4HYRA

Structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
442
structure length
442
Chain Sequence
LVPVITKMEVYPVAGHDSMLLNLSGGHAPYFTRNIVILTDSEGNTGVGEVPGGPKITTALENVSDIVVGTKVSDYRNTLLKVQAELDKSGEKDERGAQTFDLRTGVHVLTAIEAPCLDLLGKALDMPVCRLLGAGQQRDFVRFLGYLFFVGDRKKTDLPYQSEEDSDCEWYRLRNEEAIDAEHVVALCKAAKNKYGFKDFKLKGGVLRGDEEMKVIKAMKKAFPDARMDLDPNGAWHLDDAVRYVADMHGILTYCEDPCGAEDGYSGREIMSEFRRRTGFPTATNMIATDWRQVGHSLESQAVDIILADPHFWTMNGSVRVAQMCHEFGYTWGSHSNNHFDISLAMCVHVGAAVPGEYNALDTHWIWQEGRERLTKEPLKIANGGIKVPDKPGLGVEIDRDQVMKAHELYKKHCLGARNDAITMQYLIPGWKFDAKSPCLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative Glucarate dehydratase from Acidaminococcus sp. D21 with unusual static disorder
rcsb
source organism Acidaminococcus sp. d21
molecule tags Lyase
molecule keywords Glucarate dehydratase
total genus 144
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hyrA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hyrA01
3PK7A 1KCZA 2MUCA 3U9IA 3RCYA 2OPJA 4HCLA 3RGTA 2OX4A 3TJIA 4GMEA 4KPLA 5FJRA 4K1WA 1JPMA 1F9CA 3DERA 4HNCA 3ZVHA 2PA6A 1RVKA 4HYRA 1SJDA 1L8PA 1MUCA 1NU5A 3GO2A 3NXLA 1W6TA 4IL0A 4A3RA 2ZC8A 4GFIA 4JHMA 3OW1A 1SJBA 4EWJA 2I5QA 2XH7A 4MMWA 2HZGA 3Q4DA 2OZ8A 2PTZA 2HXUA 4YWSA 3DESA 2OFJA 1SJAA 2QJJA 2PP3A 2PTXA 3RR1A 2PS2A 2PGWA 4G8TA 4GYPA 3JVAA 4J3ZA 4IL2A 2AKMA 2ONEA 1NELA 3HPFA 2AKZA 4DHGA 1P48A 1XPYA 4F4RA 3GD6A 3MWCA 1MRAA 2GL5A 3T6CA 3P0WA 4HPNA 2GGHA 4DYEA 3S5SA 1BQGA 4K2SA 3PWGA 3R11A 3FVDA 2P3ZA 2OO6A 3TW9A 3VCCA 3CB3A 3ENLA 2PTYA 2XSXA 2AL2B 1OEPA 1ELSA 2DW7A 3ZLGA 1IYXA 3DG7A 4Z17A 4E4FA 3RITA 2OVLA 3I4KA 3CXOA 4IHCA 2AL2A 2OZTA 2PCEA 4DXKA 3P3BA 2ZADA 2OLAA 3D46A 2RDXA 3DDMA 4ENLA 1BKHA 4ZA0A 1KKRA 2DW6A 3RO6A 3ZLFA 3T8QA 1FHUA 1KKOA 3H8AA 2OKTA 4E4UA 4GIRA 3R1ZA 3BOXA 4FP1A 2PU1A 2P8CA 3NZGA 4MKSA 2PSNA 3UXKA 3DIPA 3SQSA 3V5CA 2NQLA 3MZNA 1ONEA 3VC6A 4FI4A 5FJTA 3IJLA 4JN8A 3DG3A 2FKPA 1JPDX 3UXLA 2AL1A 4H19A 4K8GA 3SSZA 2GGGA 1PDYA 2QJNA 3EKGA 3IJIA 3N6JA 2HXTA 3R10A 5BOFA 3VFCA 4IP4A 2XH0A 1JDFA 1XS2A 4HCHA 1TE6A 1EBGA 3CYJA 3VC5A 3ES8A 1WUFA 2PP1A 3CT2A 1R0MA 3SBFA 2OG9A 2GDQA 5FJUA 2XGZA 3CK5A 4J1OA 3UJ2A 3QN3A 3NO1A 1FHVA 3BSMA 3STPA 3UJFA 4A35A 4G7FA 4GISA 5IDZA 3DGBA 3V4BA 7ENLA 4GGHA 3IJQA 3QPEA 1MDLA 4E6MA 2PPGA 3N6HA 3UGVA 3MKCA 2PTWA 4KWSA 3MSYA 3GC2A 3SJNA 3MQTA 1MDRA 3H12A 3TQPA 4X2PA 1EC7A 2CHRA 3UJEA 3SN1A 4IZGA 3KUMA 3R0KA 2XH2A 4ROPA 3CAWA 4HN8A 2QJMA 4A6GA 3MY9A 2PODA 2P8BA 3H7VA 2QDEA 3H70A 1MNSA 3ZVIA 2HNEA 3S47A 2QGYA 3VCNA 1EC9A 3SN4A 1ECQA 2POZA 3BJSA 5FJOA 3R25A 3GY1A 3FJ4A 3RRAA 2GGJA 3Q45A 4H1ZA 3I6EA 3EEZA 2P88A 1JCTA 3TJ4A 2MNRA 3I6TA 1WUEA 1TKKA 3VDGA 3U4FA 3B97A 3PWIA 3T9PA 4DN1A 5EU9A 3DEQA 3TWAA 3ZLHA 5ENLA 4MGGA 3JW7A 4KT2A 4DX3A 3FYYA 1SJCA 3NFUA 4E5TA 3THUA 4DWDA 3K1GA 3PFRA 3UJRA 2GGIA 1TZZA 4GGBA 2PGEA 1E9IA 3IK4A 2P0IA 3UJSA 3SN0A 3UCCA 1PDZA 3QKEA 4Z1YA 4KEMA 3N4EA 4IP5A 3T4WA 3OPSA 2FYMA 3QLDA 4H83A 5FJPA 3DFYA 1KD0A 3OP2A 3ZVHB 2XH4A 2PMQA 2QQ6A 3ES7A 4M0XA 4HCDA 3V5FA 3OTRA 3FXGA 4M6UA 2OQHA 2OQYA 3TCSA 3VA8A 3P93A 3OZMA 1P43A 3FV9A 3DG6A 5BOEA 4ZCWA 1EC8A 3FCPA 3TOYA 2GSHA 2PP0A 1R6WA 3TTEA 2QVHA 4H2HA 3D47A 4HNLA 3TWBA 3UCDA 2OZ3A 4E8GA 1YEYA 1EBHA 2O56A 4IT1A 1DTNA 3DFHA 4GYPC 3QTPA 4JN7A 5J04A 2QDDA 3MUCA 3R0UA 3N4FA 3JZUA 3OZYA 6ENLA 3V3WA 2PU0A 2GGEA
chains in the Genus database with same CATH superfamily
2MUCA 3A7AA 4B2DA 5DANA 3TJIA 3NSMA 3GKAA 1JXKA 1QWGA 4Q4MA 4MG4A 1UP3A 4KIRA 4UQAA 3KDNA 1L8PA 1K02A 1OIFA 1W17A 3PC0A 1V5XA 2VZOA 3EA3A 1NU5A 4NJGA 3VNMA 2HVNA 3R79A 5D2TA 5T8GA 1F05A 5U7SA 1LTDA 1DV7A 3LTSA 2W5FA 1Y7VA 4KWWA 3V1PA 4L4MA 2NX9A 2XVPA 3AXKA 4OIFA 4YMZA 1ADDA 3U6WA 1VFUA 2ZZ4A 1OCQA 3TSBA 4QRNA 3PZIA 5BRPA 5IHSA 4PGLA 3BCDA 4QXIA 3I3DA 3U8GA 3TC3A 1BKSA 1TPDA 2PGWA 5FJJA 3VFLA 3CV6A 5HNUA 5T91A 4BQ4A 1MW2A 2X40A 3UG5A 5I3JA 1KB3A 3AUJA 4IPPA 4V1XA 4IISA 3RX4A 3PTMA 5T9CE 2OELA 3DECA 1L6GA 3PWGA 1EDGA 3R11A 1NSJA 4YJ5A 3QV7A 1A53A 3CNYA 3CB3A 3UETA 3BV7A 1H0IA 3VNKA 1FKWA 2Z2UA 4X22A 2X2YA 5RUBA 1BTCA 3GD4A 4UR9A 4ZODA 2PGFA 1QOXA 3DGHA 2FZNA 3GG1A 4D1IA 2VQTA 1HP4A 5A2AA 3WQCA 2VGBA 1I45A 4LJ3A 3U48A 2WCGA 1VKFA 1X1OA 2C1GA 3IPWA 3O0KA 4Q8QA 2G3NA 5HQLA 1EJ7L 1CGTA 1WXJA 4XVEA 3CAVA 3APYA 4AZBA 1GRGA 1DE6A 2UY3A 1EDQA 2NW0A 5AVHA 3ARXA 1KFLA 3I7RA 1IWPA 2ZRUA 3TYEA 3GR8A 3KHDA 4GVFA 5JUVA 1JCMP 1DXIA 1LWHA 2NQHA 2VEPA 3UXLA 4S3BA 1SO6A 2CWNA 1TYGA 4OBRA 4GX9A 2Y8UA 4PMXA 3O6CA 3I4EA 4JX4A 3CL6A 3IJIA 1LRTA 2QCDB 3M0ZA 5AC4A 3PBMA 1F73A 4IP4A 3W2LA 3II4A 1TE6A 3VC5A 4FNQA 4NRRA 1H11A 4EANA 2E67A 2V5BA 3WG6A 2DU2A 1ZAIA 1HKMA 3TDFA 1WE5A 4TTUA 4B2DD 4C6KA 1XLGA 4AD3A 1NQ6A 1KCKA 2GR2A 2X7WA 2X50A 2VX6A 1GT8A 3OG3A 3OBAA 5KZEA 2ZZ0A 1N62C 3AHVA 3DGBA 1FQ0A 3KBNA 2NV9A 1Q65A 3PUEA 2J75A 2Z29A 5A8OA 3BARA 2QCFA 1TUFA 3N6HA 4D8LA 3MW7A 4HMEA 3AO0A 3LB8A 1QVBA 4JDYA 4LWWA 1OF6A 4JTCA 3UNDA 4NZ3A 3GZAA 1WZAA 3R8HA 5DFAA 1TTIA 3SCTA 2XN0A 3ITGA 4Z0JA 1KQYA 3WLMA 2J9YA 5CCZA 1W9BM 1X7FA 5LHEA 4GVHA 1X8CA 4IIHA 3VYLA 1F3PA 3UWVA 4KERA 4UTKA 4BI5A 4JEQA 3LHYA 4LSBA 3B04A 1EGMA 2JEPA 4O19A 2DSKA 3WDPP 