4HZAA

Crystal structure of the immunoglobulin variable domain of nectin-2 in monoclinic form
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
124
Chain Sequence
MQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Immunoglobulin variable domain of Nectin-2 in monoclinic form
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Poliovirus receptor-related protein 2
total genus 24
structure length 124
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzaA00
4NJ9H 3NH7H 1ZHNB 4PJBB 3QWOA 1F11A 5DK0A 1A7RL 3MLYL 3HTLX 3IDYC 5CMAB 1JV5A 5F71A 1CXFA 3OXRA 3G6DH 4NO0B 3D69A 1MCPH 4GW1B 1ZHKA 4PYHA 1X5XA 4UV7H 1V3JA 3TH2T 5FDWA 1FVEB 3DUHA 3EYVA 3LQZA 4DEPB 1EUTA 4LCYA 2ICEB 3T1FA 4P5TB 2FL5A 3FQNB 5DJDA 4KQ3L 2VQ1B 3L3DB 4F9LC 1AGEB 4WWKC 4JDVB 5J0BA 2YHGA 1DEEB 5DK0B 3QXTA 3QYCA 3NZHH 3C6LB 1FAIH 5JPNB 1KF9B 2J88L 1QBMH 4FTVB 2HTLD 3DVGB 3QDHA 4RZCB 1YYLL 2XTJC 4FQ2H 4I9WD 5J06A 5EU7E 2NZIA 2B2XH 2D31A 5EZOL 3P4NA 2P4AB 4RAHA 1T0NA 4HPOH 4IS6B 4OIAA 5EO0B 2AJ3A 1KCKA 1OL0A 1RZJL 1ZEAL 1JHLH 3DGGB 4OCWL 2GHWB 4HFWB 4HT1L 1VFMA 3TF7C 1A3QA 3M17B 4NQVB 4ZG1A 5JOPD 4P9HC 1UWXK 3J7HA 4GKSB 1NCAL 3MROA 4FQCL 3GMLA 1ZHBB 5HYQB 1DBJH 4PRHE 1NCBH 4WO4B 3GI8L 4U1IA 3H9HB 1Q9OB 1RPQA 2KUTA 2VZOA 3KPQB 1OTTD 3DMMC 4QRRD 1K3ZA 2FD6L 25C8H 2Z92A 5FO9A 5EZJA 1A4KB 2EDFA 3IXAA 2YN3A 3MX0A 5IB5B 5ADOL 3MRMB 1S5HB 2BVEA 4M7JL 5MHSD 3KPNB 3O4OC 2BZDA 5FF6B 3UJIH 3VU2A 1LP9E 4KJWD 1NBYA 2ORBL 3C5JB 4XH2B 5DT1H 3QDME 4OAWA 1GGCL 2F58H 3GMPA 3HRPA 4J6RL 2JK5B 1CK0L 3KPOB 4KPHL 1AD9A 5I1JH 4X6BB 4PJ8D 4B0MM 5TDNB 1KNOA 4V1DD 3QAZB 4MMZC 5B3NA 2BHYA 5GZOD 3MRFB 1PLGL 5D6CA 5J1AA 4GRMB 1WISA 4HIIB 4K07A 4KK6C 2YA0A 1OM3L 1BVZA 4EUPB 4RMWA 4YEEA 3OF6D 1KLUB 5GZND 1L9NA 1PJ9A 3KPRB 1J9CT 3LDBB 1DSFH 2IC2A 5EUOA 2EDRA 3HZMA 1MFCL 5CEZL 1RZKH 5BRZA 2CQVA 3OKKA 1UB5B 4PJ8B 1N2RA 1MFEH 3QDGE 4UU9B 2GQHA 3ARBD 1G9MH 1HYSD 3VXSD 3NCCB 4JFFD 4P4KD 4XNXL 5EU6A 2F5BL 2HJLA 4TSCH 5FUCE 3ECBA 4TYUA 4ZAKA 1M1SA 2Z31B 3QIWD 3U4BL 5I75C 1BD2D 4OV6F 3THML 1BM3H 5I19H 3BUYA 4L4TD 5JR1H 3ET9F 4GRLB 4NQDD 4K8RC 4LSPH 4KXZI 1DJSA 4MMXC 1MWAH 2YBRA 4BQ6A 1LO5A 5DD3H 1VADB 3ZTJH 5I18H 3MRGA 3Q3GA 1QSZA 1KXQE 3B6SA 1G7MB 2Q76A 3D18A 3GNML 4I0PB 5FKAA 4GOSA 5E24E 1TZIA 3MJ7B 1NDMA 3ARRA 4PJ9C 4RFEA 2LFGA 3FTGA 4ZD3H 2ZSWB 4PJXB 2NY5L 2XZAL 3D0LB 3P2TA 4LEOB 5DJYB 