4HZ8A

Crystal structure of bglb with natural substrate
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
439
structure length
439
Chain Sequence
b'KFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 171
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz8A00
1Y7VA 2J77A 4ACYA 1UKOA 3EDKA 4AC1X 3A6OA 4V28A 3MKKA 1CGYA 2WLZA 3FW6A 3THCA 1I75A 2OLHA 3WH6A 1UD4A 1RP8A 2W4XA 1QHOA 2YDSA 1OIFA 1HKJA 1MQRA 2D22A 3M07A 4GXPA 4PMRA 4C7DA 3VIKA 1AVAA 3AIRA 5I5RA 4TUFA 1RH9A 4DM1A 1V6VA 5D9NA 4MNJA 3CZLA 4MB4A 2WHJA 3U57A 3CHFA 2A3EA 1LLOA 1GQLA 1OT1A 5FD0A 2J7CA 3RMEA 2WWDA 5KEZA 4F66A 5BYWA 1U30A 4MAZA 3SCQA 6CGTA 1DEDA 4HTYA 1JYXA 3SCUA 5JBDA 3BLKA 1BYCA 1A3HA 3PZ9A 5ECUA 2X1IA 3BSGA 2E9BA 3AS2A 1HL9A 1RPKA 3VDHA 4FF5A 1UQZA 1UQYA 1CZ1A 3T08A 1JZ8A 2G3JA 3I3DA 4NRRA 2JALA 2NT1A 4MDPA 4A4AA 3L4XA 4ML4A 2WMIA 3N17A 2VVSA 1W3LA 2A3AA 1UKPA 2J78A 4H8UA 3QHNA 1W2VA 1FH9A 3DYPA 1UR2A 1KCLA 4XV0A 2W5FA 2PWDA 3W24A 2QHAA 1JI1A 2XFRA 4H8HA 3CUJA 2WANA 2EPMX 4W5UA 3WQWA 1H09A 1VFOA 2D3NA 4JHOA 4PMQA 2XIBA 5JIPA 1FOBA 5HPOA 3L4ZA 1E6ZA 3MV11 1GUVA 2VRJA 2ZWYA 2PBGA 3PTKA 3QGVA 3GDBA 4WSJA 4HU0A 2ZE0A 1GW1A 4PSPA 3LPFA 1VJZA 4UFIA 3WUBA 3GYCA 5A1AA 4U5KA 4JFUA 3ZT7A 2XVGA 4RE3A 3W28A 2GVYA 3OLIA 3W27A 1B2YA 1C93A 1JZ4A 4PTMA 2ZICA 1PAMA 2VZOA 3PZGA 4U3CA 1JZ2A 3VKKA 3CTTA 4CU8A 2PF0A 3G6LA 4QP0A 4HMEA 2YJQA 1E6PA 4FLOA 1E15A 1JL8A 1TMQA 5DFAA 1JZ6A 1B3XA 1PIFA 2DT3A 1WAWA 3VD7A 1KR0A 2BVYA 1UKQA 2W63A 3UG5A 1AQMA 3L4VA 2FHFA 3D5HA 4W8BA 1HXJA 3AIEA 3OLEA 3AMGA 4WK9A 1E6SM 2BHUA 4ATLA 3PN8A 3F5LA 3T2OA 3AHTA 3WDIA 3OLGA 3FHQA 1F4AA 3JUGA 4ZXOA 2CCRA 1QNSA 3T0AA 3WF2A 4RL3A 4PBGA 1UOKA 4GO9A 1W3JA 1SYTA 4AXNA 3WDPP 2GK1A 2ZXDA 1MYRA 4JIEA 4URIA 1GVYA 1JDDA 5D8ZA 4ZE5A 5HOSA 1V3KA 3EMZA 4BA0A 4NSBA 4CKQA 4AD0A 4HA1A 3BXWA 5A6BA 1BG4A 3OB8A 4PCSA 5I0DA 3GXFA 1CEOA 5DT7A 5M03A 1WE5A 2CEQA 4W8AA 4DUWA 1J18A 2V3EA 1QW9A 2PWEA 4Q7NA 4J3WA 5LA1A 4K68A 4UOQA 4D72A 2PWGA 1BGAA 3VGBA 4X0VA 2EJ1A 3W6MA 3WUFA 1HJXA 4CD8A 1M7XA 1CXLA 4LX4A 3MUAA 4MPKA 1UD5A 1VFMA 3A4AA 4P7QA 5CQ1A 1V0MA 3BAXA 2CBIA 3AJ7A 4F9JA 3VMPA 2HISA 3MS8A 3VMNA 1DTUA 5I23A 4W7WA 2XFFA 3TTSA 4OBRA 4AYSA 3LPOA 3AS0A 4Z2HA 2VJXA 3EDJA 4JL1A 2WMFA 2WMHA 1HJUA 1WZKA 1JI2A 1XGZA 4W93A 3OZPA 5CXPA 1UWSA 4J7RA 4M29A 2VX7A 3WMSA 3GNOA 2ZX9A 3MU7A 4UTFA 3N1AA 3LPGA 3MMDA 3QR3A 1GZJA 1YQ2A 2X05A 4OUEA 1C3FA 1PX8A 3POCA 5GNXA 4ZFMA 2BY0A 1QOXA 2WAGA 4CCDA 1UH3A 1NWUA 3UERA 2J7HA 3CMGA 5A6MA 4JZ5A 2C0HA 4HZ6A 3MUY1 1J0KA 5D8WA 1AQ0A 2YBTA 1QVBA 3GXDA 3L4YA 1EOMA 1H49A 4U33A 2G3MA 3WH7A 3BCDA 2CERA 1N82A 3FAWA 2VRKA 3PZOA 3BSHA 1JF5A 2ZX8A 4W88A 2BVDA 1ISVA 1FH7A 3AXHA 2FGLA 4JFVA 3VGGA 1SR0A 3WEMA 4GI6A 3CZGA 3WD3A 4YN5A 2OWCA 5DEZA 3SUUA 1JZ3A 1R8LA 4DWSC 3GNPA 2DGAA 5CJ5A 3ARUA 3MUZ1 1CXEA 1OT2A 1PZ2A 3AIQA 1C7TA 1FP8A 1CWYA 2G3NA 2WHMA 4WF7A 1Z32X 1DP0A 1K9TA 3WQ4A 1B1YA 2V38A 2X8RA 1VFUA 3ZMRA 1ZBKA 3AOFA 1MQPA 1UKTA 1OGBA 4QLKA 3ZT6A 1BF2A 1W91A 1MXDA 4XZBA 3U5UA 3WD2A 2O9RA 4OZOA 1E6RA 1NOFA 3S2CA 4GZEA 3ZR5A 4WLCA 3IAPA 2Y4SA 4OIFA 4P7RA 3HU7A 1J01A 1QNOA 2OYLA 4D6HA 1Q6GA 3VNZA 4WKFA 1EH9A 4PMYA 1EA9C 4OOUA 3UR7A 2VZTA 1G9HA 3WF3A 5IXEA 2W66A 3PZTA 3EYPA 2Y8KA 4AY1A 2D0GA 2WYSA 1H0GA 2J74A 3A4XA 3ZSSA 1V02A 2WNWA 1XSJA 2AAAA 1W9BM 4ATWA 2BVTA 4D6FA 2EPOA 4NRSA 4AIOA 4P7LA 1V02E 2NW0A 3WD4A 5A6LA 3RJYA 1V3LA 3N15A 4W84A 1NH6A 1E3ZA 2XGBA 3NUKA 5D9MA 1KBKA 3ARSA 3UETA 5EFFA 2IXVA 3VD3A 2EPKX 2VNCA 2NSXA 1KR1A 2YIHA 4KWUA 2WVVB 3MANA 5A2BA 1EO7A 1D2KA 5I79A 5AYBA 2J62A 3DHPA 4XUYA 5DF0A 2WMGA 1A47A 1C8YA 1WDPA 3RCNA 1H3GA 4GPNA 2X0HA 3WMCA 3AHXA 4LGXA 4PSRA 1C91A 3L4WA 2FGZA 5D9PA 1MFUA 2EXOA 1KBBA 5CPSA 5FL0A 3AHVA 4YPJA 4UZSA 1OINA 1QHZA 2JFEX 3THDA 3UEQA 3L2LA 2J75A 5FIPA 3WBEA 2CESA 2WM0A 1KXTA 1E4NA 2DT2A 3OIHA 3WDJA 1C8XA 2E40A 2J7DA 4ATDA 2WCSA 3MV01 2VQTA 3M7SA 3I3EA 1DHKA 1PX4A 1CTNA 1ZBCA 3AZTA 3PZIA 1UD6A 2CYGA 2CBUA 4TTGA 1W9XA 4J27A 3IJ8A 1BYDA 1BLIA 2XWDA 3FNDA 1W1TA 3VIOA 3ARVA 4JAWA 5HBFA 1ZJAA 1TCMA 4AZBA 3OGRA 2A3CA 3OZOA 5HNNA 1FHLA 1C90A 3SCSA 3ZSTA 3T2QA 5EMYA 1R7OA 4TVCA 4B3KA 1QBBA 4AD2A 1JZ7A 1FFQA 3NJ3A 5A8QA 4FLQA 4S3KA 4LPCA 2VZSA 3CO4A 4B3LA 3CHEA 3VIHA 1G0CA 1M04A 3VMOA 1EDGA 2CETA 2W61A 1JD9A 1K9FA 2B31A 5E6YA 3U7BA 4M82A 4M8UA 1J0ZA 2W67A 3ZJ7A 1QI3A 2YLAA 4D6JA 1GOQA 2VRQA 2E4TA 1GQJA 3VM7A 4HPHA 2Z1SA 3TP4A 5CG0A 4J3XA 2WVVA 3VD9A 3SCOA 2Y5EA 2CIPA 2XHYA 1K9DA 1HVXA 3W6LA 3W81A 2XSAA 4L4OA 4C7GA 1KWKA 2V3GA 4P8XA 3OGSA 1WCGA 1C8QA 5EBAA 4Z2IA 2ZXQA 2FH6A 3VILA 4EKJA 1EHAA 3AS3A 1D3CA 1HJQA 1HP5A 2Q8XA 1UKSA 2V3DA 3MMWA 1W9DM 1KWGA 3O9NA 4M80A 2CXGA 3AHYA 2WLYA 2VUYA 3CHCA 4XX6A 4AD4A 2VO5A 4N0RA 1OGGA 4E8CA 1WZAA 2GDUA 4J28A 2DSZA 2XVNA 2E0PA 1VB9A 2VTFA 2O9TA 1H4PA 2EBNA 2GJXB 2Z1KA 4MAVA 3WNLA 5A3HA 3QOMA 3MUIA 1JFXA 4AIEA 1H1NA 3LMYA 1R87A 3MMUA 3F5JA 2PBOA 1UWTA 5TD4A 1XH0A 4WIWA 3TONA 3WF0A 1KQZA 1JAKA 2J7EA 3WH9A 5AC5A 4LYPA 1B3VA 2IUZA 3ARZA 4MNKA 4FLRA 4UQAA 5A8PA 4AZGA 3AMKA 3AZSA 3A4WA 5GQBA 1LQ0A 3BAYA 4AD3A 