4HZ8A

Crystal structure of bglb with natural substrate
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
439
structure length
439
Chain Sequence
KFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Beta-glucosidase
total genus 171
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz8A00
4HPGA 3ZSTA 3FHAA 4D6FA 3CIVA 5KZ6A 2WCGA 1EDTA 1HJXA 1PX4A 1K9FA 2WSPA 2ZUTA 1CLVA 2X1IA 1CDGA 5I5RA 1CGTA 4ZXOA 4M8UA 3SCVA 3AFBA 4DUXA 2DSZA 1RPKA 4N42A 3UETA 1K6AA 1FA2A 4AZ6A 4TX6A 2QHAA 1E9LA 1CLXA 4AZHA 3FXYA 4JKLA 1GOOA 4HP5A 4CKQA 1GOQA 4W7WA 1EH9A 1B90A 5HNNA 1OT1A 1HF6A 3W53A 4CCCA 4YHGA 1BYAA 1R85A 4W87A 2WAGA 5M5DA 3VDBA 2NSXA 3WSUA 1ISZA 3SUWA 3ZOAA 3WDRA 3ARQA 3UESA 4AW7A 3PHAA 2YA0A 1GNXA 1YHTA 4U3CA 4AZIA 1WO2A 1K9DA 1B9ZA 3GTNA 1NQ6A 3SCWA 1HVXA 4F8XA 4XV0A 1KXQA 3K46A 1OD0A 1LL4A 4HOZA 4F79A 4GZIA 1UH4A 2VX5A 3ARXA 3PZQA 4U5IA 4UQEA 3WL0A 1WPCA 3K8KA 4TOQA 2Y24A 5A6BA 2DT2A 1KXTA 2PWDA 1XSJA 3ARRA 4MDOA 4D6GA 1GOKA 4GPNA 1XHGA 1XH1A 4AYSA 4F66A 2Y8KA 3PZNA 3W0KA 1J01A 3T08A 1LG1A 2D0HA 2WSKA 1XRVA 3NDYA 1GOIA 2ZXDA 1KB3A 3NCOA 3VM7A 3RCNA 1B1YA 2XVGA 4HA1A 1B3XA 1GVIA 3CZGA 1KCLA 4H8UA 4IPNB 1C8QA 2XIBA 4J3UA 4PCTA 4PCSA 1QNPA 1Y7VA 2JIWA 1FFQA 2QLYA 1XYZA 3AS3A 3L4UA 4B9YA 1TR1A 1DWIM 3ZT5A 3NDZA 1C7TA 1DWJM 2DSVA 4W5ZA 1U33A 4U2YA 1KQZA 1PEZA 2ZX6A 3MS8A 3JUGA 1ZBKA 3OZOA 4AD1A 1CXHA 3VILA 4B3KA 2O9TA 2W63A 3VGGA 4HMEA 2PC8A 2WZEA 4PBGA 5CXPA 2PB1A 1UYQA 2XPKA 2W66A 4PMYA 4V28A 4W8BA 4MJ2A 4JL2A 1VFMA 1WZLA 1US2A 1NP2A 4CN4A 4F9JA 5I2UA 2GSJA 1KCKA 3ZSSA 2VTFA 3CZEA 4HZ7A 2IXVA 3SCRA 3KE0A 6A3HA 1UH2A 1KGUA 1NWSA 2MANA 3ARPA 3W4RA 2VT0A 1CXFA 3WNPA 3PZVA 2JEQA 2GUYA 3WQ5A 3GNRA 3TTYA 1V3MA 3WNLA 4ZE4A 1V0MA 2VCAA 1BYCA 1R87A 2WHKA 5GPRA 3VDHA 1MXDA 4AIEA 3T2OA 1IZKA 1B0IA 1CENA 3OLIA 3N15A 1E6SM 1JF6A 2FH8A 5CQ1A 5BROA 3BMVA 3TTQA 2YLAA 1DWHM 3WELA 5C70A 3CUFA 1BVZA 2WKGA 1JF5A 1FFRA 4E8DA 4IUGA 3B9DA 1XD1A 2W92A 4RL3A 2WVUA 3O6AA 5JBEA 1TVNA 3CZJA 3WMSA 4BQ4A 1C91A 1XH0A 1MWOA 1GJWA 2WXDM 1W32A 3N13A 3GXDA 2CYGA 3CHDA 1JZ4A 1UUQA 3MUAA 3LPOA 4TX8A 5A6LA 3AISA 4W85A 2E3ZA 4AMCA 2XVKA 3NIYA 2VUYA 1E0VA 4NRSA 1UQYA 3S6TA 5A6KA 3VIKA 4UZSA 1E6ZA 2ZWYA 3O9NA 4D6HA 3VD9A 4XZBA 2E8ZA 1U30A 2WVTA 4J3XA 2V5DA 2CCRA 2VCBA 1UHVA 1H3GA 3D5HA 1PIFA 3WF4A 4L4PA 3QHOA 4BCEA 4OOZA 2HVMA 4TXEA 3CUIA 4U3AA 1LWHA 1E72M 4C7DA 4UOJA 4MADA 1NOWA 1E1FA 1NWUA 1QW8A 3MUZ1 2BHUA 3BMWA 3L4XA 3AROA 1JG9A 3VOCA 1UWRA 1BTCA 3WNNA 3LPFA 3MMDA 3AXHA 3CUGA 2GDUA 5ECUA 4AEFA 3GYCA 2PBGA 2WHLA 2WMGA 3WH6A 5BRPA 3CMGA 2QMKA 5I24A 1NP0A 1E6NA 3VMOA 1NOUA 1CGXA 3K4AA 4PTXA 4HMDA 4Z2IA 4JFUA 4UQCA 4ZE5A 5F7UA 3VIMA 3RPMA 3N18A 5C71A 1DWAM 4WKAA 1NM9A 1E1EA 4OKDA 1ITCA 1B3VA 1CWYA 3WQ8A 1PBGA 1W3KA 1V3LA 4Z2LA 2YOCA 2EPMX 4W93A 1UD8A 4UQDA 3CUHA 2WC7A 3W38A 4D6EA 4XB3A 3BAXA 1J11A 1ZJBA 5D9NA 3EDKA 1WNOA 1UZ4A 5I3DA 3K8MA 1AQHA 1VEOA 3AHVA 3WUFA 2WLYA 1GUVA 1VAHA 2X0HA 3GNPA 2A3AA 4AD4A 4DUVA 1TFVA 1I1WA 3DYOA 3W6LA 4M80A 4BQ5A 2OWCA 1UH3A 2XVNA 4PMXA 3VGFA 2D23A 2E8YA 1D3CA 3NSMA 4M81A 3GBEA 1AQ0A 1JZ6A 3T0BA 3VIHA 2C7FA 5CSUA 1FHLA 1SYTA 1CXLA 2CESA 4AZ7A 3VINA 1Q6FA 1UD4A 2BVDA 2B31A 3VKKA 3PZIA 1E15A 1TCMA 4WLCA 3E1F1 2DH2A 3THDA 5IHRA 1WDSA 1JYXA 2WWCA 4EAMA 1VFFA 3WENA 3ZQ9A 1ESWA 5A8NA 4H2CA 2E40A 2V3DA 1R86A 3SIMA 1EDGA 5AC5A 1HT6A 3BSGA 4HZ8A 1E6RA 4W89A 3SUUA 4PMQA 1NARA 1HKJA 4C7FA 4R27A 4UR9A 1JAEA 3WQVA 4DWSA 1XSKA 4B9ZA 2WZHA 2BNJA 5EFFA 3QR3A 2J7EA 4QDMA 1AMYA 1MXGA 1XCWA 4PUDA 1CTNA 1WZMA 1OIMA 5A94A 4ML4A 1AVAA 4CGTA 5JIPA 1JZ3A 1OT2A 3RO8A 3WMBA 3WD1A 1R7OA 4GQRA 2VVNA 2CNCA 3WH9A 4TVUA 3VIOA 1JDCA 5AYBA 9CGTA 1MYRA 4CD8A 4GIAA 3SCUA 3OGSA 4JKMA 1V3JA 4ACZA 1PAMA 1Q6GA 3POCA 4RE3A 1EO7A 3AMDA 2YA2A 4UQ9A 4CN1A 2X0YA 3THCA 1KQYA 3AQUA 5ABEA 4BQ2A 3RILA 3N1AA 3W82A 1S46A 2FHBA 2D0GA 1WB0A 1GOWA 3WFLA 1O6IA 3M6DA 2EQDA 4P7NA 2YDRA 4WIWA 1W3LA 1DWGM 5D9OA 2O9OA 1P6WA 4UFLA 2D20A 3WBAA 4E8CA 2BVTA 3UG4A 5C8BB 1A47A 2VZUA 3ZJKA 3ZR6A 1K9EA 1IZJA 5BWFA 4J27A 4P7OA 4JCLA 4AZCB 4PSPA 3O2LA 4TUFA 4A3YA 1W3JA 1GQIA 3ARVA 1LWJA 5HBFA 3KEHA 2A3EA 4AY1A 3BXWA 2ZX5A 4FMVA 4CU6A 2DIJA 2VR5A 1UR9A 2UY3A 2BFGA 3VDAA 4X0VA 4P7RA 1V6WA 3G6LA 1V08A 1LLOA 4ZXLA 3WY1A 3SCPA 4DWSC 5JIWA 4JHOA 4R5EA 4M24A 3SCQA 2DDXA 2GJPA 2TAAA 1BFNA 2C8NA 1H4PA 1J0HA 4GINA 2IUZA 5HXMA 4EK7A 5HPCA 2J4GA 3M07A 4OBRA 5I77A 4FF5A 3F5LA 1HKMA 5DO8A 1F4AA 1C90A 2VNCA 1WCGA 5DEZA 3T2QA 3WH5A 3AMGA 4AC1X 2ZX7A 1BVNP 5IXEA 3RDKA 1FH9A 1J0ZA 2J78A 5DF0A 4CN6A 2GK1A 4X0NA 4TTUA 2DT0A 2PF0A 1IV8A 2VRKA 1V03A 2BY3A 5EBAA 5A8PA 2YL5A 2VURA 3ZR5A 4WK9A 1VRXA 5D9MA 4UTFA 1YQ2A 2DGAA 4Z2KA 1FH8A 1E56A 2PWEA 2VZOA 4AEEA 1VEPA 1V3IA 2ZUVA 3APGA 3ECQA 5ABFB 4PMDA 5I0DA 1EQCA 4UOZA 1W1YA 1RH9A 2E9BA 2G41A 4NF7A 1CPUA 2XFRA 3MUIA 1JIBA 2WANA 3KZSA 1FH7A 2F8QA 1UR8A 2BXYA 3KL0A 3PZ9A 2QPUA 3PN8A 4CU8A 1EOMA 4K68A 4A3HA 1UR0A 1HN1A 2EPKX 5DFAA 2NT1A 1HNYA 2OSYA 1GW1A 3OZPA 1UWTA 4E2OA 1QNRA 3A6OA 5HDRA 1H11A 4OUEA 1Q6EA 3GM8A 3DECA 4MB5A 5KEZA 1JFXA 3N9KA 1J0YA 1DWFM 1JL8A 