOA 5TAOA 1U30A 2UY3A 1H1YA 5D9PA 4MSSA 3VGDA 3DFOA 3DYMA 3PBWA 2WZIA 4P8UA 3LXBA 3P60A 3HPXA 1C93A 3CZ8A 1DJIA 3WF0A 2PTYA 1G4PA 1LWJA 5AZ1A 1NHPA 3AMKA 4CLMA 4H41A 4I9JA 3EB4A 8RUCA 3MCOA 3HPFA 1B57A 1LQ0A 1TYPA 4N0RA 2CYGA 5CSYA 4BR1A 3NNTA 3N2XA 3WJYA 3MO4A 1OX6A 4H6QA 3S6OA 3P0WA 2VTFA 2R9RA 1EFZA 1UR8A 4NQ1A 5KZMA 3ZT5A 5BXRA 3USBA 4XX6A 4H7CA 4U2YA 5BXSA 3PZQA 1MW0A 3FJNA 4ZB5A 4AQLA 4EX4A 4LCSA 2IKIA 3TTQA 1ADOA 4PL2A 1LYXA 3EDKA 3WYZA 1PL9A 4HYWA 3K4AA 3U9IA 4UCGA 5F2MA 2J7HA 3TNOA 3P0XA 3N2CA 2QPSA 3I7QA 3AWNA 3S47A 4C6MA 2RDWA 1R9YA 4IJCA 1KFLA 4H4VA 3AJXA 3NGJA 4CN6A 9CGTA 4LYKA 2CBIA 4F0SA 1H41A 1FA2A 2BFGA 1ITXA 2PP3A 3HA1A 4MLJA 3ZMRA 3DUGA 4C60A 3RPDA 5EMUA 2YA0A 3B8SA 3MUXA 5C7VA 2VURA 3SUWA 1S5MA 5DO8A 2J77A 5JBFA 4WK9A 2Q8XA 1JR1A 3LS9A 1ONWA 1BWVA 1JEHA 3LGDA 3OLDA 1EDTA 4PTNA 1YPXA 4CQDA 4RNFA 5HMEA 5C55A 5K7JA 4NNCA 4EF9A 3W53A 1XLEA 2ZZ6A 4JTCA 2YDQA 1GERA 2QVNA 4QROA 3YPIA 3GW0A 1FHUA 3QV8A 3VDAA 3H2NA 3PY2A 4ZCWA 3WF3A 4M24A 3QN3A 1B9ZA 2PDNA 2YKKA 1A0CA 2I5QA 3AZSA 1EC9A 5D9MA 4O14A 2BCPA 4N9DA 3VOIA 2E9BA 1XLGA 2XIBA 5M1TA 2X0YA 4FXRA 3GC5A 3SO7A 2ZRUA 3M4HA 1FWHC 1BYCA 4NL1A 3WQVA 3AS0A 3KZSA 2JKPA 3N2TA 4H6RA 2WMKA 3PFRA 4C6KA 3G1HA 3AUJA 1C8XA 3ARUA 1GZGA 1FH9A 2Y2WA 4XZ9A 1KXHA 3G1YA 3L5LA 4UQEA 1T5AA 3GBEA 1S5VA 2E1WA 2FPYA 2WOQA 3EX1A 2HK0A 3H55A 3LM3A 3ONCA 3V4BA 1HJVA 4EACA 3T0AA 3F5LA 1I2RA 2PDBA 1SFLA 3DG3A 4NYYA 2RHGA 3S2MA 1H11A 2NPXA 3GVVA 1KCXA 2DJXA 3W1XA 2YDRA 3GM8A 1HTIA 2FGLA 2WKLA 5HMDA 3SY1A 1P0DA 5G5GB 1UUQA 3AMGA 3TIMA 3O6CA 3RAOA 4N6FA 5A6AA 3T4WA 5G2HA 3Q45A 5BMWA 1AH4A 8XIAA 4D6HA 3W7GA 2PODA 4POCA 1DXLA 3C8FA 3FVDA 5I3JA 2NZLA 3JRKA 1NH6A 4LA1A 1J0YA 2WV8A 3L5OA 3HURA 3K8MA 2ZRXA 3EXTA 1EWEA 1SMDA 3IJLA 1BF2A 4HNOA 3B8DA 