4KJPC 4P2YA 3C5ZD 3ARFC 5E2JA 4UZGA 4AEEA 3O6ML 4GRLC 3GSUB 1OF2A 4OFPA 3QH3B 2C4XA 1KUMA 3VXTB 1P7KB 4G3YL 4ODHL 2J8UF 5E9DD 4JDZA 4U1NB 2BVQA 4HUXB 1YY8B 3RTQA 3EIFA 3BP7A 3CVHH 2BFVH 2VIRA 1WITA 4K7PL 8CGTA 4U2ZA 5FGBA 4OSUH 5F89B 3ELAT 1B4JH 3GEWB 3WFZA 5T5FH 5FM5M 2NZ9C 5T5NG 5FYKU 4Q9CA 1ZT4A 5E00B 3QEUB 1OAKH 3C09C 3QXDA 1MJJB 4ZOBA 5SX5H 4EDWH 5C0FA 2VZVA 1GC1C 3G6JA 3ZE1E 4DFIA 1T1YA 3P9LB 5GGTH 3JV4A 1OB1A 2ZUSA 2IQ9L 4UNTA 1MCEA 4ODTL 4DGIH 2VDRH 5EOQH 4AT6B 1MRDL 4LLAA 2AEPL 3PWVB 3TO4A 3QIUB 2NX5E 1W72H 4WEBH 1T20A 5E8EB 4UQ3A 3D9AL 2WBWB 1T6WA 2D7NA 4JREB 5E8NA 5FO9B 2QHRL 4WENB 4EN3B 4IRSD 3W5NA 1YNLL 1P84J 1AO7D 4PJAE 2IAND 5JLZA 1OTSD 1NCUA 2EH7H 2FB4L 5CEZH 3E2HC 1RI8A 2BK8A 4XMLH 2DQUL 1LDPL 4RGNC 1DVFA 2D2OA 4XBGA 3RWDA 5IIEA 2V9TA 3P73B 5DR5H 3B2VL 3L5IA 4G80A 4XPTH 2C1OA 3E3QE 3L5WA 1MRCH 1FC1A 3TCLB 4F7EA 3A6BL 2XNAA 2VUYA 4EXKA 2ZSVB 3FQTB 3X14B 4G6AD 4PD4J 4QF1B 1S7SB 5DGRA 1JGDB 2FX8L 3U46B 4XPAL 3QNXB 5KW9L 4RMRA 4NKQB 1OARH 5DVKA 1NBZA 3HI5L 3TIEA 4PY7B 2BJML 2AW2A 3MYJB 4M7KL 4G7YL 1I1FA 1T21B 1QKZL 2QSTA 4BUHA 4KHXL 5EORL 5SWQB 3MLSL 4S1SH 3BP4A 2EDHA 3OAUL 3MLPA 1HN1A 1MCOH 3QUYC 4L5FL 2C3WA 1RK0A 2ZSWA 2ATKB 2Q3ZA 3L3HA 3HNTH 3UBXG 1I7UA 3NIFF 4GQ9L 2DWDB 4P2QD 4Z7WF 3JXAA 2XTJB 3WIIL 5BMFL 1S3KH 3QNYA 1G9NH 2A6KA 5D2NC 4Y1AD 4FQXC 2ORBH 3BDYH 3LHPH 4I18A 2APVA 5DS8B 1AY1L 1EHNA 5KVFH 3H3BC 4DKEL 1ED3A 4NPYA 4U33A 5GGQL 4BKLB 2VLRA 3SKMA 2H26A 3U7WL 1NANI 1BIIB 4MAYC 4PRAB 3PWPA 5BZDA 5ICZB 2IPTH 4HFUL 3F65A 3NA9H 4L29A 3C60A 4GG6F 5GRJH 5T3ZE 1P7QA 1RZJH 5F6HJ 1G0YR 5E6IB 3LIZH 4PTTA 3ULUH 5DD0L 1ROWA 2Y06H 5JORB 1JBJA 4P49A 4PJ9B 5IFJA 1TJIH 1BQHA 3MGOB 4K8RL 2R4SH 2V2XB 3MA9L 4L8SA 2FJHA 2BNQD 3KPMB 3LKQA 2VZUA 3FT2A 4MXVF 2ZP0T 2SEBA 3MACH 4PJ5B 1RZJC 1TJHH 1TJGH 1FNAA 5C7XL 1GVIA 3DX9A 3GSXB 3ARFD 5DTFA 4KKLD 1RZGA 3TYGL 4QY8A 3CFKA 4XCFL 2XA8L 1G6RH 3QUMB 2NY2B 4M1DH 5IBUB 3S3PA 3JVGC 1CVSC 3CSYB 3WDJA 3C08H 2YWYA 2AK4D 4ZFZB 1MCJA 2Y07H 2H1PH 4S11A 4ZO8A 5C2BH 1KEMH 1ZT1A 5DURB 5D1XA 5DHYB 2YUWA 5D5MF 4F9PC 1YECL 2NY1D 3S3SA 1CT8B 1RSFA 3L3IB 3SGJA 5MENA 1K8DB 1HSBB 3KLHC 3DV4B 1CFQA 5FEBA 4TNVK 1JNNH 4XMPL 1DTUA 3QT2A 3VG9C 3MCLL 3REWA 2EE2A 2B2XL 1EAPA 4P3WA 3THMH 3PWPE 1R3KB 3IETB 2C26A 2NXZB 2PW2A 3O2DA 4KV5F 4PP2B 1RU9H 2VC2H 3NGBC 1WICA 4JFDD 5IF0B 2ENYA 3C8HA 1ZHBA 3VGAC 1EAPB 