4HYYA

Filament of octameric rings of dmc1 recombinase from homo sapiens
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
255
structure length
241
Chain Sequence
GFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a filament of stacked octamers of human DMC1 recombinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
total genus 80
structure length 241
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hyyA00
1Z6GA 5K8UA 1MRSA 4DEXA 3PUZA 1HE1C 4ASUD 4Q7KA 1KZ7B 2D06A 2Q3HA 1X1SA 1EGAA 3EPHA 4Q1FA 2PZFA 1F2UA 4CT4B 2KI5A 5KSOA 4CRWB 2E9SA 1OKKA 5LD2C 2O8DB 3GJ7A 3MCAA 1GFIA 3EG5A 3SU8A 5BW8A 4E07A 1VCNA 2QA5A 4JLMA 4KFUA 3EWSA 1X3SA 3LX5A 4NYMQ 2W6JD 1HH4A 1GSIA 1NN0A 4BLRA 5BWMA 5J4VA 4NL4H 2LCFA 2FN4A 2GTPA 1E2NA 1L2TA 5KTYA 4MYTA 1H65A 3KFVA 2AWOA 2ZR0A 1E9EA 3PQCA 3EZ7A 4LHYA 1OYYA 2D74A 2KBFA 4B76A 1YJ5A 1U8AA 2KE5A 1G3QA 3VR5A 3W8NA 5DNYB 1OH8A 1G5TA 1HT1E 3QEJA 5HE9A 2IXEA 2GXUA 1OXSC 1OIXA 1RRGA 3ZGXA 1KTVA 1NLYA 2Z4RA 1TL7C 3MJHA 4OHVA 3RS5A 4GNKA 2XOKD 1UEIA 5CIWA 3QKSA 4B74A 3WYAA 5HKKA 3DZ8A 4IFEA 3CR7A 1G16A 1KI2A 4Q7MB 1ZM9A 4HLUA 4BFWA 4GDFA 2J7KA 2RGDA 4AWXA 4Q19A 4KFSA 1G3IA 1QVRA 1VDZA 4JJZA 3HYRA 3AQ4A 3ZDQA 3QBTA 4B2LA 5HZHA 1BMFA 4DSOA 2YVUA 1JEDA 1Z2AA 3MAAC 1E9SA 1E1RA 4JLOA 4AKIA 1COWD 1KOFA 4NPHA 4WXPA 1BYUA 2D7CA 2W00A 1IY2A 1VG8A 2YWFA 4A0HA 2GEUA 2GETA 4QJ5A 1W4RA 1XTQA 3ZVNA 4I99A 4EUNA 3K70B 1P5ZB 3RWOA 3GJ3A 2VF8A 3SE0A 4OL0A 4DDUA 1GM5A 4WIAA 1NY6A 4BRUA 1NJFA 2H5EA 3VU9A 1PVOA 1FNMA 1G19A 2ERXA 4LBZA 2DR3A 1E2KA 1FOEB 1XNJA 1OH5A 5JECA 3TVDA 1O3YA 2IYWA 2WVJA 5IDVA 4TLAA 1DAFA 1DPFA 1XRJA 1E32A 3I92A 4QJ3A 4M4SA 2XX3A 2ZVQX 1FQKA 4B6FA 2XXAB 1SVLA 4ASUA 2MMGA 2QMOA 1NVUQ 5EE0A 4QJ4A 2G88A 1XP8A 1DTSA 1S1MA 2ODEA 2QAJA 1KNXA 3DMNA 3VX3A 5L3VA 3TQFA 5HKKD 1UFQA 2C98A 3FHCB 4Q4HA 4PC1A 2IYYA 4QOSA 1QG2A 2PMKA 4H1VA 4EQ6A 4D26A 4Q4AB 4QG7A 3OIWA 2VRWA 1Z83A 4LYJA 5E3HA 1A2KC 2J41A 1S1CA 1T6NA 3CF2A 1AKYA 3R9IA 3F3YA 1SHZA 2W2TA 2ERYA 1G8GA 2XTMA 1N6KA 4TL7A 3DMDA 2B6HA 2H7VA 1R0YA 3CR8A 3QF7A 3KDSE 1WCV1 1AGRA 2KBEA 2RGNA 1U98A 1G20E 3T06B 4PPQA 1CR2A 2WJYA 4GBMA 1E1QA 4HI0E 4RFSA 5TY0A 2JJ2A 3A8TA 4KJZA 4Q47A 2A2ZA 2YV5A 3ZS9A 1E2QA 5B64A 4ZI2A 2O0HA 4KI0A 4H1UA 4X8MA 1E2FA 3N5CA 4QNRA 4KFRA 2CK3D 1FP6A 1R2QA 1J90A 2ZJ5A 4CDGA 3PVSA 1IAQA 4ITRC 1KMHA 1YZQA 4QHYA 2IXGA 2Q9BA 5JMTA 2GVZC 4HZUA 4QGFA 4M9ZA 5DN6D 3GLGA 1II8A 3FKQA 1FUUA 2VP4A 3EC2A 2A78A 1C9KA 2GVDC 2QNRA 3BOSA 1CU1A 2XOKA 5L3QA 3ASZA 3AP3A 2VP9A 1MO4A 3BXZA 4UNRA 3K0SA 1NSTA 3IIKA 3GJ5A 4BEBA 4Z54A 1DOAA 2W0MA 3T15A 4NE2A 1AQUA 1AS3A 1KI7A 2JIZA 1E9RA 4B2PA 3U61B 3LA6A 1J7KA 3E2IA 4LZZA 2EQBA 2PZEA 5F9HA 4XWOA 3J81k 2HCBA 4F91B 2WAYA 1CJVC 2DFLA 3K53A 2ZYWX 1F6BA 2FFHA 2LKDA 3CF6R 4MRPA 5FL7D 3WMGA 5A5GA 3D3QA 5F2EA 1N5LA 1P2UA 4OK3A 821PA 2C9CA 2ZSDA 4DCSA 1W46A 4TYYA 4TSFA 2JEOA 2QGZA 3FMIA 3VNVA 2QENA 4KU4A 2WSMA 1YR7A 1Q12A 3QBVA 3SBEA 3ZZTA 2CCJA 1W49A 2GCPA 2WKQA 3C8UA 4RJLA 1RE0A 2PT5A 2BEJA 2X1VA 3K0FA 4JLDA 4C2TA 3QXSA 3WRYC 3UMFA 3O8CA 2GCOA 2Q9CA 3R9WA 4E5UA 4XSHA 2GHIA 1N6HA 2B7BA 2P6NA 4TN1A 3QF4A 1QG4A 1PZNA 4IVPA 3B1XA 1KIMA 1T0HB 1E0AA 4X8OA 5EE1A 4ZDWA 1QHNA 1A4RA 4URZR 3NDBB 3DL0A 1ZINA 2FZ4A 2WOJA 2P6UA 1W36C 2I3BA 1LF5A 4DVGA 1ZYUA 5DISB 1IHUA 1NN1A 1OFIA 1NI3A 3Q72A 1G17A 4D4LA 4K81B 5BYKA 3B1YA 3TW8B 2B8WA 1F2TB 2W0SA 4NCKA 1G1MA 3B9PA 5KYKA 2IUTA 2CMKA 3O8RA 3EW9A 3NBFA 2JASA 5BQ5A 1NVXQ 4DRZA 1GKUB 3FHOA 4MRSA 4LRWA 3ICQB 1G64A 4HATA 5H1YA 4Q66C 3BFKA 1W7AA 4L9WA 2B21A 1DAMA 2ZAMA 4JLVA 2J7PA 3RS2A 3ZD6A 2XZPA 3HU1A 3NWJA 1ETUA 1OFTA 4LHZA 2XSZA 3A4NA 3K9LA 4U5XA 3TVTA 1N5IA 1D8TA 1U0JA 3TJZA 3GFPA 3Q9LA 3U2QA 2C96A 1E0JA 4XD7A 3VR6A 1N3BA 1X8LA 2OBMA 3AKDA 2GZHA 4HLDA 3KZ1E 4Q9JA 1TQDA 4TYPA 4AYWA 2HDNB 2QMHA 4PHFA 2G9NA 2AN9A 2GRJA 1ZMXA 1N0VC 2BMJA 1E98A 1R0WA 4TL9A 1EFRD 2V6IA 1Z8FA 4OI1A 3E70C 2ZYTX 3QKUA 3AVTA 3B2EA 2Z6VA 2IW3A 1XTKA 1GNRA 5AWFC 3U3JA 2BM1A 1N6IA 2GAAA 3IEUA 2CL6X 3R8CA 3FPAA 4A92A 2OE2A 5FOSA 4EQ6B 3PEWA 1NKTA 5DLQC 2CNWD 3RYTC 1IN5A 2I1QA 3P26A 4PHHA 3PR1A 3GLIA 4DCVA 4IDNA 2EWVA 3O8BA 4KFTA 4QHSA 5KNDA 1TEVA 5GVSA 2J45A 4BFTA 2CXXA 4I1SA 1NIJA 2QAGC 3B7GA 1KI6B 3VX4A 4UNSA 2P0EA 2X19A 1SGWA 3CRW1 2O8FB 4HDOB 2BOVA 3AV0B 4LJ8A 4LYAA 1D5CA 1VECA 2GF0A 1IJEA 3EXAA 2OAP1 4D0LB 4BLPA 3U7HB 3FYHA 3SN6A 1F2UB 2ANBA 4DUGA 3K0CA 2O8EA 3T1VA 1CR0A 221PA 2W6JA 1I2MA 3TUIC 2WPDA 4KO8A 3MWYW 3LXRA 1KJWA 3OEEA 1T8UA 3A37A 4ON9A 1U99A 2O8CB 3PEUA 1BKDR 1ZCBA 3K09C 1KK1A 2Z83A 3A1TA 1UKZA 2P3SA 2XNDD 1IY0A 2WTUA 1SQ5A 3DO6A 4ARZA 1NN5A 5JCPA 2PLFA 1MRNA 1SVWA 2NO7A 2XAUA 2ZI5A 1A1VA 4M9XA 1ZIPA 3REFA 3VHLB 2HT6A 1QHGA 3QI2A 1PLJA 1DO0A 2QP3A 4P4SA 2VH5R 1ANKA 1FTSA 4EDHA 1RIFA 1Q44A 4PR0A 4QM6A 4DIDA 1I2DA 3QPVA 2FGJA 3JVUA 4Q1EA 3UATA 4TYWA 1JJ7A 2YOGA 5BYJA 1SVIA 4C0KA 2ODWA 3ZIAA 2GNOA 3LX8A 1YR9A 1YZLA 1W4CA 4PAMA 4TMVA 1US8B 1GNQA 3CH5A 3I4LA 1OYWA 3OFND 4HAYA 1Z0IA 4Z1MA 1E2GA 2XTZA 1E2DA 1HT2E 2DWQA 4M22A 2IYTA 1JXOA 3AB3A 3KKNA 4IJMA 2E1RA 5FH9A 1YRBA 4RKFA 2WMNB 3CRVA 