2OWWA 4XAFA 3K1DA 3GXMA 4RDYA 4AVNA 2G97A 1IYXA 4RNHA 3KCOA 2V8ZA 2Z29A 1V6YA 2OOFA 1H1NA 2FFCA 4FI4A 4HQVA 1R38A 2IKJA 2ZZBA 4DNHA 3KZPA 1KM1A 1RQBA 1JCYA 2J24A 5A8PA 3PANA 3R8HA 1H4PA 3UEQA 3AISA 3T0BA 1AQFA 3IUHA 4W87A 4AMCA 3NM3A 3OHIA 3TC3A 1TZ9A 3SUSA 3SCNA 3R5EA 3ALFA 3SSZA 4ZEPA 1RZMA 1CGXA 5EBAA 1E4NA 2YBVA 4AZCA 1EA9C 3DFTA 1W37A 3S2NA 4M51A 2VZUA 4LF2A 1WXZA 5A95A 3WLLA 1E6SM 1XDMA 1A5SA 3L8KA 2X1IA 2NV1A 2HROA 1IR2A 1R7OA 3AC0A 1NARA 3EDEA 1JZ4A 1UOKA 1ECEA 4Z0SA 3MP4A 3T2PA 1JVNA 4S1FA 3MUIA 1XJBA 1C8VA 4UWMA 2VGGA 4H8UA 2W63A 3G24A 2YW3A 3Q2DA 1A0EA 4BS0A 4H01A 2CW6A 3UNTA 4DPQA 1H7OA 5F2IA 4JX4A 1JCMP 4K3ZA 4DELA 2FZ8A 4NZFA 3N2BA 2HDJA 3GHSA 3STEA 1HVXA 4U5IA 1O5XA 1O66A 4TX6A 1GESA 2AKZA 5I2UA 4P7LA 5KZEA 4AXNA 3RO6A 1RALA 3OA5A 4AIEA 2HRWA 3BAYA 5LHFA 3PNZA 4F9DA 1C8QA 1E4LA 1RD5A 3TR9A 3UJRA 1FWFC 1Q8JA 4KCTA 3ITGA 1YDYA 2H8ZA 3IGXA 2TRSA 4JFVA 2DUAA 3VE9A 3D47A 3VOJA 4LBRA 1ZCCA 2P3EA 5GNZA 4LXFA 2QYGA 3MYPA 4NY2A 2XFYA 4F0RA 3ALGA 4JQ1A 4Z2HA 3G8RA 3L4UA 3W24A 4Q4KA 3SUTA 1UASA 2RGLA 5E09A 4PMZA 3VNZA 2L5HA 2Y89A 3QR3A 2R14A 2PF0A 3P7YA 4OUEA 1JULA 1HIZA 1R7AA 4JAWA 5DCDA 1YBQA 3P80A 3TSMA 4FX9A 2XHYA 4LB4A 2E5AA 2ACUA 2EPLX 4L9XA 3USZA 3WJWA 1KB3A 5CJMA 1PCKA 5C9ZA 1X2HA 2W3SA 1FDYA 2FTYA 4UR9A 4D8AA 3PBVA 1JXKA 3WD4A 4OECA 5C71A 5JH2A 3LCXA 4S2CA 2NUXA 4WSJA 2BTMA 2UY4A 3SQPA 3G0SA 4ZOCA 2PTZA 3SURA 3RCMA 1BGGA 4JFUA 3N29A 1JG9A 3TJIA 3LADA 4W9TA 2O4MA 1QR7A 1E0WA 1AW2A 4J3XA 4BQ3A 1R47A 1UZ1A 2RKXA 4RDVA 2AGTA 4DYEA 4H9MA 3GXPA 3HF3A 1V0LA 2HXTA 3MMTA 4B9ZA 4EQRA 4M3PA 1N62C 1P1MA 1TPEA 5A2CA 3IS4A 3WQFA 9XIAA 4R34A 4DY1A 3FDGA 4FDCB 4M8UA 4B4HA 4YTTA 3NS1B 3GXIA 3W7EA 1Q6RA 2V30A 4XD6A 2VYOA 3LM7A 3URAA 3VMPA 1YW1A 1GORA 2E6AA 4Q33A 3P93A 4UTUA 