5HYJB 3WDIA 2EICA 5KN5B 3P0YH 3MUGB 1AO7A 2P8MA 1R3LA 2Y36L 2XPGB 1JIBA 1HSBA 1HI6A 2OP4L 1UCTA 3MC0A 4NFDA 1ZA6B 3VWJA 4FXKB 3TZVA 1FZKB 1JUFB 1X6LA 2CKNA 1KB9K 4FQXA 4RGNE 3O81A 3MREA 2X05A 3HI6L 5D2NA 3TIDA 4C58B 3SE3C 2B20A 3S35L 2X4NB 2BOCB 3RVTD 5CSZA 5DZOA 4L8BB 1D6EB 3NIGE 5FGRA 5AUMB 3EFDH 4XWOC 3VA2C 1A6VL 3P40A 1HQ4B 4OZGE 3BQUD 4G9FD 1H0DA 5D8JH 2HP4A 5EZIL 4JDVA 3PDDA 2FRGP 3WUWA 1H3GA 4D9RD 5EULV 2Y1VA 4RISL 3UTQA 4R96A 1JGUH 1KV3A 1RIHH 1A6ZB 3V0VB 3KNBB 1IKFH 1G7QB 2AK1L 5MP6L 4ODUB 1KG0B 4WW1A 3KPMA 4PV8A 2HT4D 2YPVL 2H2PD 5JHLH 5DJZA 5KVMC 4O9HL 1FG2A 3CIQA 4U1SB 1NLDH 4ZTPL 3QDMB 1Z9MA 2WUCL 2APTA 4P99A 4EUPG 3ARED 1JNHA 1EGJH 3T0EE 4LVNB 3G5ZA 4UUJA 4UTAL 1A9BA 1EEZB 2VITA 1NEZG 4MAYA 2JF1A 4OLYL 4YXLL 3QR2A 5IW3A 1VACA 5LGHH 3VMOA 3QUYD 4CDHA 2OSLA 3NCMA 3NN8A 3MOAL 3CDGA 3T4AA 2OI9B 4NQCD 4RGMC 3W0WD 3NACL 4L4TE 3PWPD 2HG5B 4NQDE 2QADD 1OQOA 3ILQC 3DJ9A 2V5TA 4NQXB 3TIEB 4BFIA 4PGJA 3IU4H 2EDOA 2I9LA 2BVOB 4WEMB 4ZUVB 1T1WB 3SOBH 1D9KA 2Q20A 3L3OB 2W0LA 3GJFK 1A6TB 1C1EH 1T5WB 4QHLB 1I9EA 3N1GC 2X09A 4MZ2A 2AXGA 1QFWI 1JE6A 2ESVE 4DUWA 3QUYB 5HTSA 2CLVA 1A6WH 4LP5A 4PJAB 1HHJA 1P4BL 1R5WA 3DUSB 3VE0A 3P73A 4N5ED 4OIIH 4U6VL 3QUXB 1NGZA 4UQ2A 4Y7MA 2R9HD 4BSJA 5CD3A 5J89A 4TOYL 1YEKH 3QO0A 2UYLB 3GRWH 2VZTA 5E7BA 1X5GA 2V2WA 2CK0H 2FYYA 4K3HA 3WHXB 1IC4L 1FDLL 3UDWC 4ONFH 2M26A 1JZ4A 4JZJB 3BRFA 5L9DL 2X41A 3H9SB 1N6VA 1S7XA 3E6FB 2PXYB 4D94A 4OZ4B 3ARBB 5CP3A 5JTWA 5HGHB 5ESQA 1IT9H 4QOKE 4RAUB 5T5NF 3D0VB 4JPWH 4PD4K 3X12A 3T0AA 1GGTA 3L6FA 5MEND 1KBGL 1TTFA 5ICYA 2Z91A 3QULA 4APQA 1RY7B 4QHUB 4JHAH 1H9VA 1ZE3C 2X1XR 3IF1A 1SY6A 5IMMA 3V6OC 1EFXA 4B50A 3VMNA 5T1KD 2PO6D 3LQZB 1N6UA 1GCFA 4WFHE 3T8XB 1JZ5A 1V05A 2MJWA 3DX6B 2XWBB 5CSGA 3SO3B 1J87A 4JRYE 4F7MB 4PGDA 4DWHA 4HIEA 1K4DB 3BPCB 4U1NA 2R4SL 3MA9H 5J12C 4H1LG 4ZUTB 1FIGH 5IB3A 2DD8L 4Y4KA 1I4FA 2AK1H 3MV8D 1ONQA 4OLZL 2AEWA 3K46A 2B5IC 1JNHB 1G7MA 2VL5B 1RZGB 3N50A 2E27H 3HZVB 2DTMH 3JWDL 4AJ0A 3IGAA 1GJIA 1RZ8B 4J7RA 3EYFB 5C08D 4M9OA 4PJFB 4KUZH 1YEIH 1S7QB 4QTHB 4IRZH 3QUZC 5C0BE 3WHE1 1BMGA 3QPXL 1PG7W 4KDTA 3LKSB 4NO5B 1A6ZA 3FFCB 4IRJB 4PLNC 3S4SB 2RHEA 4WUKL 5BO1H 3MCG1 5INDB 2Y06L 2Y5TB 2IAMA 5I2IA 4J1UA 5K93A 7CGTA 3C2SA 1S9WA 1JGUL 1OHQA 4YC2B 3ARFA 2P42B 2R8SL 1U8NB 4TNVF 3MNVA 1U41A 3DYOA 4Q9BA 3R0NA 4YO0A 4J3XA 1OGAE 3ROLB 