3CGTA 3IJ7A 1MVYA 3ZM8A 5DMYA 5M3WA 4QCFA 2GJRA 4JKMA 1KFWA 1VFFA 1ITCA 1MWOA 1BG9A 2WKLA 1E72M 1CBGA 2J4GA 3A3HA 4L4PA 2VQUA 3SUTA 2JF7A 4UR9A 3GBDA 5JUVA 3HJEA 2V3FA 3AMCA 2X0YA 3WQ8A 3G6MA 2J8GA 1XH2A 3DYMA 3WIJA 1E4MM 3SUSA 3ARWA 1GHSA 2QV4A 1EO5A 3B9EA 2A3BA 4UZUA 3CPUA 1GOIA 3N11A 4AIUA 3K8LA 3N12A 1JD7A 3AYSA 3TA9A 3W53A 3OLDA 1O7AA 3ARXA 7CGTA 1WPCA 2E8ZA 4UOZA 4CUCA 3VGEA 1B3YA 1JNDA 3OGVA 4H2CA 2XYLA 1E6XM 3ZJKA 2GSJA 4UQCA 3T0BA 1EGZA 6A3HA 2WC3A 3OA5A 3WBAA 1G94A 5IHRA 2GJXA 4IISA 2ZIDA 3VOCA 1SMAA 1YHTA 4AEFA 2VI0A 1R85A 4E4PA 2DIEA 5FL1A 2WCAA 1EDTA 1DWFM 3VM5A 2EEXA 5EB8A 3WQVA 4CCCA 3NYDA 1H2JA 3NSNA 2WZHA 4X9YA 1QI2A 3ZJ8A 5A6KA 2XSBA 3GM8A 4B16A 1GCYA 3IAQA 2O9OA 2XWEA 1DWAM 2HVMA 1WZMA 4MJ2A 3WDQA 2CITA 5CLTA 4UFKA 3WDRA 3NDYA 1GORA 2J25A 3EDFA 2ZUSA 4ACZB 5A6SA 1E71M 4MB1A 1ZBVA 3QHMA 1WDQA 1H41A 3SCNA 5BRQA 1GOOA 1G1YA 4U31A 4Q22A 1NP0A 3WELA 3ZJ6A 4F8XA 2TAAA 1QNRA 2ZUMA 4U5IA 5A2AA 2CPUA 4PEEA 4UFHA 5A94A 2JF6A 4W89A 2UY2A 2XPKA 1JGIA 3FXYA 4PCTA 1CECA 1GNXA 2CNCA 2DT0A 5A8OA 1HT6A 1J11A 3ZO9A 1QPKA 3WQ5A 4UQ9A 1VAHA 3AIUA 3FAXA 1XCWA 4PTWA 3RDKA 1XC6A 5BRPA 3BAJA 2XFYA 4PMUA 3QOKA 5A6JA 4D6GA 4HA4A 3N13A 3VD5A 2DDXA 3WD0A 5FCZA 3SCVA 4MADA 4D71A 2IXUA 5LYRA 1SFSA 1V3MA 4MJ4A 2YOCA 1W3KA 1WKYA 4PMVA 4GO8A 2ZUUA 3ECQA 3N18A 1Q4NX 1R86A 3WSUA 3GH5A 1E6QM 3BMWA 2CHNA 2VR4A 1KQYA 1UR8A 1J9YA 3GXMA 3MSGA 3PZUA 1OD8A 3W82A 1I1XA 1Q6CA 4JL2A 1XHGA 3SCPA 2ZUNA 1CNVA 3AHZA 2JIEA 2YL6A 4M1RA 2OSWA 1UZ4A 4IM4A 3SIMA 1J0HA 8A3HA 3NCOA 3K4AA 4NF7A 1CIUA 3N9KA 4UCFA 1FP9A 1NWSA 1QW8A 4GKLA 2JEPA 1BTCA 1DWIM 3BH4A 1U2YA 4YHEA 4CN1A 2QLYA 2WBKA 4ACZA 3LPPA 4LYRA 2XIIA 2BY3A 3W38A 2ZX6A 8CGTA 4MB3A 4GI9A 1TR1A 4CVUA 4PMXA 1GPFA 1MXGA 1CXFA 2XM2A 1HVQA 5D4YA 1ZL1A 4PUDA 2QPUA 1QNPA 3EBVA 2ZWZA 1BSIA 3AIWA 3WNOA 3SUVA 2WHLA 1GVIA 2YDRA 2JIWA 1V08A 1JXJA 5BXPA 4CD5A 1H5VA 4CU6A 3VGHA 3O2LA 4B9YA 3W4RA 3CHDA 2WBGA 1MFVA 4JKLA 1KXQA 1BYBA 1GOMA 2DPEA 1B9ZA 2DH3A 2BY2A 1W9UA 1B3ZA 1V6XA 2EPLX 3VUPA 3KL0A 3TTQA 1B3WA 1WNOA 3AS1A 2D24A 4HMCA 3VO0A 3AFBA 3ALFA 3CBWA 2O92A 5I2UA 2XM1A 4HMDA 4ZENA 1E40A 4H41A 2VCAA 2YLLA 3OG2A 1UH2A 3FN9A 1JNEA 1UYQA 3PZQA 3PTQA 3WENA 3AIVA 1XH1A 2OWXA 2JE8A 4MTVA 4A3YA 4CN6A 3AROA 3WL0A 1V03A 4Z2KA 4P7OA 4D1IA 4HOWA 5A69A 1D7FA 3E1F1 3RO8A 3VINA 5CSYA 5F7UA 2D23A 1GQIA 4V27A 5BCAA 4AD5A 4GZJA 3RM9A 1DWGM 4W87A 5I24A 1E0WA 3MSDA 3PZMA 4D6CA 3WNMA 4TTUA 3AMDA 3AISA 5ABFB 3BGAA 3UR8A 3RPMA 1R7AA 4BCEA 2ZUWA 1E0XA 3WH5A 3BAWA 4W86A 1E1EA 4KH2A 4HOXA 1QI5A 2W62A 2FHBA 2YA2A 5I77A 3U7VA 4KRUA 5ABGA 1JYVA 2XVPA 4MNLA 1NM9A 3CZ8A 5JBFA 4JFSA 1VIWA 1ISWA 4UOJA 1WDRA 3GZAA 2NT0A 2VX5A 2GFTA 2DSKA 4DUVA 3UG3A 4TX8A 4CGTA 2EQDA 4W5ZA 5E70A 2RGLA 1HJSA 4W8LA 5BROA 3RJXA 1ZB5A 2ZXBA 1TUXA 4JKKA 1U33A 2XVLA 1LWHA 4DUXA 1UWRA 4J3VA 2DH2A 1V3IA 4F79A 1LL4A 3N04A 4OBSA 4FLSA 1G5AA 2YDQA 1M53A 1ECEA 3BLPX 2O9PA 1NWTA 5IDIA 1FFRA 2EO7A 1OWQA 2J7FA 2BFGA 3DYOA 2CBVA 5CLWA 1MW2A 3NIYA 1WB0A 1ISZA 3ARTA 4UNIA 3PZNA 2A3HA 3W25A 1JYWA 5GPRA 2WMKA 4BZYA 1LWJA 3II1A 1OGSA 1CYGA 2VOTA 5BXTA 4N42A 1NARA 5GNZA 4QLLA 1ZJBA 1VBUA 3WFZA 5AYIA 1L0PA 4MB5A 4C7FA 4DWSD 3K8MA 5C71A 4NZCA 4WKAA 1OB0A 3UCQA 3UESA 4V2XA 5ABFA 1GQKA 1V3JA 4X0NA 3T09A 1BPLB 2C7FA 1GOWA 3RM4A 1PZ3A 2VR5A 1QI4A 3ALGA 3BC9A 4Y7EA 1PIGA 4AZ6A 3AMLA 3KL3A 5C8BB 5A2CA 1HJVA 1MQQA 2PI6A 4NI3A 4HP5A 4Z2JA 1UWUA 2UY5A 1E3XA 1JXKA 3D3AA 3WNKA 4UQEA 2D0HA 1OSEA 1TFVA 5I78A 3TTOA 2J7GA 2WW5A 5HDRA 2CBJA 1BFNA 3SCWA 6TAAA 4Z2GA 3GXIA 4U2YA 1ODUA 1CXHA 5HXMA 3M6DA 3J7HA 2DT1A 2XJ7A 2QF8A 2ZX7A 1V0NA 3CUFA 5CSUA 3ZR6A 2YA0A 5BXSA 2VT0A 2WWCA 1TVNA 4DM2A 3EDDA 1ISXA 5BXRA 1US3A 2WVUA 1BAGA 3L2MA 3WNNA 3B9DA 4PMNA 1NOWA 2F2HA 5C70A 2WCGA 3KWXA 4BS0A 4B15A 1HNYA 2W92A 1PEZA 1CLVA 1P6WA 3VD4A 4LYQA 3VGDA 1BGGA 1HIZA 1MW0A 4CCEA 2PWHA 1X6NA 1OD0A 3T0DA 4LQ1A 2BXZA 1WO2A 2WC4A 1KB3A 2ZUTA 2FH8A 2WSPA 3AIBA 3VU2A 3DC0A 4BQ4A 3WF4A 2D20A 2PB1A 1E9LA 7TAAA 1QHPA 1VENA 1TZ7A 4H8VA 4U3AA 3ARQA 4UQBA 4J3SA 2W91A 4TX6A 1IZKA 4W7VA 4Z2LA 1TA3B 1LF1A 1XYZA 2Y2WA 2RGMA 2VVNA 4PTXA 1UR0A 2GJPA 2GK1B 3CLWA 3CUGA 2F61A 1UZ1A 1EQPA 1UG6A 5IFTA 2BY1A 2XG9A 2WKGA 1ZS2A 3GH7A 1UA7A 3B9AA 1UR4A 1HKIA 2D2OA 1TG7A 2YL9A 4PN2A 4BQ2A 3SCTA 1OBAA 3WH8A 1E1FA 3S6TA 1E5NA 5GNYA 1XD0A 1XSKA 2OSYA 2BHYA 3UG4A 1FHDA 5CGMA 4PUEA 4EE9A 1SMDA 4JFWA 3SURA 3WUGA 1BHGA 1CENA 1CGVA 1Q6FA 1BVNP 3RM8A 2VL4A 4B9ZA 4HZ8A 3OBAA 3QHOA 1V0LA 4BQ3A 4KGLA 4AISA 1W9PA 4JHZA 1IV8A 3FY1A 2WHKA 5I3DA 4S3JA 3CZKA 1HKMA 1F4HA 2VZVA 4XB3A 3IANA 2MANA 4M24A 1TVPA 4PRWA 2JEQA 3GTNA 3VTRA 1W9VA 1UH4A 2ZOXA 1JG9A 2X2YA 3A47A 3T2PA 3GH4A 4AZCB 7A3HA 3WDHA 2WPGA 1VJSA 1GOKA 3I3BA 3PBGA 1M03A 1O6IA 1XRVA 3M46A 2G41A 1Q6DA 2Y8VA 3POHA 2FDMA 1LJYA 4M81A 1V6WA 3K8KA 4GI8A 4ZEPA 1FA2A 3WNPA 4EAMA 1CGTA 1B31A 1NP2A 2WK2A 4EK7A 2PWFA 4QFUA 1MW1A 1E55A 2AOSA 3HMCA 2VX6A 2BS9A 1X1NA 1EDQA 1ISYA 1EIBA 2D1ZA 1OCQA 1V0KA 1UWQA 1W1YA 3PZVA 1M01A 2VCCA 2D0FA 5E9AA 3W0KA 1XV8A 4BF7A 3VPLA 4OJYA 5JBEA 4IPLA 1EXPA 2J7BA 