3SCSA 2WW5A 4GO8A 4MTVA 1O7AA 2EO7A 3CLWA 3GZAA 1HJVA 1CGYA 3HMCA 3MU7A 3FNDA 1W2PA 4ZFMA 4H8VA 4KRUA 4MB1A 2OWXA 1LQ0A 3FW6A 5BRQA 4J3VA 5GQBA 3DYMA 4JL1A 4DM2A 1JZ7A 2DQXA 2XSAA 3IANA 4YN5A 5I23A 3AIUA 1LG2A 4MPKA 4QLKA 4ATDA 1XGZA 3BAKA 3BH4A 4CD7A 1JZ8A 2Q8XA 2GJRA 2D3LA 4UFMA 2XYLA 3T09A 4Y7EA 4B16A 3AYRA 1SFSA 4KGLA 1ODZA 4WKHA 4AZBA 5E0FA 4UFKA 3W6MA 2WK2A 2XGBA 4FLSA 3W81A 3ARWA 3F5JA 1JGIA 5D9PA 4PTMA 5CLTA 3CHFA 4MNMA 4S3KA 3WQ4A 4CUCA 2XVPA 3WEMA 4AZGA 3BCFA 2VVSA 5ABGA 1QNSA 2J7CA 1W9BM 1OINA 3W25A 1OD8A 4UZUA 4S3JA 5E9AA 1E4IA 2CITA 5CJ5A 3MUY1 4PMVA 1GZJA 1B3YA 1BG9A 4LQ1A 3MMWA 1ZS2A 3VPLA 4FLRA 2DSKA 2D22A 2J7HA 3BAIA 2EJ1A 3IAPA 2DPEA 4W8LA 1KXHA 2J47A 1CBGA 3WNMA 2BY1A 2BVYA 1W1VA 3A3HA 5BXRA 5JBDA 1UKQA 2GFTA 3RMEA 3EDDA 3KL3A 1QHOA 4UQBA 5A8MA 5D8ZA 4W5UA 1WDPA 3AI0A 1EA9C 4W84A 1GOMA 1QPKA 4W7VA 2XWDA 1KWGA 1XCXA 2CPUA 4P8VA 5LA0A 1KGWA 2V38A 3WQ6A 5CZKA 3UCQA 4W7UA 1RP8A 2EPNA 1OGSA 2XGIA 1IT0A 3OB8A 2WWDA 2JE8A 3WQWA 1C93A 3VX0A 1J9YA 2WZIA 2RGLA 2JIEA 1W1PA 2F2HA 1KFWA 1W3HA 3SUTA 2YJQA 1UD2A 3OBAA 1MW3A 1OB0A 3N04A 4HA3A 3OGRA 4YPJA 3MANA 1BSIA 3VNYA 3AZSA 5IFPA 3EDFA 3WN6A 1EHNA 2YDSA 2VZVA 3DHUA 1BYBA 3FAWA 3WD0A 3AIRA 3WEZA 4PMNA 2WPGA 2RGMA 2E9LA 1TMQA 4HTYA 4AZ5A 1JDAA 5CPQA 1QI2A 4RE4A 1EHAA 2FDMA 3PZTA 3MV11 2ZUNA 4JAWA 1UD5A 3ALFA 3L4VA 1J0KA 3CGTA 5A2BA 2UY5A 5D4YA 4HZ6A 1QBBA 3UEQA 1MVYA 2XSBA 4XX6A 1L8NA 1WZAA 3AMLA 1D2KA 4UQAA 4U33A 1PJ9A 5IFTA 2V3GA 3WL1A 3WNKA 4LYQA 2FH6A 2CHNA 5A8OA 3HN3A 2CXGA 2FGLA 5BXPA 2GDVA 1UZ1A 4PMUA 1ISVA 2O9RA 4FLOA 5ABHA 2DT1A 1UKOA 2ZUUA 1ITXA 3TP4A 3ARZA 2YKKA 2X2YA 2V5CA 1E71M 1W91A 1NWTA 2XWEA 4AD2A 3W28A 4DM1A 3DHPA 3ARTA 4CU7A 3AMCA 3DC0A 2WVVA 4OZOA 4H7VA 1UD3A 4ACYA 2WMJA 1GHSA 4X9YA 1U2YA 2QMJA 1EOKA 4M82A 4YHEA 3GXMA 3VTRA 1HKKA 2OYMA 1M04A 1VIWA 4PTWA 2XM1A 2PWHA 2VI0A 3W26A 1KGXA 1UWUA 4GKLA 1WP6A 1QHZA 3WF0A 1Q6DA 1E6XM 4ZEPA 4TTGA 4D1IA 3VNZA 3WUBA 2BY0A 1FHDA 3KL5A 1G0CA 3WIJA 4WSJA 3VGHA 4NRRA 3VGDA 2D3NA 1JD9A 3SURA 2UY4A 2W5FA 4B3LA 3WD2A 2WMKA 3WFZA 2WMHA 2A3BA 2W91A 3IJ7A 4V2XA 3U57A 4P8WA 1WKYA 3UG3A 1QI3A 4CD6A 4BQ3A 1OIFA 2FHCA 5A8QA 3BLKA 3VD3A 4AIOA 2NT0A 3W27A 1E55A 1NH6A 2PWGA 3CMJA 4J7RA 1H2JA 4W88A 1W9UA 1MW0A 5FD0A 1ZL1A 1EDQA 1E5JA 2UY2A 3VD5A 3SCNA 5AYIA 3W37A 1XYFA 5E6ZA 1ZB5A 3GDBA 3WF2A 4MNKA 1UR4A 5JBFA 2OSXA 1I1XA 3T0DA 3WMCA 3AIWA 2DEPA 1JZ5A 2BS9A 4GO9A 1H5VA 4MB4A 2XVLA 4PMZA 2ZICA 3SEPA 1E40A 1OM0A 3VX1A 5CGMA 1MFVA 1WDQA 4DWSD 1DTUA 4KMQA 3PTKA 1VFUA 2WC4A 6CGTA 3SCOA 3PZMA 1E3ZA 3GH4A 4J28A 2VJXA 4UCFA 1H0GA 2W62A 5CSYA 3VU2A 4WJXA 2X8RA 2OYKA 1JI2A 3ZT7A 3N11A 4QAWA 3PBGA 3VMPA 3BSHA 1UWSA 5IHSA 2VRJA 3FY1A 5LA1A 1UWQA 3I3BA 4M1RA 2VZTA 3QHNA 1CEOA 4DUWA 1MQPA 4PUEA 1E4NA 1A3HA 1JDDA 4H8HA 4Q7NA 1AQMA 3LMYA 4MDPA 4B15A 3ZJ8A 1C8XA 2JEPA 4J3TA 3WD3A 1JD7A 3OIHA 4GXPA 1JZ2A 4Q22A 5HOSA 3MSDA 2J77A 1B30A 1HVQA 4GQQA 1JXJA 1H1NA 4D71A 3AS1A 5CPSA 4ACZB 1MQQA 2WCAA 1HX0A 1MW1A 1ISYA 2CERA 3VD4A 3WDQA 4HA4A 3CZLA 3WH7A 2E9MA 1JI1A 2VR4A 1LF1A 4AD0A 1TA3A 2EPOA 5I6SA 4AZCA 2J7FA 4NSBA 2D2OA 4PRWA 5I78A 1UA3A 4PYSA 4D72A 5GNYA 1PZ2A 2YBTA 4IPLA 1CZ1A 1ZBVA 2C0HA 2EEXA 2WVSA 3WDIA 4DWSB 1CGVA 1H09A 3CH9A 1FP8A 1F4HA 3GNOA 3L2LA 1EIBA 2OWWA 1X6LA 2BV9A 3QOMA 2X05A 3VIPA 2D1ZA 2D24A 2VC9A 4QCFA 2XTKA 4JFVA 3AHYA 4EKJA 2JF7A 1M03A 2ZUWA 4CCEA 1K9TA 1CYGA 2Y4SA 2E4TA 1SR0A 1QI4A 1J18A 3D3AA 3OLGA 4JFSA 2ZUSA 3AXXA 1KBBA 1PX3A 3NJ3A 3AICA 5E6YA 1BG4A 1V0KA 1EO5A 5E09A 1PZ3A 3AS2A 2BHZA 3CZKA 2WBGA 3ARUA 2CEQA 2YDQA 3OLDA 1UQZA 3VUPA 4AXNA 1TG7A 3GBDA 1BGAA 1VF8A 2BHYA 2JALA 2VX6A 3AIVA 5A1AA 2WYSA 4D6CA 4LGXA 5BCAA 1V6UA 4P7QA 2XHYA 1KXVA 4JZ5A 1G1YA 3AOFA 3HU7A 1MQRA 3IAQA 2ZE0A 2XFFA 3WF1A 3VM5A 3L4WA 3I3DA 5CPTA 1HKIA 4CCDA 4Z2GA 2DSWA 2A3HA 2VZSA 2CBIA 4D6IA 2F61A 3F4VA 2DIEA 3UERA 1EGZA 4LXFA 2QF8A 2G3JA 3MMUA 4QLLA 3FHQA 1E70M 5FIPA 1MW2A 4URIA 2Y5EA 5FL0A 5LA2A 5DMYA 2X09A 1JYNA 4KH2A 1QW9A 3PTMA 4BA0A 5BYWA 1HP5A 5TD4A 3RM8A 1GONA 2ZX9A 4PTVA 4WSKA 3VDCA 3NSXA 2WBKA 2JF6A 3QOKA 7CGTA 1V0LA 1QI0A 5BXTA 1ISXA 1FOBA 3WDJA 5FCZA 1GHRA 3AXIA 2G8ZA 3WNOA 4HOXA 1OGGA 4M29A 2Z1KA 2HISA 4P8UA 1XV8A 2NW0A 2J62A 4A4AA 3RJYA 4MB3A 1V6YA 3VD7A 4AWEA 2WHJA 4J3WA 4UOQA 2VQTA 1CXKA 3PZUA 3OGVA 3LPGA 4AD3A 1TE1A 1CNVA 1OBAA 3U5YA 3EMZA 5A6JA 2V3EA 3VMNA 3ZIZA 3S2CA 3AIEA 1C8YA 2J8FA 2YA1A 1NWRA 1V02A 1KWKA 1BHGA 1I75A 4JHZA 1G5AA 1HXJA 1HJWA 3PZGA 5D8WA 2ZIDA 3TTSA 2DH3A 3FN9A 3BAJA 3L4TA 3BC9A 4MNJA 1GVYA 1ZBCA 4D1JA 3VO0A 5A6MA 5M03A 4QP0A 3K8LA 2Y2WA 3LPPA 5ABFA 4UNIA 2VMFA 4KGJA 2QPSA 2FHFA 5A69A 2J79A 3GXFA 4NZCA 2VRQA 3VIFA 1G94A 4TVCA 4RE2A 1Z32X 1HL8A 1VJZA 1US3A 4Z2JA 3IJ9A 2IXUA 3WH8A 3ZJ6A 2G3NA 2VOTA 2WCSA 3AIQA 2CBJA 1VFOA 1PPIA 1W2VA 2G3IA 3EDJA 2WC3A 1DP0A 2J7BA 1J0JA 1NOFA 1E43A 1RD6A 2FGZA 4P7LA 2J7GA 2XUCA 3NUKA 2CETA 1G01A 2WM0A 1R7AA 1LL7A 4U31A 1PIGA 3CTTA 5M3WA 2J8GA 1JNDA 2UWFA 1EXPA 1E73M 3HJEA 3ARYA 1SMDA 3N12A 2O9PA 1GQJA 3AHZA 5EFDA 1J12A 1TZ7A 1W9VA 2XJ7A 1QVBA 1V3HA 2YL8A 4IM4A 3POHA 