3TYFB 1IAMA 3Q5TA 1D3CA 4HXBH 3P0GB 3MLUH 1FNLA 4J3WA 5SWSE 6CGTA 1QRNE 4HX1A 3WKNA 3EJJX 4FQXB 4HZLA 4PJCB 4RWHA 1JUFA 3O6LH 4WCYH 2DF3A 4L1HA 2YZ8A 1MJ7L 3OZ9L 4LSVH 3HC4L 3BPNB 2WM0A 4NBZB 5C0IB 3VFGH 1EIBA 3VFNB 4HV8A 3KS0H 3LKRA 4JN1H 1NC2D 3GO1H 4GBXB 1JZ7A 2HYMA 5IG7A 1RHFA 4TUJA 1U3HA 5EO1B 1FBIH 5CLTA 5L2KE 2ICCA 4CU7A 4PGDB 5HYJD 3UPRB 4QRQA 1T22B 2CJUH 1J0KA 2F19H 4JFDA 2V2TA 1G9ML 1IGJB 3HNSL 4M7KH 4EDXA 1X5JA 3QRGH 1QLFA 2W65A 3LEYH 4MQTB 1L7TL 4JY6B 3EJYD 3F7VB 2YC1B 4NRXA 4ZODA 1XMWA 5DRNA 1ZLVK 2DLTA 2YKLH 3BN9D 4U1MB 1N6QH 1CQKA 5D7JC 4GG8A 2Y23A 4Z6AT 2ZSVA 3FQWA 4A6YB 4XPFH 4OI8A 1OM3H 4XP1L 5KSVB 1HINL 1NGZB 3EAKA 1GXEA 5H2BB 4N9GA 1AP2B 1Q38A 1IAIM 3VXRB 1C08A 4UIKL 1KTLA 2EDXA 5AG9A 3BSZH 3WLWD 1I7TA 3C5JA 4XH2A 5FYJD 3IJYA 1FRGL 5L9DH 5DZLA 1BVLB 4PJEF 2AQ2A 1N64L 1M7IA 2O5ZH 2X4RA 3GI8H 4DUXA 4F57H 5IBUG 1JWSA 4LPCA 4WWKD 2GK0A 3C5ZB 4XP6H 5GSRB 4JFXA 1U8QA 3SE4A 3SEPA 1JPTL 1S7RA 4AIXA 4NZUL 3P11L 3ZKMC 2OS7A 4HKZB 1TQCC 1EZVX 4Q0XL 4KQ3H 3GK8L 4WO4C 2E5EA 1UZ8B 4J8RB 1RIHL 5I71B 1JN6A 5FUZL 1EVUA 4I0CC 1K2DA 2XICA 5F7EH 2QR0A 3SDDB 1WF5A 1BLNA 3NCYS 3EFFB 3W11C 3VCLB 5IJKC 4W68A 4ZD3L 2GTWA 3QIBC 2IADA 5EPMB 5A2KH 4HXBL 1WSST 1TQCB 4J23A 3V0WH 2HVKB 5D2LA 3O9WB 3QEHB 2DQTL 4L9DA 2EEBA 1SBSH 1PW3A 4HT1H 1YDPA 4X5WB 2YD5A 3PDOA 1NUFA 4O2EB 4YXLH 2YK1H 1MCRA 3BJLA 4LASL 3I6GB 1EPFA 3VRJB 3CU7A 2YSSB 1H3PH 2VL4A 2X44D 3CGTA 3N9GL 3SDDD 1U8NA 3HR5B 4K3JH 2QKIB 1OSPL 4QWWD 2HFTA 1I1YB 5EBWA 4BQCA 3VXOA 2P7TB 4YFLF 2LQRA 4M7LH 4OZIB 5D7LD 2P8PB 2VQTA 5LG1A 1OP5K 1KJMA 3EZ8A 2GITB 5ALCL 3H42H 1UM6H 3MJ8B 3OPZL 3S4SG 5FECB 4YHIB 2NZ9D 1KYOK 3VI4E 4M1CD 5BV7B 4NQDB 2EDWA 1HHGB 4AEIL 3EOBB 3K74B 1R5IA 1WBZA 2NNAA 5I19L 4RX4A 4XNYH 4NQCB 1ORQB 4Z7UB 3I50L 4NGHH 2N7BA 1L0YA 3QG6B 5JXAH 3B9VA 4XCEA 5B4MC 3ABZA 4UT9H 3UPRA 1CS6A 4G8EB 1HINH 43CAA 5ITFA 3T2OA 3DO7A 3ARVA 3OJVC 5HYEA 4KUZL 1D5IL 2EO9A 4OCMC 4R7DB 2DRUA 4X98B 2YPLA 1XZ0B 5BOPA 3SJVB 3UO1L 5BRZE 3BISA 3VWJB 5CIPB 2DQIL 5GISL 4Z9KB 1XF3A 3W9DA 4RFNC 4PV9B 3RVXC 4JFZL 1CT8A 1GGUA 3MTRA 2XZQL 3SDXF 1D5BB 4MNGE 1A3LL 1FG9C 4QRSB 5F70A 1A8JH 3V5KB 1YMMA 1LE9A 3BP6B 1ZLWH 2ITCB 1F5WA 2ICWI 4FP8H 3CXHK 4I5BA 3SE9H 3ROLA 1FVCA 3IETA 3HLAA 3DURB 1E4WL 3P4OA 1UYWL 2OTUB 4KJQD 1TVBB 1S78C 3ILPA 3OGCB 4JO2L 3K2UL 3CLEH 3BN9C 5DJCB 3HZKA 3TBSA 2VLJD 3BD3A 