3MG9A 4FIDA 4HZIA 2JJ1A 4NCIA 4TLCA 5BN5A 4DB2A 4IOJA 3SYKA 3GJ4A 3AVUA 3KJHA 3UXMA 4KSCA 2QRZA 2HJGA 3FKSA 1CTQA 2HEIA 3SQWA 5B2ZA 1W36D 4KLNA 3KUCA 3U6BA 5SZJA 4BLTA 3F0TA 3GJ8A 3W3ZB 2IS2A 1CJUC 2ZRGA 2ZE5A 5FOTA 3KKOA 4LHXA 1JNYA 4ZDKA 3RVBA 3SC3A 3OF5A 1KK3A 2EU8A 3ZYCA 1P6XA 4Y0AA 4EPXA 3QNUA 5EP3A 621PA 4BGDA 3B78A 1OXXK 1YKSA 1Z3IX 2B7CA 3M1IA 3IPYA 2FWRA 1CXZA 2VHJA 5FTLA 1BOFA 2BIFA 4DLZA 1M2OB 4KCGA 4B34A 4ZIRB 3TGPA 3QG1A 1LTQA 4AURA 1KZGB 3EPLA 5HCNA 5E7IA 3WHLA 1UKVY 4HUQA 5CK5A 3IEVA 3UG7A 4CVNA 2WZQA 3ZIAD 5G40A 1VTKA 3SYNA 1G3UA 1J2JA 4ACAA 2AX4A 1T8TA 4G5OA 1A82A 4O0MA 1XJCA 2ZQ5A 2V3CC 3U6KA 1J8YF 1KO8A 3PCRB 3VQTA 1YZTA 4OHWA 2JLXA 1DAGA 2ZM5A 3L8ZA 1RJ9A 3ZH9B 4NYJR 1GVNB 2D7DA 4JYBA 4C0LA 3ZQJA 2P6RA 4DT1B 1CJKC 2ZJOA 2XB2A 4OKSA 1WP9A 2V8OA 3ADDA 2J59A 3MFYA 3AKCA 1LY1A 2KB0A 3B85A 4BZPA 1M34E 1G8FA 1JQJC 2YKGA 4DLUA 2EW1A 2NPFA 1TAGA 1XZQA 2EYQA 2FPLA 2VHUA 4Q03A 3SQXA 1G7CA 3NH9A 2FSIA 1D9ZA 3C5CA 2WSSD 3V9PA 2ZRLA 3VKGA 2JIZD 5FI0B 4A4DA 1R5OA 3U60B 3MSXA 4P4TA 4P32A 2FEMA 1ZM4A 1QVAA 1KSHA 2CJWB 1XXHA 1C4OA 4XVUA 2R6FA 3OE7A 1L4YA 1YVDA 2OAQ1 3OIYA 4ILEA 2GWHA 5ANRB 1E4YA 4D4MA 1E2MA 2OCYC 1GL7A 5F9FA 1KY2A 3RAPR 4CEHA 1JALA 1CIPA 3C41J 1N0WA 3R7WA 1GG2A 121PA 4AKEA 4DDTA 2BDTA 5AUPB 1V43A 1SULA 3TK1A 2ZS7A 3LW7A 2EVWX 1OLOA 1NY5A 3CNLA 3FKSD 4U02A 5H68A 3I3SR 3Q7QA 3BERA 4V0MA 4HB4A 3U7FB 1K6MA 3LW8A 4IDQA 4MRRA 1CR4A 2HV8A 5LB2A 3KJIA 2JJ1D 4ZKDA 2GJ8A 1DADA 4BFYA 1Z28A 3HDTA 3QKSB 1EWQA 4NYIR 4TSFD 4DDWA 1RRCA 4PZLA 4PC2A 4PO9A 4GT1A 2REBA 2N46A 1L4UA 4HLUC 4UXHA 2PT7A 1AKEA 3AVPA 4C9BA 5JJLA 5KU1A 4RD1A 2P2LA 3IO3A 3UG6A 1E2HA 2ZTSA 1ESMA 1TU3A 3DVLA 1MR3F 1CJTC 4OQMA 1IQPA 3ZS8A 4NP6A 4NZYA 5HCIA 2WHXA 3U4QA 2HF9A 3UMRA 4JT2A 4F93B 1HQYE 1L8QA 2YINC 2ZI9A 1GKIA 3Q3JB 1DG1G 4TLDA 2AK2A 2VHQA 3SFZA 2G77B 4H9GA 3THXB 1NLFA 2IYVA 2RAPA 4NMMA 2BBOA 4MKIA 4G0NA 1UDWA 3PG5A 5LB4A 3BBPA 4XD7D 2GEDA 2AKAB 2JAQA 3ZLJA 5JRZA 2VIIA 2X2FA 2F1JA 2JATA 2QL6A 4PC3A 4YXWD 1J8MF 2OUKA 4NDZA 1R6BX 2IF0A 5JFGA 1P75A 1TEXA 4A0GA 3FMOB 3AVOA 5KHOC 3W5JA 4XOIA 2XTNA 1TU4A 5FR1A 4LV6A 2ZSFA 3QEOA 2GK7A 4FN5A 4LHWA 4MUBA 3X1WA 4OI0A 4LV8B 3QVVA 1CRPA 1KK2A 5JJKA 1E9FA 1KJZA 3CX8A 1RRPA 3FOZA 2YWHA 1R0ZA 2J3EA 4B6EA 1CBUA 1EFHA 1M7BA 2ATVA 3Q5EA 4PQFA 2OHFA 4EJSB 1K5DA 4V0LA 2BC9A 3U7EB 2ZR7A 1KO5A 1XX6A 1EX7A 4Q1BA 1QBKC 4TMZA 1YR6A 1WBDA 3ZQ6A 5DYIA 5GADl 4ESVA 1G7TA 4NTZA 5FR2A 2PJZA 3AVQA 3VR2A 2A7QA 3IHLA 2CNWA 3FWYA 4V02A 5JLJA 4HB0A 3K70D 3A4LA 1Y3AA 1R4AA 2J0QA 2ZU6A 3VTKA 2AKYA 2GJ9A 2KWIA 3EAQA 5FBVB 1Z6TA 3MJRA 2WOOA 1SVOA 3DPUA 3WP1B 4MDEA 5AJWA 4ZPXA 3B9QA 2DFKB 4NBSA 1RVDA 5TVKA 3DOEA 4FD2A 2XNSA 3GEEA 3TKLA 5IK2D 2YC4C 5KDDA 2F9LA 1MABB 1ESNA 4YMSA 1KO7A 4LC1A 1SKQA 3TH5A 2ZS8A 4RD0A 3AF2A 2H16A 3HU2A 3THWB 3SJAA 2V7QA 4PPNA 2B92A 2NO1A 3AF4A 4DUGD 5JSZB 1UBGA 1JR3E 1P73A 3AUXA 4IVRA 2Q3FA 4A8JA 1GTVA 1F3OA 1LFDB 3LBNA 3UWKA 4RZ2A 3KL4A 4QM7A 2AXPA 3O8DA 3TIFA 5B58C 3WXMA 3N2IA 4M1MA 3W5IA 4PO1A 3QXHA 2W6IA 1JXMA 1W0KD 2GA8A 2IEYA 1IN7A 4LDJA 1AJEA 1HYQA 1D2MA 4IOMA 3EPJA 4FI3C 1WXQA 1VHTA 1XTSA 4RKEA 5AJXA 1QHXA 2NTYC 4W5JA 1G7SA 2IYQA 2VP6A 1PV4A 2ZJZA 3IDQA 1T5IA 2ZSBA 5EXXA 1D6JA 5C4MA 3AVXA 3SFVA 4KYUA 2WWIA 2IXFA 1XTJA 1ZUIA 5J4KA 2WWWA 2EFGA 5J4HA 3X2SA 2CE7A 4FINA 1OE0A 4YLGA 4MKFA 4JL8A 2VTKA 1J70A 3AF3A 5FPKA 1H8HA 2QTFA 1OT3A 2NMVA 1PLLA 5HE8A 4OJQA 3R9XA 1Z08A 2IBMA 4TQ9A 3RS7A 4Q7JB 2C78A 2AXNA 2CCKA 3RDPA 3X1ZA 1NVWQ 1YZNA 4R7ZA 3KQLA 3RSLA 1ELOA 1XMVA 4LJ6A 2D3WA 1YU9A 2WV9A 2C5LA 5E95A 1US8A 4A0RA 5JCZA 3QVUA 2A3RA 2Z0MA 2QQEA 4D4JA 5LBIA 1ZUHA 4M9QA 4PPFA 3OESA 4Q9HA 4NYMR 1DARA 5A4JA 5KNCA 1JR6A 1ZU5A 4M53A 1E9CA 3S1AA 5FUWA 5E4FA 1VYVA 4F4CA 3K0EA 5DE3A 3BB1A 4D25A 1NIPA 3QXXA 5EP4A 1XPOA 5DYGA 3O47A 3KKPA 1UBCA 4LBVA 2FJUA 1P2TA 1P62B 3C5HA 1GUAA 3OEHD 2D2FA 2WAXA 1G4UR 5IK2A 5JZVA 2PX0A 1TNDA 5AJZA 4QGAA 1P60A 2I4IA 2XB4A 4TMTA 4WVFA 3RABA 2CDNA 1MH1A 4KBFA 3CRMA 4IHQA 4JLAA 4DLVA 2VF7A 2QU8A 1X1RA 2AFIE 2YYZA 1Q1QA 2D62A 3B82A 4LYHA 3BAFA 4HAZA 4FWIB 4WAUA 4DXAA 3KUDA 5JS7A 1UADA 1TQ6A 2AR7A 2RB4A 3TR5A 4WZAE 1MOZA 2J5XA 2QUZA 3HYTA 3EC1A 4KVAA 4V0OA 3ND8A 1N6PA 4N3NA 4CEIB 4KITB 3AM1A 3I1FA 4KXFB 1AS0A 3EZFA 3CONA 1W1WA 2WIAA 3Q8XB 4LCBA 4EPWA 1S2MA 3QF4B 4V0KA 1Z2CA 2OFWA 3VAAA 3T1OA 4DZZA 2V6JA 3FB4A 1KI6A 3BB3A 2UVQA 3F8TA 2GILA 3THYB 3TNFA 3BH7A 3C16C 2FEOA 2EFEB 1LVGA 4JLNA 1XCGB 1XD8A 2FV8A 5HPYB 2ZJ8A 3AF1A 3KX2A 5FOWA 3CRRA 2F9MA 3DOFA 1NL3A 1WMSA 2PH1A 2VSXA 3LAWA 3LBHA 4Q9IA 2JLWA 5C2JB 2DB3A 3EWAA 4LPSA 4RD6A 3IUYA 1OB5A 2TMKA 2P5TB 3RLFA 1G3MA 1W47A 1R5NA 1XPUA 4WXRA 4TMXA 4MKHA 2FMXA 4BWYA 2YC2C 4XJXA 2FF7A 2RCNA 4MYCA 1PLKA 2CEAA 4RZXA 3V4FA 1FX0A 3AP1A 3WYGA 1WB9A 5AJVB 3QXCA 2QBYB 4NCJA 1OXUA 2IYUA 4G5SA 4YC7A 1VCOA 4DWJA 4EFMA 1XZPA 1XJQA 1RYHA 3ADKA 2QAGB 4OYHA 4P4SB 1PUJA 4B33A 3HR7A 2ZXUA 3K0AA 1GILA 2F1HA 1W2HA 1XCMA 2CJWA 1K8RA 3K8YA 4EIWA 5H8WA 4PHGA 1K5GA 4GI7A 2HLDA 2JGNA 2ANCA 1KSFX 1W48A 2E87A 4BLOA 2CBZA 4A1FA 1FX0B 3DEFA 1T3HA 1LS1A 4TT3D 4IOLA 