4D6DA 3WDHA 1N82A 2W4XA 3TA9A 2PI6A 3GXIA 4GZJA 2ESCA 3BAYA 3RJXA 4OOUA 1HIZA 3B9EA 2ZXQA 1E0XA 1KR0A 2EBNA 4WKFA 2J75A 1VBRA 3TOPA 3ALGA 4FK9A 3A4XA 1L0PA 1B3ZA 2Z1SA 4CD5A 4BF7A 4JIEA 3K4DA 8CGTA 4HU0A 4XUYA 5A6AA 4NI3A 1UKTA 1CXEA 1X1NA 2WHMA 3GH7A 2XIIA 4LYPA 1UWIA 4LYRA 1H0IA 3AZTA 4JFWA 2EXOA 1QOXA 2CBUA 1TUXA 1E6QM 1JFHA 1VB9A 2W61A 4MJ4A 4ZENA 3RM4A 4TVDA 5A3HA 4XZWA 3MKKA 1VBUA 1OWQA 3NYDA 1HP4A 2YIHA 2XG9A 2AAAA 2YLLA 4E4PA 3RIKA 2VQUA 1UOKA 3PTQA 3MSGA 3WEOA 5A2CA 1E4LA 2OLHA 4JKKA 3A4WA 3BCDA 3TONA 4HU8A 2WKLA 3WF3A 2AMGA 3RM9A 4HPHA 4W8AA 4JCMA 5LYRA 1XSIA 4F9DA 2WNWA 3EYPA 3AMKA 4GI9A 4UFHA 3W29A 2J7DA 1UD6A 3BLPX 4U2ZA 3A4AA 3VGBA 2ZXAA 1CGWA 4FLQA 1C7SA 5AY7A 3ARSA 3M7SA 1QI5A 3VIGA 2J74A 4BZYA 3CO4A 4KWUA 3U7BA 3UG5A 3DYPA 3KWXA 3MV01 7TAAA 5A95A 2J25A 1WZKA 3IK2A 1BLIA 2AOSA 3SUSA 4C7GA 1ECEA 1BGGA 1UG6A 1W1TA 3IJ8A 5CLWA 2PBOA 3WKZA 2DT3A 1TA3B 1XD0A 5HPOA 1B3WA 4LX4A 4IISA 4J3SA 5E0CA 2VO5A 3W24A 3WUGA 1PX8A 1V02E 1J10A 3ZO9A 2VCCA 1C92A 1V6VA 2V3FA 3ZMRA 2YL6A 5EMYA 1UKPA 4PMOA 4U5KA 1HJSA 3SUVA 2ZUMA 2CKSA 2OSWA 1TVPA 1GJUA 3A47A 4EANA 5IDIA 2VL4A 2JFEX 3BGAA 1UA7A 1E4MM 1KBKA 1GQKA 5GNXA 3PZOA 5CGTA 3J7HA 2A3CA 5I79A 1GQLA 3QHMA 1ZBWA 1UKSA 2WMFA 1V3KA 1E0WA 1WDRA 1V6XA 1WE5A 1EQPA 3BAWA 4L4OA 2XFYA 2ZXBA 3QGVA 8A3HA 2VX4A 4MAVA 3AJ7A 3L2MA 4GZEA 3T0AA 3L4ZA 4AIUA 3ZT6A 1G9HA 3EBVA 4H04A 1JYVA 1W9PA 3I3EA 2GJXA 4CVWA 4PMRA 4AD5A 1JAKA 1ODUA 5CG0A 7A3HA 1OCQA 4AISA 1QNOA 5DT5A 2W67A 1E6PA 3M46A 3ZM8A 2CBVA 4MNLA 5A6BD 3AYSA 2O92A 1MFUA 1E3XA 1ZU8A 2QV4A 3T2PA 2CKRA 3VVGA 3B8SA 2WMIA 4UFIA 4PSRA 1OSEA 3NSNA 4LPCA 3ZJ7A 2VX7A 4ATWA 3UR8A 3WD4A 2BY2A 4V27A 1HJUA 1BF2A 5FOOA 2DSUA 3OA5A 5JUVA 2GK1B 3G6MA 2Y8VA 6TAAA 4HMCA 4OJYA 1JYWA 1QNQA 4QCEA 3FAXA 3B9AA 3WDPP 1LJYA 3AHTA 3CBWA 1DHKA 3II1A 4N0RA 4GI8A 1V0NA 4QFUA 1XC6A 3AZRA 3UR7A 1H49A 3TTOA 2OYLA 3K1DA 2WLZA 5AC4A 1GORA 3CHEA 3EDEA 1QBAA 3N17A 4OIFA 4PEEA 2G3MA 1GCYA 1GPFA 4BS0A 1WAWA 5BXSA 4QLJA 3SCTA 4M56A 1M01A 1CECA 5DT7A 1LL6A 1Q6CA 5FKYA 4ATLA 2CHOA 4CD4A 1BQCA 3VIIA 4MAZA 1KR1A 1RP9A 2GJXB 3F5KA 1M7XA 4D6JA 3OLEA 3CHCA 3CZ8A 5M17A 2BXZA 2E0PA 4H41A 2ZWZA 1R8LA 1QHPA 2WVVB 1ISWA 1B31A 2XM2A 3WUEA 1CGUA 1C3FA 4JFTA 1SMAA 1VENA 1FP9A 2CIPA 1JNEA 1D7FA 1DEDA 1H41A 1XH2A 3VIJA 1ZJAA 4KRTA 1JXKA 2YL9A 1CXIA 4UFJA 1Q4NX 2WB5A 1HJQA 5A6SA 4GI6A 1CIUA 3GH5A 2G4FA 3CUJA 2YBUA 1UR1A 4HOWA 3EMQA 4Z2HA 1E5NA 2WMIB 5EB8A 3U7VA 1BYDA 1VEMA 1HL9A 3AS0A 1UR2A 3L4YA 3U5UA 3OG2A 3AIBA 4EE9A 2D0FA 4PN2A 1B2YA 1W9DM 1OGBA 1BPLB 3AHXA 1M53A 5GNZA 2ZOXA 2EPLX 1J0IA 3MO4A 5A2AA 3VGEA 2ZX8A 1BAGA 2GVYA 3EMCA 4WF7A 4W86A 3CPUA 1X6NA 5FL1A 4P8XA 1W9XA 4OBSA 3WBEA 5E70A 4CVUA 2PWFA 1VJSA
chains in the Genus database with same CATH superfamily
1WV2A 2I5GA 1K77A 3ZZ1A 1NF0A 4LYKA 1EDTA 1G4TA 4JTKA 3UFYA 4PUUA 1FWRA 1TQJA 1CGTA 1TWZA 4MZ1A 4F48A 2C14A 4Q4KA 4DQWA 4WXYA 3PM6A 4AZ6A 3QV8A 2QHAA 1E9LA 5HINA 2CZFA 3DFHA 4AZHA 4LRSA 4JKLA 4NHVA 3R0UA 1GYNA 4XSMA 4GG9A 3LQGA 5CAKA 1IF2A 1H7PA 3LXCA 3UXLA 3W53A 4JQ4A 1BYAA 4W87A 3VDBA 2NSXA 3ARQA 4H00A 4RZBA 5LNSA 1A5KC 3FX4A 2VFFA 3GTNA 3U2ZA 3UGVA 3K46A 1OD0A 4CLMA 1LL4A 4HOZA 1UH4A 2VX5A 4U5IA 4UQEA 5AHFA 3T0CA 4GACA 1TPWA 1S2UA 1R5YA 2DT2A 1EB3A 3NOEA 3B8DA 4QJ5B 4QJ4B 3PWGA 2PWDA 2QUNA 3ARRA 4MDOA 3VOIA 3KOXA 1XHGA 1PDYA 2OCZA 1XKYA 5GJPA 5AVNA 3PZNA 4KW2A 1J01A 4KWWA 1KM1A 1GOIA 1FWNA 2ZXDA 1PCKA 3CZGA 1QDSA 3RLGA 4J3UA 1JUKA 4JTTA 1Y7VA 2JIWA 3FDKA 1FFQA 2DZPA 3L4UA 3AS3A 4B9YA 1TMLA 1MUMA 2INEA 1C7TA 2VUNA 3GIPA 3W86A 1TYGA 1KQZA 1PEZA 3S1GA 3E2SA 3ANUA 1ZBKA 1OADA 2EAWA 3OZOA 8XIMA 2ZRWA 3B8IA 3JW7A 4HNVA 4HMEA 3RX3A 3N19B 4PBGA 1UBPC 2J88A 2HE5A 1FWTA 2HCVA 1UYQA 4JTUA 2XPKA 4PMYA 4ZB5A 3TU9A 2GSJA 1KCKA 4RKAA 2NQ9A 4RV3A 3M16A 3SCRA 3KE0A 1KTNA 1W6TA 3HZ3A 3TCSA 2X16A 1KM4A 1R6WA 4GH1A 4W9TA 3CQIA 3HO8A 3QZ6A 3PZVA 2Y61A 5EBUA 3WQ5A 4GA8A 1T0OA 2GGJA 4ZE4A 1BYCA 1XC4A 2WHKA 3NFUA 5GPRA 4C1LA 1VJIA 1VIZA 4GFIA 2FJKA 4FX8A 4B2DD 3VNKA 1B0IA 2OXNA 4RNFA 2XN1A 4L56A 4RZ5A 3OLIA 1KLYA 3N15A 2Z4GA 4C6CA 3WK3A 4MVAA 5CQ1A 1YPIA 4QE5A 4UBPC 4XQ6A 3BMVA 1P48A 4FO4A 1DWHM 3WELA 5AHIA 5C70A 4CNOA 1UIPA 2WKGA 4G5DA 1FFRA 3TE9A 3B9DA 1GVRA 4HNUA 2W0UA 4FNTA 2VELA 2R1NA 3WMSA 3KRUA 3G1SA 3THUA 3CJPA 2WXDM 1W32A 3TN3A 1UUQA 4TX8A 3AISA 4W85A 2E3ZA 3PB2A 5TQLA 1ZJHA 1ZSXA 3IJIA 5CZ0A 3TW7A 3OBKA 3CO8A 4UZSA 1E6ZA 2ZWYA 3VCCA 3O9NA 4AB4A 2QUUA 3C2FA 1U30A 3LBOA 1JEZA 2VCBA 2AQOA 3BSMA 1H3GA 3D5HA 3CAVA 3ITOA 3M41A 3AJXA 3RCMA 2PPGA 4C1NA 4TXEA 4U3AA 4UOJA 3L9CA 1A0EA 3BURA 3M5VA 2ZZ3A 1E1FA 1QW8A 1R3VA 3AWOA 3ABSA 1KM2A 2GVJA 2RDWA 3VOCA 1UWRA 4ZOEA 1BTCA 4KT2A 2YDAA 3EX2A 3AXHA 1OABA 3CUGA 3GHTA 3W23A 1E1CB 2WHLA 3WH6A 3DKJA 4PRTA 1X38A 1OK6A 3DAQA 4UNLA 3QKEA 4RPQA 3VMOA 1NOUA 3RN6A 5IM51 4JFUA 4UQCA 3LHVA 4H6EA 4ZE5A 5CPNA 3B9OA 2DUXA 3RPMA 2C18A 3W2NA 1B3VA 3TYUA 3H6OA 1W3KA 1S5WA 2EPMX 4KCTA 4DWDA 2H6RA 4E2VA 1S2AA 1BKSA 2INFA 1F61A 3IACA 5FJIA 1ZJBA 5D9NA 3KVKA 3GKFA 3WUFA 3MPGA 1OCJA 1BRLB 3DYOA 1QXLA 