1JZ6A 1ZLSL 2OM5A 5D93B 4NKDA 4YHNB 5C08B 3DHMA 5A1AA 3BWAA 1AXTH 3HE6A 4P3CH 2VAJA 4HK3J 3AFLA 3SDAA 4FQ1H 4H20H 2PCPB 1PYWA 2D9CA 2W91A 4P23C 3UBXB 2HLFD 1HQRA 5TJWK 2EKSB 1X5KA 3FCTA 4P2CG 3QJHA 4XHJC 3T04D 3UTSA 3RQ3A 5IMKB 1I8MA 1KPUB 4K8RH 3WNMA 4HMDA 3H9ZA 3QEQB 5C0AD 4G6FD 1CR9L 3QCUL 4G6KH 4PRDB 4ZTOL 3EYQC 3GSNB 1MFBH 3G08B 4KI5F 4ODHH 2VL5A 4WU7B 2IFFH 1GAFH 3IS0X 3WL9A 1IMHC 4MA7L 1MI5E 1ORQA 4MA1B 4PJ8C 2FR4B 1KJVB 2P5EE 1F58H 5J1SC 3ARDD 1BFVL 3NFSH 3LKPB 3TN0C 4KVNL 5EIIB 4ZXBC 3CU1A 3QHZH 5TF0A 1A9EB 1T4KB 1JWMA 3MNZA 3L3KA 3HN3A 1U42A 2DWEB 4EDWL 2JJUA 4X4YA 2DM4A 3QQ4A 4P0DA 4UBDC 1Z2KA 3BSZL 2M1KA 4BSWA 5A16A 5EBWB 1NLBL 1N4XL 3TBVB 1O7VA 1LO3H 3GSOB 3WE6B 3MLSH 3ZDXE 1AHWA 5H35B 4YDVA 4PJ9D 5GGSA 1QOKA 5I8OH 2HVKA 4XPFL 1UWGL 5D5MB 3PHSA 2VQ1A 1QHOA 3O4OB 2M2DA 2XTJD 1T21A 4HUUB 5DFTA 2ICWB 2Q6WB 5DRZB 5HI5D 1RURH 2V17H 3RIAF 3QNXA 4JFEE 4U6YB 4X4MA 1S3KL 5LAXA 3KHQA 2J6EL 1DUZA 1KPRB 4ODSH 1OAUH 2ICWJ 1RZFH 5BVJB 1JHKH 3NPSC 3MRFA 4MNQE 5EOTB 4A2LA 3KAAA 1NFDE 4QNPF 3PG2A 1TCRA 1K2DB 2EDLA 4YGVA 1VHPA 2P43B 5HGHA 3CNKA 1B6UA 1BBDL 2NY3D 1PD6A 3VXSE 1S7UB 1CLYH 3MRIB 3A67L 4XCYB 4XVJL 3NCJL 4MAUH 3FB8B 2X4RB 2CLRB 1ETZB 3BKMH 4LGSB 5CJBA 4EI6B 3PWJA 1QA9B 2X4TB 5HHPB 5L6YH 4R4BA 1FCGA 3TVMA 1M7XA 4XP4H 5E8OB 4QRPD 3SGJC 2C1OB 5I9QB 3NPZB 43C9B 4YGVB 3DHJA 1GIGL 3CXDL 1UGNA 5DC4B 3RL2A 2H9GB 4S2SA 5C0GA 2ITDA 35C8L 2CGRH 4ZPTA 4LBEB 4HCRH 1MI5D 5CUSL 1U95B 1KTDA 2L7JA 1A7OH 1G7IB 5KZCB 1PKQA 1OD9A 3N1QC 4NO3A 4QRPB 1XIWA 4IOIA 1KEGH 3AREB 3F58H 2CRYA 5IT2L 5F3BA 1JTPA 2VERN 2VLMD 4J4PD 4D0BB 4HGMA 3Q5OA 4BZ1H 1RUAL 2VLRD 3MRBA 4OF8A 4XNUL 4N1CA 1MHHA 3P4LA 3SHSA 2W65B 2A0LC 1U8OB 4PJIE 5EOCJ 3UTPD 3VFPA 2VLJA 4IIQB 1NDGA 4NUGL 3EDJA 4U1JB 1AR2A 4Z7NE 1KULA 1DBKH 4L8SC 1TQBB 2QSCH 1Q9WB 5FB8A 1YEHH 1KN4H 3VWKB 4JLRB 4XMPH 1PG7L 4NZTH 3O0RH 2X7LA 3MLXH 1HYSC 4LEOA 1HQ4A 5I73C 2NY7H 4R0LC 1YNKH 2ADJA 5F6HI 3V6OE 4NNPH 3RWHA 2R23A 2QL1A 3ILQD 2QADC 1F8TH 2BNQA 1H8NA 3HG1B 4PJCA 2ATPB 3OKDB 1MQKL 4YJZL 2DBLH 2NX5A 2XZQH 3JWOH 3MV7A 2FJHB 5IB2B 4PJFA 4C4KT 1I8KA 4PGEA 1WQVT 4HWBH 4I18C 1V3KA 3FZUD 4ELKB 5CZXD 1JZ2A 1J18A 2EECA 5L8JB 2Y6SC 3RI5K 3UJJH 1YPZE 2BSED 4TVPE 5GS2D 2X6MA 1C5DA 5C2BL 4MCYA 3ZKXC 5ANME 2R2BA 3Q3GB 4MA3A 5SWZE 3ZE2E 2WLZA 1IL1A 5INDA 1P53A 4ISVA 4WI5A 4NBXB 1FHGA 5LQBH 3VXPA 5DFVC 1NGWB 