1DXEA 2ADAA 1L9WA 5HK4A 1RP9A 1EX5A 5KZDA 2YA2A 1E6XM 4K38A 1K9EA 3SUWA 5KMYA 5IFPA 3EEZA 4ZQNA 4EK7A 5HULA 3TJ4A 1NDVA 3PZVA 1QW9A 1YX1A 4V1YA 3NO3A 2E8YA 4H8NA 4U5KA 4AIBA 1V02E 5DCDA 3JW7A 3T0DA 3M07A 1W3JA 4PB5A 1QNRA 3S1UA 5I09A 2VOMA 3CWNA 3HW2A 4X61A 5GJPA 3WEZA 2J9XA 4XZMX 5JCKA 2BDQA 3O8AA 5HDRA 3AMDA 4C6JA 1S2AA 1TPVA 5BYWA 5A8MA 1UH4A 3W86A 2WCSA 4BK9A 2PGEA 4DUWA 1ONWA 1EQPA 5AHEA 3KHJA 1PDZA 2Y5EA 1ZX9A 4BQ3A 3VM7A 4DBWA 1ESWA 4HA3A 3BSGA 2CBJA 4I5UA 2G3JA 4EQRA 2F2HA 1Z41A 1KM4A 3CIWA 5EL1A 1OADA 3E38A 1JI1A 3QJAA 5E0CA 2DIJA 3GU9A 3ZWSA 3VIKA 3BURA 2X05A 3CGCA 1BSIA 3SGUA 4NZFA 4JY9A 1JI2A 2XZ7A 1BEUA 1AUSL 2W0UA 1OCJA 3SUVA 1V0MA 2G37A 4M5PA 1ZXIC 4A22A 3VIIA 4O53A 4DF0A 1FWAC 5AC8A 1VCVA 3B0PA 1TV4A 1AA1B 4AZ5A 3DFTA 1C91A 1R6WA 3RN6A 4EPKA 4V2XA 2VX5A 5IHRA 2VWSA 3WQ4A 3B9NA 1Q8JA 1EJRC 2Z1WA 3C86A 4E2VA 1YNYA 4JTRA 2IKGA 3M5YA 4XQ6A 3SDOA 2JKAA 1XHGA 3VGHA 3N4FA 2R1MA 3OZYA 1WYGA 2ZFAA 1HN1A 1GZGA 3GVGA 2VFDA 3WD4A 2NQ9A 4Q8MA 3WF3A 3RLUA 4N4QA 1VEMA 5XIAA 1UR4A 2G3IA 4WDWA 2YFNA 2G3FA 2RFGA 4HNNA 1XLDA 1ZU8A 2V5JA 4FNPA 3ZVHA 4MWAE 1RVKA 2C13A 1PZ3A 4CU6A 1UPMB 1CIUA 2FVMA 5MKGA 1YXYA 4F66A 1R85A 2PRHA 4Q4OA 4PBGA 2V5KA 4C7GA 1JCYA 3O7UA 1KFEA 2EG7A 3T44A 4K8DA 3FHQA 3LENA 2BV9A 2XM2A 3H54A 3MP5A 1MRQA 3SRHA 2YLLA 4QBXA 4LU0A 1EPXA 1OBAA 3EWCA 2WZIA 3E0WA 4R88A 4RXFA 4C6MA 2WBGA 2BWGA 2E4TA 2PP3A 3BPWA 3NL6A 4P7LA 5GJNA 4HYWA 4LBSA 1KC7A 1OC6A 3JVAA 3KBSA 4FLSA 4W4QA 1Q3NA 4ZSTA 1EXPA 2WCAA 3PZNA 5DY2A 1SFSA 1WP6A 2UY4A 4D9PA 3DC0A 1K9TA 4GUIA 1TPUA 3N13A 3IIVA 1VJIA 2J3NA 4BQ5A 1POKA 1UC4A 2C18A 4H6RA 5JH2A 3W01A 3MUAA 4L9XA 2GUUA 1XYZA 2V68A 1VPXA 4Q7BA 1FWFC 1L6YA 1JAKA 2VZTA 1RBLA 3PTQA 2WJZA 5IM51 2ZRXA 4AB4A 2OVLA 1B31A 4KCTA 3QH2A 3NQDA 3HGJA 3H26A 3HZ3A 3JRKA 3T07A 1KXHA 2DW6A 5HA7A 1GRHA 2Q01A 2QMJA 4WDUA 1WA3A 1VQZA 3F4NA 4IJRA 3AUOA 2P8CA 4QS5A 4BI7A 1VD6A 4NSBA 1OSEA 3V1HA 2PSNA 2FZ9A 1PCKA 3NYDA 3DIPA 3W1UA 1CXLA 4HTYA 3C4UA 2C19A 5LIKX 2DT1A 1YNPA 3VVGA 2YL5A 3VD4A 1I2QA 2GSJA 3L2IA 4EPBC 3BK0A 3W87A 1M6JA 1OIMA 3QMTA 2VMFA 4E0CA 4I9AA 4B5XA 2EPKX 4E38A 2EAWA 5HINA 4LA1A 3G1VA 4AW7A 2C16A 1FO4A 3S4TA 4GZ7A 3VFCA 2FFCA 3RAOA 3QHMA 2R9ZA 3LBOA 1JYXA 4QTGA 1TG7A 2OG9A 4EXQA 2V82A 4LYKA 3NGFA 3XISA 2GVGA 4A3QA 3HGOA 3DGRA 2CLLA 3SI9A 1J8VA 2AAQA 1LLZA 4PTMA 2WLYA 4PSRA 3MV11 1R7AA 5HQMA 3P8JA 1HKVA 1B30A 3ZJ7A 1PZ1A 4LUJA 1RZMA 1YDYA 1FCBA 3DBPA 2PEVA 4KBXA 1V7YA 1XM3A 4TVWA 1K3UA 1QO5A 1RJRA 5KEZA 2CIPA 2SFPA 2CZ5A 4QE1A 1VEPA 1JF6A 1TVLA 4CN1A 1HXJA 4H41A 1RH9A 2BS9A 3C52A 3AISA 2VRKA 3CIXA 3IJ7A 4PTXA 4Q8VA 5G2IA 4CD7A 1GW1A 4X2PA 4AF0A 1UZ1A 4JTTA 2WLZA 3SAZA 3QMSA 3N9SA 1R8LA 3KVLA 1F74A 3A3XA 1VPYA 4FA3A 2DSUA 1MQQA 1TPC1 5E09A 2JBMA 3OZOA 4UWMA 4F2TA 2E68A 3MY9A 2QUTA 3UG4A 2O9RA 2NWSA 1RK5A 3MI6A 3F5LA 1K8ZA 3B9EA 3BOFA 3C0SA 3W2KA 5A95A 3W7KA 2QUMA 2CLHA 5KZMA 5HNNA 5TNVA 4JTLA 3VNIA 2ZX9A 2HVMA 4DELA 4UTHA 1EF3A 4RNIA 4XTDA 3THQA 2WM1A 3VX1A 1J18A 1JZ6A 3L4UA 1ZL1A 5DRIA 4Y9PA 3W88A 1TVPA 1ZAJA 3ITCA 3VDGA 4GIYA 3U4FA 2C7FA 1W5MA 4NJIA 5EU9A 3SUUA 3F5KA 4JKLA 1CNVA 3LLXA 2J4GA 1FWSA 2VL4A 1VAHA 2WPCA 4JQAA 4AD2A 3VIHA 4YVVA 3FYYA 2ZWYA 5D30A 1EEPA 1P0DA 3F4DA 3SQPA 1MZRA 4PRTA 2ZA2A 4H3DA 4NL1A 2GH5A 3GFYA 2DQWA 1E56A 1A5AA 1SW3A 5ABGA 3SCNA 1X1NA 1H3GA 2CW6A 2WBKA 3TEVA 3GG8A 1OB0A 3GXIA 2WC3A 5K2ZA 3BGJA 3K8LA 1XRVA 5EBAA 2PWHA 1KBKA 2BXVA 5CPQA 4QROA 4ACZA 3NVVB 1NF0A 1O4UA 1V0KA 1XIMA 2NXGA 2PZNA 3MMUA 4A3YA 5D2XA 4X63A 1WKYA 2JE8A 2YYTA 1DJNA 1KD0A 2WOVA 4HGXA 5AB3A 4LNYA 3C2OA 3G0XA 4Y9OA 4XB3A 2PDHA 5LSMA 1A5BA 3CU2A 1OC5A 5REQA 2WNZA 1EJWC 1UCWA 4GVGA 1QPQA 2Z7GA 2B7PA 1V6VA 3TCSA 4QG8A 3VA8A 3EXTA 4IOTA 4ZO9A 1XICA 4GRTA 1Q63A 3UGRA 5GNXA 4GC3A 1WNOA 1AL7A 4WGXA 3AC0A 1RQHA 4AY7A 4HN4A 4AISA 2B81A 2HPIA 4C6FA 3GNXA 2WZHA 2EQ7A 4I8YA 1IXNA 5FL1A 1VDVA 3FX4A 3IACA 4P7NA 5DELA 2BVDA 1UR3M 4EKJA 4H7CA 4UQDA 3V3WA 2DUXA 4CQCA 2ZXBA 4K39A 3WYZA 4DBDA 1B57A 1KCZA 1OD0A 2CESA 1QASA 3U9IA 4LH8A 3WK2A 1IWAA 3ITLA 4RX0A 3BAYA 4FIRA 1E4IA 1F9CA 4PUEA 1W31A 1OF8A 3ZR5A 1FP8A 4JKMA 2IMRA 3WLTA 4E2DA 1C8YA 3QM3A 4Z2JA 1GOQA 4J3SA 1BZLA 4LV4A 2D20A 4DO5A 3S9IA 2CNCA 2YVJA 2V9DA 1RPKA 2JF7A 1WKFA 4F8XA 3H2AA 1RK6A 3DH9A 2WHKA 2X42A 2HXUA 1O94A 3DUGA 2OFJA 1P0BA 2QJJA 2WMIA 3L65A 3SIZA 3WJXA 4US5A 2BY3A 5CQ1A 2J8GA 2D0HA 3L2MA 3D3AA 2QUVA 4D6CA 4C5ZA 3VX0A 3NIYA 4N42A 2A8XA 4MSSA 1W1YA 4NAFA 1O12A 1E0VA 5TIMA 2KX9A 1FWJC 2WVUA 3W23A 1W9DM 3LPPA 1OG0A 1QPNA 4AUBA 1H09A 4HU0A 4C65A 5C8BB 2J79A 4AWUA 2I14A 4V28A 5HUPA 3AMGA 4GIAA 3RLHA 5TAOA 3KCJA 3SURA 5CJ5A 4IM4A 3WF2A 3TW9A 4ZENA 3PWAA 1C8VA 1GPWA 4AQLA 5JQ9A 4QNEA 4AX7A 1OEPA 3A13A 3SCRA 4BZYA 3R8RA 1Y5XA 4ZOCA 4XZ9A 2PCQA 4DJED 3AMCA 1I2PA 4MNLA 2FPYA 3E5BA 6A3HA 2O9OA 4UUIA 1J5SA 4NP7A 4MADA 1H7RA 4HHMA 2Y7DA 2G41A 3ARVA 1GWJA 3AXIA 2RDWA 2J25A 3PUGA 3BLFA 2WMIB 4DYKA 1GONA 2WQDA 4DJEA 4H6EA 1JOAA 2DIKA 2NSOA 3BE7A 3LCWA 1TELA 1BG9A 3CQKA 1GSNA 1W1VA 1SU5A 2HE8A 1X38A 3PB0A 2DZVA 4QE5A 2WZMA 2DZAA 4ERAA 1EGVA 3TW7A 1E1EA 4RV8A 4AEEA 3BL3A 1W1A1 2BLEA 4ZZ9A 2ZRVA 1S3TC 1XRFA 1K03A 3APGA 1PV8A 