3UZXA 4H4XA 1Y5XA 3LSCA 3F4CA 4C5YA 3MDUA 3L4YA 2GUBA 2C79A 4FB7A 2R94A 4DI9A 1H7RA 2FJKA 5JQ9A 1UA7A 1FY6A 5CZSA 3NAVA 1G4TA 3H22A 4LOCA 4H4YA 1PCWA 2AQVA 3RGTA 2BY3A 4LT9A 1GQJA 3CNYA 4Y6GA 2XZ9A 3AYTA 5FF2A 2ZUUA 3HG4A 2V81A 4ZFMA 3RCYA 2A3CA 1RXOB 2BS9A 1TR1A 4W8BA 5D32A 1T8XA 3W86A 2QCFA 2CHOA 2Z1BA 4KIEA 2V9DA 4UFJA 3CIXA 4EANA 1NEYA 1N5XA 2REQB 2CITA 1VJIA 2QJJA 1OIFA 1V3HA 1IXOA 4PEEA 2GUYA 4PMUA 1EEPA 2C7FA 4DUOA 1XH2A 2WAGA 1BAGA 2WOWA 4R7JA 3THUA 2GWGA 3LCWA 2AGKA 3P6LA 2QUMA 5DEZA 2OG9A 2GGEA 4LS0A 1I6NA 4DJDD 4B16A 1G4SA 2FZBA 2YCIX 2HVOA 1BVZA 1EPXA 1EA0A 1PTAA 1I4NA 3FN9A 4U5KA 3NQEA 2YL8A 2ATMA 3CL7A 2A21A 2A85A 3A22A 3I10A 1JPIA 2VGFA 3POHA 4XG1A 4DWSD 3O16A 2P3ZA 1VF8A 2IPWA 2ISFA 4REQA 4DYKA 2EQ7A 2PWUA 3CMGA 4F48A 3LCHA 4W5ZA 2DZXA 3OVQA 1YRRA 1L6FA 1EJTC 3TAKA 4J27A 1OQFA 2YYUA 3AFBA 1HXJA 3ZYZA 1IIGA 1HW6A 3FAXA 2JEPA 4WD0A 1DTUA 2BVTA 2HVMA 4M1BA 5HJLA 1UBPC 3IUIA 5FS9A 1DQUA 1TPFA 2RABA 3EX6A 1K8XA 3WD2A 1Z3NA 4Y90A 3ABRA 1U1HA 2VEKA 4L4OA 1IT7A 4AC7C 5GPRA 5EMLA 4H8VA 2D20A 3CGCA 3CPGA 1POKA 3T07A 1V77A 3ONBA 2ZZ3A 4DM2A 2CLLA 3E0IA 9XIMA 3WK3A 3WH5A 2KZHA 2BLEA 2FYMA 1G69A 4JTIA 4BEQA 1GVFA 1YTKA 2WC3A 3LD5A 5I79A 3W71A 2W54A 4D8ZA 3OVGA 3UP8A 1DYSA 2FZNA 3G5EA 1WDRA 3CQ0A 3RNMA 1ZSXA 3DI1A 4YL2A 1V97A 1R3VA 4W7VA 4ZO6A 3ME3A 2C18A 2EQ9A 5E0FA 5AYBA 1KNWA 1K70A 5AZ0A 1PWLA 4MYAA 3M44A 4R5EA 1B1YA 3BMWA 3SN4A 4B3ZA 3F1QA 3FA5A 4D6EA 1NFBA 3P81A 3N17A 1SO3A 4PB4A 3WQ4A 1UP2A 2I17A 4QE1A 5GJMA 3C3UA 3WF2A 2Y8KA 5BMXA 5DRCA 5E9XA 2X42A 4CQBA 3VFCA 5A6KA 2V63A 2W79A 1VJSA 1XW8A 4WDUA 3KRUA 2CLKA 3GKFA 3A3WA 3VINA 2D2OA 1UKPA 3ICJA 4DWSA 2EQDA 1C7TA 4QBXA 1T40A 1A5NC 4YTUA 5PTDA 4JDYA 1B2YA 3MBDA 4LB3A 1JZ6A 2F84A 2WMJA 1GYNA 2DZSA 3M64A 4GNJA 4Z2IA 1GVSA 