4TL6A 3PXGA 3R20A 2QPAA 3EZ9A 4JJKA 2YZ2A 5EXTA 1GAJA 1JBKA 2BMDA 4XIGS 5TARA 1BYIA 2GXSA 2FU5C 4C30A 1E0KA 4F7WA 1TUEA 2OLJA 2P67A 2QMUA 3HPRA 2R9VA 2ZJYA 5JS8A 1Q1ZA 1W36B 4LI0A 4BLQA 2EFHB 1NG1A 1XFAA 1NMZA 4URXR 5IF9A 4B3DA 4UJ3A 1XDBA 1XMJA 2LKCA 5DN6A 2XJ9A 4DSUA 4RFVA 1Y63A 2DFNA 4S2EA 1NN3A 1E96A 1IXRC 3UK6A 4ZCMA 2ZSAA 4YMTA 2C99A 4HLQB 2ORVA 4JKIA 2HF8A 1NMYA 1XEWY 1Z6YA 3D8BA 4B2IA 4FMCF 2ZRHA 3IBYA 4A9AA 3P27A 2XXAA 3PV0A 1RKBA 1T0JB 2ZRCA 2FFAA 2JLRA 2GJAA 2GESA 4Q1AA 2J7PD 1DEKA 1NVVQ 1UDXA 2NO0A 2CLCX 2ATXA 1OFUX 1UEJA 4WA7A 1HURA 1Z0FA 5KSPA 3GP8A 3QOFA 3OZXA 4DLRA 2WMOB 4JBXA 2PCJA 2DBYA 1D2NA 2OZEA 2FFQA 3G5UA 1QHHA 4PQRA 1BH2A 1XU4A 4LV5B 3PIRA 3U3KA 5B57C 1RYFA 3CWQA 1S9DA 1SVSA 4CEHB 3T1TA 1I4LD 3RHFA 1KNQA 4B35A 1E2IA 2MSCB 4GRAA 4RY2A 3TMKA 2FFBA 5KOYA 4PC7A 1E2EA 1ZNXA 3C4JA 1Z63A 1VIAA 2ZUBA 1KSGA 1NSFA 4EJSC 4Q9LA 3K0CC 4US0R 2JLVA 2K5UA 2GCOB 1P2VA 3FHTA 2QZ4A 3TLXA 3MGCA 4TTRA 1N6RA 2DHRA 2VL7A 4QC2A 4C4PA 3CPHA 2VBCA 3EPKA 4WZ6A 4A2QA 1M7HA 2FSFA 2R6CA 1Z47A 2XSZD 1F2TA 3RANA 2C2HA 1GIAA 3P32A 1M7GA 2EWWA 2CLDX 5BXQC 3EA0A 1F48A 3I32A 1R7RA 2QEQA 4UXJA 5K8IA 1Q0UA 2GXQA 4DC9A 2FSHA 3OIVA 4URUR 4DCUA 3UPUA 4W5HA 4WW0A 3ADBA 2IK8A 3QE0A 2D2EA 4MGZR 3CLVA 4HEJA 1W0KA 3M0EA 1COWA 1GRRA 4O2LA 3W9YA 4E22A 4UNNA 3DDCA 4OK6A 5DI3A 1W2GA 4BFXA 5LDDC 2NIPA 1OIVA 2QT0A 4OI4A 4ERNA 1FL9A 1Q1EA 5LD2B 1WQ1R 2ZUCA 4A15A 1Q21A 2QT1A 2VYFA 1VKJA 5CITA 2X2EA 1JAIA 1JR3D 2ZRAA 5EE3A 3GLHB 4C2UA 1CEEA 3WNBA 1CP2A 4RSGA 5J40A 2R2AA 1EFRA 4C7OA 2O8DA 1KDPA 1AS2A 3A36A 2V9PA 1TADA 4XSGA 5GJVC 3P4YA 4A8JC 3AVVA 4BFZA 1YZKA 2A9KA 1I4DD 2F1IA 4R71A 3TUJC 2WWXA 1NBMA 3GJ6A 4TYNA 2C04A 1S3SA 3P4XA 3G0HA 1OHHD 4I1VA 2YWEA 2OFXA 4IRUB 5FBRB 4C0AC 4JVNA 4PTLA 1E9DA 4TZ6A 5EUQB 1U0LA 2XZOA 2V1XA 2ZIAA 1NVVR 4LHVA 4ZCIA 1P9WA 2QPOA 2IS4A 3KXLA 2VLIA 3U4QB 3ECCA 1HTWA 4KVGA 2FA9A 3BJIC 1I4TD 1YE8A 1JQLB 2X8AA 3NEJA 2R8RA 4L16A 4NKRA 2V55B 1Z0DA 4F4JA 2G1KA 2A5GA 2Z5FA 3NHBA 4Q01A 4AYTA 3CO5A 4N1AA 1UAAA 1IBRA 1N6OA 1E9BA 3P1JA 5GJBA 1W4AA 3TAUA 4A6XA 4HB2A 4L8GA 1R5BA 3RS0A 3GLHE 3WYFA 1S4QA 1KK0A 3JZAA 4POAA 4RVCA 1ZW6A 2NO9A 1SVMA 4BECA 2HT1A 3LVRE 4RCZA 521PA 1R8SA 3DM9B 2BCJQ 5AUOB 5KNBA 4PAOA 1QF9A 4R9UC 1TTTA 1VYTA 4NU0A 2BM0A 5EZ5A 4CEJB 1WBBA 2ZRDA 1RRFA 3HR8A 4FMBB 4US1R 3K0FB 3NDPA 3VMFA 1SZPA 3REGA 2RKOA 3NKVA 1KI8A 2ZI3A 3HPQA 3NG1A 3JVVA 3U7GA 1X6VA 4FW9A 3A4MA 5C4GB 4DDVA 3GLGB 1ZD9A 1KSJA 1CLUA 3E5HA 4TZ0A 2L0XA 3TSZA 3ND9A 5FPSA 2O8EB 3GLIB 2OXRA 2RHDA 3CF0A 2QE7A 1GKYA 1ZU4A 2R44A 4GOXA 2CL0X 3AF0A 4XWAA 3D6TB 5F98A 3VNUA 3WY9A 3C14C 3AP2A 1P9RA 4L15A 2IYLD 2QM7A 4I4LA 2GJKA 3NHAA 5EP1A 1RC8A 3NEYA 3DM5A 1IN6A 5EXSA 2IYSA 5IT5A 1N6LA 4Q4JB 3T1QA 2VEDA 2H17A 1U90A 4BASA 2J0UA 1T4GA 3G82C 1KGDA 2RH5A 4AI6A 3PUWA 1TF2A 3RRNA 1IM2A 4M1YA 5JEEA 2OG2A 4FMDB 1NKSA 1VHLA 2H18A 3BE4A 3GLHA 2ZR9A 1HQCA 1OF1A 4MYHA 2W2XA 3VR4A 3LD9A 2PX3A 2R6GA 3D31A 2IUSA 3OAAD 5CJPA 1FZQA 1E2JA 4DLTA 1UBEA 4B3FX 1U81A 4TWZA 3RNLA 1TPZA 4XWKA 3KB1A 2F6RA 4M1OA 1SXJB 2DWOA 1FFHA 3CW2A 2O8CA 1XEFA 4JYCA 3NVAA 5JWHA 3NC0C 1DAEA 1KAOA 1J99A 1IN8A 4AIIA 1OFHA 2J0UB 1ZNWA 4G01B 3BK7A 1CKEA 1G5PA 1YHNA 3GJXC 2ZRPA 1M74A 5P21A 721PA 1AIPA 4M0LA 1Q3HA 4DLXA 4JZKA 5AUNB 1QRAA 2RGAA 3CM0A 2Y8EA 4A82A 2O8FA 4QL3A 2HYIC 1ODFA 3H1TA 4KYIB 2QG6A 3MWLA 3W34A 2WWGA 2VP5A 3KJGA 1DVRA 5GJWC 5C1BA 4W9MC 3GLFA 2ZE6A 2BVNA 3QUSA 1X8KA 3T61A 1CJMA 3SJZA 1W4BA 4CEJA 1XEWX 4JLPA 5J5CA 3K9HA 3QENA 1XB2A 3IILA 4XTCS 3L82B 3KB2A 4UJ5A 3PENA 4WOPA 3T5DA 2IS6A 2SHKA 4GP6A 3IO5A 3C7KA 4BZQA 5SZHB 2QQ0A 4TLBA 1CULC 4MGYR 2WWFA 3I8SA 3IHWA 1MO5A 3H4MA 5JHGB 3QSYA 2XJ4A 1G5RA 2O5VA 4C0JA 4CYMA 1NNEA 1G3RA 1XD9A 4Z8YA 5KDOA 1JI0A 1T91A 1E9AA 3BRWD 2VHCA 4Q4AA 4WZBE 4AYXA 5FUVA 4YMVA 4D6PA 1XBTA 1EFTA 3K9GA 3D7MA 4Q4HB 3IQWA 4LSGA 1LB1B 4W7SA 5CYPA 5L3SB 3SR0A 3C15C 3KQUA 1S96A 4CF7A 1IONA 2C9YA 2YWGA 2GAOA 1NJGA 5E7JA 2W6ID 4YQFA 1NG9A 1XMIA 5KSYA 1KO1A 3TSWA 3EZ2A 4XVQA 4OQNA 3A1VA 3SBDA 2BKEA 3ZVRA 1WDTA 4HLCA 3BGWA 1IY1A 4QBIA 4C0HA 4RD3A 1NP6A 3SI7A 3WBJA 3CPEA 5DSZA 1HA3A 3K9NA 4C0QC 3GD7A 1Z0AA 1QHYA 3QKTA 1ZNZA 4EPTA 4NHOA 2BJWA 4AKHA 1YQTA 4TL8A 4GFDA 2Q6TA 2QTHA 3L8YA 3N2EA 2AWNA 1ZJ6A 1DAHA 3K09A 4MKGA 4BZXA 1M6NA 1SXJD 5FTKA 5FFMA 1IOZA 5TMPA 2RHMA 3RRZA 2FDCA 5M04A 1QHHB 3CRQA 4KHZA 1KHTA 4DCNA 4X8HA 3OFNA 1AK2A 4D81A 2F3TA 5EE5B 5FPYA 5CB8A 3FVQA 4JIMA 1VG1A 3GLFB 2GEVA 3MRSA 1TF7A 3A58B 2IL1A 2F1RA 3CIOA 2IS1A 4OQXA 3WMEA 4CZ2A 4RD2A 3AGQA 4US2R 3KTAA 5K8LA 3OIUA 2C8VA 4IDPA 4PXAA 4P33A 3VHXA 3L0PA 3W3AA 4HZUB 1Q1BA 4D80A 4LYFA 1E79A 2BMFA 4LC0A 5FTNA 4N0EA 4YMWA 1SKYE 3CZQA 3NBZC 1KO4A 3NXSA 3P20A 3CUEF 3CNOA 4YDSA 1TMKA 5CK4A 3IGFA 3AVYA 1YRAA 2MMCA 2D4HA 2ZRKA 2XNDA 5E7MA 5K8TA 4NCHA 1CRQA 2UKDA 3OEHA 4II7A 1LV7A 4KODA 1OIWA 4IXMA 2OM2A 4UKDA 4RZ3A 4KAXA 4OJKA 3IIMA 5FBWB 2QGNA 4C3ZA 1FUKA 2JLZA 1OW3B 2OESA 3ZD7A 4R2HA 4D4KA 4QHTA 2NQ2C 4W5WA 5AJYA 4Q18A 4R98A 5EUMA 1BS1A 1OHHA 5HZKA 3CWZA 1Z6XA 3F5FA 2IYRA 2CVFA 3AGPA 2JDID 1GDDA 1VCMA 3KTAB 1P4SA 1R10A 