4AHQA 1GREA 3E2RA 4JIQA 3H24A 4M6PA 1JDFA 1EO5A 4IIDA 3TZFA 3L8KA 3WNLA 3GU1A 3CYJA 3URHA 1DXLA 1JRCA 1YBQB 1SO3A 3RYSA 1UWIA 4J1OA 3QN3A 4WCJA 3TH6A 3E2SA 3DJJA 4CN6A 4NUWA 2DEPA 1QPKA 4ACZB 3UYCA 1Y5VA 4C1NB 4FLOA 2W91A 1WZKA 1PTAA 1B2YA 1TPWA 2FPTA 3IJQA 4E6MA 4NXSA 2G0WA 1TO3A 4H7VA 5IDIA 3P7YA 3ONCA 1SZGA 2F38A 2XTKA 2E6YA 3AMZA 3SJNA 4HZ7A 3CQ0A 3ARQA 3E3HA 4DJFD 4KKXA 3RU6A 3DAQA 1BTMA 4HT3A 5CGMA 4CU7A 1E73M 3POCA 1A80A 5C9ZA 2QF8A 3PHAA 5D38A 1XANA 4NEWA 1QNPA 2CWXA 3NVTA 3CBWA 1E55A 5LKYA 4IX0A 3UWEA 3GIQA 5LA1A 3ZM8A 3WUEA 1RY0A 3ZS4A 1HKIA 4O14A 1N2VA 4C6IA 4FLRA 4O18A 3QOMA 3C2VA 3C3UA 1CXKA 4F9JA 1EP2A 3B06A 5AYXA 4HOXA 3BCJA 2ABBA 4DJDC 1PKLA 2PUZA 4L61A 1HF6A 2WZEA 3AQUA 3HMCA 2G96A 5JBDA 2QCHA 2I9EA 3TX9A 1OABA 3IAPA 3DI1A 3KZSA 4PA8A 2D2HA 2ZUMA 3GXPA 1S2TA 4F0RA 3K4AA 4GJ1A 4UTMA 3ITVA 1R9ZA 3VKBA 1Q45A 4HPXA 4AD1A 3P2VA 3P61A 3SR6B 2EKGA 1RQEA 4IXHA 3FHAA 3PPFA 2ODOA 5CJMA 1UKTA 4OBTA 2HBVA 3QFAA 4PCSA 1ISZA 1EXBA 2YGYA 3MDWA 2OGYA 4FNUA 3W70A 3CM4A 1ZHAA 3FKKA 2OWCA 1S2UA 5C2XA 1BF2A 1ISVA 5PTDA 3ID7A 1S5VA 2PDIA 1WOBA 4GGBA 4KS0A 1E9IA 5HJXA 1M5WA 1ML1A 3IK4A 2OXNA 3NOYA 1IZKA 3IGUA 4EQWA 5M1TA 3U2CA 2XFWA 1BVWA 4PMRA 3TFXA 4JTAA 5FKYA 2FYMA 1E1FA 1PEZA 1PL9A 4IG2A 1ZMCA 3M0KA 3RJYA 1JPIA 1PSCA 4W8BA 1QATA 4OE7A 1TYTA 2DZSA 1NOWA 3QZEA 1EOKA 4M0XA 1THFD 2Z2BA 4RV3A 3LADA 3V5FA 3FXGA 5DMNA 3GDBA 4L6HA 1D8CA 2V3FA 4HPHA 4GI8A 1ME9A 4GOAA 1Z69A 1MMFA 1OX4B 5BOEA 5CPSA 4DJFC 2V8ZA 2VX7A 2WPEA 2HQAA 2E9MA 1KRMA 9CGTA 2VXNA 1X98A 3AZTA 2RDUA 3FGCA 2CLIA 3N3MA 1A4MA 4X3ZA 3PNUA 1FY6A 2VC6A 1LRNA 5I77A 2R14A 4A2RA 1FWIC 4YIWA 1CDGA 4BQ2A 1T40A 2DORA 5XINA 4S1FA 4H9UA 4ZOEA 4H4VA 3QQ0A 3ALFA 3WLQA 4GBUA 2W62A 3TYDA 1H41A 4O54A 3VKAA 1A5SA 4UNLA 2OPJA 2QIIA 1D3CA 1H1NA 2WAGA 1LYXA 1VBUA 4K1WA 1AW5A 4HNCA 4S3GA 1T5AA 2BVWA 4HYRA 2DSZA 1QHPA 1C9DA 1CLKA 2GYIA 3TMQA 3NEVA 1FEBA 2Y61A 4PUNA 3RLGA 3OLDA 2CZFA 3EXRA 2QDHA 1KM0A 4K68A 4AX6A 2FVLA 4DNMA 3GC4A 3W9ZA 4NNCA 1KCXA 2YDAA 1U5HA 2WXDM 3WBWA 4ZTXA 1ZBWA 1H7WA 1UH3A 4IMEA 4PEEA 4H4QA 1DJHA 3HPSA 1K9DA 3Q4DA 5B7ZA 1TJPA 3TJXA 2EG8A 2ACUA 2PTXA 4KF1A 5I0DA 1EA9C 3PZOA 3NVWB 1DPMA 3BMVA 4JTJA 4YWIA 1W56A 1JULA 3EXSA 3TYUA 4EQXA 3QHOA 2WOQA 4M1RA 4S23A 1UMLA 4WXYA 1BAGA 2HNHA 2XZ9A 3D5HA 1WB0A 3IVUA 3MYPA 1UZDA 1IV8A 5HOSA 4DAIA 3WNKA 2Y5JA 4GKTA 3H22A 6XIMA 1V93A 1G5AA 4K7ZA 1HJWA 1NFGA 1G0CA 4LIIA 2PTYA 1CGUA 5AKQA 4DWSB 2EEXA 4XWUA 4KW2A 4O52A 4P7QA 3GG0A 3B9DA 1O66A 4F2UA 3DG7A 4M56A 1Q4WA 5HAOA 1Q6RA 4LVGA 2Z6IA 1TPFA 4MDOA 1UB3A 5TBOA 3PZTA 1JZ7A 2OLAA 3A9BA 2E5DA 2WNNA 2PC8A 2RJGA 3ITOA 3UZYA 2WVSA 4MWAC 3B4YA 3MVTA 1BKHA 3RO6A 2BG5A 5H91A 2EG6A 4AIEA 1LG2A 3NR0A 4F40A 1QU4A 3ARRA 2PU1A 1JEZA 4MPQA 4H2CA 3EKZA 4H9ZA 1QHOA 3HIJA 4WSHA 3VNJA 3DN5A 3V5CA 2NQLA 4QDMA 3MZNA 4BF7A 4Z2KA 3KW3A 1TV7A 3ALGA 2BOGX 4IMCA 4JTEA 2FKPA 1AZ1A 4LOCA 3TA6A 4AVOA 3CZLA 1UC5A 4JNZA 5G4WA 2AQWA 3SM0A 5BOFA 1M1BA 4G7EB 5K7JA 1CB7B 3BGAA 3KBMA 2IXUA 1A5UA 1DBTA 3AICA 1R0MA 4A8IA 5C9RA 3WNMA 5BMXA 3LEPA 1XGEA 4CLMA 4NJHA 3AIQA 3MJMA 4D8ZA 3PG8A 3STGA 4CCEA 4LS0A 3CO4A 1PX3A 3W84A 2E9LA 4EAMA 5EFDA 3AYTA 4IPIA 3N4AA 4R3UA 4F48A 1FCVA 4OTKA 4FB7A 5CBBA 5AYYA 2PTWA 3CB8A 3H21A 3NPXA 2XSAA 2DSWA 3WKZA 4X0NA 4QIUA 4U28A 3P14A 1HKJA 2VURA 5I3IA 1Q7MA 1X6UA 1A50A 3IVTA 4LPCA 4PBFA 3ECQA 1H51A 3QGAC 1Y8BA 1S7MA 1FWBC 1KGXA 4JTFA 3GUGA 4KCVA 3FY1A 3EMCA 3NQ8A 5A6LA 3S42A 4FF5A 1QBAA 8XIMA 3UZWA 1LLOA 7CGTA 1QR7A 1UOZA 2PODA 3H70A 3INPA 6REQB 1M41A 3VCNA 4QLLA 2JF6A 3GYEA 4LYQA 4M7TA 2IKIA 5FJOA 2J7BA 1UP2A 4GFSA 4EMWA 3OO2A 1JZ2A 1TA3A 1AH0A 5C70A 4BEUA 1AOGA 1SSDA 1ODZA 3LXBA 2QR6A 5CPNA 2PC4A 1QO2A 4HHPA 3QF0A 3H2CA 3LGDA 4QG6A 3N2MA 2X1SA 3MANA 4YHEA 4AMAA 5AZ1A 3N11A 1WAUA 2WSYA 3CHCA 2VJXA 4Z1AA 1WO2A 2BC1A 3AJ7A 5CPLA 3MTWA 1C29A 3IJ8A 4U4MA 3N18A 4MJ4A 2A7NA 3VMPA 3V0UA 4Q32A 5E6ZA 2JQXA 3THUA 2E0PA 4DWDA 3VDBA 3TMLA 2VRQA 1PKYA 3H2FA 3VO0A 3SFKA 2IS7A 1LUCB 3DOPA 3WQ6A 3FEQA 4H04A 2QW5A 3LSBA 1OFDA 3VNDA 1TZZA 3W6YA 4UTLA 5EBUA 2F7FA 3B3DA 4GD0A 5CBJA 3W72A 2EF9A 3GXDA 1RXOB 2DZBA 3ETRB 2E1DA 1ITQA 2CERA 2JALA 5FJPA 2RKXA 2XN2A 3NA8A 2WPBA 4LC6A 2PMQA 3TC7A 4QSFA 1PCWA 1ZPTA 2R82A 4HCDA 4I6KA 3IJ6A 2VCBA 1OC7A 1RUSA 3CMFA 2EQDA 3EOEA 3REQA 4B5TA 2O7QA 2C0HA 3S6TA 3BAJA 4JFTA 4XO7A 3GX9A 3K13A 2QPSA 3R89A 3MUY1 1H2JA 1O7AA 2X1RA 4GWEA 3D47A 4I9JA 5CPTA 3UCDA 3TR9A 3H7UA 1UASA 1J2WA 1NOUA 4HA0A 1FA2A 2I56A 3OVRA 1K6WA 3TV8A 1XSKA 3OEXA 3CZEA 4FK9A 2WNQA 1BXBA 1Q6EA 2Q02A 1WBJA 1K4GA 3BGGA 3B0UX 3SFWA 3MUIA 3W83A 4JQ4A 5DT5A 3DERA 2AAMA 5D03A 5EMJA 3AWNA 3M5VA 3IAQA 3I65A 1MUCA 2HV5A 3DH7A 2VO5A 4UTWA 5EPDA 1AK5A 4AFYA 4EWJA 1Q7QA 1G94A 4R9XA 3MMTA 1HZYA 3AROA 1KM1A 3BW4A 4DJDD 1XH1A 1DYSA 5CZJA 2BZNA 2Y62A 4WRHA 1YE6A 2WSPA 1RCOB 5MHBA 1ZLPA 1H7NA 2PLJA 1XLEA 2X30A 4DQWA 1W0MA 3RR1A 2WK2A 4A8LA 5IFTA 3RFAA 1AODA 4NZCA 4G8TA 1H0GA 4ZEPA 3TSDA 1EDTA 3LRMA 4LNCA 4CQDA 3KBJA 3EMZA 3GD6A 4LAOA 3OVGA 1E5JA 3DK8A 1N5WC 3RX2A 7ODCA 1I2NA 1TWDA 3MCMA 3GK0A 3AIBA 4IG2B 1XLMA 5FL0A 3DHDA 3OB8A 1AFSA 3ENLA 5AY7A 4W7WA 3NPVA 5BMWA 2QPUA 3IUHA 1W3HA 