2QW5A 4YTRA 1KLZA 2DZTA 1KLYA 2GGJA 4GNKB 4CCEA 6XIAA 4IQJA 4GJ1A 3C5QA 5CPLA 4EP8C 5A1AA 3OZYA 5DELA 4WUIA 2OZ0A 3EX2A 1U5JA 4UOZA 4R3UA 5U4NA 2X30A 1IWBA 4KGLA 1OF6A 3CYVA 4KWUA 1DWAM 1AZ2A 4HPGA 1O95A 3VZXA 2WW5A 2Y4SA 4CN4A 5J5RA 3WQWA 3L5AA 3GRSA 1NQ6A 1THFD 3B97A 2A3AA 3DECA 4BQ5A 5A69A 2CDUA 4GZIA 3TR2A 1SR0A 4LY4A 3EB2A 4A3RA 1TWIA 4AZHA 1Q6CA 4ORIA 1K6AA 1FWNA 3ZS4A 2PRLA 1DL3A 3DZ1A 2J7BA 2YVJA 1TPB1 5CBBA 3STPA 1C90A 3EX3A 1BEUA 3FSTA 4C91A 1WZLA 3E2QA 4JS3A 4AW7A 5CJNA 1AUSL 3UBPC 4PB5A 4UQCA 5K4ZA 1E1FA 1VYPX 3NXFA 2O7QA 4TU1A 3P67A 4ML4A 2ZICA 1E9LA 1RVKA 4JTQA 4AIBA 3PG9A 4KESA 4O0ZA 2CKSA 3UJSA 4ZO9A 3I68A 3V5FA 4N9BA 3O6DA 4H4QA 2HZGA 4WKFA 1VP5A 4Q6JA 2OT0A 1R3QA 2E28A 1UKSA 4MKNA 3VI2A 1K4GA 4JQ2A 1TVNA 1EC8A 1MW2A 2YVFA 1M7OA 4H00A 1TWDA 1S1PA 1EP1A 2Y88A 3H4XA 3N34A 4UIOA 3W7IA 4KPLA 4IP7A 4MB3A 4APNA 1LPFA 3GTHA 1EO7A 1YPIA 3IV3A 4LEFA 4NNBA 4QFUA 1TO3A 5KITA 3ARTA 3TV8A 3TDFA 3KL0A 2G0WA 2QMJA 3BZJA 1TPWA 1Z7AA 1XYAA 4P7QA 1N7KA 2CESA 2RAGA 6REQA 2I56A 4QXIA 2CLHA 4BV6A 3P2VA 3M9YA 1MDLA 4AD3A 3TZFA 1LOQA 4HD5A 1Q65A 2VFHA 3MKVA 4Q7NA 1PEZA 5DBTA 1GRTA 2TYSA 3AIEA 4DWSB 4K1GA 2O4QA 1W9XA 3AZTA 3OB8A 2QZRA 3OVPA 2P8BA 4Q8OA 4PRRA 3MUZ1 3TP4A 1TJRA 1UA3A 1D7FA 1IEXA 3K30A 5D05A 1J2WA 4C1LA 2QEZA 3C0SA 2QAEA 3LA4A 4PGLA 1ITQA 4H2CA 3F03K 3ZJ8A 1SW7A 4E3VA 5B80A 1RH9A 3B9DA 1GWJA 3DX5A 1VFMA 1T99A 1S46A 3RIKA 4RPPA 3T78A 2Z2BA 4I6VA 2FQIA 1A5AA 5LNUA 3BJTA 4DJFD 4CVUA 2C14A 4Q8PA 2J8GA 3B0VC 4HOZA 1NF7A 1PIIA 3H7UA 1H62A 3QF0A 3QGAC 3GNOA 1L2UA 2ZUMA 3DCPA 3KS6A 4PMJA 4W89A 1JQVA 3GKAA 3HRDC 4GYPC 3W70A 5A2AA 3OG3A 4PMNA 3DC0A 3Q58A 8TIMA 3FYOA 3MSDA 4OQVA 1PB0A 5C0QA 1G5AA 3Q4DA 4PC8A 2HK1A 3MHFA 3WQOA 5K3VA 2A3HA 3T81A 2XJ7A 4K7ZA 1OX5A 2Y7EA 4ZBCA 