2H3NB 4TULL 1CLYL 3OB0K 3LIZL 3MCLH 4OGYL 4X9HA 3ULUL 1IZJA 3F6LA 1Z5LA 2UY6A 2AI0L 3VXME 4G8FA 5C09E 5F96L 3L3IA 4RWYH 5MENB 1WK0A 2VN4A 4TOYH 1JK8A 2BNUA 4CVWA 3O4LE 3O45B 3MRLA 3SPVB 5C2UB 4OCXL 5HD8D 1Q94B 3D39A 4NKMB 1A5FL 4P2RA 4FQHA 4HW6A 3KVQA 1CGSH 4CMHC 4UT7L 3PGFL 2EC9T 1U8KA 2ICES 1HZHH 4FS0A 1RZ7L 2YK1L 1SVZA 2O5XL 5IHUH 3IJHA 5CBEA 5T1DH 4AIZA 2CKBA 4NZJA 1S7SA 2FYYB 4WFGE 3WHXA 5JIHA 2R4RL 3FT2B 1MLBA 4AENA 1ZAGA 1E28A 5TGBB 3UTSD 3REVB 3IT8D 4PJXF 5IBLC 3D2UB 2P24A 4NIKB 4FFVC 1S9YB 3L3GB 5INCB 2DJSA 2R2CA 5IM7B 4X7SH 2EXYC 2R0ZH 4LEXL 4Y0GA 3VFTB 5KANG 4F37K 4JO1L 4I3SH 2PF6A 4HK0A 1CL7I 4B53A 3FB7A 3BD4A 2RAMA 2J7LA 2I24N 3L3OA 5E6ID 3P9WB 5K9OB 1KXVC 3N1FC 3V6BR 1J1OH 1DN0A 5DRXA 1KTDB 1EFQA 4HFWA 4I18B 1SYVA 4IDLA 2CKBL 3OHXA 3U1SH 3RX7A 3WO3B 1NPUA 5CCKH 5DMKA 3H9HA 5CD3B 5INCA 4UV7L 5K9JH 3VH8G 1BZ7B 2JELH 5I30L 4JQVA 3C9NB 1XIWD 4FG6D 5TH2B 4PREB 2QADB 3N1PC 3VFWB 1MH5B 4YDJA 4KRMB 3ZYZA 4FQCH 4G6JH 2I60L 5C07A 4CN4A 3B8SA 5CWSA 1IE5A 2F54A 1UH2A 4IOSD 4N0RA 1NCCH 4NQCA 1ZWIA 2E7CA 1VFAA 3CAFA 3WKML 4QCIA 5CKGA 3BH8B 4JPKL 3B4NA 1HHKA 2DYPA 2X4SB 1LVEA 1VFOA 2D31B 3QNYB 4M9PA 4ZXBB 4OQ1A 3QNZB 1C7SA 2KKQA 4PLJD 2QR0B 3C8KB 4P2OC 4PGCB 1HYRC 2VDMH 5EOTA 1CL7L 1FP5A 4H88L 3GHEH 4FN0A 2IMNA 5C07B 1P1ZA 3IAQA 2DQDH 2DJ4A 1RZIB 3R1GL 2WW8A 5J56B 4XP1H 5J4MA 1TQBC 4F58L 4XC1H 2CD0A 5T33H 3X11A 3Q5YA 4G43B 1UXWB 4LIQH 1IRAY 4HJGA 4XB7A 4A6YL 4MX7B 2ESVD 2R29L 1M7IB 1EJ6A 1T2QH 2HLAA 4JHZA 3DROA 4R8WH 5BZWB 4FP8L 4PJGE 1KG0A 4WW1B 1Y18B 4M8VA 2OTWB 5I1GL 4P46C 5E70A 4V1DA 5DGQA 3BOVA 4PJHB 4L3CA 4Q6IA 1F11B 5E4EB 5B22A 5ADPH 4FFWD 3OKMB 4QGTA 1B6DA 4HUWB 3ECBB 4IRZL 3VXRA 4EQ3A 5D72H 2VDQL 4YHOL 1HILB 5F3HB 4CADA 3GMRB 1OT2A 4K7FB 1GGIH 1W0WB 1KCVH 5DD5H 4PP2A 3TBTB 1MHCB 3ZYJA 1XF5B 4UTBL 4Y16A 2J4WH 1ZGLB 2XKNA 3EJYC 1PQZA 1B0GA 1PZ5A 3EYUH 3NCBB 1A14H 2X4PB 1JMZA 1I9IL 2E9JA 3ZDZE 5JIPA 3MRQA 4GMTH 4NQTA 4P2RD 2OR8A 2CIKA 4D9RE 5JW4M 3BKCH 3PGDB 4HAGA 4OGAD 1YN7A 4LSTL 5CJQL 4I1NB 4HLJA 3X3FL 2W0PA 1MRDH 3IJHB 4KU1A 3HPJB 2W38A 3FQXA 4U6TA 3HHRB 5EU5A 3WCYA 5C8JA 3L3GA 1U8KB 1UKTA 4ZYKA 1DBML 2CDGB 3B3IB 3TA3D 5T3XE 2WINB 4XZUA 3VXNA 4ESKA 3QEUA 3EYOB 4RSVA 1MELA 5D2NE 4OCRL 5C0BA 5I6XC 2H2SD 3VFNA 1Y6MR 2NY5H 2XZAH 1CF8L 2YXMA 1DFBH 2RR3A 3ORJA 3BYTA 3KPNA 5FF6A 4PV9A 1NFIB 5HSFA 4G8FB 4HPYL 1L6ZA 