2ZUDA 2OLKA 4JVMA 5H70A 3L0IB 1LNZA 3Q7PA 4ARZB 3BORA 3THOA 4B3BA 1SHKA 1KKMA 3CX7A 1II0A 3GFTA 1G21E 5FL7A 1SXJE 4IDOA 3GEHA 3EARA 1EFCA 4XH9B 1MKYA 421PA 4EKDA 4ACBA 4RD4A 3SNHA 4AG5A 5JBQA 3B1WA 2ZVPX 2F43B 1P61B 1ZNYA 1RZ3A 1OKKD 5AK0A 5L3QB 1E2PA 1E94E 3T12A 1T9HA 2ZSEA 2NOAA 5J4YA 2QP4A 1AQYA 2HXSA 3FFBA 1JEEA 4Q4LA 1LW7A 2H57A 2IHYA 5J4LA 2J46A 2V54A 1SXJA 4JL6A 5TDHA 5JWRA 1ZRHA 4JBYA 4Q02A 2NZ8A 1ZBDA 1WRBA 4M1WA 3WBKA 4B3XA 1E69A 1XEXA 4O2RA 4OHZA 1ONBA 3ASYA 2MSDB 2RGXA 5DHAA 4GMDA 1G8PA 3HP1A 3VR3A 1U8YA 1QHIA 1Z07A 2ZI7A 3DZDA 1OV4A 1NBMD 2R65A 3WNCA 5EJEA 4RFSB 1SXJC 4Q21A 4OQFA 1CR1A 3NC1C 1QZXA 3HWSA 1U94A 1GITA 4PC6A 5FPTA 1V5WA 3RS3A 4B71A 3V4RA 2OBLA 2VQSA 4ZDIA 2IT1A 3GLGE 3NTUA 3CH4B 1OJLA 4G5GA 3NBYC 3TE6A 3DKPA 4TTQA 1G291 1U2RA 2A5DA 5KSZA 3GLFE 1OXTA 4E09A 3QKRA 2ZITA 3BFVA 4TLEA 4TMWA 3VU9B 5FTJA 3QPUA 2GCNA 2R6DA 2O0KA 1E0SA 1U9IC 2GDJA 5TV2A 4YMUA 5KPJA 2AL7A 3E1SA 4Y0VA 4MH0R 2IWHA 4K8OA 3LXXA 1II8B 3W8RA 1IXZA 2F7SA 2X77A 4DLSA 3WRXC 3BB4A 4PANA 1DBSA 1W0JA 1BO6A 3L0OA 4B3GA 1R8QA 3L0SA 4QGHA 1G4AE 5CLQA 3TR0A 4EPVA 3SHWA 4URWR 3VFDA 3CB4A 4QBGB 4BEJA 5L3RA 3W6PA 5EP2A 1EK0A 4PX9A 2C95A 4JMPA 1IN4A 3UIEA 5CJ2A 4DBLC 1VG0B 4QXAA 1JECA 1BMFD 1ZM3A 1L7VC 4BFSA 5FPHA 4LJ4A 3N70A 4F38A 4CEIA 2JDIA 2QRNA 1P3JA 2LWIA 3T5GA 4GL2A 1BIFA 3CZPA 4L4UA 4F92B 1EWRA 3LVQE 3RS4A 4MGIR 1OSNA 1KYIA 3QJYA 4U7DA 4LJ7A 4BPBA 4C0SA 3QG5A 4P31A 3H86A 3WNDA 3PITA 4ZV4A 2WIBA 2ZJBA 4M2LA 1A2BA 2QROA 4GOKA 3VR1A 4GPTA 2J0SA 2VSOA 2NZJA 3V00A 5FBQB 1TQ4A 2O8BA 1JPJA 3K70C 3W6NA 2WWYA 3RWMB 4Z1MD 4WBSA 4YONB 3LFUA 4GZMA 1QDEA 2CK3A 1G6HA 1G9XA 2P5SA 1T3SA 3FE2A 3KFXA 2Z4SA 4LBWA 2FGKA 2H1LA 2HYDA 4V03A 3WHKA 4E03A 2ZE7A 2QAGA 5CM8B 1WA5A 2EFCB 4Q1CA 5LPNA 1KDOA 1XD2B 1AZSC 2G3YA 1E1QD 2CLSA 4P0TA 5FTMA 1HE8B 2O0JA 3AKYA 4JSTA 1KY3A 1NLZA 1MO3A 4IKEA 5UKDA 5JI2E 4TQAA 3NIBA 3MWJA 3TW4A 2UZIR 5HR5A 3CX6A 1Z29A 1KJYA 3TUZC 3I73A 1Z0JA 3EZ6A 2IUUA 2WJVA 3SHFA 3SJCA 3H2YA 3LRPA 2RGEA 2BMEA 4Q9KA 2FZLA 3GCGA 4KBGA 3QIAA 3ICEA 2G83A 2RGBA 3L2OB 4B3CA 2MSEB 3EIEA 3S1AB 5IRCD 3LQQA 4DB4A 1S8FA 4A8JB 3M6AA 3B1ZA 4LUCA 4HAXA 1D9XA 4KV9A 4TMKA 5JHHB 3SOPA 3EA5A 4HDCA 4F4IA 1UKYA 5DI3B 2A5YB 5FOXA 3ZZ0A 3LLUA 4BUJA 3IQXA 1RPZA 2G0NA 2IHBA 5JWOA 4BRWA 3UMSA 1XXHE 1AN0A 3B1VA 2J9RA 1Q57A 1PJRA 4LJAA 1FTNA 1G8YA 2QI9C 4AG6A 2CL7X 1W0JD 2ZU0C 2ZI4A 2BBSA 2NO6A 1KMQA 4R2IA 2C77A 4K46A 2F55A 1KI4A 2JLUA 5SZIA 3TAHA 1RFLA 3BD9A 5ELXA 4ZI3A 1E3MA 1G18A 4HAVA 4J0QA 1XWIA 2UZ3A 2VP2A 4TYQA 2IWRA 3PFIA 3FDIA 4PSAA 3I61A 1EESA 2QE7D 3FFAA 3H84A 2ECKA 1F5NA 1ZC4A 3NH6A 3RC3A 5BN3A 3BIFA 2V7QD 1G8HA 3THXA 1E6CA 4RZUA 2ZS9A 1OH6A 2BKUA 1IXSB 3B60A 2CCGA 4PFSA 2AK3A 3SZRA 4QBFA 2GJSA 1CS4C 3ZZUA 2ONKA 3TSOA 3LV8A 4HB3A 2PEZA 4Q7LA 2WBLC 3LY5A 2QMEA 3LO5A 5JI3E 2CHVA 3AKEA 3T34A 2P65A 3UWOA 3ZVLA 5BN4A 4LOAA 4Q4JA 4MDFA 3B6EA 2ZETA 1B0UA 4DLYA 4NONA 3LLMA 4D82A 2OFOA 4UQOA 3U44A 2PZGA 4YDHB 1EFUA 2FX3A 5G3ZA 2ZANA 1XTIA 2ZRMA 5JSZA 5CDFE 3OAAA 5KDLA 4A6PA 3I5YA 1GRQA 1F60A 4I1UA 2A5FA 4C7OB 1P7CA 2IYZA 5DO9A 1X86B 4OQLA 4I1OA 2FPKA 2WJJA 1UF9A 3GFOA 1AA9A 1W5SA 2J87A 1DE0A 1TUIA 4JVLA 2Z43A 2J0VA 4M8NE 4ZO4A 1FW6A 2QBYA 3TBKA 1EG7A 1AGPA 3RRMA 2WKPA 4JLBA 1Z06A 2F3RA 1RW4A 2VHTA 4PQYA 2OO7A 5GJCA 4LJYA 4DJTA 4QNMA 2WSSA 3KKMA 4LY6A 1GP2A 2PLRA 3LBIA 4CGZA 4IW3B 4JL5A 1KDTA 1E1RD 1MT0A 4PZZA 3I5XA 1C1YA 4FMDF 3I72A 2WJHA 5C18A 4LJ5A 2BHRA 4DKXA 1HY3A 1CF4A 1YR8A 1OXVA 1FMJA 2VO1A 2GZAA 1H8EA 4GOJA 5J47A 2CHQA 1M8PA 2QORA 4JSYA 3TRFA 2OEPA 4L5BA 1UKEA 1H8HD 4GSYA 2BBTA 3PUYA 1Q20A 1ZP6A 3OHMA 4EAQA 1KDRA 3EIQA 1N6NA 1EXMA 1VIYA 3KKQA 1X8JA 5TXGA 5L8VA 1ZC3A 2BV3A 5SZKB 4EJSA 4FWTA 2HJVA 3I62A 3GQBA 2C9OA 4B32A 4OI2A 2PJRA 2VP0A 3CKLA 3QPWA 4AC9A 1JJVA 2WPDD 3AUYA 4HUQB 2WICA 3BS4A 3QXJA 1GRNA 3FMFA 3PUVA 6Q21A 3IPXA 2REXB 5G3YA 1NF3A 4TQUS 4URYR 2JLSA 1DO2A 3K1JA 3U3OA 1DG3A 2AHOA 3PUXA 1G41A 2ZYVX 1M1YE 2EFDB 2WKRA 2PCLA 3FGNA 3EIHA 3MLEA 2BBWA 3K0AB 2ZJ2A 4B44A 4QRHA 4B75A 2JJ8A 4Z51A 1E4VA 2QM8A 2H92A 1KI9A 2VSFA 4DSTA 4TTPA 4BFUA 2IEZA 3IKJA 2CVHA 4M9SA 2GXAA 3BFXA 4A2WA 3BH0A 1YZUA 2ZYUX 1H8ED 3LDAA 2O52A 1GL6A 4ZKEA 2WJGA 4QKQA 1P2SA 4Z8XA 3KQNA 2KSQA 2GBLA 4S35A 2ZJAA 5DIFA 1ZD8A 4UXIA 1NRJB 1XCPA 2DYKA 5CLLA 4AKGA 3I8XA 3DKVA 1FP7A 2GKSA 3MWKA 5CYOA 2OV2A 2Q0HA 1VPLA 3NBXX 4BE7B 4C0BA 5DHFA 2Q21A 5JEDA 1YZGA 1WE2A 2XGJA 3PEVA 4HUTA 1HUQA 1A7JA 4G5RA 3R7WB 2QPTA 4Q5IA 1JAHA 2J1LA 4CT5A 1Z0KA 8OHMA 1S0UA 2W83A 3R8FA 4JKYA 3M4YA 5KUTA 3FMPB 4B48A 3THWA 2FG5A 1FNNA 1GZSA 2ZRIA 2DFTA 4PAQA 1W44A 4PO8A 4QGGA 5EE9A 4ZDJA 3WP0A 1VCIA 1DS6A 1MO6A 4D0GA 1TQ2A 4LWZA 4HAWA 3QQ5A 5FI1B 1UJ2A 1E2LA 4I81A 4OHYA 2OCAA 2BJVA 4ZCLA 3LWNA 4BFVA 1VG9B 4L9SA 2NG1A 3BC1A 3RC8A 1P72A 4HYYA 1D2EA 4P4UA 4DHEA 3MD0A 5TB5A 1FMLA 3BH6A 1U0HC 2BWJA 5FUYA 1OH7A 3EASA 1N25A 3CBQA 4LGMA 1VMAA 1XTRA 4MITA 4NH0A 1HV8A 3JZMA 4IEEA 3T35A 5IHPA 2ZRJA 4JLKA 5FUXA 2RGCA 4PHTA 1R0XA 2ZI6A 4B73A 3A6PC 3THYA 4MQBA 2O8BB 3OE7D 4M1TA 3Q5DA 3U5ZB 4LK2A 2ODNA 4KLZA 5AR1A 2YHSA 1DELA 