2YBVA 3ICJA 1GT8A 1AH0A 2OWCA 3FSTA 2OGYA 5B7ZA 4E3VA 3HM7A 4OBTA 2PTWA 1XRFA 4YYCA 4M81A 2C6QA 1AQ0A 3HG5A 5D2VA 1FHLA 2CESA 1XIIA 5B80A 4ZVJA 3PZIA 3E1F1 4Q8PA 5IHRA 3THDA 2EJAA 4E6MA 2TMDA 3WENA 5DY3A 4H2CA 2E40A 2V3DA 4UTTA 1UC4A 2CLIA 1ZTVA 1W3IA 4PBEA 3OO2A 3FJNA 5BOOA 1HKJA 3SY8A 1XSKA 1TZ9A 2BNJA 4OE7A 3G0SA 5EFFA 3QR3A 4AX7A 4I6VA 4A6GA 3SDOA 4I7WA 3AU2A 1CTNA 1IWAA 3HPAA 3S5ZA 1OIMA 4ML4A 1JZ3A 4KFOA 2EHHA 3RO8A 3WD1A 2GWNA 3GDRA 4GQRA 4XTIA 3VIOA 4CD8A 3WQCA 1EJWC 3DHDA 4A8LA 1GEQA 2WSQA 4DBUA 3T78A 3POCA 4QROA 4RE3A 1C8VA 3AMDA 2YA2A 4QE1A 4AFYA 5HJXA 1HQTA 2HXUA 2OB3A 4C6IA 2X1SA 3EOLA 2X40A 3AQUA 4WUIA 3BQ6A 3N1AA 2HQAA 2D0GA 1WB0A 3H7VA 2ACQA 4P7NA 1V8EA 1W3LA 5ECVA 1WUEA 1P1MA 4H8NA 1OFEA 2EG6A 1P6WA 3W2KA 2OEMA 2D20A 4UFLA 1OC5A 3UG4A 3ZJKA 3ZR6A 2TRSA 1K9EA 3P61A 3BV4A 4WJEA 3ZWSA 1OY0A 3BCJA 1W3JA 2ZDRA 1L8PA 5HBFA 3LNMA 3BXWA 4GYPC 4XD4A 1Y5VA 4H6QA 1S1RA 3IJ6A 4DRSA 4OV4A 2BFGA 3LU2A 3KOZA 1F76A 2VXNA 3DBPA 2AL1A 4GCAA 4P7RA 5JH1A 4S3FA 4Q8MA 3G6LA 3O06A 3F4WA 3BOXA 1TV3A 3TYCA 1MRQA 1V79A 4DWSC 3EWZA 3B06A 1EA0A 5LSMA 4QSFA 1NFGA 4M24A 2GJPA 3SM0A 3ITTA 1LCOA 1SO6A 5AHEA 2RAGA 1FXQA 1J0HA 3H7UA 3M0VA 2UBPC 5HXMA 5HWMA 5E1QA 3YPIA 2JKAA 3NDOA 4NL1A 1SW3A 3F5LA 3UBPC 1RQEA 5DEZA 3AMGA 3VC6A 1TE6A 1FH9A 5BRBA 4ZOCA 2ZA3A 2DVUA 5HAOA 4MF4A 1IV8A 4NJIA 4E0CA 3GUWA 1TTIA 1W3TA 5EBAA 4BKNA 3FYYA 1GGOA 1IGWA 4WK9A 5D9MA 2AMXA 1Q8AA 4AXKA 4Z2KA 5IRPA 2PWEA 4AEEA 1H1YA 2BGSA 2I56A 5ABFB 4L6OA 5AB3A 1EQCA 4UOZA 2ZADA 1W1ZA 3OOQA 3MUIA 3TWAA 1JIBA 2WANA 3G1DA 3N4AA 3WLJA 4QAIA 3STFA 4ILSA 1YDVA 3K4WA 1XG3A 1UR0A 4ERIA 4NZ1A 3RYSA 4QQ3A 1O94A 1I0BA 4JIHA 3W72A 2OSYA 1UWTA 1QNRA 1H11A 2HPIA 3NVDA 1TJPA 3GM8A 5CKSA 4OUIA 1ADSA 1JFXA 3N9KA 3DFYA 1J0YA 3ITLA 3VXGA 1EC8A 1YEYA 2C16A 4C5YA 4AVOA 2WW5A 2E1WA 1UZDA 1QK0A 3HMCA 3MU7A 1H63A 2YCJA 4MB1A 3EOSA 1DOSA 3BK0A 4J3VA 1O1HA 3RITA 4ZB2A 3GKAA 4M6VA 4JN7A 5I23A 1LG2A 1QK2A 5H8PA 2GGGA 3UU0A 3BAKA 4ZA0A 2A7NA 2Q8XA 3SFWA 1TV7A 3FA3A 3T09A 4Y7EA 4ZMGA 4FOUA 1EUNA 4R33A 4Q8NA 3R11A 3QR0A 4AZBA 2Q6ZA 5E0FA 4LY8A 4UFKA 1EC9A 2WK2A 3EA1A 3N2OA 4IIDA 4GGBA 4KEVA 3W81A 3PBMA 3UJSA 2ZRYA 3G2GA 2G50A 3REQA 4F4RA 4WRHA 3S3GA 4H9XA 3CHFA 1IIHA 4PB4A 3WQ4A 1PVNA 2XVPA 1XG4A 3BCFA 4I9JA 3W25A 3S1WA 4MJMA 4R34A 3NZPA 1E4IA 1DKWA 4TV5A 4JQ1A 3LCLA 1DQWA 3NQAA 1XKJA 1K4GA 5G4WA 4I8DA 3FA5A 3IAPA 4IXHA 3DKLA 1KXHA 4WSHA 2J47A 1CBGA 2XH4A 3NQMA 3T4CA 3IJDA 3A3HA 3K30A 2E67A 3W85A 7REQA 4AY7A 4W5UA 4MIMA 3AI0A 4KIEA 1TJ0A 1GOMA 3KTSA 2DVTA 2OO0A 3UWEA 1XCXA 3R25A 1KGWA 3KLLA 3UYIA 1LRQA 4PRRA 5CZKA 2GWGA 1KBLA 2XGIA 1VH7A 2QCEA 3P7YA 3P5ZA 2POTA 1JULA 3CYVA 3VX0A 3B0VC 2PCEA 1ZRQA 1MW3A 4YVVA 3RLVA 3W7HA 4YPJA 1SR9A 4DJFC 4PTNA 4LCRA 4OT7A 2GVGA 1DE6A 3PULA 3C86A 1VPYA 2VZVA 5EPDA 3AIRA 3WEZA 4EIVA 2E9LA 4AZ5A 3H26A 2BB0A 3TOYA 4RE4A 3T55A 4BFAA 2Q02A 2ZUNA 4JAWA 4KERA 1UD5A 2PP3A 3BLLA 3L4VA 3CGTA 1XIGA 3SN0A 3LENA 2UY5A 2AGKA 3IIZA 4HZ6A 3W2JA 4R53A 5M1TA 2XSBA 1WZAA 3AMLA 4UQAA 1F6PA 1XLKA 3ZLFA 3FDGA 5A8OA 4FX6M 3HN3A 2PLCA 2CXGA 5BXPA 3URBA 3MWCA 1JVNA 4Q4SA 5D2TA 3A21A 3DERA 3XISA 4PH6A 1UKOA 2AGTA 2ZUUA 4HYVA 3ARZA 4XVDA 4O18A 1Z6KA 2X2YA 2V5CA 1E71M 1W91A 2NQZA 3TQ0A 2EPHA 1GKQA 4GIRA 5FF7A 5L6UA 4ZO6A 4GKTA 1NDVA 2WVVA 2A7RA 3PWIA 1LUCB 1QPQA 2OZ0A 1RLCL 1RD5A 2J66A 5CZJA 4GVFA 4X9YA 1U2YA 2QMJA 2G37A 3OZYA 2IPWA 3VTRA 3LCWA 3IJQA 4LFYA 2R1LA 2XM1A 2TPSA 2PWHA 1CX9A 4OU1A 1EP3A 1QHZA 3WUBA 2BY0A 3EB2A 3EX3A 1V7YA 4WSJA 1DORA 3VGHA 4DJFA 1JD9A 3SURA 1PKNA 2PLMA 3UA3A 5AOUA 3R2GA 1JJKA 3CL7A 3VKCA 1XGDA 2GOUA 4GX8A 4YXGA 3IS4A 2I7GA 3QJAA 1HW6A 3NQEA 4CD6A 4RJEA 4O13A 1EJXC 1OIFA 2FHCA 4LUYA 3BLKA 4AIOA 1E55A 1NH6A 1DPMA 4YU1A 2E1DA 2Y6ZA 4GVHA 4A21A 3LGEA 1H2JA 4IG2B 1W9UA 2OR2A 4HQVA 3SCNA 4JNZA 1W5PA 1R30A 1BF6A 1XYFA 3WF2A 5AECA 3W7KA 5JBFA 3SQMA 2OSXA 1I1XA 3T0DA 4DXVA 3IRSA 1A5CA 2J9ZA 4U4MA 2ZICA 4GNVA 3SEPA 1E40A 2ZZ1A 3H53A 4DJDC 2NZLA 1XYAA 1KFKA 3W7NA 3N6QA 1VFUA 2WC4A 4C6FA 3CM4A 5FEWA 1QPOA 4BI7A 1JDFA 1XQLA 2Y7EA 3GH4A 5C6MA 4UCFA 2W62A 5CSYA 2J8TA 4L4MA 3CV6A 4C60A 3P82A 3O3RA 2QQ6A 5IHSA 2VRJA 3A4JA 2ZA2A 1UJPA 1ZFJA 3AALA 3QHNA 2WNQA 3ATYA 2W79A 1JR1A 3PANA 1FWWA 1A3HA 2V82A 4XKYA 4PA8A 1SJBA 4MOZA 3SFKA 3UZYA 1XLGA 4LC8A 5I07A 5SWUA 1JRBA 1C8XA 4GY0A 3T44A 1H51A 1P0EA 5HOSA 1B30A 1HVQA 4GQQA 2IMRA 1JXJA 1H1NA 3QR1A 1WBHA 3AXKA 1RBLA 4IMDA 1MW1A 1F3XA 1XLHA 3WDQA 5LGZA 1EBGA 1R9YA 4DBWA 3WH7A 1RPXA 1JI1A 3L23A 3I65A 3C0JA 1LF1A 4AD0A 1TA3A 2EPOA 4GD0A 4NSBA 5I3IA 3UWQA 2D2OA 4PRWA 3G24A 4D72A 3RR4A 5GNYA 1AW5A 2YBTA 1CZ1A 1ZBVA 2C0HA 4ICCX 5CSSA 2QAPA 3R43A 5KTLA 4B5WA 5HUPA 2GGHA 5JVLA 3L2LA 2HK1A 1X6LA 3N6JA 2X05A 1OCBA 4NJJA 4TU1A 3VIPA 2D24A 2VGBA 2IPGA 2VC9A 4QCFA 3VE7A 4EKJA 4GYJA 4CNSA 2ZUWA 2E4TA 1SR0A 2OT0A 3H8AA 5EYWA 4B4HA 3LI0A 3F03K 3BQ5A 3D3AA 1OYCA 1EGMA 2VKZG 3NA8A 3AICA 2QJJA 5HNUA 5E09A 1PZ3A 1R47A 3EOUA 1FWAC 3ARUA 2CEQA 4JBRA 4C6PA 1F07A 4AXNA 1QOPA 1BGAA 2WKJA 2VX6A 4S39A 3CWHA 3QRHA 3R8HA 5HQMA 5A1AA 4UMCA 3RX4A 1GYLA 