2NYYC 1F4WL 4FMKA 1AC0A 1WBYA 3BN3B 3QG7L 4Q9RL 3KLAA 5KW9H 3CPLB 2VH5H 1BFTA 2VDNL 4JFDB 4MS8C 4E41E 3MRDB 5ESVA 3H7LA 4O2CA 2C3VB 3SDYH 3AU1B 4RDQG 2BY2A 4NN7B 1MLCA 4XTRC 3B9KD 1MQKH 4MJIB 4N8VA 4G7VH 3S34H 3VFRB 2EYSB 3BAEL 5DC0A 1MCOL 3SPVA 3DMMB 4JFOA 2NY1C 2QEJA 1MIMH 1PSKL 3TN0A 1ZHLB 3QIBB 4OF6A 3WJLA 4ZUWA 2GSGA 2EDBA 3R4DA 3MBXL 4QLRA 1NAMB 1KXTB 5FYLH 2MHAB 4HZLB 4NRZB 3QFJE 3SDDC 4WJ5B 3AM8C 1M05B 1D5MA 4PYGA 4JGMA 5L2JA 3A6BH 4OCSL 2O5YL 2DQTH 1U3HD 1KBGH 4QTIH 3HRZB 2X1PA 3VW3L 5CHNB 5ADOH 3GSQB 4Z7VB 2DM7A 4XPGH 5E1AB 3AXLA 2LVEA 5L7XH 3SY0A 1BGXL 1EUUA 1KJ2B 4K7PY 2A74A 3HE6C 3SKMB 1BWWA 3MRJB 4JY4A 4CW1B 2JE8A 1IM3A 1DBJL 4L8CA 2ICWA 4YUEL 3O3DA 3OJDA 2NY0B 1T66D 1DVFD 4U7MA 1UENA 1J0HA 3O2WL 4HIIA 4ODXA 1MFDL 2VDPH 5FM4A 5FGCE 1FSKC 5CMAA 4XC3H 4GAYA 3EFFA 1MH5A 4YDJB 2F53B 5CGYC 3T77A 3I85A 2DQHH 5I8KH 1HK6A 4LCUA 3RVVC 1MAML 1HSAB 5KZCD 3BPCA 4ZDHA 2BXZA 1CGYA 3QEHA 4JQIH 2FEEL 1R3HB 2W0FA 4XHJD 3C09B 3MLRL 3PGDA 2DICA 2GTWB 2BCKA 4KK6D 3MRMA 4FZ8H 4LQFL 1A7NH 1AXIB 1PKQB 4NZTL 4RDQF 5TE4L 1R3HA 2W0FB 4QF1A 5FYKD 2MKLC 2IQAA 2R8SH 5FYJE 5IWLA 1MVFA 1WCQA 4N8CL 3VG0L 4WU7A 4LSUH 3T0WA 5JDJA 4E41D 1GPOL 4JPKH 1YN6B 4MXQC 1DEDA 1G9EA 1IGYA 4MYWB 3ARPA 1BJ1J 2Y6SD 3L7EA 5D1QB 3T77B 2GEEA 3O6KH 5I16B 5HPMA 3BKCL 4PBWD 3U6RA 2CMRL 1T20B 2V9QA 2DQFB 4Y4HD 5DSCA 2VWEC 3LB6D 4GS7B 1XAUA 4XB8A 4LLDA 1YEFH 5BZWA 5FUCC 2PTUA 2PYEA 1NBVH 1A1OA 2JELL 3OXSA 3M07A 3ZHDA 4YWGH 3E1F1 2Q8AH 3TA3A 3MOBL 4G43A 4RGND 1E4XI 1ZVSA 2EIDA 4LCIH 1NFDA 3HB3D 4MAYB 4UOW0 5IW1B 5DA4A 3I9GL 3FO9A 1WUNT 2PNDA 5BW7C 1NSNL 4Q2ZB 1EGJA 2D0GA 4JG0H 4JKLA 4HKBB 2I27N 3X13A 1K8IB 2IJ0C 5F9WB 4Z7VA 2A0LD 2DL9A 5D7LA 3G9VA 3V52L 4WTWA 1UM5L 4RWYL 1V3MA 1NCWH 4KRPC 4PRPB 1QZ1A 1A3RL 1U3YA 2XXCB 3H3KA 1FVEA 2Z31C 4LAQL 4RISH 1HCFX 4HK3N 5T1MA 2JCCA 4ZFFB 2YBRB 5IMOB 1EBAA 5DD5L 5FIEA 4PB9H 2P5ED 3CFJB 3WV0A 4LSQH 1ZHLA 5IHBA 1BBJB 4GO6B 2R0LL 5ACZB 2AK4A 2YD4A 4JFOB 4YBLC 2Y07L 5HI3C 2GT9A 4DN4L 2E8ZA 2W1NA 1IQWL 5T1DL 3BPOC 3T0ED 1M05A 4OKVB 4YHMH 2YRZA 3CLFH 3P9MA 3FFDB 2BRRL 1NCBL 4NRZA 4PS4H 5DJ8A 4ZAKC 1AQKH 3K8KA 1NL0L 1TDQA 2D03L 2HWZL 1AGFB 2J8UE 1BEYH 3FFCD 2BERA 3ARDB 4HFUH 1NGYA 2VAAA 4PRPA 3DUUA 1HQRB 5FAAA 3JV0A 4MCYB 4HUMB 5CGMA 5DJ8B 5LGHL 2E3VA 4H1LH 1UADC 1QRNB 1F6LL 1R3JB 3EYSL 4FFVD 3VD4A 2Z9TA 3PL6B 4N68A 5DYOA 1UXSB 4FZEL 