5A5WA 3N2MA 4PCPA 1ZJAA 3WUFA 5MF5A 2GQAA 3STFA 4KIRA 2X41A 2XVNA 3ZLHA 3DGBA 2FHBA 3W74A 4GGHA 1DXEA 3DAQA 5C2XA 4E4PA 3KOYA 3B8UA 1OABA 2CKRA 5EMYA 5M5DA 1J10A 3QFWA 3V1HA 2R8WA 4AUBA 3KVKA 2JF7A 4CQ9A 4V27A 4O1EA 1JF5A 4C6IA 5AHEA 3WQEA 2W5FA 1R5YA 1YPFA 3SRDA 4AWSA 4O18A 3G1SA 1JUBA 4D8LA 3WUGA 1OSEA 2DSZA 5AYIA 2DFAA 3DKLA 3CTTA 1Y0EA 5DMMA 1KC7A 1XQLA 1TIWA 1IWAA 1UROA 3CO4A 1UH2A 4FA3A 3GH7A 4Y2WA 2A3EA 2H3DA 4DO6A 3DHUA 2C16A 4RDZA 5A94A 4OE7A 2RJGA 2YPIA 5IBXC 1TRIA 1S5WA 2J8FA 5CC6A 1UWTA 4Z0JA 1LLZA 2DH2A 3WNNA 6ALDA 2VX6A 2EQ6A 1KR1A 4GVGA 4XZIA 1MVYA 3GWQA 4B9YA 1XD0A 3N1AA 2NLIA 1CT5A 1H09A 3WH6A 4Z2KA 2VGIA 3W1RA 3GH5A 4M5PA 5TIMA 1W1VA 2I7GA 4MOZA 2RDTA 2WNZA 4UR7A 2FJUB 3TJLA 4MAVA 3VD9A 1S2VA 1JGMA 4NJHA 1ONXA 4FX7A 3DYOA 2VELA 5LHEA 2BC1A 2OGYA 1CWYA 3BLPX 3P14A 3ORWA 1R8LA 5A8MA 4A8RA 1HL9A 5AC5A 4ZMGA 3WJXA 1FHVA 1LRNA 4GVFA 1ONFA 2QUVA 1GCYA 3IGUA 2GRTA 1KM0A 4QCEA 2H3BA 3OC4A 4AY1A 3SR7A 2PSNA 4YHEA 1E51A 4A35A 1FX6A 4MG4A 3TXVA 3NL3A 1U1UA 4GC3A 4WJ8A 2DPEA 2XSAA 1LQAA 1RR2A 2FIQA 2LLEA 5A6TC 2NWRA 4Q3MA 4Z1CA 3TYBA 4CCDA 2JKAA 1WBJA 2NQ9A 2NQZA 3VIOA 3WX7A 2ZIDA 3PBMA 1EGZA 1A0DA 5IOBA 1UCWA 1QNRA 3NSNA 2E40A 4ZOBA 1V7YA 4J3TA 5LXXA 4XV0A 1MW3A 1FEBA 3WY1A 5ABFA 4HHHA 3F4NA 4GFSA 2VEGA 3KTCA 3LHTA 1F4AA 2BGSA 3BW4A 4LTSA 2BY1A 3LYEA 4IP5A 1J0JA 4PCTA 4H19A 4GYFA 4S23A 1CXFA 3BG9A 2YR1A 1OCBA 4L4MA 3E0LA 4G7EB 2JBMA 2VL4A 4O53A 4DB7A 3CMJA 2VEFA 1W3KA 4A29A 2XIQA 5E0CA 1ISYA 4UMCA 5B7YA 3UESA 3H2OA 3LXAA 4GUHA 1TMHA 4MZ8A 2EPOA 3GG7A 1GXFA 1IZCA 1XICA 1GQLA 2W91A 2GYIA 2NXIA 1PDYA 2QJNA 4L64A 4NJIA 3MWAA 4H9TA 1UD3A 4J56A 2ZVRA 3T40A 3EOLA 3PTDA 5F4WA 4LUSB 4CU7A 1OD8A 1XCXA 4W8AA 3IAPA 3L0GA 4S3KA 3BQ5A 4TV5A 3MUCA 3GXNA 3ARRA 1WZAA 4PMRA 3BAJA 