4PMOA 5A8NA 1KGUA 1KXVA 1TA3A 4RE2A 5EFDA 4E8DA 1V6YA 3AI0A 3L4TA 2GUYA 3F5KA 5E09A 2VX4A 1J0YA 2VCBA 1E73M 1JAEA 1XD1A 4FK9A 4MNMA 2YBUA 1CGXA 1H0IA 5AY7A 4TXEA 1HN1A 4AD1A 2DEPA 1QNQA 1NOUA 3GBEA 2BNJA 5A95A 1KXHA 3MO4A 4GQQA 3FHAA 4QDMA 2E9MA 1CGUA 4W85A 4D6IA 1W3HA 1E4LA 5I6SA 4F9DA 1JF6A 3WY1A 4UFJA 5A8MA 1LL7A 1PJ9A 1UD3A 1LG2A 3VX1A 2WC7A 4AW7A 5FKYA 2VURA 3RIKA 1JDCA 3K46A 4P7NA 3EMCA 1CDGA 2ZXAA 3VX0A 1AMYA 3NSMA 4HA3A 3VIJA 5A6BD 3W29A 1AQHA 2XUCA 3AXIA 2VC9A 3CUHA 4PMDA 1GJWA 3VVGA 2GDVA 1H11A 4AZCA 1GHRA 4JFTA 1UD2A 1X6LA 3F4VA 1KCKA 3U5YA 4D6EA 1UWIA 4R5EA 2XGIA 3ZQ9A 4CD4A 1XCXA 3W26A 2DSWA 1HP4A 1VEMA 2CKSA 4P8WA 1V3HA 3CMJA 4WJXA 4P8VA 4J3TA 1TE1A 2BV9A 3WF1A 2AMGA 1B0IA 3WEOA 5D9OA 2J79A 5ABHA 3CUIA 1C92A 4GQRA 1E43A 3TOPA 3WEZA 1LG1A 1US2A 1ESWA 2DQXA 5M5DA 2ESCA 2OWWA 2QMJA 2D3LA 5AC4A 2J8FA 1JFHA 4D1JA 1J0IA 1KGXA 1IT0A 3HN3A 1B30A 1W2PA 5BWFA 5HPCA 2E8YA 1ITXA 3WN6A 3CIVA 3AZRA 1JZ5A 2WMJA 3VIFA 3DECA 3AQUA 3AXXA 1XYFA 2FHCA 4PYSA 4PMZA 3RILA 4CD6A 4MDOA 4LXFA 1W1VA 2DSUA 4AEEA 1C7SA 3WMBA 2ZUVA 3B8SA 4GZIA 5DO8A 1PBGA 3KZSA 1CPUA 1E56A 3K1DA 2G3IA 3SEPA 3CZEA 1HKKA 1EHNA 2Y24A 4AWEA 5IHSA 4PTVA 3EDEA 2DSVA 4DWSB 5IFPA 1E5JA 1NWRA 2QMKA 3K4DA 1VBRA 1CGWA 2X09A 1FH8A 1LL6A 3BAIA 4HZ7A 4E2OA 4EANA 4HOZA 5CPTA 1DWHM 3VDAA 2YL8A 2ZX5A 3VDBA 3CZJA 4OOZA 1NQ6A 1VF8A 3NDZA 3SUWA 4KRTA 2G4FA 3APGA 3O6AA 4RE4A 1DWJM 4HU8A 3WKZA 3BCFA 3EMQA 4IPNB 3ZIZA 1W1PA 1QI0A 2XVKA 4JCLA 4W7UA 1WZLA 4AMCA 3VDCA 4UQDA 1HF6A 1EOKA 4M56A 4P8UA 2VZUA 4CVWA 2YA1A 1CXIA 3SCRA 9CGTA 4QCEA 1E4IA 1UHVA 3PTMA 2V5DA 3VIMA 1I1WA 3KEHA 4AZIA 2C8NA 4GIAA 1WP6A 1BYAA 5ABEA 4UFLA 4FMVA 3VNYA 3ARRA 3AICA 2DIJA 4CD7A 4ZE4A 1J12A 4QLJA 1G01A 1VRXA 2WVSA 5E0CA 2F8QA 3CH9A 1HX0A 2UY4A 4UFMA 4AZ7A 3VIGA 2UWFA 2BXYA 3ARYA 1ZBWA 1K6AA 2J47A 1E0VA 3GNRA 3NSXA 4ZXLA 2G8ZA 2E9LA 4JCMA 1Q6EA 1GJUA 1V6UA 1EQCA 1J0JA 3AYRA 1VEPA 4D6DA 1J10A 1HL8A 4QAWA 1UD8A 2CHOA 4XZWA 3WUEA 3BAKA 4H7VA 2YL5A 4WSKA 4DWSA 1L8NA 3WL1A 3WFLA 3VIPA 3PHAA 5CPQA 2YKKA 1WDSA 1ODZA 3ZT5A 4AZ5A 4OKDA 3DHUA 1JYNA 5E6ZA 1OIMA 5M17A 1W32A 1PPIA 4YHGA 3WQ6A 5LA0A 1BVZA 4HPGA 1GONA 1RD6A 4TVUA 4WKHA 1JIBA 1UUQA 2PC8A 2WVTA 4U2ZA 2OYKA 4A3HA 4H04A 5CGTA 1XSIA 3BMVA 3ARPA 4CU7A 1UA3A 2VMFA 5JIWA 5KZ6A 4KMQA 1B90A 2UY3A 4CN4A 2WZIA 4BQ5A 2BHZA 3L4UA 2V5CA 2QPSA 1ZU8A 2WSKA 4TOQA 1UR1A 4J3UA 1PX3A 1JDAA 5FOOA 4GINA 2E3ZA 1S46A 2WMIB 4TVDA 4R27A 3VIIA 2XTKA 3TTYA 4KGJA 4AZHA 3KE0A 3KL5A 5E0FA 2CKRA 3VGFA 5CZKA 1CXKA 1RP9A 2WZEA 2OYMA 1UR9A 1BQCA 1OM0A 2WXDM 5LA2A 1KGWA 3IJ9A 1MW3A 1E70M 1QBAA 1VEOA 3W37A 2OSXA 1HJWA 3ZOAA 2WB5A 5DT5A 5A6AA 1E6NA 2EPNA 3WD1A 1CLXA 3IK2A 1K9EA 4IUGA 1IZJA
chains in the Genus database with same CATH superfamily
4O1BA 1YNYA 4PUUA 2I7GA 5MF5A 4FO4A 1GEQA 1Q65A 4F2BA 1EGVA 4JYFA 4UTLA 3P5ZA 3HA1A 4GXPA 4C7DA 3AIRA 1DIEA 2F6UA 1RH9A 3O16A 4GOAA 5HJXA 4NZFA 3CZLA 1V5XA 2WHJA 4NI8A 2A3EA 3W7GA 1HUVA 5ABTA 1LLWA 5FD0A 3O6DA 3CU2A 5IBXA 2J7CA 3EX1A 1NF0A 1X97A 5BYWA 4MAZA 4HTYA 1A3HA 5ECUA 3BSGA 2ATSA 3AS2A 4I90A 1HL9A 1OX6A 4GYKA 3T08A 2G3JA 3I3DA 4NRRA 2JALA 1GEHA 2NT1A 4A4AA 4GH1A 5AYZA 2VFDA 3N17A 4QSHA 1UKPA 4H8UA 3QHNA 3WBWA 4YNGA 1EYEA 3KS5A 4AF0A 2XFRA 2VEKA 4O11A 2WANA 4UMAA 3F1QA 3PBVA 3MCOA 4W5UA 1H09A 4NNBA 2D3NA 1TQJA 2GLKA 5HPOA 1MEIA 3L4ZA 1E6ZA 2VRJA 3B03A 2A1YA 2PDMA 2FFCA 2ZE0A 2BWGA 2G4JA 4L64A 1RPXA 2OO0A 4HYWA 4MY8A 4JFUA 2XVGA 4RE3A 3L9CA 4LC6A 2OO6A 2EKGA 3TV8A 2ZICA 3TX9A 1PAMA 2G0WA 5C9UA 4U3CA 2XN0A 1JZ2A 1DYSA 2NX3A 1NDVA 4UR8A 4HMEA 1QOPA 3GG0A 2Z4GA 5E9XA 1TMQA 1JZ6A 3TVAA 3S42A 2CZEA 4A3QA 4IQJA 3OODA 1H1ZA 3VD7A 4CEUC 4QS5A 3LYEA 2W63A 3UG5A 3LTPA 3S0CA 3D5HA 2ZADA 3GYEA 4W8BA 3PBYA 1HXJA 1EJVC 4K8GA 2AGKA 4EX4A 3T2OA 3OLGA 3FHQA 3EKGA 1F4AA 3LSCA 4PBGA 4GIYA 4IMGA 5G4EA 4GO9A 4DHGA 1W3JA 2HRWA 3S47A 3W1TA 3ZYZA 2CXEA 1MYRA 1Y8BA 2R6OA 1U1HA 3EMZA 3PJTA 1BEUA 3RNDA 2QPXA 4AD0A 4YTRA 5D03A 1K3UA 3BXWA 2VFEA 3MBFA 3GXFA 2FKPA 5M03A 3WJZA 1WE5A 4IGSA 3UZZA 4W8AA 4DUWA 2BMBA 1J18A 5T91A 2V3EA 3ERPA 2PWEA 1EC7A 4Q7NA 3TN4A 4B5WA 3CHVA 1F3WA 3MHGA 4D72A 2YXOA 3N4AA 1I45A 3VGBA 4X0VA 2EJ1A 3W6MA 3WK2A 4AVOA 5HMSA 4CD8A 2PDQA 4L5ZA 1P0NA 2J6VA 3M64A 4P7QA 3BAXA 1QWGA 3VC6A 2O56A 3GDLA 4NG3A 2HISA 1ITQA 5I23A 2XFFA 4AYSA 4EAYA 4XZMX 4Z1AA 3AS0A 5HWJA 2GVGA 1TQXA 2XDFA 3KXQA 3KFTA 5REQB 5CXPA 4K1GA 2W79A 3OIXA 3WMSA 3G77A 3TWBA 3N1AA 3LPGA 4WOQA 4X60A 4JQ1A 1DJIA 4AXKA 1KKRA 4QG8A 5GNXA 4XO7A 2WAGA 3VNIA 1NWUA 4HSHA 1F5ZA 5AHMA 1S39A 3SQMA 1A50A 4QX4A 3AYTA 3M41A 1J0KA 1AQ0A 2WO5A 2YBTA 1QVBA 4Q4KA 1FDJA 2CLIA 4IQLA 4QE5A 1N82A 4H9VA 1KV5A 1JF5A 1OFAA 4NZ3A 1RBOB 2FGLA 4QM1A 3TYZA 3VOGA 5FF3A 1P7TB 3SUUA 2RJGA 2Q02A 3GNPA 3R8GA 4IIDA 4ROQA 1RJRA 3CIXA 3W7RA 3AIQA 2G3NA 2P53A 1DP0A 2X8RA 3D46A 5J5RA 1XCFA 3RU6A 3AOFA 1Z41A 4B90A 1UKTA 3M4HA 1OGBA 3KOZA 1XRTA 4FOUA 1LBFA 3TNOA 4XZBA 2FZ9A 1XLDA 3FLUA 2OGYA 3IJ6A 4IP7A 1HTIA 3TZFA 4OIFA 4P7RA 3H7RA 1NDZA 1YW1A 4L7ZA 5I02A 2REQB 3PNUA 3MP4A 1TUFA 1XISA 2PF8A 4H9MA 3UR7A 