2DW7A 1IGSA 2YDSA 4F79A 5ABTA 3VDCA 4PUMA 4WJXA 5EMLA 4UQEA 3ISIX 4PEKA 1NVMA 3ZT6A 5A6BA 3CXOA 1Q2SA 1GZ1A 3E5PA 3UQNA 4JHOA 1R2RA 4QISA 2QZRA 3R94A 1ZCOA 3O3RA 2R8WA 2Q8ZA 4C6PA 5H6HA 3T8QA 2ZYFA 4ZFCA 5KVHA 1X1ZA 4PODA 1V97A 4G9PA 2VD8A 3BOXA 2OWWA 2PDNA 2TRSA 3BZGA 4IX2A 3WIJA 1JFXA 4L7ZA 4HYVA 1JZ4A 1MFUA 4EE9A 1ADOA 1AW1A 3GVRA 2J7DA 1ONEA 3CAQA 5FJTA 5D32A 4ZXLA 1PIGA 5FSDC 5HBFA 1WDPA 3UT0A 5JCMA 4GR1A 1QI4A 3UU0A 3UY8A 3UA3A 4C6QA 4BCEA 2FGBA 4GZJA 3JR2A 3ES8A 4GXMA 4GY7A 5ABHA 2PDFA 4JHZA 1W37A 4A8RA 3B8DA 3VGGA 4CQAA 3UVIA 5CBIA 1YTEA 4J5NA 1R3QA 1MW1A 2AOSA 1QAPA 3E9AA 1OFPA 3IV3A 3KVMA 1GHRA 3GWQA 1L6FA 1X2HA 5LZLA 3GYCA 3CHFA 1AL8A 1UWRA 2INZA 1JL8A 3EYPA 4OJYA 4GGHA 2TPSA 4NRSA 4O4WA 3NEHA 1LPFA 3WJZA 1AQMA 4AY8A 5LIWX 5A69A 4XZLX 2VZSA 3NXFA 5DMMA 1LROA 3CEPA 2AAAA 3WD0A 3BSHA 4Q8TA 2W4XA 4HVXA 4J3TA 3NCOA 1NDWA 1KM6A 3S9ZA 3C2RA 4D6JA 2XG9A 3TLQA 1DVJA 2GZXA 3LCLA 3QLLA 2VC5A 3BXWA 1ZQ5A 1TFVA 4Z1CA 4DY1A 5BZAA 1HJXA 2E25A 2ATSA 1O5QA 1FHDA 3SJ3A 1TCMA 4AZIA 2GVJA 2POZA 3IWPA 4UMAA 3SCVA 1X39A 2WC7A 4LY4A 3TSMA 1XG3A 3L12A 1JCLA 4XG1A 3Q45A 2ALRA 5DLCA 4I7UA 2NUWA 2P88A 3L5OA 1ZUAX 1GRTA 4KEUA 1G69A 3VK5A 3ZO9A 4CCDA 4C6BA 1TX2A 4R85A 1GRFA 4XAGA 4MHBA 3UZ5A 4GJIA 1EYWA 1Q4NX 2ZTJA 5ENLA 3USBA 4ZQOA 3ZFHA 4ERIA 4J27A 1SO4A 4PMZA 3RPDA 1BRLA 2GJLA 1DL3A 3GDTA 4BURA 2YX0A 3T7VA 3Q58A 4LUSA 3VAVA 1Q6FA 2GUBA 1PYFA 4EXBA 3G0SA 2C3ZA 1NDYA 7A3HA 3U7VA 1H4PA 1M7OA 3UWZA 2P0IA 4AG0A 2R94A 2W67A 4XAFA 1OK6A 3ARPA 3AS0A 4D6GA 4Z1YA 4JIPA 3T4WA 4M6VA 1OFQA 3B8IA 1OGSA 4QP0A 1UWQA 4D2JA 4HA4A 2W61A 1YBQA 4WSKA 3AHTA 3OP2A 1FOBA 3DFSA 1EWEA 3U5UA 2J6XA 3IIPA 4MVAA 4JNYA 1JD9A 1E3ZA 5H1WA 4XZWA 1TV3A 5C9WA 3H55A 1Z32X 4XD5A 4UCGA 3JU2A 3NSNA 2EGZA 2EBNA 3ZJ8A 3G6MA 4E8DA 4LT9A 2GQWA 1DWIM 3LRLA 1WXYA 3N34A 3TOYA 1LVLA 2GSHA 4CNUA 4TIMA 3ARUA 5FS7A 3F4WA 4H2HA 4KRUA 5BXTA 1XJBA 4E8GA 3F03K 3ZJ6A 1B9BA 3QGVA 2V67A 3VD3A 4RDVA 4GQ0A 5GPRA 5C54A 3EOUA 3GNPA 1XYAA 3DCPA 3NWRA 4Q8NA 2OB3A 2POTA 3M9YA 4GUJA 2DT0A 2V81A 1EJXC 3CL8A 4UC5A 3EBVA 4FDCB 1OCBA 1WDSA 4GMEA 5CSRA 4M52A 7XIMA 2PTDA 4LANA 1XFCA 3DYMA 5D02A 3HG5A 3EAOA 3ZIZA 9XIAA 1GV4A 3PZQA 3O9NA 1LCOA 2ZQ0A 3GNOA 4DVOA 2ZKMX 1RY8A 3QV8A 3BQ6A 2XIMA 1CXHA 2VELA 3MCNA 3WQEA 3VGEA 2J74A 1VFOA 3KBWA 1TVNA 3WF0A 1SZEA 3NS1B 3BO9A 3W1TA 3W85A 5CZSA 2HZGA 1UWAA 5GRTA 4YWSA 3OQ8A 1BWLA 3OQEA 3AM9A 2BX7A 4OVXA 5L9FA 1C92A 4IPJA 4J3ZA 2CBVA 4IL2A 1LF1A 1OJTA 2FMNA 1ZY8A 4BY3A 3AHZA 3W76A 1NTHA 4LS2A 2EPLX 4DNAA 1JG9A 4ZTYA 1R2TA 3VMOA 3GG7A 4IUGA 4L4PA 2CC0A 4GNKB 1LQ2A 2PRLA 1ZJHA 1XPGA 4EF9A 1DWJM 5CGQA 4QM1A 1VR6A 1B3ZA 2YBTA 5BNKA 3RX3A 4ZQRA 3MMWA 5U4NA 2F61A 2XSXA 3O2LA 4CD4A 3M6DA 2QYGA 3SUTA 1SPQA 2P0OA 3WF1A 5FF7A 1Q1RA 1TE1A 5G4EA 1EF2A 1XLCA 2PGRA 2Q8XA 3CUFA 4NXKA 1W9XA 3UPMA 4PUUA 2GUYA 4HJWA 2AL2A 2JGYA 2YAUA 4QSHA 2WP5A 2ZADA 4Y90A 2R6OA 4JYFA 1EUAA 4AEOA 5JU6A 1L6SA 5FEPA 4MYXA 5CPMA 1XQKA 3LTYA 3EDEA 4WDXA 4DIAA 4IPLA 3KOZA 3QBUA 1MQPA 5D33A 3EPMA 3RCMA 3RG6A 1JVNA 4LVFA 4AHOA 4JPGA 3H23A 4RZ6A 1O6IA 3AYRA 1DWHM 1O5KA 1ME8A 4S3DA 1SM9A 4AIOA 1A5MC 4NQ1A 3WQFA 2VC9A 1BXCA 5D2VA 1UWUA 3EKGA 3TUUA 1M7XA 5C0QA 1Q2RA 4HCHA 4Z0SA 3A12A 1Z9AA 2GDQA 2Y0FA 1XXXA 2XGZA 3K4DA 2A3BA 3UJ2A 2F6KA 1RD5A 5I6SA 3QZAA 3P62A 2BVTA 5ECUA 4GX8A 1YNQA 2EPMX 1ZKQA 1SW0A 1PHQA 3SCQA 3GVWA 5A6KA 2QUUA 3DKLA 3WMLA 3EB3A 5D09A 5MF5A 4B15A 1PBGA 2B31A 1ZRQA 4GY0A 1NY1A 2E5AA 4DLMA 2E09A 1N8IA 4PL1A 3VZYA 3M16A 2V6OA 1Q1WA 1EL3A 4G56A 1XKYA 2OYKA 4S38A 4UTFA 2X2GA 3HURA 4YNGA 4A21A 2D3NA 1XDJA 4BF9A 3D9XA 3QYQA 1STZA 2VFIA 3KTCA 4NILA 4F2BA 5EGRA 4JEJA 4ECLA 1DWFM 1WKEA 1UA7A 2P8BA 3ZVIA 3IRSA 1OG6A 3MYOA 3NOEA 1KLZA 5CLWA 2ZE0A 2DZTA 1D2KA 3FJ4A 3J7HA 1K6AA 1PPIA 2A21A 1OWQA 3S46A 4JFWA 4DWSD 1W3IA 2Q3RA 3A5VA 4NAEB 3P5YA 1MXDA 2I5GA 3PTKA 1NAL1 3ABXA 1KXQA 1BHGA 3APTA 5E93A 4LF1A 3F4VA 3ONBA 3SECA 3M4HA 4DN1A 2Y70A 4DWSA 2FIQA 1ONRA 5DXXA 3ZOAA 4C6EA 5U25A 4IWWA 1PS9A 1XL9A 4TVDA 3CUIA 4W8AA 1VLWA 1V77A 2UY5A 3M5XA 5EA9A 2WKJA 2Z26A 1P1XA 3M0MA 2WVVB 4FX6M 3TE9A 4AZCB 1JPHA 3KE0A 4Q8UA 3E2VA 5A6SA 4NI8A 1L6WA 5KINA 2REQB 3BAWA 4B91A 1VLIA 4O1FA 1S5NA 5C7VA 3VGDA 3OHMB 2PURA 2Z28A 4C90A 1IEXA 3QC0A 4M1BA 3UW6A 3SCOA 1XWYA 3O05A 4J35A 1JYVA 5EB8A 4JQ1A 4JCLA 2F84A 1YW1A 3FS2A 4J3XA 1IIGA 4QCFA 5HPOA 1V6YA 1DIKA 4JKKA 4NZJA 3L0NA 5G4HC 1NWUA 5BXRA 1GTEA 4IQLA 4PBEA 3IEBA 4P8VA 2ZWZA 4DUOA 3WBEA 1F6KA 4H9MA 3CZJA 1BLIA 1JGMA 1E6NA 1EKOA 3CHVA 3IGSA 1VIWA 1GOIA 4U3AA 3CPRA 5E1QA 3OYXA 3ZMRA 1AVAA 1LDCA 1MEWA 3L4VA 2GDUA 4RK8A 3AI0A 3IJ9A 1NHSA 4N9BA 1E70M 3EX1A 1PX4A 3WMSA 1E0TA 2YSWA 3LLDA 1XIHA 2FVKA 3G8EA 3DHPA 4TO8A 2Y7EA 2Z24A 2P50A 3COTA 2A6LA 1SO5A 1XH0A 4AU0A 5ABEA 3UNTA 1EBHA 1XGZA 4IJCA 3QQWA 1A0DA 4HNUA 3LPGA 4UTWC 4PN2A 4NYYA 2YCIX 2BC0A 2V2CA 2PD5A 3VKJA 3RCNA 2OTDA 2QT3A 4DNHA 5FS8A 2JK2A 1PAMA 5FAGA 3OU8A 1B5TA 1BGGA 1XLBA 3RR4A 3G24A 5FMHA 1LWJA 1FFQA 2C0AA 4REQB 1NARA 4KGLA 2Z0IA 1YTDA 1ZMDA 2GK1B 3EDJA 1MNZA 3KS6A 4F0HA 5F1VA 3KEHA 3WQ5A 4AY1A 4Q4RA 4EWND 3HPAA 3PPCA 4IL0A 1KBJA 4TVUA 2GQAA 1AW2A 2QHAA 3S6DA 3W75A 4ORMA 