3L68A 4KPLA 3ATZA 3TC6A 5BCAA 3CC1A 4P7QA 2XHYA 2VWTA 4RDYA 3C6CA 5H8MA 1KFLA 2VENA 2P1FA 4Z2GA 4HPXA 4UIOA 3E5BA 2CBIA 5LHEA 4RXGA 3LRLA 3F4VA 5FSDC 2FZNA 4L9ZA 1QPRA 2QF8A 3MMUA 3R1ZA 3TQVA 2G3FA 1E70M 5FIPA 1BWLA 1S3TC 4QDWA 2OODA 4URIA 4LAMA 5CSRA 1Q4WA 2R82A 3RM8A 4L64A 3GU2A 4N4PA 2ZX9A 3Q58A 4KCVA 3RPDA 5MKGB 2X30A 4LEFA 1XLBA 1R3SA 3NSXA 3WO8A 1GG1A 5BXTA 2YGYA 1BXBA 3VA8A 3WDJA 3UNDA 5FACA 3WNOA 3OVPA 5I03A 3GG8A 3FJ4A 3GVRA 1X7IA 2J9XA 4P8UA 1XV8A 2NW0A 2J62A 4A4AA 2F9RA 1OJXA 3RJYA 1ZJIA 4MB3A 2Y5SA 4DPQA 3STCA 4O52A 4J3WA 4UOQA 3W2UA 1CXKA 1H61A 3MI2A 3S47A 2GDQA 1LOSA 1LORA 4FXRA 4GQ0A 1OFQA 1VYPX 4IJRA 3EMZA 1LBFA 4Z0SA 4RLIA 1SZGA 3LCHA 4K3ZA 3S2CA 3W01A 2YA1A 3DC8A 1RUSA 3GVVA 1M5WA 2WSRA 1EX1A 5CBIA 4AF0A 5AN7A 3FN9A 4O53A 1ZBCA 5M03A 5A6MA 1W3NA 4XD3A 4HSNA 4DBEA 2DVXA 2Y2WA 4UNIA 5DLCA 2J79A 3GXFA 2VRQA 1SM9A 1RA5A 3ME3A 2OZ3A 1ONRA 1VJZA 3LY0A 1US3A 5HNTA 1PKLA 1UASA 1G7VA 2VOTA 3AO0A 1Q6RA 2POZA 2CBJA 1PPIA 2G3IA 2NLYA 9XIAA 2QCDA 1DP0A 3TTEA 1NOFA 1RHCA 1RD6A 3IV3A 4P7LA 4O54A 3HG3A 4JQAA 1G01A 1R7AA 1EIXA 2OU4A 3CTTA 2J8GA 4RNJA 3S2MA 2UWFA 4DLMA 4S23A 4EWJA 3M0XA 4S3EA 5EFDA 1TZ7A 1XLDA 4NNBA 1QVBA 2FMNA 4BHYA 3WLNA 4DUOA 7XIMA 3AUJA 3L5AA 4LBRA 4F0KA 3TYAA 3B9EA 2FFIA 4FIRA 1FKXA 1H50A 1QCWA 1VBRA 3U2EA 1YE6A 3K1GA 1A3WA 2X41A 3OEXA 4GVGA 4BF7A 8CGTA 4HU0A 4XUYA 4IFOA 1H5YA 2ALRA 4NI3A 3WK1A 4J5NA 1UKTA 1PCWA 1X1NA 1XJBA 3IVUA 1IR1A 3DFOA 5DX7A 5BOFA 1H0IA 1IEWA 3AZTA 5HMEA 2YPIA 1O1ZA 3LTSA 3GR8A 4US6A 3LA4A 2A4AA 4WDUA 7REQB 2XN2A 3TK7A 4TVDA 1I8JA 2NUXA 3NYDA 4XBSA 5LXXA 1HP4A 1UROA 2HXTA 1PKMA 2YLLA 4UMBA 4E4PA 1W37A 2HRWA 4R85A 2P10A 3WF3A 1A5MC 1RQBA 5LYRA 5HR7A 1IHIA 5H2ZA 4F9DA 3EYPA 3OA3A 4AVFA 4DYKA 3E9AA 3W29A 3TC7A 1UD6A 4U2ZA 5H6HA 1S5MA 4PEKA 1C7SA 5LKYA 4PFHA 2G5WA 3VIGA 3QZAA 1PTAA 1MEHA 3U7BA 3DYPA 1SSDA 2J25A 3LTPA 4C7GA 2Y63A 2FFCA 1UG6A 1BGGA 1ZAIA 1O5QA 2Q3OA 2YYTA 1WBJA 2PBOA 3WKZA 1RVGA 3SY1A 4IISA 3WUGA 3W24A 4NYUA 4JEQA 1PX8A 4PB5A 4EACA 2Q01A 1J10A 3ZO9A 2VCCA 3CV2A 4ADTA 2ZUMA 3GIYA 2CKSA 2PDGA 3A47A 3VUSA 5IDIA 2VL4A 4FNSA 6XIAA 3BW4A 1ZENA 4ADUA 1UMYA 2QZRA 3EKGA 3CU2A 3UJFA 1DJGA 2PURA 1P0DA 5GNXA 1FHUA 5CGTA 2DJLA 3N25A 3VE9A 3DBNA 4ENLA 1GQLA 1KFBA 1ZBWA 1UKSA 1A3XA 4WR3A 3S6DA 3UXKA 4L4OA 3RUBL 3BMXA 1TVLA 3TWBA 4GZEA 1Z7AA 4H9UA 2OMAA 4PCFA 3ZT6A 1LT8A 2O7SA 3KHJA 3W88A 4F3HA 3ABQA 2GJXA 4LC6A 4Y2WA 1TV5A 3MKCA 3OODA 4XAPA 1FWBC 4ZODA 4HYWA 2DZTA 2NXHA 2YCKX 1HKWA 2ABAA 4NT0A 3M46A 4EXQA 3MCMA 3P81A 3ZM8A 4MNLA 5A6BD 3AYSA 3KBJA 3GS6A 4PGLA 4V1XA 2CLMA 3QKZA 2CKRA 3TMLA 1TPC1 2WMIA 3SN1A 4UFIA 4LPCA 4V15A 3V7PA 4ATWA 4V27A 3P62A 1ME9A 2DSUA 5DMMA 1A5BA 2GK1B 3TMQA 4PUNA 3VOJA 4OJYA 2BOEX 3GNDA 4UTMA 4DNHA 3DFPA 1HGYA 2ZDSA 3WDPP 4S3DA 3CBWA 1DHKA 3LOTA 4N0RA 4GISA 3BG3A 5CZTA 3AZRA 3UR7A 2OYLA 4ICNA 3U2CA 2OG9A 1QBAA 4OIFA 1UC5A 4JIPA 1GCYA 1THFD 4BS0A 5CC7A 1WAWA 3I6RA 1EJTC 5BXSA 4IFKA 1UCWA 5AHMA 3MHGA 2OPJA 1C29A 2H3DA 1LL6A 1Q6CA 1R2RA 3KBVA 4NP7A 3GZ3A 4CD4A 2C1IA 1VPXA 2NVCA 2P0IA 1RP9A 3F5KA 1TV8A 2IKGA 1OK4A 2BXZA 2RJGA 4PUJA 1DIKA 3MVTA 2ZCGA 1X39A 1C3FA 1VENA 1FP9A 1U83A 1XH2A 1H7XA 4EPKA 2YL9A 1Q4NX 3BZGA 2Y0FA 1L6SA 2G4FA 3WLRA 3LK6A 4EVZA 3BWWA 3CL8A 1GW9A 5G4HC 1TV2A 1E5NA 3MT1A 4NX0A 4H7ZA 1HTIA 1HL9A 4R88A 3SADA 4V33A 5F2LA 3T05A 1B2YA 2FYMA 1OGBA 4UNKA 1XLMA 1BPLB 3NZ1A 3AHXA 1M53A 4N6EA 4JTAA 4K2SA 4WY0F 2V2CA 4UTIA 1AG1O 2GVYA 5DANA 1TCDA 4P8XA 1K8ZA 4IX0A 1O5RA 3BG9A 3FHAA 3W00A 4RZ6A 4D6FA 1TWDA 3WLOA 1O68A 4DO5A 3PFMA 1I2PA 2WOQA 1K9FA 4YL2A 5KZDA 3SGGA 4ZXOA 1PKYA 3NAVA 4MWAC 3SCVA 3VNMA 3AU6A 2VR2A 3TSDA 2DU2A 2VDGA 1RPKA 4N42A 3UETA 5FJPA 1K6AA 3FXYA 4L1WA 4CKQA 1GOQA 4W7WA 1N2VA 3TQKA 5D32A 4C6OA 2VEKA 4BWLA 4DAIA 1HF6A 3M0MA 4CCCA 4IIEA 1R85A 3L7RA 4LOCA 1TJ1A 3SUWA 5DY2A 3ZOAA 4AW7A 4KIRA 1MDLA 2XIQA 1IXPA 1EEPA 3VDGA 2Y88A 1XIEA 1K9DA 1B9ZA 2PTYA 1R0MA 4IIBA 3GTFA 4XV0A 1TMHA 4L9XA 4FNRA 3ARXA 2Y7DA 1ZAHA 3W7LA 3WL0A 4O11A 2Y24A 2DFAA 1F73A 3HQNA 1XSJA 4PR4A 4XG1A 4GPNA 2R8WA 4PL2A 1FTXA 4XISA 2VEIA 4AYSA 4F66A 3W0KA 3T08A 3W3OA 2WSKA 1XRVA 2H90A 3NDYA 4Q6JA 3T07A 3NNTA 3QTPA 1B1YA 2OX4A 3TYZA 3KCJA 1GVIA 1KCLA 4C6DA 3LHTA 1UWAA 4NKCA 3CAKA 4PCSA 2C19A 3W76A 3WK0A 2A1YA 1TR1A 3U9IA 1DWIM 5BZAA 3ZT5A 3NDZA 2DUAA 1DWJM 3QV9A 1VPQA 4QE4A 4W5ZA 3GIQA 3P60A 1L6GA 3MS8A 4MSSA 4B3KA 3TJLA 2O9TA 1E1CA 5AYYA 4WZHA 2PC8A 3URNA 5JU6A 3UJEA 3OHIA 3TEVA 2W27A 4V28A 4W8BA 4MJ2A 1VZWA 1NP2A 3UGRA 5I2UA 3QFWA 3KBWA 1SW7A 3JZEA 2YB1A 4UB9A 5HWNA 1NWSA 3HPZA 4JDYA 2PLKA 3ARPA 1Q6OA 2VT0A 1CXFA 1FDZA 2D73A 3WNPA 1FWEC 4GWEA 2V30A 3VOGA 4QR6A 3QBUA 4F40A 3WNLA 2Z29A 3PP7A 1KM5A 4NIRA 1TUFA 2FQIA 4C1KA 4Q7IA 5I3HA 3TVAA 3NXLA 2GQ3A 1CENA 3A5FA 2FH8A 3VKBA 2A5HA 3TTQA 2YLAA 3HQOA 3EXTA 1BVZA 2ZQ0A 4X2PA 3FXGA 3KRSA 3EOOA 3ITYA 2W92A 2ACSA 2AAMA 1ZGDA 4RK8A 5EMLA 2YYUA 3O6AA 4NXSA 4IJBA 4HPJA 4BQ4A 3FGCA 3H12A 1MWOA 1GJWA 3BW2A 3N13A 2CYGA 1WKFA 4S3AA 1TKKA 2H9AB 5A6LA 3STGA 3GVGA 4AMCA 5J04A 3TYBA 3S6TA 3VIKA 3MHUA 4O50A 1HO4A 3VD9A 4XZBA 