1TWDA 1G9HA 1UUMA 2QEZA 5REQA 2FIQA 3RPDA 3EYPA 4XTDA 4AY1A 2Z28A 2D0GA 1FKWA 2INEA 3WK3A 3A4XA 3FCPA 1V02A 5HATA 1W17A 2AAAA 5H91A 3FJLA 2Q01A 4AIOA 3DAQA 2P76A 5A6LA 1U1UA 3N15A 2J66A 5D9MA 3USBA 4YYCA 1FDZA 2IXVA 4JYEA 1M65A 4DLFA 2DVUA 1OEPA 2ZZ4A 1RV8A 3FEMA 3FXGA 3QGKC 5I3FA 1EO7A 2ZYFA 2C1HA 5AYBA 1XIEA 1NEYA 3DHPA 4DIAA 1P7TA 5DF0A 3MZ2A 1C8YA 4I8DA 7ENLA 4GPNA 2DUZA 3VCRA 4AMAA 3E96A 3BLFA 4C6PA 4GNKB 4YU1A 5FL0A 3AHVA 1PZ1A 4DXVA 2GQ9A 3GC5A 4HNLA 1XLBA 1QHZA 2JFEX 3THDA 5LNVA 2QCLA 2QCDB 4HN4A 3WBEA 2CESA 2KZHA 3P0WA 3OIHA 4JX6A 4GLEA 7ODCA 1ADDA 1MZRA 3KRSA 4WDXA 3RX2A 1MXSA 1OC6A 1PX4A 1R5YA 4PTDA 3AZTA 4NZ5A 4WJEA 2CYGA 6PTDA 2OT0A 3GTFA 4BI7A 2REQA 4F2UA 3XISA 2B0MA 2JQXA 1P0EA 4L6DA 1FHLA 4J9JA 4M5PA 3S1WA 4H7CA 1JRBA 1PE1A 3P82A 1DJZA 4E2DA 4B3KA 4GYPC 1Q8JA 3PG9A 3VA8A 4KWVA 2A2IA 4DJDD 3CAKA 3CHEA 2VYOA 4I8YA 4DWDA 5E6YA 3U7BA 4J1OA 3URQA 1D3GA 1VCGA 3VM7A 1I8JA 3TH6A 3WQDA 3SCOA 2V2CA 3WYZA 2CLOA 2D73A 2XSAA 3B04A 5XINA 4PR4A 5HUPA 1WCGA 1M1BA 3UZWA 3P8JA 3OBEA 3F2CA 2X1TA 2ZXQA 1OX4B 3C0JA 5K4ZA 4EKJA 3AS3A 4O1AA 4ZR8A 2V3DA 3M0ZA 2ZQ0A 3S46A 3O9NA 2CXGA 2QCDA 1EBHA 3MDUA 2P50A 2WLYA 3H12A 4O28A 4IMFA 4AD4A 3EOSA 1PVNA 4N0RA 1OGGA 5KZDA 2HNHA 1DE5A 4E8CA 3O0KA 4J28A 2XVNA 2E0PA 2GJXB 5A3HA 1WA3A 2CLHA 4B4FA 5FEXA 3V5CA 3TOYA 3QOMA 3QV7A 1JFXA 4AIEA 1H1NA 5GJMA 3DU0A 3LMYA 1R87A 1DJXA 3R6IA 3T6CA 2W9MA 1XH0A 4P5UA 5XIAA 3LDVA 3NGJA 5T9BG 2J7EA 5AC5A 1RD5A 3UJEA 5BOFA 3LMZA 1Z7AA 1B3VA 2IUZA 4MNKA 4FLRA 2X2GA 4AZGA 1H7XA 4YJ5A 3AZSA 3A4WA 1F73A 1XLKA 1NELA 3BAYA 1NFPA 3NURA 1XFCA 3IJ7A 3O6YX 5M3WA 3F03K 4FP1A 5C2XA 1ITCA 1ELSA 3N34A 3ZLGA 3E5PA 1E72M 4GXMA 3A3HA 3E38A 2JF7A 3HPXA 1A5CA 3HJEA 2V3FA 2X0YA 1PS9A 3WIJA 2WM1A 1K77A 1UPPA 4QG9A 4GACA 4BR1A 3B8VA 3EX6A 1JCXA 1GOIA 4QJ3B 4AIUA 1OX4A 2P10A 1JD7A 2QCEA 2Y5SA 3DX5A 3ARXA 3W1PA 2FB2A 2RUSA 5H6HA 2VEIA 4UOZA 1DPMA 3G5EA 3VGEA 4O0KA 1L9WA 3GZ3A 4X3ZA 4JIPA 4YVXA 1E6XM 3LZ5A 3XINA 3L68A 1AJZA 1W5MA 3NQ6A 1EGZA 4Z0SA 1F3EA 2QJMA 3GNNA 2GJXA 4IISA 3IPWA 3EWXA 1O95A 2HWGA 2DIEA 4NT0A 2QT3A 3EGJA 4FX7A 3GHSA 1V77A 2Y5JA 4CCCA 1PHQA 2ODOA 3V5FA 3THUA 2HCVA 4MIMA 4PUKA 1QI2A 1DV7A 5A6KA 3GTIA 3RU8X 3GM8A 2HK1A 4ZB0A 3UCDA 3IAQA 2O9OA 2XWEA 3ANUA 2HVMA 1K7XA 1WZMA 2J88A 5FI8A 3WDQA 2CITA 3QQ0A 4K8HA 4LEFA 4LEQA 4UFKA 3WDRA 1GZ1A 3EDFA 4ACZB 5A6SA 1XKYA 4XD6A 2VC5A 4LVFA 1W5OA 1H7NA 1H41A 1T40A 4MOZA 3SCNA 4WZHA 3VOFA 3TQVA 3NQ8A 4U31A 4Q22A 2QXWA 1KFCA 3WELA 4C91A 2E28A 3B8DA 4WQ6A 3VCNA 3TN5A 1SZFA 2QV5A 4PEEA 3GSMA 3BWWA 2JF6A 2PTDA 1WKDA 3C0LA 3CAQA 4NJGA 1JGIA 3M6YA 3TQ0A 3FXYA 1S2WA 4PFHA 2DT0A 3UCCA 3LENA 1OG0A 4AY7A 2X7VA 5IDZA 3AIUA 1ZLPA 3BDKA 3QJAA 4XZ9A 3N25A 3JU2A 2XFYA 4PMUA 2CLEA 4D6GA 3N13A 3VD5A 1XLLA 5SWUA 3DOPA 3WD0A 3EPNA 4DI9A 3ABXA 1YPFA 1FHVA 1ME9A 5LYRA 1F2JA 2YB1A 3I7RA 3W7KA 4GO8A 3UD6A 3ECQA 4FF7A 3N18A 1R86A 2DZAA 2Z25A 5DBTA 3UA4A 2IW0A 4JQ2A 4DY1A 1R3WA 1KQYA 1XLFA 4PTNA 4UC5A 3MSGA 1KFBA 1DQUA 3W84A 1H61A 1I1XA 4I5UA 5CC7A 4Q4RA 2H8XA 1XM3A 1CNVA 4QTGA 2FVKA 1R0MA 4M1RA 1M7OA 5FEPA 8A3HA 4NF7A 1LQAA 1FRBA 2V8ZA 2QUUA 1FP9A 3LV6A 1QPQA 1QW8A 3C6CA 3BH4A 2DZUA 4UWMA 3ENLA 2QLYA 1UROA 4ACZA 4O1FA 1ZGDA 1TV7A 2TRSA 3UXDA 2ZX6A 2V69A 3DFOA 4O0QA 4XBJA 5DMMA 1S2AA 2V0TA 2XM2A 4IZGA 2PLCA 5D4YA 1ZL1A 1P1XA 4L6OA 4IIEA 4GHRA 1BSIA 2QGYA 5LKYA 3WLKX 3HV9A 3VKAA 2Z7KA 4ZBCA 3O3RA 3KWSA 1KLYA 3EX3A 3SADA 1H5VA 4CU6A 4EXAA 1Q7MA 4YCPA 2WBGA 2BG5A 1W1B1 1MFVA 4GJJA 4JKLA 1GOMA 1B9ZA 1A0CA 5IRPA 1RCOB 2BY2A 1B3ZA 5HJYA 2IKIA 3KL0A 3ABZA 2H6RA 3ALFA 3RLGA 4CNUA 1NF7A 3LGDA 1E40A 1YYAA 3NQCA 3G1YA 2YLLA 3OG2A 2X30A 3PTQA 4HKPA 1XH1A 4MTVA 4CN6A 5AHLA 3WL0A 3W2NA 1V03A 5A69A 3S9ZA 5D09A 1ZUAX 2D23A 2C79A 4BI6A 4KCUA 2ACSA 4V27A 3DG7A 1OQFA 4AD5A 2BOEX 4W87A 4C6IA 4L1GA 3WNMA 3AISA 3KX6A 5ABFB 2XH7A 3LCHA 4A29A 3UR8A 4ZQRA 1E0XA 4GUGA 5LIXX 1AZ1A 4GE8A 3BAWA 4JR5A 1S5NA 4FPSA 3C2RA 4K7VA 4G2DA 3TQPA 5K2ZA 4ZO7A 3HM7A 4CQ8A 1QI5A 2F84A 2DP3A 2G50A 1K6WA 3W72A 2FHBA 2YA2A 3MUCA 4KRUA 4GX9A 4RNIA 3O7UA 3LTSA 3DFTA 4MNLA 4S3EA 2DZSA 4Q4OA 4Q8UA 4GG9A 4EF9A 1MEHA 5JBFA 1RHCA 1WDRA 3GZAA 2VX5A 5U7SA 4KEVA 2DSKA 1H7WA 1KFKA 4F0HA 2EQDA 5CGQA 3HFTA 3I4EA 3FKKA 5FACA 2CLFA 1HJSA 5BWAA 3QN3A 3H22A 1KTNA 1QO5A 3DFHA 3NR0A 2XVLA 4MZ8A 4O8RA 4OECA 4IIHA 4DUXA 4B5NA 2NLIA 2DH2A 3LBMA 4F79A 1LL4A 2ALRA 1G5AA 2YDQA 1JRCA 3R5EA 5HWNA 1AJ0A 3UXKA 4KWOA 4O12A 4XVEA 5T9CE 1ECEA 2NV1A 5C54A 1QMLA 5IM51 4PRRA 4Y8FA 2RFGA 5IDIA 3A12A 1OWQA 2BFGA 5DCBA 3G3DA 1L6YA 4NJIA 2W0UA 2CZ5A 1MW2A 5JQ9A 2CLLA 1ISZA 5DRIA 4UNIA 2A3HA 3W25A 2Y7FA 4BZYA 3II1A 4AVNA 4N42A 3PSVA 4QLLA 1GVEA 4RPQA 1HO1A 3WFZA 4DO4A 2GGGA 2DU2A 4DWSD 4JGDA 4WKAA 3W74A 3BANA 3UCQA 6XIAA 1T8QA 4V2XA 1L6GA 5ABFA 1LQ2A 1GQKA 1U5JA 4NAFB 3N6HA 4ZQCA 3RM4A 3DN5A 3BC9A 1PIGA 5AHEA 3T0TA 4K38A 4KCWA 4O50A 5C8BB 3M0HA 2CLMA 1HJVA 4QG6A 1MQQA 3JR2A 4HP5A 2QF7A 2UY5A 1E3XA 1RQBA 1OSEA 5I78A 3TTOA 2J7GA 4JTHA 1BFNA 3ID7A 4B92A 1X96A 4U2YA 1ODUA 3W07A 5HXMA 3M6DA 4N4QA 1MNSA 2XJ7A 4ORMA 4C60A 