1T0OA 4HPJA 3KAOA 4JTDA 4HSOA 4MKNA 3WH7A 2D2OA 2ZUNA 2YW4A 1Q66A 2GVEA 4MWAB 3K46A 1AD4A 1SJAA 1PUDA 2INFA 1AH3A 4AD4A 2O7SA 4GA8A 3NQ2A 3WCZA 4MYAA 2ONEA 4R53A 3BW2A 3C0LA 4PUWA 4UQBA 5I3FA 1TB3A 4A3UA 1IT7A 5CZKA 3DX5A 1D7YA 1ICPA 5DCEA 2YA0A 3F1QA 1KV8A 2YCJA 1XLLA 1V0LA 2GGHA 3NVDA 3CGDA 1BQGA 4K2SA 2ACRA 4GCXA 3PULA 2ZZ5A 1R2SA 5AHMA 1DQWA 1QCWA 3PUOA 2NSXA 6XIAA 3W82A 2J8FA 5B7YA 1OJXA 5BU9A 5CLTA 3LUTA 2AL2B 3ATZA 2WB5A 2ZTKA 4M29A 3PFMA 2O9PA 1HT6A 1CEOA 3MT1A 4W86A 4HU4A 1DOSA 3H7RA 3BQ5A 1J2BA 1V3HA 1V6XA 2PCEA 4LAKA 4M51A 5LXEA 1SFJA 7TIMA 1EJSC 3UWYA 5AC5A 2GLKA 3OGVA 4IFKB 3UESA 4GE8A 2PZ0A 1C9WA 3HGRA 3GSMA 3GZ3A 3EOLA 1XIGA 2EPHA 3M7SA 4QHRA 4O8AA 4FXJA 4GUHA 3EDDA 3UXKA 3EF6A 1TZ7A 1S5MA 2D1ZA 4XAYA 4Q4PA 1GRAA 1KO0A 1M9HA 1G4TA 3LBCA 3LCGA 4DPQA 1GEUA 4C60A 2DSVA 4HNTA 3LDVA 1HGWA 1JPDX 4H19A 4HOWA 4ZSUA 2NVDA 3A4JA 4B4HA 4S3AA 3LCIA 4IXXA 3GTIA 1RR2A 3S0CA 1GCYA 4ML9A 5D37A 3N9RA 3TCEA 3JUGA 1FX6A 2PWDA 1YDVA 1UKPA 2GSEA 2WWCA 2HEJA 4F3HA 1KA9F 1XD0A 5BCAA 3TN4A 4PFHA 3O63A 4MDPA 2C3CA 2EQ9A 3OG2A 3QRHA 4LRTA 1T7LA 1IEIA 3GNDA 4B5NA 3BSMA 3NL5A 4FALA 3C2EA 1FFUC 1Q6OA 4V27A 1F6PA 3EPOA 1XFBA 1ZAHA 4WKHA 3Q2DA 3LZ3A 2OLHA 4H50A 3AZSA 3Q37A 4KWOA 4MM1A 3VM5A 4WF7A 4H4WA 2X1TA 1GQNA 4X9SA 3T09A 4RZ4A 1FDJA 1G9HA 2WSKA 1E0WA 1R3SA 4D1JA 1FCUA 2Q09A 1YE4A 3K2GA 3PG9A 4R5EA 2DZWA 1GESA 5CPOA 4YL2A 3VE9A 2ALDA 3DXIA 2VRJA 3EKLA 3ZYZA 1UR2A 3WNNA 5A8NA 3WH6A 4QEHA 2Y5SA 1S5WA 2QDEA 4JTQA 3NZQA 3GVQA 1L2QA 1DJZA 3K8KA 3L0KA 3UXAA 4BS0A 4XVDA 3CH0A 1DJGA 3RRAA 3W22A 1Q13A 3IGXA 1JQXA 4UTTC 1G6CA 2P5NA 2R1PA 3WEMA 4XD4A 1ONXA 3EPNA 1SR9A 4GPNA 4UNIA 1TJ2A 2XHYA 3G1XA 1IZJA 4JBRA 4O1EA 4G7EA 4N7QA 2QCDA 5FAJA 3L4XA 1QNSA 3PBUA 1K4HA 1OFEA 3E0IA 2J7CA 3HPZA 3S2MA 4EQSA 5LNWA 2OGJA 4MGGA 1JDCA 4ILSA 3UZJA 3SUSA 2B0MA 1GVOA 3ARTA 2CPUA 3CWOX 2VUYA 3SIMA 2R1KA 4HHHA 2XFRA 1PHWA 3GTXA 5FF3A 5LYRA 3K1GA 1GPFA 4K1GA 1W5OA 1EH9A 1K8XA 3GB6A 1V6WA 3WLNA 3W4RA 4R7WA 4HA1A 3LPOA 3WQOA 3SN0A 2ISWA 1XLFA 4IP5A 5F2GA 1WZLA 4XIAA 4LGXA 1J5TA 3M6YA 2BY2A 3WY1A 3HFYA 1NM9A 2YDQA 4H83A 1TSIA 4J4KA 4FF7A 3VGBA 1GW9A 3WH9A 4GVIA 5HMFA 3N3TA 1Y5WA 4CCZA 1JJKA 1MUWA 3GDLA 1UD4A 3LNPA 4EIVA 1GVEA 6REQA 3WLPA 4L6DA 1Q6QA 1PIIA 2HSAA 2WWDA 1PVNA 1J0KA 3CPGA 2JKEA 2PP0A 4KCWA 3T42A 5E9AA 3UPBA 2NV2A 5JBFA 3IIXA 3DBNA 1EIBA 3AIVA 4GYPC 1ADSA 3QV9A 3B8TA 5I24A 3WX7A 4LCQA 1B3VA 1OT2A 4X0VA 3MKKA 4NZ4A 3PPHA 5D04C 1SSGA 4GQQA 3T05A 1H2IA 1UIOA 4KPLA 4WLCA 3GE7A 1E6ZA 1JROA 1KQZA 4Z08A 2E5BA 4JNMA 3GBDA 2PDUA 1FDYA 2ZUWA 1DHKA 1IXQA 3LLFA 4QQ3A 2DVTA 1XR2A 4MAVA 1J0HA 3I7SA 4O1BA 2OO0A 2J7FA 5TF0A 5CAKA 1HO1A 5C9XA 4XK2A 3ITXA 1VIZA 2AGTA 3G0UA 2OZ8A 1F8MA 4UCFA 1KCLA 1TV8A 3G1HA 2CFFA 4O50A 1K1DA 4CQ8A 3CHEA 1YKWA 4K7YA 3UR7A 1T96A 3CQHA 2V3DA 2H6RA 3G77A 3TK7A 5IOBA 4GABA 3A4WA 2W79A 4PUDA 3OOQA 3U3HA 1LJYA 3GXFA 4ZE5A 4JIRA 1XDIA 1VFMA 3QQ1A 3TNOA 3FVDA 1TTPA 2GR3A 1W9UA 3CPUA 2JGQA 3NM3A 3CUGA 1B54A 3WFLA 2ZUSA 1W91A 5AYZA 4MFEA 3QVQA 1K77A 3MS8A 4FR6A 3S1XA 4B4FA 4C7FA 4CD8A 3W7NA 1KV5A 4RE4A 3WK0A 3DJGX 3BC9A 4HNOA 4ADTA 3S1WA 4DM1A 3TOPA 1PIFA 4DXKA 1O68A 3HQPA 4R34A 1XIJA 1E1CB 4XISA 5CC6A 1GJUA 4US5D 2V2HA 1KW1A 3MI2A 2IUZA 1UIPA 4K3ZA 4FXSA 2YDRA 1B4KA 1RVGA 1B90A 2WMKA 1I1XA 4L64A 5FCZA 1EYEA 3SQSA 1XBZA 3RLVA 3HJZA 2PF0A 4WZHA 3S2LA 3AIUA 4YTUA 3IJLA 4KEZA 1HL8A 4GC4A 1P6BA 3DG3A 5FA5A 1U1HA 3B8WA 2INEA 3SRFA 4K8GA 3G2GA 2GGGA 3TR2A 2I16A 4QJ3B 4YCPA 3WMCA 2MANA 3W1LA 1TIMA 5CH9A 1XIBA 5FOOA 2GOUA 4NI3A 3VIOA 1QT1A 4N02A 5CSUA 1CXIA 3MI3A 5ECVA 1EWDA 3PR2A 5IRPA 5C9UA 2I1OA 4PMNA 1FFVC 3VOHA 3GFXA 2GVYA 1GGOA 4W87A 4XTIA 4A35A 3R0DA 2X99A 3HB9A 3PUDA 1K9FA 4GIEA 2VHLA 1KGWA 1P6WA 2DJLA 5H2ZA 4Q8OA 1VZWA 2IKJA 5K4XA 3MKCA 5HMDA 3DKJA 3N2TA 3NQVA 1YDOA 1J96A 5F4XA 3POHA 2WQPA 4U3CA 4WKFA 1GVSA 1WV2A 3RPTA 4C6LA 8TIMA 2X0YA 4WY0B 3V0SA 5LGXA 4JIIX 2DQXA 4UBPC 1XIDA 5FEZA 5AN7A 2OX1A 1GOWA 3FW6A 1UA3A 5FESA 1DWGM 3R0KA 1CX9A 2VC7A 1RLCL 1LM1A 4B90A 2QJMA 3W7HA 5HNTA 4P8XA 1A5NC 4QEEA 1H1ZA 3T40A 3B8UA 2ZA1A 2ZXAA 1VFSA 4ICNA 3WK3A 1J10A 1X7IA 1ECQA 5CGTA 1M65A 1HVXA 4H1ZA 5HPCA 4OFCA 5EMMA 1LQAA 5BRQA 2ZBTA 5K9CA 4UZSA 3W7PA 3PAOA 3THDA 2A3LA 3WLHA 2XWEA 3PBGA 3UEQA 1FVPA 4NAFB 1V4YA 3PWIA 4EPEC 1H5YA 4Q6XA 3ZLHA 1JDEA 4GG9A 1XCXA 1DP0A 1XF0A 1VRDA 5JCLA 1R46A 1DE5A 1R3TA 2XYLA 2D73A 1C8QA 4ZB5A 4W7UA 3EUB3 1P7TA 3SCSA 1P1MA 5DEZA 1FWCC 3KOYA 3NJ3A 1N82A 2YCKX 3UJRA 4NZ1A 4HK5A 2P53A 5DMYA 4D6EA 2J8TA 5EY5A 4BJHA 4W5ZA 3W7IA 4G5DA 1KFWA 1Q5MA 8RUCA 3KP1A 1EHNA 1YLVA 1CXEA 1ZP4A 2CEQA 2E40A 1Z42A 1BPLB 3T4CA 2BHYA 3WDRA 4R9OA 2FGLA 3NG3A 2PDKA 4PL2A 1GOXA 1SFTA 1DIEA 4E8CA 1EZWA 3LPFA 4L1WA 1SMDA 2WHJA 1F3EA 3K4WA 4JDBA 3AOFA 4GK8A 3V75A 5HJLA 5BWAA 3KOFA 3OZMA 3CV2A 1P43A 1KXTA 3NM1A 4W84A 4L1GA 4RXGA 2FZMA 3C56A 4LY8A 3VILA 1FKXA 2ATMA 2QV4A 3C0QA 3CV7A 5C5YA 1EFZA 1OD8A 2B7OA 3HQOA 3A3HA 1ISYA 1NP2A 5AFDA 5FD0A 1VEOA 1FXPA 4MY1A 3L21A 2OEKA 4UOJA 3WBXA 3P6LA 3R2GA 1X97A 1DTNA 2HCVA 1P0EA 3QTPA 5CG7A 3PY2A 1AQFA 3I3BA 4YTTA 3MPGA 4B5WA 1YXCA 1HVQA 1PX8A 2CETA 4HZMA 3UWUA 4NY2A 1REQA 2CKRA 