5IDZA 1F3WA 4JDRA 1Z41A 2Y70A 3HG3A 1AFSA 4L6HA 1E4MM 3VOFA 3TWAA 3UWWA 3SN1A 3J7HA 1GOOA 4LV9A 3QZAA 3PNUA 2PD9A 5CAHA 1N60C 3VC5A 3TJ4A 3KHDA 2OX4A 1KV8A 1KM2A 1E6RA 5EBUA 3UWYA 1NJJA 4NX5A 3U4AA 3IK2A 4CEUC 3N13A 3S5OA 6A3HA 1OCJA 2V2HA 3TMLA 1KBBA 1PX3A 2F6KA 2CXEA 4G7EA 1RK6A 4N4QA 4NIRA 4XVDA 4N6EA 5RUBA 2ZZ4A 2HNHA 1IR1A 3C61A 3MHUA 3WDPP 4V1XA 2R24A 4WSHA 2OOGA 3U57A 4C1NB 1L8NA 1S39A 3LDVA 5HQLA 1H60A 3E0WA 2CLOA 3VAVA 4R33A 1H7XA 4C6QA 2WC7A 4GBUA 3BUVA 4HMEA 4HB7A 2WLYA 3NG3A 1F6PA 1S7MA 5LGZA 3IC9A 3VE7A 2CETA 1H0GA 3LTSA 3RPTA 1LORA 1F76A 3UERA 4GK8A 5HR6A 3WQPA 3V3WA 1XLLA 3ARSA 1CXKA 4FALA 5FAGA 1DOSA 2R91A 3GIPA 2E09A 3CAKA 3AXMA 3BGAA 2ZA3A 3WNMA 3GD3A 1HKJA 1UZ4A 5JCMA 2E9MA 4XBJA 3OODA 2TPRA 5D9NA 2AOSA 3N04A 3MVTA 3QKZA 4LQ1A 2G3MA 3ENLA 2CWNA 4J35A 4S3DA 2C19A 3RMJA 1DV7A 4EWJA 4PTWA 4UZUA 3LHWA 4F2BA 1J9YA 3C6CA 1SO4A 2YJQA 2HNEA 1GVOA 3TNBA 1TG7A 1G1YA 4AZ6A 4JQ9A 3XIMA 2A0NA 3OBKA 1M1BA 2OZTA 1QPRA 3GYEA 2XINA 1NP0A 2PLKA 1A5CA 3T2QA 4D6GA 3E2RA 1FWJC 1OFBA 2GH5A 4KFOA 1XGEA 4MNJA 4IPIA 2OO6A 1RCXB 1UW9A 3QYQA 2OYLA 2C13A 5T9BG 4WZHA 3A4AA 4Z42C 3VDHA 1C9WA 1ZCOA 3AMDA 3UF9A 1AH0A 1BYBA 1MQPA 2E25A 1F6KA 4ASTA 2J79A 4FNRA 4J1OA 2PDGA 1UHVA 1P5BA 3RJXA 1FKWA 3IACA 4RV3A 5A6MA 3AIBA 4O1CA 4ZZ9A 3IIZA 2FFIA 3TYCA 2R1NA 3W88A 2PDFA 3W75A 2FH8A 3D3FA 5FIPA 1BXCA 3W7QA 4NAEB 7REQA 2VDGA 1AJ0A 1NDZA 4LVFA 4A3UA 3DFQA 3C0JA 3H6OA 4V2XA 1ZHAA 4C65A 2W67A 1OM0A 2AKMA 5T9CE 3PZOA 4XO7A 1ICQA 3IPWA 1K7FA 5AFDA 5E6YA 4US5A 4AHQA 4IWWA 1SJCA 1XH0A 1BG4A 5T8GA 2CZEA 5BOFA 5A6SA 3K8LA 3P8IA 4UOQA 4V28A 1XLIA 1JCNA 4GUIA 4C1NA 2O7SA 3WEZA 2YX0A 5A6BA 3M0KA 1QDSA 2QV4A 4GX8A 1DWJM 2DSVA 2HSAA 4I9TA 2CNCA 4KT2A 1VHCA 5C70A 2I9EA 3WMLA 1JFXA 3NM1A 2VRKA 2DVUA 4BCEA 4HTBA