2HQAA 1TX0A 4DO6A 3SQLA 1I2PA 2AGTA 5CSUA 3ZR6A 2YA0A 4WDWA 2VT0A 2WWCA 5I06A 3DENA 4GI4A 1W5QA 1S5WA 1OYBA 3QZAA 4NKCA 4PE8A 1NOWA 4QROA 2HXUA 4B15A 4BS0A 2W92A 5A6TC 1CLVA 9XIMA 3CL6A 1EPXA 1J2WA 3IV8A 1HIZA 5AVHA 3MMTA 1X6NA 1N8FA 5L6UA 4Y96A 4H1ZA 3LCLA 1WO2A 1AD4A 3TYEA 3DC0A 3VOJA 3QPYA 4BQ4A 3WF4A 1RLCL 1JCMP 2PB1A 3RF9A 1ZJIA 7TAAA 1QHPA 3UZ5A 1PKMA 2XIOA 4H8VA 2Y61A 3ARQA 1IQ8A 5JH1A 3EZ4A 1TA3B 4LF1A 1LF1A 4EXQA 3B8TA 3AUJA 2Y2WA 1ZCCA 4GX8A 3MO7A 3TNBA 1EZ2A 4PTXA 1NU5A 2GJPA 3CLWA 5G4HC 4NAFA 4MG4A 1EQPA 1UG6A 1PTGA 4LAOA 4XWUA 3NO1A 4QXIA 2JGYA 3B9AA 4BEUA 1HKIA 3ICJA 3SCTA 5B7ZA 4ZO8A 1TWWA 3S6TA 1E5NA 3GR4A 1XD0A 3TMQA 1EEXA 1WUFA 3FKRA 4D2JA 1XSKA 2OSYA 1LP6A 2BHYA 3DGRA 1ZZMA 3E2VA 4PUEA 4IG2B 4Y9OA 3QKEA 1YADA 2XZ9A 4YYFA 1JCTA 3LXBA 4XZIA 5J8LA 4XIAA 4JTFA 1GT8A 3IUHA 1BHGA 2P0OA 1BVNP 4DBEA 1JQVA 2VL4A 3Q65A 1DVJA 2ZDSA 3CB8A 5DXYA 1W9PA 2WHKA 3Q94A 4HK5A 4XB3A 3QC0A 4QDPA 2MANA 4IGMA 2F2KA 4QSFA 1TVPA 4JXCA 3VTRA 1BVWA 1W9VA 2ZOXA 1JG9A 1H50A 2X2YA 4FNPA 3QZEA 3N9RA 4AZCB 7A3HA 2R94A 2WPGA 3NQ7A 1I2QA 2B7NA 3BLOA 4ERIA 4C1NB 3PBGA 5CZTA 2ASHA 1XBZA 1XRVA 2Y8VA 1Q6DA 4Q8OA 1BWKA 3UXIA 1FA2A 3E2RA 3WNPA 1CGTA 4GK8A 2HK0A 4FB7A 1EF3A 3HMCA 2VX6A 1K4GA 4WRHA 5C55A 4R7OA 1X1NA 4PFMA 1TZZA 3AALA 1TJ2A 2D2HA 1UWQA 1W1YA 3PZVA 4BEQA 2VCCA 3WLIA 3S2MA 3CAVA 2P3EA 2QDHA 4GZ7A 3VPLA 1LM1A 3S2JA 1EXPA 2J7BA 3T07A 1RJPA 4FXRA 4NJJA 3B8IA 1TA3A 1OADA 3O0FA 4R9XA 3G22A 3H2EA 3C2EA 1MUCA 3PUEA 1M41A 4LAMA 5CC6A 5E09A 3BLEA 3N6JA 3U4FA 4D8LA 5LHFA 1E73M 2PDUA 4A8IA 1XD1A 4HCHA 1ICPA 2YBUA 2PDIA 4PH6A 1H0IA 3A24A 3CV7A 3NQEA 3W70A 3SIZA 3D0CA 3UPWA 3A23A 2V5LA 2Z27A 5BU6A 1XINA 3ZWTA 1NY1A 1W1A1 4Q8NA 2E9MA 4IG2A 1MEWA 3E02A 3TFXA 1E4LA 4FZIA 4N02A 5DCEA 3WY1A 2PDKA 4UFJA 2OEKA 2QJHA 3D6NA 5A8MA 1LL7A 4KESA 2DJXA 2WC7A 5FKYA 4P7NA 4QIUA 4LVGA 3VIJA 4JTGA 1NJJA 3MA8A 2QVNA 1AQHA 3KAOA 2OT1A 1KFEA 2VC9A 1THFD 2GDVA 3CQIA 4AZCA 1GHRA 4L4LA 4GGBA 4C1NA 1KCKA 3PB2A 2V63A 2I17A 1RUSA 1UP2A 1XCXA 3W26A 3DFYA 2DSWA 2OKTA 2CKSA 4QNWA 4X22A 3PUGA 4LU0A 4P8VA 1A4LA 4J3TA 1TE1A 3DHFA 2J79A 5ABHA 3CUIA 1E43A 4ERAA 3WEZA 3LQLA 3TLQA 1LG1A 1US2A 1ESWA 4F2TA 3QPEA 3ZR4A 2PGFA 4LJ3A 1P6CA 3KCLA 1JFHA 3KRUA 1DJGA 1J0IA 1IT0A 1AH3A 4NILA 1SR9A 5HPCA 4HB7A 2E5CA 1YXDA 1XDJA 1K4HA 3AZRA 3CIVA 1JZ5A 1PTDA 3M16A 4PCFA 1BD0A 1X98A 4LCQA 4S3GA 3UJSA 3AQUA 1F76A 1W3IA 4PYSA 1BKSA 4CD6A 4LXFA 3OEXA 3QSRA 3A4JA 2DSUA 4AEEA 4MUZA 3IEBA 2ZUVA 1DJYA 3V5OA 1LWIA 1PBGA 3KZSA 1CPUA 3CZEA 2RDXA 4JHMA 2Y24A 4WGHA 4AWEA 1I9CB 1XGDA 3K4DA 1W8SA 3T4WA 4JTAA 5G1MA 2DORA 2B4GA 2TSYA 3N3MA 3WLOA 4NAEB 2YL8A 3HBLA 2ZX5A 2CLKA 4ORIA 4HHPA 3VDBA 4ADSA 3STCA 1FY6A 2OQLA 4NP7A 4KRTA 1GG1A 2G4FA 3PTDA 3KDOA 3O6AA 4DJEC 4GQ0A 3LB0A 2PP1A 3W1LA 4IPNB 3R7MA 1UB3A 3ZIZA 1QI0A 2XVKA 4AMCA 3VDCA 4UQDA 1EOKA 5AECA 2VZUA 4CVWA 3SJ3A 3UWZA 1N8WA 2A21A 1UHVA 3VIMA 4GUJA 3N2OA 4GIAA 5ABEA 4QAIA 5D04C 2PGEA 3VNYA 3GXTA 5LXXA 5G2HA 4ZE4A 2WVSA 2F8QA 3CH9A 1HX0A 3LGGA 1S5MA 3ARYA 2BDQA 2OU4A 4ZXLA 1Q6EA 1GJUA 3TAKA 1V6UA 3C3UA 1EQCA 4O4WA 5CBBA 1VEPA 1HL8A 4R85A 1UD8A 1TPUA 1OK4A 2XZ7A 3FV9A 3SRHA 4XZWA 1FWJC 1IEIA 4JN6A 4DO5A 2YL5A 1L8NA 1ENUA 3OQEA 1ODZA 1GKPA 4OKDA 1JYNA 3IUIA 3P80A 4B5TA 4BKNA 5M17A 3RYSA 2QKFA 2JK2A 5LA0A 1TREA 4NAEA 3E0WA 4A3HA 3B0UX 1K8XA 1H7PA 2YCJA 4FXJA 3DC8A 3V75A 1XQLA 3CQ0A 3G1AA 1ZU8A 5DY2A 1MSSA 5DBUA 1UR1A 4D9PA 4HT3A 2NUXA 5FOOA 4GINA 2ZE3A 4C6JA 4GUHA 3UFYA 1JCLA 2Y85A 1ZHAA 2WNQA 3TTYA 4KS0A 1W5NA 4FOKA 4CQBA 1VGAA 5CZKA 4LF2A 3T0CA 4UB9A 2FTYA 5GVJA 2HSAA 1OM0A 3IJ9A 4HIBA 5BOEA 3D3FA 3W23A 5E0KA 3ZOAA 2EG8A 2NWRA 1TX2A 2I14A 1B4EA 4O14A 3WD1A 3IIVA 3SRKA 4HYVA 2I57A 4XKMA 1Y7VA 5AZ0A 3B8WA 4ACYA 4KFOA 3EEGA 1J2BA 1KM6A 1RK6A 3A6OA 2WLZA 4UTTA 1I75A 3WH6A 1W1IE 3DZ1A 3TE9A 1QHOA 3FSTA 3KVJA 1YIXA 3ZWSA 1MQRA 2QIWA 3OHMB 3GY1A 4GVGA 4BJHA 3H23A 5LHEA 2JKAA 3TU9A 5F4WA 3VIKA 4Y6GA 1AVAA 4Z17A 3ZVHB 2V2HA 2B7OA 4IJRA 4H9XA 4MB4A 2ZC1A 1AH4A 1VFSA 4JD4A 3CHFA 3D47A 3DI0A 4IL2A 3FJNA 1XF0A 4BFAA 4F66A 1IF2A 4DJFA 1U30A 3SCQA 2E68A 6CGTA 4OVXA 4FR6A 3RLHA 3EWBX 3SCUA 2QCNA 2RAGA 3PZ9A 3R58A 3CQHA 2X1IA 1WKEA 1RPKA 3VDHA 2X0SA 4JX4A 3IIXA 1GQNA 1UQYA 3ZZ1A 1CZ1A 1JZ8A 3S1XA 1RVKA 4RXFA 2CWXA 4MDPA 4R3UA 2YPIA 4G5DA 4CQ9A 3DXIA 3NQVA 3VKJA 3PJWA 2A3AA 1FH9A 4DZAA 3DYPA 3F2BA 3EWDA 1KTCA 2CU0A 5LNUA 3N73A 2DW6A 2ZRVA 5EL1A 2FZ8A 1W31A 4Z42C 4C6EA 4DZ5A 3M5ZA 5LNWA 2QHAA 4I5XA 2PDYA 1WQ5A 3G1XA 5AFDA 2EPMX 3TLLA 3U2EA 4PMQA 4KETA 4ZQNA 3NQBA 5HMDA 3OQ8A 3MV11 1R3TA 3QM3A 2ZWYA 4DN1A 4WSJA 3HPFA 2PDWA 1GW1A 4AU0A 4YTQA 1VBHA 4O13A 3LPFA 1VJZA 4UFIA 3WUBA 4U5KA 2Q6ZA 2C1IA 3W28A 1EXBA 1B2YA 1C93A 1JZ4A 3PZGA 4HNTA 3LCGA 3VKKA 3LHYA 2GQ8A 3RRAA 3ZVHA 2YJQA 1E6PA 3KLKA 1E15A 5TNVA 5DFAA 4UXDA 2Z2BA 1YTKA 2DT3A 3UVAA 3KHDA 4A22A 3SSZA 4DAIA 1UKQA 3VC5A 4XZLX 2V9DA 5BMXA 1RAKA 1E0TA 3OLEA 1RCQA 5FJIA 4WK9A 2VEFA 3LLXA 3RAOA 3JUGA 3S5YA 4ZXOA 1TSIA 2CCRA 3GK0A 3EWCA 1UOKA 4Z1DA 3WDPP 3W2JA 3T8LA 3QGAC 3EWWA 1S3TC 3P67A 1TV2A 2GGJA 