3TN5A 3EX4A 3RU8X 4S2BA 5A2CA 5DRCA 4IMAA 1DJQA 1B0IA 3PSVA 3A23A 1Z3NA 5A3HA 4Y96A 3C6CA 1VENA 1VYSX 3MHUA 5I5RA 4FO4A 2XIJA 4AZGA 4UFMA 4ADWA 1DJYA 3PZ9A 3O16A 4XUYA 3LBMA 3NQ6A 1WCGA 1RP8A 1RA0A 1XSIA 4ZOBA 1VHCA 4DLFA 4MMWA 2YKKA 3BMXA 3P84A 4W7VA 1YRRA 3T0AA 3E0VA 2BOFX 3Q67A 4AC1X 1G4EA 5A6MA 4GYPA 1W3NA 2W9MA 1NELA 3UA4A 3KFTA 4DUXA 3RM4A 1KM3A 3L4TA 2ZUUA 4PFMA 2P10A 3MWCA 3KWSA 1MW0A 2E7FA 3P74A 3IUDA 4C91A 3AFBA 2PWGA 4YN5A 3P0WA 2O4QA 1GKRA 5I79A 3E1F1 1ZJBA 3IS4A 3FYPA 3GQYA 1NWSA 3SB0A 1BYDA 1J6PA 1K70A 1AH4A 3B8VA 2YXGA 3MA8A 3CIVA 4H4SA 3W27A 4BFAA 1H63A 1ELSA 3VZZA 4A3HA 3WUFA 1FHLA 1RV8A 1M53A 2DGAA 4H00A 4IHCA 1F3TA 2RGMA 2C8NA 3KL0A 1S3HA 1FH7A 1T8XA 1M7JA 1UJQA 1GETA 4PYSA 4J57A 2OKOA 3GNNA 3AS3A 2NXIA 4FEZA 4O1AA 3IVSA 3DC8A 1SQ7A 4C7DA 3C61A 3GXMA 1UQYA 3N1AA 3PBYA 3BOLA 5FEXA 1E0XA 1XD1A 3QZ6A 3RHGA 1TTQA 1YPXA 4S3CA 3W1QA 3WQWA 4I90A 1G01A 2ZRZA 3UR5A 4W85A 4CN4A 2DZXA 4QE4A 1N8FA 3UF9A 2QAPA 3UY7A 3AYVA 1GVFA 4PCFA 5A6TC 3W53A 4O4VA 1HW6A 5DF0A 4E3VA 4FX8A 3G6LA 4KQNA 4GINA 4QQUA 3IIZA 2YL6A 3R5EA 2ASHA 1ZBCA 5FS6A 1R9XA 3P60A 1RCQA 1VBHA 1EZ2A 2Z00A 1EBGA 5AYIA 3KBVA 2XGIA 5AYBA 3GTHA 2ACSA 3CK5A 3VIMA 1KFKA 1UPPA 3CQIA 1W2VA 1FIQB 1CECA 1FHVA 3H4GA 1NJJA 4FR1A 3B0YA 1E9LA 3QHNA 3WQGA 2ZDSA 3LV6A 4CCCA 4G7FA 4PTVA 1LP6A 5IDZA 1S38A 4JCMA 3EOOA 1S1RA 5EBKA 5BWFA 4J56A 3MSYA 3VKKA 1V51A 4JS3A 2WBAA 9XIMA 1WYIA 3KS5A 3FA5A 3W74A 2D69A 2WMFA 3MQTA 1CZ1A 4LF2A 4MAZA 4PUJA 3ABQA 3QR1A 3CZKA 2BHZA 3Q6JA 3WK1A 1VRXA 4YPJA 2VVSA 3RM9A 2ZZ2A 3JS3A 1RPXA 2WSQA 3KWXA 4O0ZA 4KPRA 4DPPA 4OOZA 3CAWA 3RRXA 4OGZA 3W07A 3KTSA 4IQDA 3T78A 1JDAA 4A6GA 2BGQA 2J88A 3GRIA 4DBUA 4Z1DA 3U2OA 1UBPC 1HTIA 1BWVA 1W32A 4O15A 2V0TA 4DF1A 3V35A 1QTWA 4AD5A 1MOKA 1ZS2A 3W28A 4K37A 2PDPA 3Q94A 2YVFA 1FCQA 2VKZG 3LB0A 1RBOB 4DYJA 2UZ9A 1AJZA 1FDZA 4U2ZA 4D8AA 2L5HA 2V38A 4TQTA 2W63A 4K8EA 3UVAA 4AXKA 3T9PA 2OODA 3DEQA 1MYRA 4CU8A 2XJ7A 1LRQA 4ASTA 4P8UA 3BAIA 3BV4A 4E2BA 4CEUC 4MUZA 4BI6A 3D6NA 3OLIA 3IJDA 1BRLB 5I00A 1TR1A 4IFOA 5BOOA 1D3HA 5LIYX 4C1NA 3GTNA 1FWDC 3CZ8A 4OZOA 6PTDA 1UP0A 5FS9A 3WLOA 3Q65A 4L65A 4LBRA 3OLGA 1KFCA 4C6CA 1V3JA 2VR2A 3DHFA 5M17A 3AXMA 1O1HA 1I1WA 3S5OA 3ZVHB 3N19B 3T0CA 1KWKA 2QQ6A 3IV8A 2FPVA 4K36A 4ZOHB 1KFBA 8XIAA 1QNQA 4WX2A 4BV6A 2WHLA 2FH8A 5DY3A 4IJBA 1XCWA 2VEKA 4MNJA 2ZVIA 1ZNNA 2QJGA 3FV9A 4AF0B 3EOSA 3P67A 4AIUA 2NQ5A 3CEUA 1EHAA 1H60A 2DIEA 1R7OA 5U1OA 5REQB 3SCPA 3UR8A 4MTVA 2ISDA 1OFRA 4IICA 1V03A 3CWHA 5ABFA 3EX2A 4INFA 4NKCA 2YIHA 3WD3A 4C1LA 2E6FA 3R0UA 4JZ5A 6ENLA 1QI3A 2OSYA 4JTIA 1TWSA 1IIHA 2VEGA 3L5AA 3EGJA 6CGTA 4F0MA 1M01A 4DRSA 3WSUA 2WNWA 5I7GA 1R30A 2C15A 4WGHA 1M68A 5DCBA 4JQ2A 2XFYA 3FNDA 1CT5A 1JRPA 1W6TA 1MQRA 2H9AA 2A3AA 3S5ZA 3O1NA 1O5XA 4KIEA 3N2OA 3CS2A 1YMYA 1W3LA 1Q6GA 4L4LA 1GVYA 1C7TA 1B3WA 4XV0A 1GHSA 2BY0A 3U2EA 2X8CA 1KWGA 4IGMA 1SW7A 4GRSA 2D24A 3TNBA 2E8ZA 2PS2A 3PAJA 4TV5A 1MWOA 2OU4A 2ZIDA 3TQVA 3V0TA 4H4ZA 1GRBA 3NDZA 3WBYA 4FAMA 2AKZA 3F4CA 1WKDA 4DHGA 4FNRA 1P48A 2G5WA 1FH8A 1XPYA 1QXLA 2O0TA 3M0HA 1EOMA 2GL5A 1HJVA 3BUVA 1W3KA 3LTPA 2AQVA 3BLEA 4HPNA 2X8GA 1HL9A 3PF3A 1S46A 2A5HA 4AZ6A 3OHIA 2UY2A 1QK2A 1UD8A 2V5LA 2Y8VA 2P3ZA 3KP0A 6TIMA 1XLJA 3SQMA 3R7MA 4GI6A 3TROA 2X0SA 3M5ZA 3VDHA 3A64A 1T6MA 5CC5A 5KSWA 1Q85A 5EKYA 4O8RA 3PZGA 1WBHA 1XDLA 2YBUA 5LNUA 3H4XA 1CPUA 1K8YA 1J12A 6TAAA 3SADA 5CG0A 2WM0A 3S1VA 2WMGA 4GQBA 4GXWA 3ERPA 3ABSA 3TQKA 3QFBA 4Y9AA 4REQA 3MP4A 2CCRA 4RNJA 2PDXA 5EMYA 2WOIA 4QAIA 3MVIA 2WW5A 2GVLA 3MUXA 3STCA 4Z1BA 2ZZ1A 3NPUA 1ONFA 1PO9A 3L7RA 2QNEA 2YR1A 4FI4A 3QYSA 4OBSA 3L4WA 3A9IA 4JN8A 3IARA 4FZIA 1VYRA 3H53A 1X8FA 4FNTA 3B9AA 2F5ZA 5D2YA 3ZWTA 4TVCA 4C5YA 5XIMA 5F2MA 3RMEA 1XS2A 3UZXA 3KM8A 1XUUA 4OQVA 1E1CA 3OC4A 3UBPC 2XM1A 4BA0A 3U0HA 3CH9A 3KOWA 3EEGA 4UTJA 2R24A 1TCDA 2J9ZA 3STPA 2YPIA 3B9JB 3GDRA 1J9YA 4LC8A 5AZ0A 3V4BA 2QEZA 4TX8A 1ZALA 2Q3OA 1VS1A 1MUMA 1HX0A 1W1PA 2Y8KA 4KFPA 3RIKA 4JIHA 4LUYA 3KL3A 1E5NA 2XU2A 4YU1A 1RCXB 2RGLA 2VUNA 1RA5A 3DFQA 1IE7C 3VPLA 6ALDA 4LAZA 1LBFA 1GJPA 4XX6A 2YVGA 5FEWA 5JCNA 4IPNB 3TYAA 4GZIA 4UZUA 3S2NA 3A47A 3O0FA 4HK6A 4IGNA 2Q71A 3SN1A 3TU9A 4JR5A 3UWWA 4O16A 2NT0A 4CQBA 4V33A 1C8XA 3FLUA 1TMLA 1JDDA 3W7OA 2GPTA 1WXZA 4R27A 5LIUX 2WMHA 2WP6A 3MSDA 1UMYA 4O28A 4XZBA 3PN8A 4ATWA 1X2GA 2VOTA 4LVBA 2NX1A 4PTNA 3WLSA 3CLWA 1GNXA 2QKFA 2MNRA 3I6TA 3USZA 1BGAA 5H8MA 1AZ2A 3VABA 4P7RA 1IWBA 1F6YA 2VFHA 4NHVA 1EUNA 3MO7A 2ZZ6A 3TZNA 4IMDA 1GQJA 3SGGA 3FAWA 1KTBA 5A6JA 4JTHA 4KT2A 5D8ZA 4DX3A 2Y1HA 3NDYA 1SJCA 1CENA 1F2JA 4BHYA 1OQFA 3W0KA 1XLAA 3S5YA 1ZZMA 3PFRA 3A4AA 3BLOA 1NQKA 2W54A 4NJKA 3O06A 2D2JA 4JTUA 3VGFA 2IPWA 3TFCA 3TTOA 3MU7A 3QY8A 1NHQA 4KEMA 4EACA 3IANA 3LI1A 3MJYA 5C2GA 2YCLA 3FJLA 3THCA 2ISVA 5J5DA 3PG6A 5K3VA 1CYGA 3RILA 2DV0A 4HU3A 2VGFA 3N15A 2FTPA 5M5DA 3A5FA 4B9ZA 3WJYA 2X09A 1AMKA 4U33A 3AWOA 1EB3A 1S2VA 1N5XA 2V3EA 4JFSA 3GM8A 4LUIA 2ZICA 4H4YA 2EJ1A 2NV1A 1KBLA 5ABFB 2Q8LA 1DIOA 2XGBA 2CZEA 1XBXA 3T8LA 1CCWB 5L6UA 1OY0A 3C8FA 3M7WA 3MC5A 3P80A 3N14A 2CYGA 2XIQA 4UTIA 4DB7A 3KTXA 1BXNA 2DVXA 5GNYA 1ZB5A 3BWWA 3ZXWA 