2WVTA 3H2EA 1PIFA 3B9NA 1KKOA 1ICPA 4L4PA 3TN6A 4RR4A 3MDWA 4OOZA 2HVMA 4G7EA 4Z17A 1FWDC 3CUIA 2WQPA 1E72M 3PBVA 4C7DA 4MADA 1KW1A 5EMUA 4OV9A 1NWUA 4G1NA 3NPXA 2BHUA 3L4XA 1JG9A 1QUMA 3IIPA 4FF7A 3TNOA 3MBFA 5J5RA 3PTDA 5G1YA 4TO8A 3FVDA 1TIWA 1VKFA 2FJUB 3CMGA 2QMKA 1ME7A 1W8GA 2XSXA 4YTQA 1E6NA 1CGXA 2IS7A 3LCGA 4DN1A 3LV6A 5G1MA 3ABZA 5C71A 1DWAM 4OKDA 1PBGA 4W93A 4QJ1A 4UQDA 1SJAA 2FMOA 4YJ5A 1Z69A 1ZY9A 1G7UA 4JY9A 4NG3A 4D6EA 1KV8A 4JTRA 1UZ4A 3K8MA 2HZGA 2Z26A 1GUVA 1VAHA 2X0HA 4DUVA 4HN4A 1XCFA 4M80A 3S0CA 1S2VA 4HPNA 4MZ8A 5D09A 1UH3A 1XDJA 1XLAA 1F74A 2E8YA 5FI8A 4I5RA 3NSMA 4HMNA 2JGQA 1F3EA 4H83A 3JR2A 3TZFA 3RU8X 3VIHA 4HNLA 2C7FA 2NXIA 1CXLA 4MY8A 4LY4A 1Q6FA 1UD4A 1UR3M 2BVDA 1S5TA 2B31A 4M6PA 3WQGA 1CT5A 1E15A 3JU2A 1WOBA 1H1ZA 4GYKA 1I0DA 4HBKA 5AYZA 2WWCA 3ZQ9A 3E0LA 1PUDA 3BSGA 4EXAA 3EPOA 3CH0A 3LHZA 5KMYA 3VC5A 1TELA 3VI2A 2WM1A 3EXRA 3N4EA 1NAL1 4BJHA 4R27A 1FUYA 3WQVA 4DWSA 1XLFA 4IIHA 2WZHA 4O16A 4ZBCA 4RNIA 3KOFA 1BRLA 1EXBA 1AMYA 3QYQA 1IYXA 2P76A 4PUDA 1JGMA 1WZMA 2DY3A 1AVAA 4ZO7A 2C13A 1OT2A 1S3HA 3WMBA 1R7OA 3ERPA 2E09A 1GVSA 1M3UA 1YMYA 3WH9A 9CGTA 1MYRA 2DP3A 3R89A 1UBSA 1N55A 1V3JA 1F8MA 1PAMA 3GY1A 5FAJA 4PODA 4S3CA 2ISDA 4UQ9A 3NQGA 4CN1A 1XIBA 1A5SA 3B4YA 1OC7A 1B4KA 1BKHA 2ALDA 3G5EA 3W82A 1PHWA 2PF8A 1O6IA 2AL2A 3M6DA 2EQDA 3S6OA 4WIWA 1YTDA 1DWGM 2VFGA 4QISA 3WJXA 3N2MA 3WBAA 4ZL1A 2Q8ZA 2BVTA 3S1XA 4IJCA 3UXDA 4KCUA 1IZJA 4J27A 2YW3A 5I02A 3O0FA 1H62A 1LWJA 5AZ0A 1AW2A 3VOFA 4C6JA 3KEHA 4AEOA 2ZX5A 4JR5A 1S5VA 3EX6A 2NX3A 1YYAA 3TH6A 3U8GA 1V6WA 3W1XA 3O7UA 2ZRVA 3T40A 2ATMA 2GQ8A 3WY1A 3LB0A 5F4WA 1I2NA 2Z24A 3D47A 4U28A 4Q3MA 8TIMA 4IOTA 3IV8A 3H22A 3H23A 5DXYA 1BFNA 4QRNA 2Z1WA 1EF3A 4GINA 2IUZA 4GXMA 3N14A 1ZNNA 2V67A 3MTWA 4LTSA 1HKMA 4J1OA 4DX3A 4RDVA 4S3GA 4XIAA 1C90A 4ZGYA 3T2QA 2IPFA 4AC1X 4O0ZA 2ZX7A 1BVNP 3GR4A 2VFIA 4M6UA 2DT0A 2VRKA 2BY3A 4HSOA 3UF9A 2YL5A 3PSVA 4UCGA 1VRXA 4UTFA 4JOMA 3EAUA 1WUFA 1VEPA 1V3IA 2ZUVA 3APGA 3ECQA 4CQDA 1W1YA 2E9BA 1CPUA 3L66A 3KZSA 5F1VA 1FH7A 2F8QA 1UR8A 4K8GA 1PZ1A 3GDMA 3S8HA 4Q6XA 1SW0A 2I5IA 4NZFA 1LQ2A 4A3HA 3UPWA 4GHRA 3TR9A 1PHQA 3T9PA 2I57A 3MVIA 4UR7A 5HDRA 1TV4A 1S1PA 3O6DA 1HL2A 4IWWA 3DECA 3KOYA 3M43A 5EMMA 2ZE3A 3TAOA 5J5DA 2QF7A 3PPGA 1DWFM 3CT7A 5KINA 1ADDA 2EO7A 3QGKC 3GZAA 5CPLA 1CGYA 1EL3A 2IQ0A 1W2PA 2E68A 1IGSA 1XISA 4GBUA 3FW6A 5XINA 1SFJA 2DQXA 4HK6A 2A0NA 4ATDA 1BQGA 3QMRA 2XYLA 4P5UA 4HIBA 3O1NA 1LUCA 2OEKA 1J2BA 1ODZA 2H8XA 1M41A 3AYTA 5LIYX 2OELA 3E6EA 3IGUA 3OIXA 3SR7A 4D8AA 1HGWA 3H70A 2I1OA 4PTMA 5CLTA 1XYCA 4GIEA 2FZMA 3BTNA 4L5ZA 2FPYA 1RXOB 4JPGA 3T81A 3WEMA 2B0MA 3TSBA 4X2RA 1QNSA 5CZSA 1OD8A 1IT7A 4MKSA 3QQ1A 3MUY1 3TXZA 1B3YA 1BG9A 3QH2A 5HQLA 3QY6A 1ZS2A 4JN8A 3MO7A 3BAIA 3C0SA 3HB9A 4L80A 4W8LA 2NVDA 4OTKA 4H9TA 2BY1A 2BVYA 5FJUA 5BXRA 1U1HA 5FEZA 5JBDA 3EDDA 3IPWA 1R2SA 4IUOA 3B97A 5A8MA 5D8ZA 3GDLA 2QJNA 1EJUC 4W84A 3M5XA 4DVOA 2NUWA 5BU9A 4W7VA 2XWDA 5D33A 3GG0A 2HNHA 3DIPA 2V38A 3WQ6A 2WJDA 2PDUA 1QAPA 4W7UA 1D8WA 1RP8A 5HATA 4DF1A 1OGSA 3D3FA 4CEXC 4EPDC 2JE8A 1ZHAA 3KFTA 1P7TB 4H4IA 1J9YA 3R6IA 1RJQA 4M5PA 2E5BA 1JUBA 3KBNA 2CLFA 2GVLA 3DI0A 3FKRA 1LRNA 4I5XA 4TR9A 1E51A 1TRIA 2DZBA 3EWUA 5IFPA 4GQGA 2YDSA 3DHUA 1GTHA 2AQVA 4PMNA 3QM3A 2ZZ7A 1ALDA 2V2DA 1QI2A 2Z28A 4GYFA 1KO0A 1EHAA 3PJXA 3EKZA 2PDBA 2Y7GA 1BXCA 1AMKA 1KC7A 4H01A 3ALFA 4GUJA 1J0KA 5A2BA 2ACUA 1FVPA 1MVYA 2B81A 1L8NA 1YXCA 1D2KA 2P3ZA 3E0WA 2LLEA 4DY1A 2FGLA 5HULA 2FLIA 3MY9A 4XZNX 5LIWX 3CPRA 5K7JA 1PS9A 1ISVA 3W7EA 4Z08A 3SECA 1T5AA 2L5HA 3TP4A 1XIHA 2FDSA 1AQFA 2YKKA 2Z7GA 4UUIA 1NWTA 4K6AA 5K4XA 5HANA 1OFBA 4N9BA 4LT9A 1P1XA 4UTLA 4CU7A 3AYVA 4DLFA 3AMCA 3DC0A 3V0UA 3MP3A 1L2QA 1UMLA 4H7VA 3PUEA 4ACYA 4ECLA 2OZTA 3BGGA 2YZRA 1DXEA 1GHSA 4ERAA 3LCXA 1EOKA 5CCZA 3F2CA 1WKDA 1NSJA 1M04A 5A6TC 1VIWA 4ZSUA 3H4XA 4IMEA 4EPEC 2QUVA 3PUGA 4GKLA 1WP6A 4FNPA 3WF0A 3DG7A 1Q5MA 1VYRA 7PTDA 2YSWA 4ZEPA 1IWPA 1DQXA 3LZ3A 4BF5A 1VBHA 2YZ5A 3WIJA 4IPIA 4S38A 4KWSA 4J2PA 1S2WA 4NRRA 3VGDA 1Q3NA 4LF2A 2W5FA 4LWWA 3V3WA 1NDYA 1K1DA 2V5LA 3WD2A 4HU3A 3WFZA 1ITUA 2Z0IA 2A3BA 1X1OA 2H9AA 3U57A 4B2DA 3FIGA 3EEGA 5I06A 2F6UA 3W27A 3G77A 4PMJA 2C1HA 1MW0A 5FD0A 1ZL1A 1EDQA 1E5JA 2UY2A 3S46A 1N7KA 3S2NA 3IGHX 2YXGA 4G1KA 3DZ1A 5E6ZA 3S83A 2R6OA 3EOEA 5F1UA 4KFNA 1RCQA 1JZ5A 2BS9A 3G0UA 4GO9A 3V16A 2GGIA 3LTYA 4RW3A 2XVLA 2E6FA 4C6BA 1D9EA 4O0KA 4X63A 5T26A 3VX1A 1MFVA 2OO6A 4DWSD 4ZSTA 3W7MA 2REQA 4WGXA 3S9YA 2GVEA 4I6KA 2Y8UA 4KS0A 3VU2A 3IIOA 5FJRA 1AJ0A 2X8RA 1JI2A 3ZT7A 2QUMA 3N11A 1E9YB 1UWSA 1UWQA 2VZTA 4ALDA 4DO7A 4DUWA 1R3YA 3F7JA 4JIQA 1EYWA 2XISA 1MQPA 3VZXA 2AL2B 2ZBTA 1K8XA 2FZBA 4JTDA 2PP0A 3TCEA 1D8CA 2ATSA 4B15A 2RDXA 1KRAC 2I9EA 2JEPA 1H60A 1JD7A 3OIHA 2QVHA 3CQHA 2J77A 3W7IA 4D71A 5CJNA 1M7PA 2WCAA 1N8WA 4N9CA 4HT3A 1XP3A 3P3BA 4ZQNA 4Z1AA 2C15A 4QG6A 3TV8A 4JTCA 4LCSA 4HJFA 5G4EA 4AZCA 4IZGA 3NM1A 1UA3A 1SZEA 3DOPA 2PU0A 3IGXA 1V51A 2X2GA 5H1WA 2WVSA 4IMCA 4DWSB 1CGVA 1H09A 3CH9A 1NF7A 2H3BA 3ABRA 3UWVA 4KEUA 