5JRJA 4OHXA 2RGGA 2WJIA 3SS8A 2ZRFA 2I1VB 1E99A 3MUFA 3MMPA 3B8HA 5KPDA 1VYUA 2PL3A 4URVR 4A2PA 1NMXA 4LX0A 2ZRNA 2XITA 1ZUNB 4A0FA 1Z6AA 2W58A 2QTVB 2JCSA 2A30A 5HTKA 2KJQA 3X1YA 2PBRA 2R6AA 2JLQA 2B8TA 1ZIOA 2QSZA 3HU3A 2H8KA 4JLJA 4MGKR 1ZM2A 4NCNA 2GF9A 1NBME 1A5TA 2ZROA 5D3QA 2ZE8A 5D3MA 4BQSA 1HEIA 3A1SA 2G6BA 2ZREA 1GWNA 2IYXA 3SYLA 1XJ0A 4AY2A 2AD5A 4M21A 2WM9B 5JJIA 4V0NA 3GLIE 2FPMA 1FQJA 4XTRA 1DAIA 2DWPA 4GMXA 2Q9AA 1B23P 3QY0A 1N2CE 4ABYA 1S3GA 1ZVQA 2YOFA 3AVWA 3U3MA 4RCYA 3A1WA 4MRVA 3GEIA 5GVRA 3PJRA 5DGXA 2QY9A 3ETLA 2DY1A 2QN6A 1KMHB 1Z5ZA 4NYJQ 3ZVMA 1GNPA 2Q3MA 4FCWA 1JB1A 4Q48A 1II9A 4JS0A 4CIDA 3QKRB 3AEZA 5EXPA 1GL9B 2ZRBA 5CDFA 1KI1A 2XEXA 4OBEA 2YNMA 2BEKA 3RRYA 5D3MB 4NYIQ 4D2IA 1JR3A 4DIEA 1PUIA 1GOTA 4XVRA 4HDQB 5FOVA 4IDHA 2G1JA 4UNPA 1ZCAA 5C46F 2YOHA 3TQCA 1Q3TA 2JJ2D 4QBHA 1TF5A 3W6OA 2ONJA 3ADCA 2ORIA 1LS6A 4FMCB 1Q22A 1TX4B 4DT1A 4EFNA 3UKDA 4FXPA 3UANA 3KXKA 2IX3A 4DCTA 4YXWA 4Q00A 5DI9A 2OBNA 2R62A 4P3YA 2IA5A 3KQHA 4IVQA 1U8ZA 4CW7A 1OB2A 3KXIA 3LNCA 4GP7A 1G7RA 2RGNC 4JBWA 4IEIA 3CPJB 4HAUA 4D0NA 3EX7C 2G0TA 4HSEA 1T3LA 5G53C 2CHGA 2GBLC 2V4ZA 5F3WB 3VKHA 5CB6A 4O3MA 4U00A 3OEED 2FOLA 2DPXA 1UM8A 1WF3A 5FL3A 4PSVA 4EPRA 2OCPA 1OPXA 2IF2A 2N42A 1ZAKA 2FSGA 4ZIRA 3IBGA 2PMDA 2N1BA 3W90A 2ZEJA 4MA4A 3LQRA 4Q1DA 1G6OA 3KJEA 1XEXB 4ESHA 2JA1A 1ZD1A 2PEYA 4IXNA 4N0DA 2V1UA 4A36A 1P9NA 5DH9A 2W2VA 2HLDD 3U44B 2EYUA 5EZ6B 1FPMA 1QHSA 2IC5A 4B47A 2ZAOA 3Q85A 4G1UC 1XMSA 3LH5A 2ASEA 2QSYA 4AD8A 1EX6A 3SDZA 2ZPTX 4JT4A 3GPLA 3B13B 1T5LA 1W5TA 2VA8A 2YJTD 4GZLA 2FH5B 1DAKA 4PPGA 2ODBA 3X1DA 3DHWC 4JVSB 4KSBA 4B43A 4BLSA 2OT3B 2GZDA 4LBYA 4MUAA 1N0UA 2OSBA 2WWHA 1SKYB 4DSNA 1MABA 2HUPA 4X8LA 4OK5A 4AK9A 4DLWA 2VPPA 3GMTA 2DCUA 4LPKA 5FBLB 5G41A 3KQKA 1IJFA 4M1SA 4FCVA 3HJNA 3VKWA 4EPYA 2OXCA 2OILA 5CM9C 2XZLA 4MYUA 1MV5A 1KAGA 1SVKA 1U9IA 1Z22A 3SJBA 3X1XA 1XXHB 2AD1A 4O25A 3H0KA 2REOA 5FOUA 1E79D 2NGRA 2OCBA 2AFHE 4PSKA 4QFMA 1N5JA 2HCJB 4UNQA 3PEYA 3ZJYA 3RSOA 1XPRA 1KI3A 5A0FA 1XF9A 1KKLA 1ZM7A 4M1KA 3WMFA 3BWDD 5AUQA 4FCTA 3SEAA 1S9HA 2NPIA 4PZYA 2BCGY 3A1UA 4G5QA 1XD2A 3CNNA 2A5JA 1N5KA 2QP9X 2GK6A 4EFLA 1AM4D 3GJ0A 3U3RA 3FTQA 3AH8A 3IIJA 5B30A 4DEYA 2C03A 3B5JA 2FE4A 4TT3A 2JLYA 1RJ9B 1UPTA 4IOKA 5EQTA 5L3SA 4IFBA 1UBFA 3ONWA 5CIQA 2HXYA 1LF0A 4V0ME 1AZTA 2CE2X 2F43A 2ORWA 2FNAA 2RMKA 5KO2A 3L43A 4G3XA 4LJ9A 4MRNA 1O87A 1JPNA
chains in the Genus database with same CATH superfamily
2GERA 2JLCA 3UEOA 4DUPA 3FETA 1MRSA 1RSZA 1VI6A 2CFTA 3MK31 4MWZA 1HE1C 1TIKA 5BQXA 5JY6A 2D06A 2O7RA 3GUZA 3HS3A 5BRJA 4MW5A 1O6CA 3U1TA 3B9BA 3AU9A 5CT4A 4FU0A 4Z0PA 5IYZA 2PL5A 1RAHA 4RTPA 2O2ZA 3DR3A 2I2BA 2ZIGA 1L5RA 2C5FA 3V2UA 3OKFA 2DU8A 2G63A 4J16C 5LD2C 4NAHA 1FMCA 1XZ8A 3JWJA 1QFXA 5BW8A 4TTVA 3TLBA 1VCNA 4LX8A 2PUVA 3EWSA 3LX5A 4EW6A 4Z49A 2FPWA 3G0GA 4QVGA 3COSA 4F2PA 1UDBA 5J4VA 4L7QA 5SY6A 1N57A 1PJAA 3AI3A 1FVXA 1FXSA 3N07A 4AJ1A 3V8VA 1B8UA 2C2KA 1Q0HA 2ZWMA 1L2TA 2W8BA 1NQUA 1WJGA 4MYTA 5KTYA 4AKGA 1E2UA 3U09A 2HPAA 4JA2A 2DXIA 1YK0A 1E9EA 2PZKA 4TTAA 1CY1A 2Y2UA 5DNYB 2Z3VA 2BFNA 3V7FA 1G5TA 1G8AA 5HE9A 1YFKA 2GD1O 1WD7A 4P54A 2VXBA 1OIXA 4KQGA 4QRDA 4GAEA 4XPZA 3RS5A 4I55A 4QQNA 3QKSA 2W4QA 2XMPA 2LDBA 3N87A 3CR7A 1TO6A 4BV8A 2CXTA 4EHDA 3LWDA 1YDHA 1E9VA 2OCIA 4HLUA 2WT8A 3DHNA 3IV6A 3UICA 2YVKA 5IVKA 4Q19A 4MW0A 4NVRA 1LBEA 1G3IA 4JENA 1VDZA 2VPWA 2Q41A 4HH1A 4JJZA 2HMWA 2PQ6A 5HZHA 2AJLI 1WLSA 3CLRD 4C7VA 5K2OA 4J9VA 1E1RA 5DGTA 1R64A 1JQ5A 2EGHA 4E33A 1TFUA 4IJKA 5CBPA 4NPHA 4WXPA 5BORA 4CF5A 1VSUA 1PWZA 5A5DA 4A0HA 4KXUA 3J7TA 1CVIA 1NATA 2AE2A 1QG0A 3WKBA 2ZYRA 2GETA 4OEHA 5A3QA 4LN1A 1CZHA 4QJ5A 3GNLA 2HQSA 4I99A 4EUNA 1L6IA 2BY4A 1JLKA 1Y7TA 2I66A 5DBFA 3K70B 3NHLA 2XUHA 1Z36A 2QPLA 1R9NA 2G09A 3OMLA 3ZE0B 3PSAA 5HMLA 5TVGA 4IJ6A 1BW9A 3LPDA 4Q4DA 1WKBA 1OI3A 4G5FA 4LDRA 3T7EA 4WIAA 3WSTA 2H5EA 3IOBA 4CFYA 3IP3A 2FW1A 4BVKA 2ERXA 1XNGA 1QH8B 2QGFA 1U8EA 5IX8A 1EHIA 1GRCA 1QR2A 2C4UA 2H63A 2MHCA 2R66A 2XUIA 2J07A 2XVMA 2YXNA 3BXFA 4TLAA 5IDVA 4YRFA 4GGOA 3BM5A 4FSDA 1D2AA 4ZVRA 5KREA 3I30X 1R4NA 3K9WA 3VISA 3I1IA 2VYND 1A0OA 1J2RA 4RHEA 1SVLA 1J2UA 3UTDA 5LWHA 5IJ9B 5EE0A 4QJ4A 2AKEA 4TSRA 4YEDA 2BSAA 2EHJA 2D2IA 1HGXA 4NPCA 3TSAA 1J1IA 1XNRB 2ODEA 5ITZB 4ZEMA 3OEYA 3MYYA 1O2DA 1Y80A 2G17A 1OWOA 3GFSA 5FI5A 4Q4HA 4YN3A 1GTL1 1A9SA 4Q3EA 1JKMA 1YHZA 2JCXA 3PNVA 2PGXA 2HF2A 1YHYA 4BE4A 2R68A 2X7HA 4LYJA 4D8WA 4DR5B 3WLSA 3TQRA 3MJFA 1BHO1 1T6NA 1U8FO 1U2SA 1FK8A 4R68A 2DGDA 1N6KA 4TL7A 3DMDA 1NUQA 2DE0X 2QJRA 2B6HA 3LX4A 4DV5B 1QPBA 4IG4A 3QMPA 3QVSA 1WCV1 4MIYA 5EZYB 1G20E 3M7IA 1O08A 4YRAA 1JDBB 3AIMA 3TIXB 2WJYA 3W3AD 4UM8B 2NQTA 4RFSA 1VPDA 1R6VA 4U4AA 4W4TA 2UVPB 3RU7A 6CHYA 3QK7A 2A2ZA 4Q47A 1J8VA 4ZI2A 2X2PA 3DBRA 3JARA 5I7SA 4MQ5A 2EEZA 1E2FA 2W2LD 2RFLA 3N5CA 4G36A 1PSDA 4JEMA 4KFRA 3TMYA 3H16A 1GN9A 3SQOA 3PVSA 2ZVJA 3O83A 5TR9A 1KYWA 4H6PA 4XVCA 2P2CA 1W34A 2YFYA 3L6BA 1KXZA 4B83A 3RW9A 3PNLA 4XD2A 2GVZC 2XODA 3KUKA 4PN7A 3CNBA 3KCQA 5HGJA 5KNDD 2OYSA 2HA2A 1SC9A 2OLEA 5ICMA 