5LA0A 1U5JA 4PMQA 1FXQA 1IF2A 1BSLA 2OT0A 1BYBA 3ABOA 5J04A 3B05A 3VE7A 2DJXA 5I78A 1TRIA 1N61C 1RALA 4WY0A 2GGEA 4QLKA 4J9JA 5G1YA 3OIXA 4HJFA 3M64A 1YXDA 3QEZA 3VZXA 3K30A 3NGJA 1ZY9A 4RE0A 3WD2A 2CLOA 1Z89A 3QKZA 3D3FA 1KTCA 2PA6A 1MI3A 1J6OA 3AMKA 2BXZA 3N25A 2Y4SA 2CLMA 2NLIA 2JEQA 3NXLA 1Q6LA 4GFIA 2G97A 1VYPX 3T1GA 4G1NA 3ZR6A 1XC6A 4B5SA 3EAUA 2W6RA 4EOUA 2FDMA 1JPKA 2CBIA 3UCQA 2XVLA 3GXNA 3ME3A 1GKPA 2BASA 4Y7EA 4UOZA 3M0XA 1DTUA 2XH7A 2RAGA 1FWNA 4LRSA 4EMIA 2PTZA 1CWYA 1F7BA 3BH4A 1TPB1 5JMUA 3XIMA 3RO8A 4Q8PA 4GH1A 4PCNA 3H4KA 4MZ8A 4F4RA 3LD5A 3ZJKA 3VOIA 1PWLA 4D6IA 3CQJA 1GZJA 4XAZA 4XD3A 4DYEA 1C90A 1JNDA 2VENA 3AIEA 4U2YA 4JD4A 3NZPA 1EJTC 3AYSA 3R43A 3VIPA 1T3QC 1XINA 5KVIA 3WH5A 4J7RA 2X1UA 2F8QA 5CAHA 4ZO8A 3ICJA 1W9VA 5T9BG 1I2OA 2EJAA 2WYSA 3WNPA 2VEMA 2FLIA 2W55A 2EPOA 3GIYA 3R13A 2GJXA 1F5ZA 1UOKA 3NSXA 4ENLA 2X0HA 4I6VA 4PB4A 4KRTA 1QI0A 4ZO7A 4OU1A 4DUVA 1LL7A 1W1TA 4S3KA 2HRWA 3STFA 2PBGA 3C0JA 4JYEA 3EX3A 4BR1A 4E3TA 2VX4A 5B80A 1JZ8A 1XYMA 2NUXA 4LEFA 3GFZA 1H7OA 1PZ0A 3H4WA 4KFOA 3SSZA 5JIWA 4TX9A 4RW5A 2NLYA 1UR1A 3N6JA 2HXTA 1AMYA 4J40A 2A7PA 2V3AA 3TJLA 2OCZA 3IRDA 1VB9A 3CT2A 1UZ4A 1YPFA 2DH2A 3PM6A 4QJ5B 4JDRA 1I2RA 3PANA 4Y2WA 1JNEA 1J0ZA 3S9YA 1HJUA 4H4XA 4IQEA 3WUBA 5KETA 4TVYA 3OLEA 1US0A 4MLRA 1NPXA 1RJPA 3VCRA 3CO8A 4FS9A 5I3KA 1X6NA 3UPWA 3WBAA 1KRCC 2A3EA 1UHVA 1JRBA 2CKSA 4X2RA 1DJIA 4I5XA 1YDNA 1I75A 4PH6A 5G5IA 4RLIA 1DHPA 1K4QA 7REQA 1V8EA 2VR5A 1E71M 5A8GA 3EZ4A 1CTNA 4WSJA 2WVVA 3CTLA 4C6OA 4RE3A 2F2KA 2Y89A 2FGZA 3XINA 3TQPA 4Q4SA 1G1YA 5LNSA 3LMZA 4ZMGA 3LK6A 3H6OA 3DYPA 2WKLA 5FF0A 4DEFA 3UJEA 4MNMA 3NAVA 1VJZA 3MSRA 7PTDA 4JL2A 2XH2A 1F61A 5FJIA 3UXDA 2IQTA 3FSUA 1BYAA 5F2LA 3E49A 4XO6A 1GQIA 2E3ZA 2RHGA 4UR8A 1HP5A 4WD0A 4X60A 2NT1A 5D9MA 4ZL1A 4EF8A 4B3ZA 1H61A 4UQ9A 1O95A 3UYIA 1YTKA 3AALA 2NUYA 4PMDA 1F76A 2QAEA 2IXVA 3WN6A 3GR7A 2BTMA 1WAWA 3GY1A 4XZNX 2VZVA 3BLKA 1ME7A 2V3BA 1A0CA 1W8SA 5E6YA 3URBA 1FBAA 1FWTA 1SUXA 4J3UA 1FEAA 4JAWA 1JCTA 1NFBA 2PDGA 3HO8A 3S83A 4Y6GA 1SYTA 3BJTA 3PTDA 5I23A 1RAKA 2Y6ZA 4FX9A 1H1YA 4XIMA 5HXMA 1LOSA 2YYUA 4KCUA 3WJWA 2R91A 3MWAA 1XKJA 3GC5A 1C93A 3DFPA 1IEVA 2QCEA 2NPXA 2WC4A 4FIQA 3EDFA 3NFUA 1KNWA 2IQDA 4R7OA 3LNMA 1LBLA 4POCA 4FXFA 3BMWA 4L5ZA 5GJMA 3VMNA 1ZP3A 4G2DA 3SGZA 4TV6A 2F6XA 1RBAA 2ZC1A 2PB1A 1Z8AA 1W1IE 1UUMA 3FOKA 3UCCA 1CGWA 2J24A 1JZ5A 3QKEA 4LYRA 1UW9A 3N4EA 4IIEA 2A1YA 4XZHA 3U2ZA 1I0BA 4GH3A 3GNRA 4NG3A 1EQCA 4CVUA 2XVNA 2YZRA 1PWMA 1NP0A 5KTLA 1GKQA 3FJ6A 3U5YA 4AVNA 4NNAA 3S5NA 1GYLA 2OEJA 2PI6A 2XH4A 2VZUA 3B4UA 4HIBA 1M04A 1S5TA 3NL3A 4AXNA 4UFLA 4LV9A 3R12A 2G4FA 1VH7A 1PYMA 1VPQA 3IGHX 2FHFA 1SVDA 4PMYA 3W73A 3BVJA 3TC6A 3W2UA 3K5XA 3TA9A 4AH7A 3BJFA 2YCEA 3SCUA 2C71A 2HQMA 2W92A 4HNLA 3TWBA 2OZ3A 2ZZBA 4P5UA 5HATA 4IT1A 4EXAA 2BP1A 1IQ8A 3GHTA 1MSSA 4L4OA 3WQ8A 3N2BA 1NH6A 3ZSSA 4G6CA 5LNVA 4W93A 1ECEA 2HE5A 4UOQA 4H7ZA 1XLHA 2HWGA 1S2CA 2A3HA 5FJRA 3CYVA 4IFKA 4PSPA 3GBEA 3W1PA 3LI0A 3A7UA 3D0CA 2Z4GA 3DHUA 4HMNA 3QW3A 1XCFA 4B92A 3A21A 3AJXA 3OW1A 3N73A 1XYLA 4JTGA 1NDAA 3A3WA 4KWUA 2O9TA 3GW0A 4WQ6A 2PDCA 3R58A 4Q22A 2ZUTA 3P0XA 4RJEA 4LUSB 2HTMA 2PWEA 2VWTA 3H2OA 5G2HA 2AGKA 3BW3A 3CASA 4H4UA 3OZPA 4NNBA 4OECA 1JCXA 3QFWA 3TKFA 1ITUA 1TMHA 4Y8FA 5E70A 1RJQA 1MEIA 3FFSA 5AHFA 4CVWA 4AYSA 1OX6A 2VGGA 1OHLA 1PTGA 4AVFA 3MKVA 3NQEA 4KEVA 4ZOAA 4GO9A 4MWAD 4JFVA 5A94A 3TAKA 4UMBA 2Z1SA 3KCLA 4J28A 1CLVA 5FF2A 4OWGA 4NYUA 1GXFA 1A47A 4NAEA 3G1AA 3MMDA 4OKDA 3KRUA 3T2PA 4B9YA 5TR3A 3V5OA 1O60A 4RDWA 2OO6A 3AIWA 5K9XA 5I03A 3KRZA 3EANA 1QW8A 4PZVA 2QULA 3GIPA 1ISWA 3WDHA 3QV6A 4LQ1A 4URIA 3I4KA 3PPGA 4AZCA 3BCFA 4ZQMA 2BSLA 3BAXA 1V3KA 1G7VA 3ZZ1A 1D9EA 3WDIA 3DDMA 3NZRA 4KETA 4FSAA 1KKOA 4PTWA 4E4UA 4QGCA 1VFHA 4LVDA 1UROA 1GVIA 3N17A 3K1DA 1UG6A 4DJFA 2EKCA 5D05A 1H50A 2QJHA 2H3DA 2YB1A 3AHXA 4HTBA 4DXVA 5I3DA 2DDXA 4LS1A 5E9XA 3HG3A 1U22A 3QFEA 4LVAA 1VFLA 4RPPA 4AYGA 4AWTA 3I6RA 3M0JA 3BLLA 1A3WA 1W5PA 2VFGA 3NQMA 2VD9A 3M1ZA 3LHUA 1AJ2A 5HWNA 4Q7IA 3NVZB 3FSTA 3BLPX 4LEQA 1HJQA 1MXGA 3PJWA 3QPYA 1TWWA 4QAWA 5HNRA 2WANA 3C8NA 4YVXA 4UMCA 1OCNA 1FWRA 4TMBA 4ICMA 1XYBA 1FWGC 1N7KA 2C6QA 4HZ6A 4HHLA 2OSWA 5HR6A 3R6IA 2FHBA 3WZ0E 4CGTA 3LHWA 1QFEA 2VDIA 3B8SA 3V36A 1V3IA 4M82A 3AU6A 2QCMA 2E3TA 4IP7A 5MKGB 3MZ2A 7ENLA 3QXBA 1LWIA 4GYJA 1TMQA 5FACA 4ACYA 2EXOA 1H6VA 1U33A 2PPGA 1KBIA 5CSYA 4O0KA 4WKAA 1E4NA 1UKOA 2VT0A 3GC2A 3NL2A 2EPNA 4EPDC 1Z6KA 3ANVA 3B40A 3L5MA 1RLDA 2CXGA 1LOLA 1MO9A 3PB2A 5H8UA 1HGYA 1NWRA 2VTFA 3L9CA 5HUOA 4JYDA 1ZFJA 3KRSA 3HOJA 4D6HA 4YCOA 1J01A 2FFIA 1H5VA 3VINA 3RDKA 3ARWA 5AC7A 3UWQA 3LERA 1J93A 1G4SA 4UTTA 3WMBA 4Q7NA 3EA2A 3GRTA 2QGHA 3GU2A 3WLRA 5CC7A 1EC9A 1MFVA 1TIWA 2J13A 1US3A 1RHCA 3W7MA 3UG3A 4GJJA 3RPMA 3BG5A 3W7QA 3DK9A 5C2CA 1N55A 4GXPA 4HZ8A 3L5LA 4JXCA 4N4PA 1EBDA 4ZB0A 3W6LA 5HMEA 3NDOA 1SZNA 2Z2AA 1FWEC 3DZ1A 3UFYA 3HQNA 2UWFA 2R9RA 1H7XA 1BFNA 3W02A 3N2CA 2Y85A 5JCIA 4YTSA 5C6MA 4H8HA 4MZYA 3LV5A 1OX5A 1GOOA 1XYFA 3R8GA 1D8WA 2VDHA 2E6DA 3E74A 3NURA 3ITTA 3ATYA 1KFJA 1U5VA 3GH4A 3BLDA 2RABA 2ZA3A 4U10A 4CKQA 