2ZXDA 3R11A 1I60A 5D05A 1GVYA 4ZE5A 5D8ZA 1QASA 1V3KA 2TMDA 4UNKA 3A3WA 1CLKA 5LGZA 4O4VA 3NG3A 1GW9A 2YYTA 2GQAA 3VE7A 3OB8A 1CEOA 4U28A 3UGRA 3MWAA 4KIEA 1QUMA 4K68A 4B5SA 4PB4A 2PWGA 3V35A 1GVFA 2DIKA 3M5VA 1CXLA 4LX4A 2BP1A 2XH4A 1PB0A 4AEOA 4MPKA 1UD5A 3VMPA 2J9YA 3SRDA 4DAFA 5TBOA 3TTSA 3VNLA 3ZVIA 1TV4A 1HJUA 4I5RA 1JI2A 1HGWA 1NFGA 1R38A 4AWSA 4XUGA 4J7RA 4M29A 3E9AA 4DUOA 1SJAA 3BW3A 1Q13A 1DJWA 3PWGA 4I9AA 4QJ4B 1XIBA 1C3FA 4KPLA 3L0GA 1S2UA 4ZFMA 1ZP4A 1QOXA 3KVLA 1UH3A 1KM4A 1EP2A 1JPMA 2Z24A 2G96A 4HD5A 4GCAA 5D8WA 5HR7A 3L4YA 4DO7A 1EOMA 3N2XA 4U33A 3WH7A 3BCDA 1SZRA 1DHPA 2POZA 2BBFA 4HN8A 3STFA 3W7NA 2ZX8A 4E4FA 1XQKA 4O1CA 3WJSA 4JFVA 5TF0A 3NM3A 3WEMA 3WD3A 3NNTA 4O0ZA 5DEZA 1R8LA 3VKCA 2HVNA 4GH3A 3JZEA 9XIAA 3VYLA 2WV8A 2PU1A 3MUZ1 1CXEA 1OT2A 2HZGA 1C7TA 3F4DA 5B7YA 4WF7A 1IR2A 1XUZA 1XPGA 3WQ4A 4XTIA 3ITVA 4IP5A 3ZMRA 4GIEA 4V1XA 4E5TA 4RR4A 4RJEA 1A4MA 4Y9MA 4S38A 2PDGA 1BF2A 3W6YA 4NL1A 2ISDA 3WD2A 3ELFA 1Y5XA 1G4TA 2GGIA 3HGOA 3GFYA 1OFRA 1J01A 2Z1VA 1QNOA 4LB3A 3IIOA 4WKFA 4OOUA 5DN1A 5CJMA 3NZQA 1HQTA 4XAYA 1VIZA 5IXEA 1PDZA 2W66A 1AL8A 2Y7GA 4HNUA 1EBGA 1T6MA 3V0SA 2CHRA 4WHBA 1H0GA 1LTDA 2J74A 2WNWA 5H1WA 3QLDA 3R89A 3ITGA 1MNZA 4P61A 3AWNA 4S3FA 4D6FA 2EPOA 1W0MA 1RY8A 4P7LA 2WOQA 3M44A 3RJYA 1HL2A 4W84A 1E3ZA 4JICA 3ARSA 3KRZA 1TCDA 1W54A 3QF0A 5KZEA 1CCWB 1TTIA 2ZA3A 3ORWA 5EFFA 3VD3A 3QFEA 1W5PA 1EB3A 1T7LA 4YIWA 3CYVA 4CQCA 3QXBA 3SO7A 4M51A 4GGHA 3GW3A 2G5WA 1E9ZB 2P1FA 3UF9A 2OELA 1GVRA 2QULA 4RW3A 4RCXA 3BUVA 1VLWA 3I6EA 4YTSA 1V4YA 1A47A 4AHQA 3QFWA 1H3GA 5CCZA 5F2GA 2QDDA 1BF6A 3WMCA 4PSRA 1XRFA 1G6CA 2XINA 3Q37A 3L4WA 1BWLA 5FJTA 5CC5A 1KBBA 1J79A 3BV4A 2BVWA 4Y9PA 1OINA 5FIPA 5EU9A 3UZJA 4MWAE 2WM0A 3MQTA 4GISA 1E4NA 4N9BA 3LOTA 2J7DA 4DQWA 3M7SA 1DHKA 1CTNA 1K7FA 3ZLHA 3LLDA 1UD6A 1OFDA 1KCXA 1XIHA 4J27A 1BYDA 1X1OA 2XWDA 3FNDA 3RHGA 1ZJAA 1TCMA 2F38A 5FJOA 4WJ8A 1LZOA 5CZSA 4US5A 5HNNA 2ACUA 3V18A 1P43A 2RDWA 1G7VA 1WV2A 1JZ7A 4Y9AA 3NJ3A 4BHYA 4AB4A 1H5YA 2NVDA 4B3LA 3VIHA 1G0CA 1M04A 3VMOA 3G8EA 3FA5A 1EDGA 2CETA 4MJZA 1TWSA 4FA3A 1K9FA 3OHIA 4Q33A 4M82A 2YXGA 1J96A 3CLMA 1IEVA 1TJ0A 2SFPA 3NQMA 4D6JA 1GOQA 3B05A 4PC8A 2WSQA 2VRQA 4MSSA 4HPHA 1QK2A 3W7HA 1SJDA 4J3XA 1OFPA 1TYGA 4C7GA 3QH2A 4L4OA 3W81A 1C9WA 4JNZA 4P8XA 1C8QA 4A8LA 3P61A 4Z2IA 2FYMA 4C5ZA 3HG2A 1EHAA 1O5XA 2UV8G 2R14A 2TPSA 3VOIA 3N4EA 3MMWA 4K36A 2VD8A 1X1ZA 4M80A 3AU6A 1OABA 1Z8AA 4M0XA 1D7KA 1MUWA 7XIMA 1VB9A 2O9TA 3TJLA 2EBNA 2OTDA 5HMEA 5T8GA 3CT2A 1OJXA 2QCMA 2GQ3A 3MUIA 2GUUA 3F5JA 2PBOA 4AHPA 3BLIA 3PP7A 5TD4A 2PTYA 4ECLA 4LV9A 3W7PA 3B0YA 5A5WA 3WF0A 1KQZA 1MZHA 3IJQA 4UQAA 4I3GA 4XSLA 4Q4PA 5HQEA 5A8PA 3E49A 1UBSA 3AMKA 5GQBA 2YDAA 2C91A 3EWYA 3R10A 3MPGA 3NEHA 4GFIA 3ZM8A 5DMYA 4DB7A 3TCSA 3APTA 5DX7A 6ENLA 1MWOA 3GE7A 1CBGA 5PTDA 3W7LA 3B9OA 2VXNA 2VQUA 4N7QA 3WQEA 2DFAA 5JUVA 4O1EA 1TELA 3AMCA 1I6NA 2GJLA 3WQ8A 3DYMA 1NVMA 1ZP3A 1GHSA 3LK6A 4L4MA 3GFZA 3N12A 2W27A 3AYSA 1JUKA 3CPGA 3ITLA 1RQHA 1H60A 4HK7A 4ZO9A 1WPCA 2E8ZA 4OT7A 4J5NA 1QPRA 1ALDA 1G7UA 4XBKA 3L23A 1S1PA 3GD6A 3ISIX 4JIRA 2GSJA 1JDEA 2Y7EA 3FYYA 1H7OA 2VGBA 2YW3A 2ZIDA 3VOCA 1SMAA 3BOLA 1KM0A 5GJNA 2VI0A 1R85A 4DNHA 4FX6M 1JEZA 5FL1A 1DWFM 2EEXA 5EB8A 3QSTA 4CNNA 1IHIA 3NYDA 1S2VA 2ZA1A 4BWLC 2Z6JA 1R9YA 5EMJA 1DWAM 4OV9A 4OBTA 5KSWA 3H54A 2ZZ2A 4QRNA 4MUPA 1E71M 5HNTA 1ZBVA 1P6BA 1WDQA 5BRQA 3BJTA 1H51A 1NP0A 4YWSA 3ZJ6A 5HINA 3G18A 4H4IA 1ZCOA 3CM4A 4C6MA 3MWCA 1M7JA 2A5HA 4U5IA 3P14A 1O60A 2CPUA 4QITA 4UFHA 2UY2A 2XIQA 2NV9A 3E0LA 2CNCA 4NX5A 1J11A 1QPKA 2Q71A 3IIPA 1K03A 4UQ9A 4M6PA 1VJIA 2Z0IA 4IPPA 4LSBA 3RDKA 1EGMA 3BQ6A 1XYCA 1R2SA 3QOKA 3KVMA 1W6TA 1WAUA 1AZ2A 3NOEA 3SCVA 4MADA 3EAUA 1V3MA 4HPNA 5AB3A 4MJ4A 1X7IA 3P74A 1W3KA 3DIPA 4PMVA 2ZUUA 3DFQA 3FVDA 1I2NA 3I65A 1Q4NX 4F0LA 3GH5A 1E6QM 2PODA 4NIRA 1K8CA 2PMQA 3WLMA 1J9YA 6REQB 3PZUA 1OD8A 1UASA 3W82A 1VYSX 3NQGA 4R33A 3SCPA 3KCJA 4JEQA 2JIEA 2YL6A 3AHZA 2OSWA 2C0AA 3SIMA 1J0HA 3K4AA 3NCOA 5D2TA 1CIUA 1EP3A 4RZ4A 3REQB 3ATZA 2VFIA 3ABOA 2JEPA 1DWIM 4XSMA 1U2YA 4YHEA 1O4UA 1EJSC 4HCDA 2XIIA 3GO2A 5HNRA 3T8QA 2BY3A 4GCXA 1JULA 1KBJA 1NTHA 5J5DA 4MWAC 3C0SA 8CGTA 3OVQA 4MB3A 2HDJA 4PMXA 1GPFA 1TPH1 3HQ1A 4TO8A 3KTCA 5FF0A 1N2VA 1XUUA 2QPUA 1BSLA 4S3CA 2ZWZA 3AIWA 3WNOA 3SUVA 1L6WA 5CH9A 2PP3A 3M47A 1RVGA 1SSGA 1JXJA 3C8FA 2DY3A 5EPDA 2Z6IA 3O8AA 4CD5A 3BJFA 3M1ZA 3QR1A 2ADAA 3VGHA 4YL2A 3CHDA 1HKVA 2E7FA 3L7RA 4Q7IA 1KXQA 4O19A 2PAJA 3ONCA 5BOOA 2DH3A 3LTYA 3RLUA 4B5UA 3K2GA 1LORA 3NTYA 1EJTC 1B3WA 3QQ1A 4IL0A 2O92A 2VR2A 1KRAC 2XM1A 4GYJA 4RNFA 3EWZA 2UBPC 2VCAA 9RUBA 5EYWA 4IHCA 4F0KA 3TYUA 1UH2A 1EC8A 1UYQA 3PZQA 6REQA 3UNTA 3IACA 3WENA 3AIVA 3H24A 1U5VA 2JE8A 1VPYA 4A3YA 3AROA 4D1IA 1AG1O 4OFCA 3VINA 3CUZA 3W00A 1GQIA 4JX5A 1XDMA 2PURA 3BV7A 1SGJA 1UZHA 6ALDA 3K30A 1E0WA 3L0NA 3PZMA 3REQA 4D6CA 1SPQA 3G1HA 3QPZA 2D2JA 3AMDA 3ES8A 4JOMA 1XWYA 3BGAA 3LV5A 1TMLA 1R7AA 5K3VA 2FTPA 3WH5A 4HPJA 3MI3A 4KH2A 5I3GA 1GVOA 4HOXA 3LZ3A 1K7EA 3T42A 4LYKA 3U7VA 