1FUUA 2VP4A 3FDXA 5CX1B 3WR5A 4CXMA 4R2XA 2WAOA 3KHKA 1CU1A 3GRUA 1MC4A 4L8LA 1MO4A 1S01A 3E8XA 5G02A 4BEBA 4AS1A 2RKBA 3GZTB 3T15A 1AQUA 5F23A 1KI7A 4PCAA 5CIYA 1E9RA 4TLMB 3ZY6A 1J7KA 3E2IA 4AWAA 5F9HA 5A7GA 5DNEA 3W5UA 4XIYA 2I4MA 2WAYA 3C6XA 5NULA 4F91B 1UFKA 2H9AA 3THSA 4OHBA 2PVSA 5BMVF 1HC7A 2LKDA 3CF6R 4DQXA 1OQAA 2Q8NA 5A5GA 1YTUA 3PJFA 5F2EA 1GY8A 1P39A 2B36A 3HO6A 5EXEA 5K2MA 3RUFA 3LIPA 4ZEVA 1JQBA 1G6Q1 2GN9A 3FUTA 4R84A 3AY3A 4P7FA 5CVCA 2JG3A 1YR7A 2Z8YM 3KSAC 2B2XA 4G56A 2X22A 1TZCA 3INGA 4ND4A 4MQFA 3X1KA 5ICCA 2FLWA 2DEUA 1RE0A 2LRHA 3QEMB 2HA7A 4BMCA 3DBHB 2RK6A 3QXSA 2PM8A 3S1SA 4KW7A 4MJLA 1B0AA 2GHIA 4XSHA 3I8OA 3U26A 3QF4A 1H3FA 3AM3A 3D5QA 1KIMA 1E0AA 5AM2A 5KWSA 3R5KA 2O5RA 4HV4A 1LPNA 4L73A 3UGKA 1A4RA 3C3JA 3RJTA 1ZH8A 4URZR 4A2CA 3NDBB 5F78A 4G41A 2VCYA 4LJKA 2V7VA 4P84A 5L4NA 3L7BA 3CN9A 1LF5A 2XMRA 3NCTA 1TJNA 1IHUA 1H1LA 1YCDA 1BXGB 1TI7A 2FPIB 2NXCA 1G17A 3FTNA 2WAAA 2IEGA 4HFMA 4IS3A 4Q12A 5T4FA 4EG6A 5A06A 2B8WA 4GMHA 1LK7A 1YB5A 4UDNA 2NYRA 5KSOA 2IUTA 2J3LA 1C7FA 3RB8A 1UPCA 4B7ZA 2J9FB 2E3JA 1NVXQ 4FGJA 3PXBA 4MRSA 1YQEA 2QMQA 4LRWA 3U81A 1CUVA 4HATA 2ZT6A 1W7AA 3KYIB 1YMVA 3RS2A 1VE3A 2J7PA 1FTGA 5AHOA 4CG1A 1AE1A 4K9QA 3W5AA 3I76A 3NMUF 3A4NA 2YS7A 5C4IA 1R3DA 4S1VA 1EAMA 4U5XA 4B46A 1R9GA 4BO2A 2XIJA 5DP2A 3GFPA 4OX9Y 3IT0A 3HXLA 4IXDA 1E0JA 1JFLA 4XD7A 1N3BA 5BY2A 2OBMA 3E8SA 5E4TA 3MQFA 1YFJA 3HWX1 1K5HA 3DWIA 1CIVA 4M86A 1IH8A 4RNCA 4TYPA 4X1YA 4KVZA 3LBFA 5DHRA 5JV5A 1QNLA 1E98A 2W2NA 3GW8A 4E5MA 2Q9UA 2JD2A 3VU0A 2AFHA 1JKIA 1GV1A 3O1IC 1EUCA 3IURA 1KA9H 5ELLA 4OI1A 4UVHA 3F5QA 5EESA 2PY6A 3B70A 2LBPA 5AWFC 1I6KA 1MJGA 3CUUA 1CD5A 3GA7A 3ONDA 3R8CA 5K01A 2DSTA 1FS6A 4PX5A 1KAMA 5EMJA 4GLJA 2GZ2A 3DV2A 1IBSA 3NBMA 4EQ6B 5IM4F 2EZTA 1BD4A 2Z9CA 3PR2B 5MN4A 5DLQC 1YASA 5FEUA 1ZWKA 1RBMA 2HB6A 1SWVA 1N2EA 4LDZA 2RHLA 3LC7O 3T3MB 4BFTA 1TLLA 3GA5A 4FYYA 5FF9A 5LQRA 4Z4GA 3ILXA 1KI6B 3CZRA 3OPYA 1MOQA 1H0KA 1KH3A 4CM1A 4KR2A 3LQYA 3JD3A 4UHBA 1X87A 2QL9A 3EK2A 1XTZA 2BOVA 3GGJA 2C2ZA 5JTUA 2P2ZA 3AV0B 4LJ8A 3HBNA 2HRDA 1V5IA 3WQHA 3OQNA 1VECA 2UVPA 1I01A 3FBGA 1PT9A 5HDQA 3KHTA 4QVKA 4J2OA 1BCRA 3EXAA 1SJ9A 4P98A 4D42A 3F74A 1N2CA 1GUFA 4LYDA 4G9GA 3AUKA 4U2DA 3P2YA 3FXAA 3ZTWA 4OLBA 5I8ZA 2QUAA 5K3FA 3SN6A 1ADBA 1C3LA 1F2UB 2ANBA 4P9NA 1QE5A 2F3SA 5K0SA 1ESDA 4R9RA 5FORA 2O8EA 4HJXA 4FOLA 1M5TA 4QLAA 1CR0A 4AW9A 4ZT4A 3ZDBA 5BMOA 1I2MA 3TUIC 3Q10A 5FAXA 2HJ9A 1WSWA 2H48A 1BKDR 1C41A 2FR0A 3K09C 3OUTA 1Z26A 5DWVA 4LDAA 3PWKA 4TXLA 3DFMA 1W8DA 4ETWA 1RR6A 1RQ2A 3GGCA 2AB0A 2PRYA 3O8OB 3OF3A 4IV5A 1RRVA 3L6CA 3KJQA 4KYVA 4WINA 1KWKA 1PGOA 1XWFA 1EAYA 2L19A 2PIAA 4IIDA 4U7HA 3WKAA 1JG3A 3REFA 2HJRA 5TLSA 5KU7A 1QHGA 1XRQA 3QI2A 3SZ3A 1DO0A 2QP3A 4MLPA 4P4SA 4MUKA 4KRXA 4CN8A 1RIFA 1YOVB 1V9SA 5LP1A 2QLTA 4AJNA 1J9EA 2OVFA 1H22A 1I2DA 3UATA 4MUEA 3VDMA 1H6BA 5AW3A 4TYWA 2UUCB 2YOGA 4F2WA 2ODWA 1I32A 1CP3A 1HT0A 3UYLA 1GQFA 1YZLA 1EIZA 4H0NA 2JFUA 1D03A 3JALB 4KGXA 3KZCA 1LK5A 3VVMA 1GNQA 3CH5A 1PJCA 1YS7A 3OFND 1C1DB 1MJFA 3RVJA 2ISSD 4MVJE 2XTZA 1HT2E 3W4IA 1JDBC 2P9YA 3O5AA 2LCIA 3VSDA 2P27A 3IMGA 4RETA 2WNSA 3KKNA 2QZPA 1JB9A 1QONA 3DHYA 2V0NA 4DCMA 1SUPA 1B76A 4RKFA 3B7WA 3DW3X 4TLCA 3K3PA 2JJ1A 4LRXA 5BN5A 3ZZUA 4R5HA 4G2TA 4IOJA 4W1PA 1I3CA 3AVUA 3CH7A 3EXG1 3UXMA 1DU4A 2QB5A 2HJGA 3RQIA 2XI4A 3Q3VA 1T4BA 3GC6A 2HEIA 1C4XA 2BR3A 3FLBA 4FFNA 4KLNA 4MZXA 1TVKA 1LUAA 4PZUA 1WTCA 2ZRGA 3GEGA 1MQSA 2ZE5A 3KKOA 5FOTA 3A06A 3AFMA 4JXJA 2GN0A 4ZDKA 3EW7A 3VDNB 1YE3A 3SC3A 3OF5A 3OZEA 2AJTA 1OD6A 3OJEA 3ZYCA 2HJSA 1QJ4A 4Y0AA 2R1VB 1QFSA 5EP3A 2VXOA 5E6RA 5TPWA 4CKEB 1VDMA 1OXKB 1Z13A 1YC5A 4QU9A 3LTEA 4EY8A 2PBFA 3P5SA 3CVUA 2FWRA 5FTLA 4Z6KA 1BOFA 2BIFA 1M2OB 4B34A 3GT3A 3PRYA 4WJKB 4WOKA 1LTQA 2FZ5A 1BA3A 2PPLA 3K1YA 4LYYA 1S8AA 2ZB2A 4HDMB 1PJQA 1Q1GA 5TGTA 5C5DA 3AW8A 5HCNA 5GONB 2O54A 4H1TA 4HUQA 3WSWA 4HL6A 5CK5A 5CTAA 3KZXA 2ZWAA 3A2LA 4JI2B 2WZQA 1VTKA 3KZKA 1G3UA 1EVIA 3FYCA 3QEKA 3F8WA 4X1OA 4Z4EA 4G5OA 5CFMA 1ISRA 2IIQA 5EWMA 2Y6UA 1EDZA 2IU0A 2NSHA 3NTXA 3D5EA 3UM9A 4DEXA 2C7RA 3D3EA 2IJGX 1ZD5A 1NFFA 2IU6A 3HB7A 5TQJA 4EM6A 4NYJR 3C70A 4FEAA 3K5PA 1A4IA 4KAAA 3ZQJA 3DTVB 3IT2A 3JATB 3ED5A 4DLBA 4F84A 5H9WA 4DT1B 4BGIA 3P9SA 1QP8A 4I55B 4R7GA 2XB2A 4BVEA 3QLVC 4OKSA 1YMUA 1E6MA 3MQ2A 2V8OA 3VTAA 4MEJA 5A05A 3MFYA 1LY1A 1DP4A 2ET6A 1J8FA 1FS4A 3B85A 1KY5A 5DCUA 5AM4A 1KETA 2EW1A 4NJMB 2HIMA 2YKGA 5BP7A 1TAGA 3SQXA 4U39A 2H4ZA 1R16A 3JQFC 5JSQA 3NH9A 1PBTA 3CCCA 3BAZA 4JHXA 4WL0A 2HFKA 2WSSD 3C5CA 4IRMA 3GH1A 4O2AB 2R47A 2D0DA 3R3ZA 4RH0A 4X1IA 3CUYA 4NJEA 1DNPA 1XMXA 3EEOA 3MHPA 2DOKA 3NONA 4ZCQA 1OBFO 2I33A 5A6SB 1USVA 1ZM4A 3EEFA 1Z5GA 1P2FA 3D54D 4D79A 1XXHA 2OGUA 1C4OA 1Q0QA 3R6DA 2R6FA 2Q5EA 1L4YA 3GCZA 4L08A 2H08A 3H6KA 3WDLA 4GW3A 5DASA 5HF6A 1QJCA 4I5FA 3KQTA 3D2LA 4UZSA 3PFNA 1BFUA 1HRKA 1YV9A 2OCYC 1GL7A 1A2OA 1YU6A 1ADJA 2FLKA 1CIPA 3QVKA 4RLFA 4YXFA 3R7WA 121PA 1E3EA 3PGVA 3WK4A 4AKEA 1STOA 3RG8A 5AUPB 1C80A 3F9IA 4HNAB 5FUBA 2EBHX 2PR2A 5KQSA 1DV1A 1OLOA 1Z5UA 