4MJZA 3SZ8A 3HPXA 2OZ0A 1WDQA 2JIEA 3W26A 2GGIA 2W3ZA 3MHFA 3WDJA 4HD5A 2ZXDA 3P82A 5LA2A 1MZHA 3N2XA 1XV8A 3UJSA 3GVVA 3BAKA 4LW7A 4Z42C 2I5IA 3VOJA 1F8IA 4F9DA 3FA3A 2GQ3A 1JCNA 2PDLA 1CI1A 1WX0A 2QVNA 3S2JA 5ER0A 2VFEA 1B3XA 1JF5A 3UD6A 1HKWA 4ADUA 2EQ6A 2QS8A 1OFOA 1BVNP 4RDYA 1UJPA 1TTJA 1PE1A 4KH2A 3CGEA 5DMLA 4EM4A 1CXFA 1P4CA 1VBRA 3OTRA 3CHDA 2OQHA 1FP9A 4BF5A 1QI2A 1QJWA 2DY3A 4XD6A 2Y88A 2OQYA 4KFNA 4N6FA 3HF3A 1TPH1 4AD0A 5FI8A 3ITYA 4TMCA 5A5WA 1XIEA 1OYBA 1XH2A 1NWTA 1BVZA 5CKSA 1WDDA 3VIJA 2WV8A 3FCPA 2J7HA 2PBOA 5LIXX 3W7DA 1LUCA 4WR3A 4DJEC 4H4TA 3NQGA 3W7LA 1Q6CA 1BWKA 1YEYA 1UH2A 1YQZA 4FOJA 2FH6A 4QNWA 2HS8A 7TAAA 2QJIA 1K7FA 3MO4A 4C1KA 1BG4A 1UUQA 1VHNA 1E51A 2IPGA 3SW6A 4EVZA 2C79A 4AWEA 3G1FA 4LUTB 3WENA 2PWVA 1ZENA 1U2YA 1XSJA 3CGBA 3E6EA 2G4JA 2GQ8A 4ALDA 2QAFA 2FB3A 4L6OA 4HCLA 3RGTA 2C3DA 1UR8A 3DFNA 4GKLA 3W7GA 3FJNA 1O1ZA 1REQB 4QITA 4XKMA 4GO8A 4L9YA 2J62A 3GO2A 2X7VA 4UB9A 4A3RA 2ZC8A 4JHMA 1Z44A 3CUJA 1DEDA 3JZEA 1SJBA 4RKAA 4M80A 3A7RA 4OT7A 4OOUA 2O92A 2JKPA 1Q8AA 2HMCA 1K7EA 3WFZA 4JQ3A 2YL8A 1Q7ZA 3G5EA 3W7CA 2GJRA 3MBDA 4I9MA 4ONVA 1XI3A 4FOKA 1GYMA 3HPFA 4EM3A 4JGDA 5BU6A 2VQUA 4FNSA 3OYZA 4NX5A 4WK9A 2PE4A 4L9ZA 4HBKA 3G1YA 1H7PA 1NHPA 1SB3B 5TQLA 3HGSA 3TLLA 3LXAA 1F07A 1AQHA 1E3XA 2VVNA 1RSCA 4H01A 4U5IA 4MB4A 4E4PA 3HG2A 2VDGA 3TQ0A 2BY1A 2W3SA 4PR4A 2ICSA 4DWSC 3AXHA 4MB3A 3ZLGA 3OGSA 3KZPA 4JIEA 3CL7A 2A3CA 2OT1A 4LYPA 3OA3A 3T2OA 4E4FA 4UFKA 2A85A 4W88A 2OZTA 2V2DA 5FF4A 3P3BA 3OJGA 1DORA 1F8WA 4N9DA 3CJPA 2RDXA 2H9AB 2VP8A 3BG9A 4M81A 4K8HA 5BROA 4EX4A 1CGXA 3KLKA 4ZA0A 1BF6A 5HJYA 1LORA 3O07A 4PRWA 1R38A 3G3MA 5J8LA 4RR4A 1ODUA 4RZ5A 2QCLA 4ICCX 1R5YA 1UD6A 2NWRA 4R33A 4LXFA 4D6FA 4NT0A 3DU0A 4JTKA 4UTUA 3TXZA 1JD7A 3KLJA 3HM7A 3TYZA 3WNOA 3VIGA 3EB4A 1DIDA 1TWIA 4CNTA 3LSCA 3VU2A 2XISA 3W1MA 1DQUA 2DUAA 4I7VA 3WLKX 2QJNA 4O13A 3WO8A 1E4MM 3R10A 4WXZA 2Z1XA 3C2YA 3WL1A 4Y8EA 1LL4A 3BG3A 1IXOA 3DI0A 3G8RA 5A8PA 2H3BA 1XIFA 1ZTVA 1S2WA 2J6VA 4DBSA 4S3JA 1OFBA 4MJ2A 3R4IA 3GLCA 4YHGA 3FDGA 2ZRWA 1XC4A 4A05A 5CC3A 3S2CA 3M47A 2P3EA 4IH3A 3QTGA 5SWUA 3VUPA 3II1A 4S3EA 4FOUA 1L0PA 5DBUA 2X1IA 4GISA 2Y2WA 4AAJA 3L0GA 1EJVC 3F2DA 4TTGA 3TN3A 2FHCA 2GWGA 4HU8A 4CUCA 1A5KC 3UXIA 3NVYB 1W54A 1PB0A 3HN3A 1BWCA 1BQCA 4HK7A 2PFHA 4PULA 4O1DA 3H12A 4QCEA 1JAEA 1LLWA 3TYCA 3KOXA 4B3KA 3HU7A 1IGWA 2BOEX 4B3LA 2V5CA 3LN3A 1E6QM 1L2UA 3M44A 3NZ1A 4YXGA 2V63A 4HSHA 4K7VA 5C71A 4RUBA 5A8QA 2ZCGA 5F4SA 3G3DA 4AZ7A 4O17A 2QCGA 1R3VA 1FH9A 1BD0A 2DT3A 4QX4A 1MNSA 4GZEA 4QJ4B 4WOZA 2OEMA 3S47A 3QR3A 1GG0A 1OX4A 2JIWA 1S1PA 3BJSA 1IZCA 1VQTA 1UKQA 3EA1A 1HFBA 3I6EA 3TONA 4MJMA 1R9YA 1W1B1 2GK1A 4FX7A 2GR0A 2WJEA 2YB4A 1JR1A 4I7WA 4AEFA 1E40A 2WMJA 4ZR8A 3F7JA 1VP5A 5CEWA 3VD9A 5HQEA 2CU0A 3I10A 4G1KA 3NO5A 4TR9A 2Y24A 3WUGA 1YPIA 4Q33A 4UXDA 4Z2GA 3VNZA 4ORIA 4HSNA 2ZX6A 2C1HA 3SRDA 4XKYA 3RK8A 4GNVA 4IGHA 4QFUA 4RDZA 3I68A 1UZHA 3CV1A 8A3HA 3L66A 2V6AA 5HR7A 4ZE4A 4IMGA 1QWKA 1KN0A 3KCOA 3QY6A 3CAKA 4QDWA 5HWJA 4MKVA 4XBKA 2CLEA 2DVUA 2OYMA 2Y63A 2ZUVA 2ZVRA 1JUEA 3AS2A 4Q8WA 3G22A 1J0IA 3M0IA 3OPSA 3O0HA 2H8XA 3MCOA 2J27A 1QW7A 3MUZ1 2ESCA 3I3EA 1E72M 4PMOA 1HG3A 3SEPA 3GR4A 2XN1A 4GCAA 1D3GA 3OBKA 4Q4QA 1QPOA 1TRDA 3G1SA 3C3NA 4OUIA 2WSRA 3B0VC 2I9UA 2HBXA 1DJXA 1I0DA 2W66A 4QS6A 3GDMA 2XVKA 1ALDA 2D3LA 1FFRA 2RUSA 1XBVA 3FDKA 2E28A 3GH7A 2PAJA 3HG4A 1W5NA 3EX6A 4GUGA 5LNRA 1TQXA 3TTEA 7REQB 1P0NA 1KRAC 1F4AA 2YW3A 1N8WA 3W7RA 4R7JA 3TAOA 3AZRA 3SCWA 2O56A 4KESA 3DFHA 4MY9A 4P61A 1QDSA 4JN7A 1TREA 4GUFA 4I8DA 2WVTA 5AECA 4M24A 3FYOA 4BWLC 1LBMA 3LQGA 3PK7A 3W7JA 3IIOA 4PUKA 3RCYA 1XHCA 3MDUA 4UR7A 3URAA 2WJFA 1LQ0A 2R1LA 3GHRA 3UERA 1Q6DA 3WEOA 3NTYA 2UBPC 1GEHA 1HQTA 4NIRA 4PCPA 1TV2A 4UIOA 1B4EA 1XLIA 2JFEX 4JOMA 3FAXA 4M19A 1XP3A 3DGZA 3LRKA 3QR0A 3LHZA 4HQVA 2RDTA 3OGRA 4YYFA 1V08A 3PS7A 1TYPA 4M6QA 2VNCA 2VEFA 5F1UA 3TYBA 3W3OA 2PDMA 1K8CA 1UUOA 2QIWA 5C55A 1D7KA 1I9CB 1ZCCA 4Q6JA 3ZT7A 3G1RA 3CZGA 3WFAA 5JVLA 2ABAA 2I17A 1OK4A 2FTYA 2REQA 2D2GA 4US6A 1A49A 2QCNA 2A6NA 1PTDA 4IQJA 3GHSA 2Z27A 1V3LA 2E5CA 4L56A 1IXPA 1A3XA 1W8GA 2J47A 5I06A 1F4HA 3EWDA 4RNHA 3EMQA 2FZBA 1K7XA 3DK4A 3PZMA 3T6CA 1M6IA 3BZJA 5DXYA 3GTFA 3W37A 4XBSA 4XSMA 1OM0A 3PBVA 3S5SA 3SR7A 1KTNA 1MXSA 2OLSA 3S1GA 1GOMA 1SMAA 1XX1A 3VCCA 3LOTA 3QOKA 4GBDA 3VIFA 2WHMA 1XQLA 5D8WA 3VTRA 4ZQPA 4S39A 4HOZA 2XPKA 4RNFA 4PMUA 5DX7A 4M7SA 3TXVA 1NIUA 4W9TA 4NJJA 5CSSA 3NQAA 3VKCA 2OWXA 2TSYA 1KR0A 4BEQA 1C3FA 3N04A 3WLLA 4GQGA 2Z1BA 3ARYA 4FXRA 1FHUA 2OKTA 2HISA 1WZMA 4GIRA 3M0YA 1GQKA 4FP1A 4KRZA 3UZZA 4I9TA 4GLEA 3URQA 1W9PA 2YLAA 3AU2A 4QR6A 2E6AA 3NZGA 4MKSA 3F2CA 2ZX8A 3NPWA 3M43A 4L80A 2VYOA 2ZX5A 2TYSA 1W1ZA 4DJDA 1XYCA 5LXXA 4E2OA 2Z7KA 3DFOA 3GAYA 4FMVA 4ATLA 3MP3A 3SQLA 5LGZA 3EWUA 2J7EA 2GWNA 3BTNA 5AVNA 1SGJA 1QNOA 3G1DA 1E0UA 4WJEA 2XH0A 1N63C 1O5RA 1B3OA 3RNDA 3TW6A 1S39A 5CJNA 5FJUA 4UQCA 4XBJA 2X8RA 3U7BA 3NO1A 1XGDA 4M3PA 3EWZA 1JYWA 1E6PA 1XDMA 3VNLA 4DO6A 3EWWA 1FWWA 3FK4A 2NVAA 1T99A 4RE2A 3UR2A 2CHOA 2FB2A 3LQLA 1MDLA 2OSXA 1P5BA 3ANUA 3UGVA 2ZXQA 5G1MA 2BMBA 3T55A