1VPQA 5ABGA 1YPIA 2ZCGA 1NM9A 2OQYA 3CZ8A 1VP5A 2GWGA 4IIFA 1QU4A 3PAOA 1UJPA 1J6OA 2NUYA 2NT0A 3HQOA 5CJNA 2GFTA 3UG3A 3FDKA 2NQHA 5E70A 1US0A 3CC1A 4KCVA 2A7PA 1ZB5A 1JDFA 2PTZA 5C2GA 3P81A 3PC0A 3CL7A 3PWIA 3HO8A 2PLKA 3N04A 4ZSTA 3L21A 4FSAA 1SQ7A 1R3QA 1M53A 3GLCA 2Z26A 1K70A 3S2LA 2O9PA 2EO7A 1OVDA 3GNDA 5CLWA 2PTXA 4IFOA 3NIYA 3GUGA 1WB0A 3ATYA 3P8IA 4Y8EA 4JTJA 4RNHA 3PZNA 3EB2A 1IEWA 2YGYA 4HK6A 3C3NA 1OGSA 2VOTA 3U2OA 1XGEA 2FZNA 5CZ0A 1VBUA 5TQLA 5AYIA 4GYFA 1F6YA 1T96A 4NZCA 4RDVA 4M6VA 4V15A 1OB0A 4JQ4A 4KEZA 4X0NA 1BPLB 1SZGA 2C7FA 1PZ3A 3L5LA 4N9EA 1Y0EA 3KBVA 1TTQA 3ALGA 4Y7EA 3AMLA 5A2CA 5DY3A 3E0IA 4D8AA 3UZXA 4JNMA 1WYIA 1VFTA 5TIMA 4Z2JA 1UWUA 4PODA 3GVVA 1TFVA 4KFPA 3UYIA 3O06A 3EOOA 1JQXA 1KTBA 4NZ1A 4ICNA 5GJPA 3TSDA 6TAAA 1MRAA 3GXIA 1BQGA 2R1PA 4MLJA 2FZDA 4C6QA 3DBNA 2QF8A 3CWHA 3OYXA 5FESA 3PPCA 1LYXA 1ISXA 2WVUA 2GVLA 3A9BA 3QYQA 4PMNA 1GG0A 2OZ3A 2WCGA 3AXMA 3CASA 3LXCA 1IIGA 1OX5A 1P6WA 2V2DA 3E12A 3HGSA 2OJPA 1FWBC 2R91A 4LUTB 4EF8A 1YRRA 1OD0A 3Q58A 3T0DA 4LQ1A 2BXZA 3Q45A 4EWJA 3UJFA 3AIBA 1RZMA 3STPA 1HKWA 3TR9A 2A7NA 4LUIA 1VENA 1TZ7A 4U3AA 3C8NA 2WJFA 4TX6A 1IZKA 3PSWA 4W7VA 4Z2LA 3SJNA 1YEYA 1VHCA 2ABBA 4DZHA 1UR0A 3EB3A 4ZOCA 1O94A 1L2UA 2F6KA 3R43A 3L66A 4DJFD 4AIBA 2XG9A 4KIRA 2F6XA 4PUNA 3TSBA 3EPOA 4BQ2A 1ECQA 5F2MA 2Z00A 3O15A 3RXZA 2VEPA 1M3UA 4FXSA 2QCGA 4JS3A 3LNMA 5ECVA 5CGMA 1YTEA 4YVVA 1XYLA 4EE9A 2G3FA 2YW4A 3WUGA 1CENA 1CGVA 3IJIA 3RM8A 2AMXA 4B9ZA 3LM3A 1FCQA 1XLEA 4RZ6A 4AISA 5I3DA 4K7YA 3CZKA 1HKMA 1YMYA 2I9UA 1ONXA 3LHZA 2QVHA 4O54A 2ISFA 5AN7A 3UWQA 1IXQA 1KRBC 5AHNA 3LRMA 1QT1A 3S9IA 3I3BA 3N19B 3FA4A 1M03A 2ZKMX 3M46A 3AC0A 3H26A 2FDMA 4M19A 4M81A 3WLPA 4WXZA 3A9IA 4LUTA 2POTA 3GDRA 1B31A 4OHQA 2CC0A 4QFUA 2AOSA 2BZNA 2BS9A 1F6PA 1ISYA 2D1ZA 3U0HA 1Z69A 2OPJA 2J13A 5E9AA 4UBPC 3W0KA 1R3YA 5JBEA 1KGUA 1KXVA 3BLLA 3URAA 1GWJA 1E9YB 1V6YA 3AI0A 3L4TA 1SW3A 3RMJA 3LHTA 3CMFA 1C9DA 1J0YA 5C6MA 1WUEA 4A2SA 3UVIA 1QJWA 4M7SA 4TXEA 4AD1A 3FFSA 3OZYA 1TRDA 4OQVA 3LRLA 1FTXA 1QNQA 2VWSA 1Z6KA 2BNJA 1KXHA 4O10A 4GQQA 3PF3A 4ZO6A 3LA4A 4W85A 3VI2A 5LSMA 1O68A 4F4RA 1TKKA 3RX3A 3S9YA 2OX1A 4LVBA 4F9DA 3MUXA 3L2IA 3M0LA 4ZB5A 3VX1A 4HQVA 4O52A 2B81A 1XJBA 1QDSA 5CZJA 3MP3A 2BX7A 4US6A 3GG1A 2XUCA 2C3ZA 4H3DA 4PMDA 5AZ1A 3SGUA 3NVTA 3VVGA 3GHRA 3GWQA 3MJMA 4INFA 4JFTA 3KTSA 4AYGA 3FA3A 3U5YA 3O63A 4FXFA 4R5EA 4WSHA 3ZQ9A 2BGQA 4CD4A 1YX1A 3BG5A 4L65A 3CT7A 4X2PA 2HBXA 3NPXA 3ME3A 4KEMA 1V3HA 5K9XA 3CMJA 5F4XA 3F4CA 2AMGA 4FNTA 4XAFA 5HR6A 1H7RA 5D9OA 3M5XA 3WQOA 1RA0A 3WQPA 3GAKA 3TOPA 2QYGA 3PPFA 1AODA 1QNVA 4YS1A 2OWWA 1R46A 2QMJA 1JUBA 3VCCA 4R7JA 4M3PA 2OZTA 1KGXA 3HN3A 4MKVA 3W83A 1KLZA 3DFPA 3SBFA 1TTPA 3WN6A 4LY8A 2WMJA 3DECA 3LG3A 2FHCA 4PMZA 4CCZA 4ICCX 4DJDC 3MSRA 4G56A 7REQB 4ZOAA 1W1VA 4B2DD 4FNSA 1WOAA 4KERA 3APYA 1FWEC 2ABAA 5DO8A 2GWNA 5DCDA 5F4SA 5I3KA 1QTWA 3NXLA 3L5MA 4NUWA 3EDEA 2DSVA 3RRXA 4B3ZA 1NWRA 1V93A 1ITUA 1UMLA 1LL6A 3BAIA 4ZGYA 2V5JA 5C2CA 1AMKA 4B5VA 3VDAA 2IQTA 1FKXA 3E74A 1VF8A 5C7VA 4QDWA 4RE4A 1HFBA 1WXYA 4GMEA 3DKJA 3TN6A 3STEA 3VKDA 3BJSA 4WOZA 4OTKA 1OYCA 3IWPA 1HF6A 3BLDA 4P8UA 3TN3A 3HB9A 1MDLA 2V5DA 4MZYA 1S2CA 3K5XA 4HSNA 2C8NA 4GRSA 4OU1A 4PCPA 4TMCA 4ZTYA 2G95A 3AICA 4NVTA 4CD7A 4AX6A 4NNAA 1YDOA 3TYCA 2OQHA 3SY8A 1G01A 1LBMA 2H90A 4EP8C 5CC3A 3GVWA 3P5YA 4A21A 3CH0A 2ZRXA 1YLVA 4UFMA 4IQEA 2PGRA 1TPWA 4J4KA 1E0VA 5C0QA 3O07A 3NSXA 2G8ZA 4ZTXA 4LS2A 7REQA 3CQKA 2E9LA 4F0MA 3DDMA 5EMLA 3PPGA 3INPA 1J0JA 3AYRA 3W7EA 3CYJA 3PBMA 1E0UA 1F74A 1GYNA 4G9PA 1TIMA 3WUEA 1SFTA 1R9ZA 1YXYA 3LHVA 1EYWA 3GTXA 1XIGA 3P2VA 2IKJA 5LIUX 1H1YA 3VIPA 3OPSA 3DHUA 1W32A 3ZS4A 2O0TA 4C1KA 3WQ6A 4HPGA 1RD6A 2PC8A 4DYKA 5KTLA 2X1SA 3T81A 5CGTA 1XSIA 3N14A 4CU7A 2VMFA 5JIWA 1KBLA 2UY3A 2WZIA 4BQ5A 2DV0A 3TIMA 4TOQA 4XISA 4J3UA 2I56A 3GDTA 3PJXA 1NQKA 5CPOA 1FDYA 3HF3A 1S46A 2WMIB 2IPJA 4TVDA 4R27A 2J9ZA 4Q6XA 1PZ0A 4UUIA 4A8NA 1F61A 2XTKA 4AH7A 4GKTA 4AZHA 3KE0A 3PG8A 5E0FA 4KT2A 3R8RA 1F3TA 3I10A 2A3LA 3VGFA 1KNWA 1CXKA 1RP9A 2O7SA 2OYMA 4US5D 4WDTA 3IGSA 4RUBA 4XD5A 2PRHA 1XIIA 1L6SA 5LA2A 1KGWA 1E70M 2R9RA 1QBAA 2OSXA 4GJIA 4V33A 3GHTA 3WQGA 5FSEC 1TPFA 3CJPA 4IUGA 2DW7A 4JTRA 4BY3A 2J77A 4LAZA 4AC1X 3MKKA 1CGYA 3R2GA 3THCA 3QW3A 2OLHA 2WJZA 5KMYA 1UD4A 4ASTA 1ZSXA 2YDSA 3Q4DA 2CLPA 1IIHA 2D22A 3W02A 2OEMA 1BKHA 4AAJA 5D38A 2GGHA 1IT8A 3UPBA 5I5RA 4TUFA 1CT5A 4H01A 5D9NA 4MPQA 4MNJA 4ZQOA 2X1UA 4ERGA 3U57A 3L67A 2RHGA 4TV6A 1S1RA 3LEPA 1LLOA 3W73A 3W22A 2R1NA 3CWNA 1XYAA 2G97A 4Q8WA 5KEZA 2PD9A 1JYXA 1LRQA 5I3JA 2H3DA 2E9BA 5TAOA 4NASA 4FF5A 2X41A 1MO0A 2GDQA 4I9TA 3L4XA 1J5TA 3WX7A 3GQYA 1TWZA 3TYBA 2WMIA 2VVSA 3BQ5A 5EMKA 1Q66A 1W3LA 1N7KA 4RKAA 3TUUA 4NJKA 1W2VA 3VOHA 4F3HA 2C71A 1UR2A 4MMWA 2VGGA 4XV0A 3MVIA 2E25A 1FWDC 5LXEA 2PWDA 4JTSA 3W24A 4GYPA 1JI1A 3IJLA 4H8HA 4G7FA 3W7IA 1KRMA 2TYSA 3PFRA 3ANYA 3GB6A 4JHOA 2XIBA 4HYRA 4RNJA 3PK7A 5JIPA 3BURA 2CWNA 4L1XA 3T7VA 1T99A 5LGXA 1O12A 3LY0A 3GDBA 1DL3A 2IMRA 2C14A 3IVUA 3GYCA 