3C2QA 4O2BF 2JEZA 1YB2A 1X80A 3FNGA 5H68A 3UA3A 3Q7QA 1BNCA 3HFJA 4TWBA 3T9CA 5G1NA 1SG9A 1Y8QA 3KJIA 1QQ7A 2GJ8A 3UZUA 4GI1A 4P93A 1GD1O 3O82A 1IWPB 4C87A 1T26A 3A6LA 4FEYA 4UBOA 2IDJA 4IQ4A 4PC2A 4GT1A 4PO9A 2BDUA 2REBA 5E6SB 2ZXFA 4UXHA 2W6OA 3AESA 3D6FA 3AVPA 5AVYA 4HWSA 4PVDA 1EVZA 2XGSA 3ZC3A 1RLTA 3DYBA 3DMRA 3IO3A 5CTJA 3GRRA 2ZTSA 4M54A 2G9UA 2QVBA 3FLEA 1CJTC 1T9KA 1GZ7A 5F51A 3AV3A 4OQMA 1IQPA 4FNMA 2GK3A 2C88A 2PZAA 3MTGA 3N8DA 2YVAA 3U4QA 4F93B 5KOYA 4N8SA 3VU1A 2YINC 1CVLA 3AIIA 3FG9A 1F8GA 1GKIA 1WD5A 1LWNA 2IOFA 3DEHA 4TLDA 2AK2A 2HCTA 2VHQA 2ZBGA 3NOOA 5ALKA 4L2IB 1P17A 3SFZA 4DJDC 3EDRA 3OJ0A 3D9QX 1J09A 4KP7A 3SZUA 3DP7A 3F6BX 1W75A 4HFRA 1NJ2A 3CJRA 4NH4A 3T0IA 1KU6A 1TIBA 5KOJB 4UVIA 1DDGA 4G0NA 4GMKA 3M83A 2CMHA 4RK4A 3BBPA 5LB4A 1KE1A 3A3NA 2AKAB 2RHCA 1NW8A 4URFA 1A9XB 1V7CA 3LOQA 3OG9A 5JH7B 3CNQS 3ILVA 5CHEA 5FHRA 5T8KA 2EJCA 1SEVA 1E58A 2JATA 2Q5OA 4YP1A 4LYEA 3R0JA 1JJFA 1Y3BE 4K1XA 3PFKA 2GD6A 4I3FA 5IKEA 5B58T 3COJA 4Q16A 4V0QA 4AO7A 2E89A 2GLUA 4FXOA 1SD2A 3FMOB 3MBKA 2NO4A 2F00A 1CZKA 3LKBA 1TU4A 3N0WA 3W4JA 1QVZA 4G0ZA 1EINA 4DIKA 5BV8A 3M34A 4COOA 4W9NA 1LX7A 4RHUA 1KFJB 2EKBA 3GGPA 4N3CA 4OI0A 1F4VA 5JJKA 4JCCA 1RJFA 4PSDA 5EUBA 1FU4A 4YI3A 4L3WA 1RXVA 3P9CA 3SGLA 4XZ3A 5I7UA 2J08A 1M7BA 3AXSA 4JJ4A 1YB6A 2PKYX 4M8KA 2W2QA 2I7XA 4V0LA 1IQRA 5ILGA 1RCTE 1SQFA 3OZCA 5C1OA 4BIIA 1EX7A 1QBKC 3ISTA 1YR6A 2MJLA 4KR6A 5GADl 2V6MA 4IICA 1G4HA 4KMOA 4PGAA 4AJLA 5FR2A 3N2GB 1XDWA 4J1TC 3VR2A 4F1WA 2PG3A 3G2KA 1B6TA 1VPTA 4E5VA 2Z2JA 4UU8A 4FCCA 1ISPA 2X3YA 3A4LA 5KNCD 1Y3AA 2XRYA 4ZOBA 1L8OA 4QUIA 4FZRA 3TOVA 4C4AA 2O1SA 2J0QA 1VBMA 2D0OB 5IXJA 3VTKA 1Q7BA 3BGVA 4CI0B 2FPUA 3K16A 2BFAA 2KWIA 3O26A 3MJRA 4I4TA 4CMKA 2WY2D 4K6HA 5DW0A 1NUHA 2OD9A 1ZS9A 2VHYA 4DV0B 1OWLA 2NYVA 3B9QA 1K3UB 1BXRA 1RVDA 2XCSB 4P0QB 4TUYB 3LKZA 3NHSA 2XNSA 1X77A 1WIWA 5CJJA 1CZNA 4FOPA 1DAOA 3UBTA 2RJ3A 5EHQA 3ZDRA 4LC1A 4XSVA 2X86A 2YFHA 4PIVA 4CTKA 4KR9A 4UTRA 3HU2A 3THWB 1JJBA 2B0JA 1ZZEA 4L1KA 5BW6B 2PUDA 1BG6A 2CD9A 2PIDA 4WXYB 4DUGD 4LNUB 3CXUA 1UBGA 1JR3E 2PX5A 1P73A 3AUXA 3H8VA 1F3OA 4K9PA 2JFOA 3JVDA 1WX1A 4QM7A 3IEKA 2CWDA 3HL4A 2JFZA 5FI3A 3O8DA 4KDEA 2AH5A 3TIFA 3UCEA 2R97A 3HDVA 4IUYA 4M1MA 3TOXA 3ELUA 3QU7A 4IIJB 2YY7A 4XRRA 1ONNA 5FP0A 4CNQA 4YT8A 2FP4B 1JXMA 3I2GA 3LPAA 3UC5A 2HHCA 1KYYA 1IHXA 1CUZA 1O96B 1UM9A 5HZGA 1VHTA 2OOSA 1WUYA 2VLBA 2PU5A 3I6QA 1U2ZA 4CL8A 2C3OA 1PV4A 1SA0B 4RLQA 2ZJZA 1GGHA 2Z6UA 2ZSBA 3AJEA 4ZT2A 2AZXA 3A2MA 5C4MA 4FFBB 1X92A 2JGJA 4KYUA 2WWIA 1XTJA 1VB5A 1ZUIA 2WYIA 2QTAA 4I2VA 1C7ZA 4FNGA 2A0YA 3RHSA 4BQNA 1D0VA 2SKCA 1A8QA 5J4HA 2EFGA 3FJOA 3RUPA 4Y2HA 4FPXA 2P7HA 3H5TA 2GAFA 4RIFA 2O7NA 4YLGA 2W2KB 2LE0A 2A3NA 4JL8A 4GG1A 2OL4A 5IBRA 1EFVB 1F0PA 1LPMA 2PSFA 2P9JA 1OT3A 1U3UA 2K2WA 5LJLA 3VOAA 5HE8A 2XPCA 2P5YA 2WSIA 4UE2A 4B2YA 1DIOB 2QX6A 4KIFA 1IBMB 2DUUA 4D3DA 2WF5A 4MDYA 1VPWA 1FDTA 4BATA 3RDPA 2BRUC 3KQLA 1NVWQ 1ELOA 3B8EA 2WYOA 5A9SA 3VM6A 2YBEA 2WV9A 1DWOA 4L4YA 3F96A 4RH3A 4RF3A 2PANA 1C3JA 4CTNA 3R0ZA 2CY0A 3JQAA 3ZKWA 4H7EA 1PGPA 3NHWA 3RTGA 1IQUA 1DV2A 3TDNA 4H7IA 4B3MB 3OESA 3KU4A 4NYMR 4Z0HO 4EHHA 5KNCA 3QU4A 2VATA 4FGLA 4JGIA 5LR6A 1JR6A 3DV0A 1L1QA 2D1YA 1DC8A 2XYRA 3HABA 4HGNA 1Z18A 1ZHOA 4EG5A 1U2PA 1JBEA 2NT4A 5ALXA 1FJXA 3BB1A 4X3OA 3U4AA 4D25A 1H1DA 1UCFA 2VJOA 1XPOA 5EQDA 4DV1B 2JAUA 4LBVA 4AMZA 4YX9A 5IWAB 1GUAA 1G4UR 1O6FA 1V8DA 5JZVA 1XLUA 1SCNE 2MSLA 2PX0A 4HTFA 3HY6A 2NSLA 2WQ6A 3HACA 4TMTA 4S0XA 3RABA 1Y9JA 4IHQA 4JLAA 2VWQA 5JCXA 2AFIE 2YYZA 1Q1QA 1Z5NA 1ZPDA 1X0VA 2MR6A 1CUHA 1XNQB 2QVLA 1EA5A 4FWIB 4I08A 4P3NA 4UZEA 3KUDA 1WNFA 5ALMA 4D9NA 1JLRA 4QNNA 2FUEA 1TKRA 2AR7A 2RB4A 2YYSA 3BA6A 2Y99A 4WZAE 5IYZF 1Z34A 2BN4A 2DBZA 2J5XA 4RV9A 3TWOA 5CVUA 5CRIA 2QUZA 2YR0A 3ND8A 4X3PA 4Z86A 5TMEA 5ALUA 4CEIB 4Z9FA 4CCWA 3MWEA 2EFJA 3AM1A 1THMA 4B4OA 3IUMA 3FSGD 3NTLA 1GTG1 3RVPA 5E7QA 1AS0A 1P45A 3EZFA 2H1CA 4C78A 4CLHA 1MENA 4EO4A 4UEWA 4DG8A 4EPWA 5IJ0B 3CZ9A 3GPBA 2GDZA 4RX1A 3U7FB 3DZFA 1U7UA 4Z3OA 1GUDA 4B4DA 1YL7A 2IHTA 1M2HA 4DZZA 2F2TA 3OCYA 1BEZA 3E7WA 3H2KA 4DIUA 2WYWA 4AMUA 4IDDA 3UV3A 3G68A 1R50A 1IZ7A 4K9LA 4OHPA 4DSTA 2FV8A 2PRIA 3CRRA 4F9GA 1FNCA 4JC5A 4R9SA 2AEFA 2CSXA 2VJYA 1LI5A 5JXHA 3LBHA 4LW8A 4MUNA 2DB3A 4ESOA 5CT9A 5TS3A 1VKOA 4RTSA 3I2FA 1MXHA 1YBHA 2I6FA 1F3LA 2OY0A 1MX1A 2VS1A 1NR5A 1PWHA 2CXHA 4MKHA 3G2OA 3HGTA 2FQWA 2HWWA 2B8JA 2YC2C 4OP1A 2FF7A 1FYFA 4X6YA 1XJ5A 6AT1A 2CEAA 3KSMA 4EY7A 1FX0A 3AP1A 2QBYB 1UMCB 2R1TA 3AFHA 4NCJA 5ALHA 1SC3A 1TVKB 1UT5A 4DWJA 1XZPA 3M4ZA 2HSEA 4MQ4A 4MRAA 2GK4A 5IFKA 1QIDA 3G1TA 1RYHA 3MBOA 4LFBB 1ZJYA 3PNOA 5B7QA 3WL3A 1VSTA 1CUJA 4HEA1 2VK8A 3K0AA 3UWDA 2PGLA 4RWEA 5AVJA 3N2LA 1YZ3A 4WEQA 1MO2A 1XCMA 3IP6A 1K8RA 4EIWA 5KTPA 1GAEO 4RNDB 1EBUA 5H8WA 3KDAA 4IJWA 2HLDA 2CYBA 3LBYA 1Y4AE 2GEFA 3HUEA 4RSRA 4XW2A 1AGYA 4OLJA 5FWNA 1FX0B 2HK8A 1GLVA 4N9WA 4QA9A 1RI4A 2TYSB 4HGQA 1Z8DA 4OJMX 1W5AA 4XX0B 1LS1A 1V7QA 1KP2A 2FZGA 4TT3D 5AW7A 4IOLA 3PXGA 4X7MA 3CSUA 1KZ6A 2G9QA 4HNGA 5EXTA 1OVGA 3K9BA 