3UY7A 3GNOA 3TIMA 2BV9A 2QUTA 3QOMA 4GUGA 2D1ZA 2XTKA 1PDZA 3AHYA 1RK6A 2FZ8A 4I3GA 3W7RA 2P53A 3PG8A 4CCEA 1K9TA 4K39A 4PB3A 4XVEA 3OYZA 4EXBA 2CU0A 1V77A 2FZDA 3E0IA 1RR2A 1T99A 1LLWA 1KBBA 1PX3A 4O12A 5EL1A 1BG4A 3FV9A 3MYOA 5K9XA 3GXTA 3TROA 3IEBA 4YWSA 3NXFA 3O07A 3AS2A 1VC4A 3VKJA 2PGWA 3NL2A 1KM6A 3GTHA 2OKTA 3SQSA 3CUXA 2V5JA 5T8GA 5C55A 2X7VA 5KITA 2BHYA 3T0TA 3EXSA 4C6LA 1GTEA 4Y90A 3DX5A 3SY5A 4D6CA 4LGXA 4MPQA 5EY5A 1KXVA 3KVJA 1LWIA 5IBXC 1MQRA 2WSYA 4CQ9A 1FHVA 4MJZA 4NQ1A 2DSWA 3DUGA 2F61A 3L2IA 3RRAA 1LP6A 3N2TA 3P74A 1EGZA 4JICA 3UERA 2DZXA 3FHQA 5JXQA 4JX6A 4C6KA 4DBSA 5HWJA 3PPHA 1V5XA 5LA2A 3VOHA 4D9PA 3LD5A 2V68A 4YS1A 5EKYA 1OX6A 3ENLA 1VCFA 2PLJA 5I09A 2PTXA 3E12A 4FOKA 4G2DA 2AKMA 2A6NA 2WBKA 4PC8A 3QOKA 3SQLA 5FF4A 1WA3A 1K7EA 4IGNA 5DRIA 3AXIA 3LQLA 2YW4A 3VABA 3RO6A 3PWAA 1WOAA 1Q6QA 5G2IA 4PZVA 4M29A 2Z1KA 3A22A 3TZNA 4IFKB 2ZKMX 3DFNA 1W31A 1U5JA 4LAOA 3VD7A 1QT1A 2ZVIA 1RCXB 3QYSA 4S3BA 2VC5A 3LRMA 3PZUA 3ES7A 3V75A 3M44A 2XFWA 4JTFA 3LPGA 4AD3A 2UZ9A 1TE1A 4N02A 3WJZA 5A6JA 1W54A 3ZIZA 3ZS4A 1C8YA 1NWRA 3O15A 1BHGA 1I75A 1HXJA 1TQXA 1FWCC 5D8WA 2DH3A 3E02A 1DXFA 2G95A 4GUHA 4MNJA 1W0MA 3UWYA 1SFTA 2HV5A 2BMBA 4L9YA 4QP0A 3K8LA 5ABFA 2VMFA 1IZCA 3H2MA 5FEPA 4NZCA 1Z32X 1HL8A 3M0LA 3N6HA 1W5MA 5AC7A 4Z2JA 1EUAA 3GNNA 3IJ9A 2IXUA 3WH8A 2ZYFA 4FOJA 1H7NA 2WCSA 4XZLX 1JCMP 4Z1BA 3EDJA 3BGJA 1FWFC 2WC3A 4UTJA 2V9DA 2FGZA 3W70A 2J7GA 3G1RA 4H6KA 4GABA 5E0KA 5C9RA 4U31A 2R94A 1PIGA 3WLLA 2FB3A 5MKGA 1OF6A 2X0SA 3N12A 1GQJA 2VFDA 3KP0A 4E38A 4D6DA 4IM4A 3WDHA 1N82A 4NX5A 1IQ8A 2PI6A 2ONEA 3RAOA 4MWAE 2ESCA 2X1RA 3BAYA 1LZOA 2E5CA 1HIZA 3PNUA 1E0XA 3L0GA 2Y1HA 3KBSA 3TOPA 3ALGA 2PA6A 3W87A 1L0PA 4LCQA 4CD5A 4AIBA 3K4DA 1SGJA 1S39A 3B40A 3D46A 1AZ2A 4X60A 1J5TA 1L6YA 4ZZ9A 4LYRA 3WBWA 1XLIA 4GRSA 3HGJA 2CBUA 5FF0A 1TUXA 2W61A 3WG6A 3A9BA 4ZENA 3TYEA 3GD6A 1TTJA 3OW1A 4X3ZA 3KTXA 4XZWA 3EWCA 2XG9A 3DN5A 3RIKA 3UA4A 3WEOA 5GJMA 5A2CA 4DO6A 4JKKA 4HU8A 2WKLA 2AMGA 5LIUX 1YTEA 4W8AA 4LUSA 5KETA 4MFDA 3WYZA 1BXNA 2GOKA 5DCDA 2QJHA 4AWSA 2BTMA 2WNWA 4YNGA 4X61A 3VNIA 4M6QA 3A4AA 3DG6A 3VGBA 5HR6A 2ZXAA 1CGWA 4FLQA 3UWUA 3W73A 4RW5A 3LEPA 5CG7A 1V7AA 1W1B1 3CO4A 2ZRZA 2PDXA 3WLTA 3KWXA 3N4FA 3MV01 4WVXA 1ZCOA 4DYJA 4GVIA 7TAAA 1WZKA 3SRKA 2DORA 1YBQB 4AY8A 1PSCA 1P6BA 2XZ9A 3L12A 5E0CA 2VO5A 1V02E 4AG0A 4IH3A 1ME8A 2OQHA 1C92A 1MZRA 2OLAA 2YL6A 4HKPA 1RCOB 1VHNA 4PMOA 3SUVA 4QTGA 3PJUA 3BW3A 3STEA 3UVAA 5XIMA 5DN1A 5ENLA 2C3ZA 3HFYA 2PTDA 4XAGA 2QIIA 5JQ9A 1DVJA 2WV8A 3IVSA 4UTUA 4I9AA 1KBKA 1PZ0A 3PZOA 3IJLA 2A3CA 1Q2RA 1U22A 4KCWA 1E0WA 1Z9AA 2QDGA 3G18A 2PU1A 3NQBA 1EQPA 5CPOA 3BAWA 2XFYA 3DG3A 2VX4A 2FTWA 3AJ7A 3A23A 3L2MA 3CHVA 1Z8AA 4MWAD 3T0AA 3QTGA 3L4ZA 4AIUA 2PDIA 2FKPA 2RDTA 1JYVA 4CVWA 1XIFA 2OEJA 1LTDA 4PMRA 3QMSA 1ODUA 1FCUA 5CG0A 4NZ5A 7A3HA 1OCQA 1QNOA 2CLPA 3PUOA 2Y70A 4JTHA 5DMLA 3W7PA 1MFUA 4LJ3A 2CW6A 2QV4A 3T2PA 2YR1A 4LVFA 4L61A 1NDZA 3VVGA 3QW3A 4BEUA 1DJWA 3ES8A 4L6HA 2VX7A 4HZMA 3WD4A 2BY2A 4Y8EA 5D03A 5PTDA 1BF2A 2O55A 4FALA 5FOOA 3NPUA 3Q37A 2Y8VA 4O15A 1JYWA 3FAXA 3ABOA 3B8WA 1M7JA 2PZ0A 1MEIA 1LJYA 3II1A 1GJPA 1AH4A 1MUWA 4FIQA 1V0NA 5E93A 1T41A 4RNHA 5BMXA 1H49A 3TTOA 4L1GA 5G5IA 3CHEA 1OYAA 2G0WA 4JD4A 3N17A 1FDYA 4WDWA 5C9XA 4RDZA 3MQTA 2G3MA 1GPFA 3LHYA 1KCZA 1TPB1 3CYJA 4IICA 4AU0A 3NZGA 2KZHA 3P14A 1UP0A 2CWXA 4HA0A 5FKYA 1NIUA 3PBUA 2V5BA 1M9HA 2PDLA 1LBLA 4HHPA 3GSMA 1KR1A 2GJXB 1M7XA 4D6JA 1PYMA 5BU6A 3CZ8A 4Y9MA 5M17A 3UR2A 1VR6A 3ZVIA 1OYBA 4QS5A 2ZWZA 3GXPA 3W02A 2WVVB 1SMAA 1D7FA 4LSBA 1JQVA 1ZJAA 4KRTA 3O63A 2GQAA 2PDJA 2WB5A 1HJQA 2C91A 2YBUA 2PS2A 4MUPA 1EP1A 3LLDA 3W1TA 3W9ZA 4Y9NA 4HOWA 5AHNA 3NO3A 2RHGA 3QFEA 1DJHA 2QV5A 3GE7A 1VEMA 3LSBA 1UR2A 3L4YA 3AIBA 2D0FA 4PN2A 3S42A 4LAKA 1R38A 1TPFA 5GNZA 2ZOXA 2Z2UA 3UVIA 3MO4A 1IEQA 2NQLA 2ZX8A 5BW6A 2ZFAA 3EMCA 3I68A 3UY8A 1FBAA 3UPMA 3HJZA 4CVUA 4WY0A 3C52A 5KSWA 4HPGA 2F2KA 2PD5A 5L9FA 4RE0A 4LW7A 3TUUA 2ZA1A 3ANVA 2PMQA 2WSPA 2ZUTA 2PGRA 1CLVA 1B3OA 1ZP4A 1XLCA 3H2CA 5M2FX 1AK5A 4M8UA 5ABTA 3GFZA 4YVPA 3GUGA 3OHMB 2DSZA 3DGRA 1FA2A 1CLXA 1E9IA 3U3HA 3P67A 3BUVA 3GU9A 4GZ7A 1GOOA 5C0QA 4HP5A 1KFEA 2DZSA 1KLZA 4GC4A 1EH9A 1B90A 3LHWA 1J8VA 1H7WA 1OT1A 5DMNA 3SZ8A 2PDQA 5H91A 4YHGA 2BOFX 2WAGA 5M5DA 3URQA 1T8XA 3WSUA 1TPH1 2FGBA 1A53A 4N4QA 3WDRA 3UESA 4JN6A 1T40A 4R9OA 1M7OA 4EPBC 3RFAA 4U3CA 1WO2A 1QNVA 1SJDA 3MYPA 4LAUA 1NQ6A 3SCWA 1HVXA 4F8XA 1P4CA 1T7LA 2QCFA 2VYOA 4GZIA 3C2EA 4IIFA 1GKRA 5D2XA 1MNSA 3PZQA 3T4WA 3C61A 1WPCA 3K8KA 4C6MA 1Q63A 4IQLA 1KXTA 2GZXA 4D6GA 3M1ZA 3WMLA 4WX2A 3KDOA 2JGYA 3BLDA 3NQ7A 1QU4A 2Y8KA 3NWRA 4LUJA 3FLUA 3PC0A 2EKGA 1LG1A 2D0HA 3VZYA 2X1UA 4LALA 3VM7A 3RCNA 3W84A 1RQHA 2ACRA 4A8NA 4ZTYA 3KTCA 2XIBA 2QS8A 4PCTA 1JCLA 3TXVA 4ZTXA 3O8AA 1XYZA 1N8FA 2A79A 3CAWA 1NY1A 2Z7KA 3L65A 2DSVA 1XPGA 3VNDA 4U2YA 2ZX6A 4XKYB 3JUGA 2VDIA 4AD1A 3UZXA 3VILA 1NEYA 2V2HA 1Z44A 3M47A 3VGGA 1QO5A 2WZEA 4GXWA 5CXPA 1L6WA 3R10A 2PB1A 3EZ4A 5J8LA 5LNVA 2W66A 1LYXA 3DFQA 4JL2A 1X6UA 