1B4KA 3LQGA 3ZT7A 1DJQA 2GVYA 3OLIA 3W27A 4H19A 1VFLA 5LNSA 3LHUA 3QY8A 3WLSA 1TV5A 4PTMA 4JN8A 2PF0A 3G6LA 3ZLFA 3MTWA 4N9DA 4RV8A 1DQXA 1JL8A 4LNCA 1WAWA 1KR0A 2BVYA 3L4VA 4LBSA 4XD3A 2FHFA 5JMUA 3AIEA 2Y89A 3TR2A 3AMGA 1XS2A 4O15A 3C5QA 4C65A 2BHUA 3RPTA 2YFNA 3HIJA 4S2CA 5H2ZA 1PYFA 1OK6A 1B54A 1QNSA 3I7QA 1DXIA 3MB9A 3WF2A 4RL3A 1KM5A 2V6AA 4AXNA 2GK1A 1A53A 5F1VA 3IARA 1Z48A 2CZDA 4NSBA 1A0EA 2ISWA 3Q67A 1FWGC 5D2WA 3W75A 3RR1A 1XLIA 3GTHA 2OOGA 2CEQA 2I5IA 2EAWA 1QW9A 3T1GA 2F7FA 5LA1A 1Q6LA 3R0DA 4UOQA 1JJKA 2PPGA 3TROA 4AY8A 2BODX 4BK9A 2YZRA 3MC5A 3MUAA 3YPIA 1IT7A 3A4AA 2PCEA 2XN1A 1V0MA 2EG7A 4GD0A 2CBIA 3AJ7A 3DHDA 4EVZA 3MS8A 3R12A 3VMNA 4W7WA 1GJPA 1RR2A 4FNRA 1GTHA 3BG9A 2ZVIA 4Z2HA 2VJXA 3EDJA 4ZQPA 3UZYA 3WQFA 3TFCA 2P0IA 3KZPA 1XGZA 3RCMA 1R6WA 3TSMA 3RN6A 4E38A 5M2FX 3GNOA 4A35A 2ZX9A 3GUWA 3MU7A 4UTWC 2PU0A 1LROA 1WX0A 1Y65A 5G4WA 1OC5A 1YQ2A 1PX8A 3W7QA 5FEZA 4CCDA 1IYXA 3UERA 1SZNA 2J7HA 5A6MA 2C0HA 2PZNA 4HZ6A 1GPWA 3RR4A 4HGXA 4GY0A 1P0BA 2ZBTA 4LBRA 2G3MA 1AJ2A 3FAWA 3PVFA 3OP2A 4E0CA 3PZOA 1W8GA 3BSHA 4W88A 2BVDA 1ISVA 2WJEA 1FH7A 3AXHA 3VGGA 1SR0A 4GI6A 3CZGA 4QEEA 4Z08A 4AC7C 4F0SA 1EIXA 4DWSC 2DGAA 1H62A 1VZWA 1KRCC 5CJ5A 3VNDA 1PZ2A 2DZPA 1FP8A 1CWYA 2OG9A 4X2RA 1YTDA 2V81A 1IXOA 2AL1A 3QEZA 2R82A 3CTLA 4U4MA 2BSLA 2QDEA 3QQWA 3R0UA 3V1HA 3ZT6A 4WVXA 1W91A 3N29A 4B91A 4PB3A 1LCOA 1EL3A 1E6RA 1NOFA 4GZEA 3ZR5A 4WLCA 2Y4SA 2TODA 3KTXA 4HU3A 5EMUA 3W9ZA 2VFGA 1Q6GA 4PMYA 4IMEA 3OVGA 2VZTA 4HU4A 1FCVA 3WF3A 3CPRA 4XVDA 1ZAIA 2P8CA 3PZTA 3U2CA 1RJQA 2Y8KA 3UWWA 1FXPA 3DG3A 4Q6JA 2WYSA 1IWPA 4QNEA 5DXXA 3G1DA 2H9AB 3STGA 1W9BM 2QCCA 3C52A 3P6LA 2WSYA 1V02E 3VZZA 3A22A 7TIMA 4LW7A 2XGBA 2QNEA 4QJ1A 4FHAA 1RSCA 4ENLA 2NSXA 1OZMA 1KR1A 3RX4A 1F9CA 4JTQA 4KWUA 3SY1A 4NZ4A 2E6FA 3LUTA 2WVVB 2QCHA 3TC6A 3MANA 4C6NA 5AYYA 1FWNA 1ZQ5A 2J62A 4XUYA 1FQ0A 3RCNA 1E51A 2X0HA 3AHXA 3BVJA 1C91A 2FGZA 4NQ1A 3HFYA 3EKLA 5D9PA 4L9YA 4S2BA 3W2LA 2Y6ZA 4YPJA 5IBXC 5DANA 3UEQA 3O6CA 3MI2A 2DT2A 3QVQA 1C8XA 4IPJA 2NX9A 2VENA 3I3EA 3S2NA 1XIJA 3NA8A 1ZBCA 1FVPA 3TYAA 2CW6A 2CBUA 1W9XA 2E1WA 1D3HA 1BLIA 3QMRA 3VIOA 1RBLA 3GC2A 1U22A 1TPC1 2JKPA 2NQJA 3OZOA 4Q8TA 3IUDA 3SCSA 3ZSTA 4YTUA 5EMYA 4TVCA 3KVKA 1P1MA 4IH3A 3SB0A 4OWGA 1FUYA 2H9AA 2DZVA 3SW6A 1EUNA 4LPCA 2Z1BA 1SFJA 4FEZA 2W61A 1OFQA 4S3BA 3GAYA 4M8UA 1J0ZA 2W67A 3R0KA 3ZJ7A 3KBWA 3OZMA 1SJBA 2E4TA 2Z1SA 4HVXA 3TP4A 3T78A 4ADUA 5CG0A 2NQZA 2WVVA 3I68A 3IK4A 5HUOA 2Y5EA 4XBSA 2CIPA 1HVXA 3GG7A 1KWKA 3S6DA 3MBDA 3DERA 3T05A 5EBAA 4L56A 1ZY9A 4UCGA 3TK7A 3VILA 3SI9A 1WBHA 2DZBA 1D3CA 1HP5A 8TIMA 4R9OA 2YXXA 1W9DM 1KWGA 5RUBA 2BOFX 3TAOA 5D30A 3VZYA 4MZ1A 3CHCA 4XX6A 1AFSA 2AL2B 3LCXA 2ON3A 4P2VA 1WZAA 2DSZA 4IXXA 1ZPTA 5LNRA 2Z1KA 3WNLA 2GYIA 5JH2A 3VNJA 1KCZA 4Q32A 3AYVA 1UWTA 3GVQA 4JY9A 1K8ZA 2RH9A 4WIWA 4NX0A 3TONA 3F2DA 4CQDA 4LVDA 1JAKA 2PS2A 3WH9A 3U48A 4LYPA 4IX2A 1UUOA 4IWWA 1R2RA 2IQ0A 5IOBA 4JNYA 2DJLA 4MKNA 1XX1A 1OZQA 3OVPA 3TJIA 1X8CA 1LQ0A 2OZ8A 4K39A 1X6UA 3CGTA 3TC7A 1MVYA 4JQAA 4QCFA 3S1VA 3GKFA 3TW7A 4JEJA 4ALDA 2GJRA 3QY7A 1BWVA 1KFWA 1VFFA 3SECA 2WKLA 4PULA 1KKOA 5CSSA 2J4GA 1VCFA 1EJWC 1K1DA 3GBDA 2PDXA 4QR6A 2QAPA 4LWWA 3H70A 4IQDA 4ZSUA 1LLZA 1XH2A 3ITTA 2XIJA 4GBUA 3SUSA 2QQ6A 1J6PA 3WJXA 3ARWA 3DESA 2GJNA 1EO5A 3FX4A 2A3BA 4UZUA 3N11A 3K8LA 3HG4A 3UU0A 4HHLA 3OLDA 3E2QA 1Q6OA 3FOKA 3BO9A 4QEHA 1DIKA 4IOTA 1RA5A 3OGVA 5I3HA 2AL2A 2XYLA 6XIMA 5HAOA 4UQCA 3I6TA 3KOXA 4KWWA 2Q8ZA 2WC3A 1N55A 3WBAA 1G94A 3G3MA 1FWWA 3LNPA 5IHRA 2EF9A 1Q7ZA 1JVNA 2P5NA 1YHTA 4AEFA 3HTWA 4KQNA 4E4PA 4POCA 3FSUA 1EDTA 4IGHA 3UR5A 1J8VA 2EJAA 4PEKA 3GX9A 4LS0A 3WQVA 5K9CA 1H2JA 4FOJA 3NSNA 4I6VA 3AWOA 3H2AA 5DQPA 3ZJ8A 3LCFA 3PS7A 4B16A 4W4QA 2VKZG 5CLTA 4JTDA 3H4GA 3NDOA 3NDYA 1GORA 3OYZA 2ZUSA 3UG8A 3LLFA 1F3XA 5J04A 2IS7A 4J40A 3KLLA 2NLYA 1G1YA 1XG3A 4F8XA 2TAAA 3WLQA 3DEQA 4JBRA 1QNRA 4UR7A 1WKFA 4WXYA 2BGNE 3KBNA 3WCZA 1QRQA 4W89A 5AHFA 1L6FA 1PTAA 1I2OA 4PCTA 3W7MA 1CECA 3BW4A 1S2TA 1GNXA 3SN0A 4C1LA 2GVJA 5A8OA 1HT6A 2VEGA 3TDFA 3ZO9A 3M43A 4O16A 3FAXA 3LBOA 1XCWA 4CNOA 4PTWA 3M9YA 3P84A 1XC6A 5BRPA 4REQB 3WJWA 4S1FA 2F9RA 2O7QA 5E1QA 5A6JA 1BTMA 2DDXA 3PM6A 4IP4A 2G37A 5FCZA 5FSDC 3A21A 3CEUA 2H3BA 1SFSA 3S5NA 2YOCA 1WKYA 2P88A 1P4CA 2JGQA 1U1JA 5D02A 2QS8A 2B7PA 1XBXA 1UR8A 3GXMA 1VBJA 1ZAHA 3E0FA 3CNYA 1XHGA 2GOUA 2ZUNA 3W3OA 1UZ4A 1IXNA 4K1WA 3G2GA 2OCZA 2NVCA 3CEPA 3BTNA 3N9KA 4UCFA 3R1ZA 1EP1A 1BTCA 5HQLA 1PWMA 3GXPA 4CN1A 4JTTA 3QRHA 2DZWA 3W71A 2YCKX 3W38A 3N6QA 1B3OA 3G0UA 4GI9A 4CVUA 2FZMA 1MXGA 3WK1A 1CXFA 2OLSA 4PUDA 1TJRA 3EBVA 3BMXA 4ZMGA 1XG4A 2WHLA 3WLLA 1GVIA 2VELA 4A3UA 2YDRA 4C6CA 1I0DA 4NNCA 2PP0A 3USZA 1UPMB 3FK4A 3O2LA 3W4RA 3KM8A 4REQA 3KOYA 1QFEA 1AW1A 4CLMA 3HPAA 4E3TA 1BXBA 3WLRA 1V6XA 3VUPA 3TTQA 2NV2A 1HW6A 1R30A 3AS1A 2D24A 3VO0A 3AFBA 3CBWA 1FWTA 5I2UA 2R24A 2C19A 4HMDA 4ZENA 5H8UA 1JNEA 1OCNA 3IV3A 2FGBA 2VGIA 4GXWA 4H9UA 4UTIA 2OWXA 2YZ5A 3CO8A 1XBVA 3M0IA 4HOWA 2ONEA 3E1F1 3RO8A 4EOUA 2BOGX 2Y62A 5F7UA