2Z56A 2VOEA 3CVVA 2OGTA 1JBKA 4I14A 2CV1A 2GXSA 4KO1S 4V39A 3ILHA 1GGKA 1B0ZA 1ODLA 2GQ0A 3DQZA 3T8YA 1O97C 2IYFA 4F7WA 4KRGA 3GPCA 4GXNA 1PR4A 2QL7A 4PTZA 1ML4A 3FPEA 4FC6A 1QOPB 4D5GA 1V11A 1E7SA 4KACA 4TPKA 4YV1A 3QE9Y 4M49A 3CGGA 3G5MA 4LYGA 4XARA 5JJBA 3TYXA 1NMZA 4UBJA 1C30B 3GN1A 2AE1A 2XJ9A 2PKCA 4EO9A 3JYNA 5H81A 1P44A 3MVEA 1I4WA 1CERA 1E96A 1NN3A 2RH4A 4W63A 5CVDA 4EI2A 4ABTA 2ZSAA 4XGIA 3B9RA 4YHBA 2C99A 3TGWA 4MLDA 1GRVA 4KGZA 1PNTA 3NP9A 3D6VA 4ND1A 1THGA 2HF8A 3ANMA 3DDSA 4EMBA 4MV8A 4TWAA 2Y1GA 1B14A 1JZTA 3AUJB 1HOTA 3RODA 2EEPA 2OGSA 3LPNA 3P27A 3PV0A 4MV7A 3EUEA 2XXAA 1L5QA 4PX2A 2Q1WA 3OTWA 3PUIA 3MINA 4FVTA 2GH1A 4UUAA 3TW0A 4CG3A 1DIBA 4R8MA 1L8XA 1N1EA 2J7PD 3QXGA 4ND8B 2CLCX 1A9YA 2NO0A 4MPDA 2ATXA 4KWEA 1OFUX 1M2FA 2NNLD 1HURA 2PBZA 4WA7A 5ALTA 1CUSA 3IRUA 2WWRA 5FO0A 1IK6A 2P2SA 2PRKA 2XDWA 1ID1A 3M4NA 4D56A 4N5MA 2PCJA 2OZEA 1D2NA 3L79A 4CMAA 1UH5A 1R6TA 3PGLA 3K92A 5B57C 5BYKA 1NULA 1OZAA 1RYFA 3PXCX 3AR3A 1S9DA 3U37A 4CEHB 4KB5A 4F9FA 3E03A 2QW0X 3WK8A 1I4LD 2POCA 3NRCA 4YWJA 3EEYA 1G55A 7MHTA 1HPLA 1J97A 1L5HB 1BE8A 4YJ3B 4RY2A 3GYGA 4NJOA 4JBNA 5F7ZA 5IAKA 2P2YA 4R69A 4PC7A 1Z63A 1ZNXA 5DEIA 1CNFA 2X5OA 1GCGA 1NSFA 2ZUBA 4HXFB 3K0CC 4IXWA 4US0R 4J0FA 4CKWB 2GCOB 3MTEA 5A9RA 4OB8A 2G4VA 2QZ4A 3VPCA 4U9UA 3WS7A 4F3TA 2QJOA 2VL7A 1GFZA 4K9DA 3GHYA 4A2QA 2F4VB 2R6CA 3R5TA 4HWPA 3GF4A 2IXTA 1GIAA 3P32A 3PQ7A 1DIGA 1M7GA 4II2A 3DF7A 4Z53A 4YPOA 2CLDX 4XFKA 5BXQC 3EQZA 3WK9A 4TXMA 1HFEL 1U5BB 2FSHA 4HOYA 5G0TA 3UPUA 5KCMA 2JHFA 4WW0A 3FNHA 3ADBA 3H1FA 2IK8A 3BVPA 4F45A 1NR7A 4HEJA 3GRYA 3SKXA 2Q5IA 3H13A 2ZUTA 3OZTA 4NICA 4UNNA 4R16A 5DI3A 1W2GA 3L18A 1QQBA 4ERNA 2NADA 2QT0A 3M2TA 2HIHA 4IIEA 5LD2B 4G63A 4KR3A 4WADA 2YVLA 1WQ1R 2ZUCA 2WEKA 4FYWA 5EGNA 2Q45A 2FRDC 2R7KA 3ZJ5A 2H0QA 1U7XA 5CITA 2X40A 2AF4C 2O50A 1TAUA 2QR3A 5EE3A 2BONA 1ST3A 4BVLA 4BQRA 1E3IA 2R6ZA 5EI5A 1AGXA 1CEEA 3HB0A 1CP2A 2R2AA 3OLWA 1EFRA 1M1ZA 1X38A 1KDPA 3A3KA 1AS2A 4UOZA 3V8PA 2O8DA 1ODJA 3ZTYA 3NB0A 4DZRA 4AY3A 4WZZA 3UJDA 1JEYA 3HY3A 4A8JC 4XB1A 1MMFB 1M0WA 4OYLA 1R1DA 3COVA 1M6VA 1XAIA 4RVOA 2HMVA 4D74A 3ORYA 1YZKA 2ZRQA 2F1IA 4IFTA 3TUJC 5HIAA 1CY4A 1NBMA 2YJGA 3GJ6A 3OOEA 1V9CA 3ZV3A 3FIUA 2C04A 3AR4A 1P5JA 3P4XA 4B3HA 4I1PA 1YRWA 3FYUA 3L4SO 3G0HA 5FBZA 2QRPA 2NUAA 2YWEA 3DBHA 2CMDA 5B6JA 2AFIB 1E5DA 1B26A 1E9DA 1YBMA 3GLKA 1UANA 5H02A 3UYKA 4JU8A 5A6VA 1U0LA 5I9SA 4BS9A 1M0EA 2FPOA 2ZIAA 4KQ6A 2C2XA 2ETVA 3HVUA 1NVVR 5HQTA 3M81A 5CAEB 3WDKA 1DZIA 2HQOA 2CLEB 1K7FB 2P0YA 4DSAA 2LZ0A 2IS4A 1EQAA 4DLNA 2E37A 4XE5A 1TMGE 1Y7HA 2NZ2A 3KXLA 1XZHA 3W5DA 3TZEA 1HTWA 4JP8A 1AURA 4KVGA 5DYWA 4HXYA 4RXUA 4UZFA 4KYTA 1UQUA 2O1XA 1JQLB 2X8AA 2QXYA 1ZOPA 2AQKA 2Z5FA 5BV0A 3JQEA 4MV3A 4XASA 4EAAA 1CRWG 3OJFA 4M98A 5ITZA 4JJIA 3WGQA 2INGX 4L8GA 1MRZA 2QD1A 4BMPB 3DOCA 5BOSB 3DNMA 2HD4A 1KK0A 4POAA 4N5NA 3D4IA 1O8CA 2OHIA 1E4EA 1ZW6A 3DP9A 3HCRA 1JTEA 2FEXA 2P90A 3M1LA 3OJLA 4JEUA 4W1QA 4WLFA 5IAAA 3RE1A 5KKCA 3DM9B 3HBMA 4PAOA 2XHEA 4IIVA 3UOAB 3ZCPA 3TIVA 4IIJF 2WC1A 3R3WA 2O8NA 2PO5A 3SHOA 5JW6A 1V25A 1JHMA 1RRFA 1X1AA 2DBRA 3NXKA 2HK6A 4I19A 3PHHA 1D2CA 1Z5PA 1F06A 5ED4A 1XQ6A 1Y1LA 3K9QO 2WIFA 1TM3E 3LDFA 1Z17A 3OUUA 3P9PA 1SZPA 3RH0A 1EMDA 3R5HA 4FKZA 3OCVA 1KWGA 2Z1DA 3VJRA 3O90A 1GARA 1SOUA 2ZI3A 1SBZA 2E21A 2X2OA 3HPQA 3JVVA 3A4MA 4FHFA 3PS9A 4AZ3B 1ZD9A 4DDVA 4DIOA 4JV5B 1F9EA 2XY4A 5EJ7A 1XU7A 2L0XA 4L6CA 5T8KC 3EWIA 3OFSA 3C24A 4XA8A 3WRWA 2EKDA 5JXGA 1PR9A 1ICIA 2BGLA 2RHDA 3AOGA 2QE7A 1LBQA 4QDTA 4EDHA 1WY5A 3H0CA 4QTXA 3VNUA 3UBMA 1N2IA 2WF7A 5LXTF 1GQRA 3AP2A 2QDXA 4O02B 1WLYA 1LDNA 1P9RA 3HJAA 4OMCA 4WZAA 1BSVA 4NFHA 2W2PA 1UJMA 4OXKA 3HA5A 5DCYA 3G85A 1JTFA 2V0CA 4I9UA 5EXSA 3SEFA 1BFKA 2H7YA 3M6LA 4GPD1 1GNTA 3IVAA 3AUSA 2H17A 1B2RA 3GVXA 3LCRA 4F3RA 5FYDA 2NU7B 1P77A 1H69A 2GBCA 4ZAYA 2I54A 2YQ4A 1R12A 1WDKA 3EBOA 4RFLA 2HA0A 4OUDB 5JEEA 2WWYA 3U6BA 1VHLA 4PBRA 3B7PA 1V0JA 1AHIA 1U80A 1JWAB 4U0KA 1OF1A 2W2XA 3D3JA 5ERYA 3NHZA 1QWOA 1ZI9A 2G4LA 2R6GA 3Q3GE 1U7PA 4EF4A 3AYXB 5CJPA 4MHSA 2O2SA 3H5IA 4QDJA 2HA4A 4GO1A 4TKUB 5C8ZA 1UBEA 2QW1A 4GOMD 2M6KA 1CQXA 3RNLA 1LCIA 2QTLA 1A9OA 4C21A 1DKUA 3D5TA 4M1OA 3CW2A 1XAJA 1NR1A 2QN8A 4BP1A 2I62A 3K4HA 5I7EA 2C7QA 5JWHA 1Q84A 3LPLA 1JTVA 3L1UA 2CXSA 2Q1UA 1IN8A 2QKYA 1ZSYA 3ZE8A 1C7EA 3ICPA 2PSJA 3BK7A 5H80A 1GVHA 1Y8QB 1YHNA 1CRLA 3V48A 1LLCA 4MDHA 3RVSA 2V8BA 1KQGA 2X8WA 1E6UA 1PQYA 2RHBA 3GOQA 3LA8A 5BRAA 4QUJA 1C1XA 5BO5A 3VKUA 1JDUA 1W29A 1QRAA 3CM0A 3TMAA 3W2HA 5BVGB 2Y8EA 3UWMA 5EJIA 2E49A 4NFYA 3RVRA 2HYIC 2QD4A 1P7PA 2QG6A 1NGSA 2VDNB 3PSHA 4NE9A 5DX0A 1DVRA 3LP8A 3PX2A 5I9TA 2QLNA 4IWNA 3GLFA 1NPDA 2WYVA 3L04A 3JQGA 1X8KA 4RMJA 3D7SA 3AHHA 3D81A 1G8SA 3ZLVA 4EKYA 3OWXA 4CMIA 4XTCS 3IYLW 3EZXA 2A57A 1M1XB 2XUAA 3PENA 2NSDA 3BMQA 3GFVA 1YDEA 3FUXA 3RFCA 2I7DA 3ZWCA 5BT8A 1SB8A 3KTFA 2QQFA 3ZK9A 4BZQA 3LDHA 1VHDA 2RHGB 1W88A 3P2EA 2QQ0A 3LM8A 3M1AA 1CULC 2WWFA 3KVNA 4TMFA 5ALSA 3GLIB 3IHWA 2QL5A 3LS2A 3SM9A 2HMYB 4MA5A 2Q0QA 2XJ4A 4N0MA 3R0IA 1YD7A 3OT1A 3P9RA <