1WZLA 1US2A 4XD5A 4F9JA 3SJNA 4LU0A 1KBIA 2VTFA 3MCOA 1O5XA 4HZ7A 4QJ3B 2IXVA 2O4MA 3FKKA 3INPA 1JDEA 3BANA 4G7EB 3LN3A 3W4RA 1TJRA 3C3NA 3ZFHA 1PTDA 2DW6A 4AMAA 5T91A 3C2OA 2JEQA 2IPJA 3GNRA 4K1WA 3USZA 3L5LA 3TTYA 3SN4A 4GOAA 1POKA 1MXDA 1PYFA 4AIEA 3OBEA 3BO9A 1MI3A 1E6SM 1GVQA 2VGIA 2RFGA 4IG2A 4N6FA 4XO6A 4R7OA 2XINA 5BROA 3QMTA 3DHFA 3NM3A 3OQ8A 3LMZA 3SW6A 2WO5A 4E8DA 3R4IA 1ONEA 1W8SA 3UD6A 2ISVA 4FR6A 3CZJA 1UZHA 4DJED 4PULA 1C91A 3V1HA 4J4KA 3G3MA 3GXDA 4NJKA 3OG3A 3LCIA 1EZWA 2XVKA 3V5OA 3GG7A 1RY0A 1XL9A 2X1TA 2VUYA 2WJFA 1E0VA 1UQYA 5A6KA 1OX5A 3MB9A 4Q4RA 1RVKA 4A2SA 3H2AA 4D6HA 2E8ZA 4LNCA 3L0NA 1DYSA 3PPCA 3BPWA 4M0XA 3WF4A 3BJTA 2NV2A 4M3PA 1NJJA 1XIMA 1HO1A 4FI4A 4WJ8A 3GTXA 3EWYA 1OQFA 4PUMA 3BMWA 1MZHA 4O1EA 1QPNA 1AL8A 3GW0A 3M0HA 4MKVA 3WNNA 1AUSL 4IPJA 5ECUA 3F2BA 3C2VA 2DJXA 3S9IA 3N2XA 2PBGA 3I7SA 1BSLA 4BI5A 5BRPA 3UPBA 2A3LA 1TB3A 4EX4A 4KFPA 5HJYA 4PTXA 2GUUA 4HMDA 3V0TA 4Z2IA 4QSHA 3KP1A 4ROQA 1WDDA 3W2LA 3MHFA 1F05A 1IE7C 3VIMA 2BP1A 3N18A 1EJVC 4WKAA 1NM9A 1ITCA 4JTQA 1CWYA 3WQ8A 4CNTA 4YTRA 1V3LA 4Z2LA 2YOCA 2F7FA 1UD8A 4TIMA 5HMFA 3CUHA 2NV9A 5DBTA 2WC7A 3W38A 4XB3A 3BAXA 1J11A 4RV8A 4LB4A 3R5EA 3EDKA 2W6RA 5I3DA 1AQHA 1MMFA 3I7QA 1YNYA 3AHVA 2JKPA 3AC0A 3DFTA 3HPXA 2WLYA 3QY7A 3GNPA 4AD4A 3KWSA 3WFAA 1TFVA 1I1WA 1TTPA 3TJXA 2PEVA 4BQ5A 4ERGA 5E9XA 3QLLA 4PMXA 3VGFA 2D23A 3KS6A 1D3CA 1OCNA 3WCZA 1EF2A 3GBEA 1JZ6A 3E2RA 5CSUA 4KETA 1SYTA 1YKWA 4AZ7A 3WLSA 1JPHA 3VINA 3BLEA 3P0WA 4Q4QA 4WLCA 3MUCA 2GUBA 2PCQA 4F2BA 1WDSA 2EF9A 1JYXA 2PD9A 3GFYA 1VFFA 1P0NA 5A8NA 2D2JA 4FPSA 3V5CA 2C0AA 3WLQA 4EP8C 3EB3A 4JEJA 1R86A 3QGAC 4XZIA 4YTUA 1EDGA 4QG8A 1VS1A 2HVOA 2ZZ4A 1XF0A 1R2TA 3GYEA 1E6RA 3W6YA 3HQPA 4ZFCA 4A2RA 3OVGA 4W89A 3SUUA 4C91A 1NARA 1CB7B 1JAEA 2PZNA 3RLHA 3A9IA 2J7EA 4QDMA 4A22A 1XCWA 4MM1A 1SO4A 2FTPA 1V4YA 5A94A 4DZ5A 3IUDA 5JIPA 4ZOAA 3H21A 2QJIA 4DB7A 3G22A 3FEQA 2CNCA 4TVUA 5AYBA 1QWKA 1QASA 3LLFA 1Q45A 3SCUA 3OGSA 4JKMA 4O1BA 4ACZA 4Q8QA 4LEQA 6REQA 3M0KA 3THCA 2YFOA 3TJIA 3G0XA 2MNRA 1QOQA 2ANUA 3RILA 1WQ5A 1EEXA 2DUZA 3WFLA 5D9OA 4QGCA 1ICSA 2O9OA 1M65A 1XS2A 3QY8A 5C8BB 1A47A 2VZUA 5D2YA 4P7OA 4K1GA 4JCLA 5D2WA 4AZCB 3IARA 3O2LA 1RBAA 3ARVA 2MUCA 3GVWA 3SJ3A 4WQ6A 4FMVA 1IT8A 2DIJA 4XAYA 2VR5A 1UR9A 2UY3A 3VDAA 4X0VA 2XIOA 1W5OA 3H4GA 4LS1A 1AODA 4Q7BA 1QJWA 3IUIA 3S2LA 2VOMA 2ZC1A 4ZXLA 3FK4A 5DBUA 2HS6A 4R5EA 1OFOA 1I9CB 3S2JA 2VEFA 1FCBA 4KWOA 4PL1A 3IIVA 3W83A 1XYLA 3A3XA 2NX9A 3TC3A 4Q4MA 3TSMA 5K9DA 3UQNA 2J4GA 3M07A 4OBRA 2VGFA 5I77A 1NFBA 3G1HA 3BARA 5DO8A 1OG6A 5I3JA 4Z1YA 1GG0A 8XIAA 2VNCA 1V93A 1WCGA 3R12A 3CEUA 3WH5A 3LRKA 1S5NA 2PGEA 1VGAA 3CS2A 5A8GA 3M5ZA 4NZ4A 5DF0A 2GK1A 4X0NA 1XI3A 4ZR8A 4TTUA 3GC5A 1X8FA 2PF0A 4F0SA 5CC5A 1Y5XA 5A8PA 4NY2A 3ZR5A 3QPEA 2ISWA 3F4NA 1FH8A 1E56A 3B8TA 1B5TA 1F5ZA 1ENUA 3KVLA 3C2YA 7TIMA 4E2DA 4NF7A 1WDWA 1XUZA 1X98A 4IX2A 4NASA 1OZQA 4XBKA 2BXYA 3KL0A 1RJRA 4KRZA 2QPUA 2WNZA 4CU8A 4K8HA 2FPVA 1EOMA 1KTBA 1BWVA 3E2VA 5E5CA 3RCYA 1HN1A 4B5UA 1ZCCA 2A6LA 4S1FA 4HK7A 1HNYA 1XIDA 3P5YA 3OZPA 4E2OA 3LI1A 1QRQA 5BOEA 3A6OA 5C9WA 3DI1A 2GSEA 4OUEA 3STPA 3WQPA 3QQWA 1Q6EA 4JNMA 4B90A 4LUIA 4MB5A 1NU5A 2NUYA 5KEZA 5HK4A 3S4TA 1XM3A 1JL8A 4IMFA 3SCSA 1FCQA 1O7AA 3M9YA 4HNOA 1REQA 4LB3A 3FNDA 1LQ0A 1XDLA 1DXIA 5BRQA 4Y9PA 3DYMA 1NVMA 4REQA 4JL1A 4DM2A 1JZ7A 2V0TA 3IANA 4YN5A 3QC0A 4MPKA 4QLKA 1XGZA 3HGOA 1VP5A 3BH4A 3USBA 4CD7A 1JQXA 2YB4A 2GJRA 3VKDA 2A7PA 2D3LA 1X8CA 4UFMA 1TR9A 5C7VA 3AYRA 3PBYA 6ALDA 2PE4A 4AWTA 1YRRA 4KGLA 3P93A 3BICA 3DH7A 3P6LA 5C9ZA 4IP7A 2XGBA 1VFHA 4FLSA 1T8QA 3F2DA 2B7QA 3ARWA 5D9PA 4DJEA 2PFHA 3G3DA 3UCDA 3FYPA 4CUCA 3RHGA 3CAQA 4Z1DA 2VVSA 2O4QA 2A85A 2J7CA 4UZUA 6REQB 4DELA 4EF9A 5DXXA 1YIXA 3L67A 5CJ5A 3NL6A 1K3UA 4L1XA 3GO2A 3VPLA 4FLRA 3W7CA 2J7HA 2EJ1A 2QW5A 3CQKA 3PAOA 4F0RA 2PSNA 1W1VA 3KL3A 1QHOA 1DQUA 3RXZA 4UQBA 1XX1A 1WDPA 4PCPA 1EA9C 2BVWA 2PDPA 3HOJA 1QPKA 2PC4A 4NZJA 2IKHA 3LCFA 4P8VA 1KWGA 4E5TA 1NDWA 3RGTA 5CC3A 2RH9A 2P8CA 1BWKA 3E0FA 4XUGA 4KWVA 1P7TA 3OB8A 3WQWA 2C1GA 3F4CA 4NU7A 1Q6LA 1O66A 2WZIA 3UXAA 1W1PA 4R7WA 1W3HA 2O7QA 1UD2A 4LV4A 1OB0A 2BASA 2VDHA 3QV7A 1KTCA 1PXGA 3OGRA 3G1AA 1AJ2A 3AZSA 3VNYA 3W7OA 1SUXA 3EDFA 3VFCA 2CHRA 5LNWA 4QEEA 1EHNA 3FFSA 1VYSX 3N34A 1EFZA 2PRLA 3FVMA 3WD0A 3OPSA 3KUMA 3UYCA 2YCLB 1F3TA 1KFCA 5D02A 5CPQA 5BNKA 1XFCA 3EX1A 1PTGA 4HTBA 3PZTA 4MUZA 4AYGA 1XICA 4E3TA 3SO7A 2RJHA 1S38A 2JBMA 1QBBA 2QCDB 4N9DA 1DJXA 4X9SA 4XX6A 1R3QA 3M5YA 4U33A 2V3GA 4GK8A 4S2BA 2CHNA 4QS6A 1KRCC 3WJYA 2GDVA 1EBHA 1UZ1A 1O5KA 1ZPTA 2FIQA 2DT1A 2QCLA 1ITXA 1SZFA 2XWEA 2INZA 2PUZA 4DM1A 2F6KA 2QKFA 3DHPA 3ARTA 1LROA 4R7JA 3G8RA 4GH3A 1KM3A 3PNZA 4OZOA 1T96A 5LGXA 1UD3A 5CC6A 4C1NB 2VC6A 4O28A 4LVAA 4M82A 2NWSA 3GXMA 2YXOA 4NNAA 1B9BA 1HKKA 2OYMA 2R24A 1OZMA 1Q85A 4QQUA 3ZVHA 1KGXA 4CNPA 1UWUA 5CJMA 2QR6A 4RDWA 4GUIA 1EZ2A 1Q6DA 2P50A 4TTGA 3QPZA 4D1IA 3UZJA 2DZVA 3CUZA 1FHDA 3SAZA 3KL5A 3UXIA 1P0BA 4MY9A 4QEHA 3JVAA 1KM0A 1UIOA 4B3LA 2Y5JA 2GL5A 1ZZMA 3CXOA