4I2XE 4WI2A 1AKJB 1RJLB 4PG9B 4LKCA 2EKJA 1I3GH 3G5YA 5IW1A 3MV8B 1IZKA 4M43L 4RBPH 2MFNA 1CD8A 5C0AB 3VFSA 4O9HH 5E6YA 3BGMA 5EU7C 4P2OA 2XT1B 4LMQI 3RGVD 5DEGA 1N3NB 1YN7B 3MR9A 5I1AB 4YX2L 3AS3A 2FGWH 4Z7OE 4YXHH 1XGRA 4Y2OA 1A21A 5HI5C 1ZEAH 4W4OA 5C0BB 3LN4B 2X1OA 2PYFA 4NQED 3BQUA 1MFBL 4BQ9A 4LCWD 3V6ZB 3LAFA 4JM4L 4OZHF 3HAEA 4OD2B 4YPGA 4KKBD 1X4XA 1JF6A 1FN4B 4NQUA 5F9OH 1G6RA 1UG9A 2G9HA 1NBYB 1J1PH 3LQAL 1A02N 3H42L 2XOTA 5CEZD 3PF2A 4Q74A 4U0RB 5DMJB 1HDMB 2JK5A 5GZNC 3FT4B 3W0WB 5ERWB 5SWZB 4Z7UA 5C0AE 1MHPH 3ZTJG 5E2WL 3QWQB 3RKPA 4JY5L 5CIPA 2EC8A 4JKKA 4F7CB 5EB9A 1WLHA 4OD1L 4C59B 1QQDA 3WLBA 3V5HB 4MB3A 5EZIH 1BGXH 3MJ8A 4KI5C 4P59L 4YHPB 3HE7B 1VFBA 3S88L 4IBLT 2OR9H 3EBAA 1MIML 3IU4L 4TUOB 2ARJA 1E6OH 1KOAA 2PXYA 2QKIA 3KPSB 1AQDA 4R4BB 5HHMB 1WWWX 2X4TA 1Y18A 2DLFL 5HHPA 4LAJH 4F3FA 3U2SB 2EIZB 1U2CA 3JUYA 3HNVH 1U92B 2YPLE 3SDXE 4CNIB 4ELMF 4NRXB 3LD8C 3QJFB 1YMME 3T1FB 4LHJB 5GRUH 2AJ3B 4DQOL 2EEDA 1MCIA 2WP3T 5TE4H 3W81A 1GYAA 2DLGA 3FMGH 3EDDA 4UT6L 1W8OA 3GBNL 2X9XA 3RL1B 4O58H 3TNNB 2H1PL 5I1HH 4QRQB 5GRXG 1AGBA 5HHMD 3KLSA 3IDYB 3KYKH 3L3JA 1QPXA 3TFKD 4XVTH 2Y9RT 3W9EA 2ERJC 2A83B 3LKNB 3ARGD 2AI0H 5J6GB 3U82B 5T1LD 3QI9A 3TNNA 4YXKL 4M93C 2NY6C 4U6YA 3N85L 4NCDA 1NCNA 2V5YA 1OGAD 1MHHB 4CJ1A 3IXTB 1FNEA 3WO4C 1KT2B 3O3DB 3OJDB 3RHWK 2EDQA 3GMMA 3G04A 4JFXB 5JW5A 5KSBE 4FFYH 4Z76A 2RCSL 3NCFB 4QXGL 3KDMB 5JQ6H 4Z7WE 4NQEE 2A73B 2GK2A 1PX4A 1EO8L 2D7PA 1NKRA 3HMXA 1YNLH 4Y5VC 5EA0L 1MNUL 4ZUSB 5DQJB 2RB8A 5HHOA 5CJ8A 4HLZH 2GY5A 4N0FA 5D4QA 2BVUA 5DVNA 4E42B 2H32A 2A2QT 4CUCA 5IMKA 3QUML 2PXYC 4Y8AA 1I8MB 1MRFH 3PDGA 5IMLA 5E8EA 3VFMA 1NFIA 1J86A 2KPNA 1QBLL 2J2ZA 4GG8B 1A7OL 4F8QA 1W72A 3MLXL 4KAQL 5CD5D 3BD5A 5DA0B 1MREH 5SV4A 4X7FC 3DBXA 3FB6A 3V4PH 3C2AH 5IKCA 1QG3A 4ZS6C 5ICXB 1HIMH 5KOVC 4X5LA 3GHBL 1EO7A 3TT1L 1QR4A 2E6JA 4LHUA 3B9KB 3S36H 4P2OD 4XNUH 3RKDC 4NM4L 2DLEA 2N7AA 1X44A 1F45A 2VB5A 3WIFB 3LPGA 1LE9B 2CLZA 2L7UA 4YHYB 2AJUH 5IG7B 1XGRB 1AC6A 1KENH 1QFUH 1ZT7B 5M95B 3S88H 5F8RC 4JCMA 4LCWA 4M6MH 1KIPB 3U7YL 1WWCA 1UA6L 5JQHC 2E8YA 2DQHL 3WIIH 3O2DL 2XN9D 2OTUA 5EU3A 1XIWC 4AT6A 5HPOA 2CJUL 4Q9QL 3E8UH 4HKXB 4QHKJ 2A9ML 2HFFA 4G8EA 2I07B 5LGJB 4LKXB 3ULSA 2CDGA 4YR6A 2DDQH 5A16B 3AREC 4BSWB 4ENED 5HVFB 2B1AL 2OMBA 3I2CL 5ESQB 4JN1L 3JBG7 4GW4B 3ULVC 1FZOB 4KPHH 5I1JL 5MERB 2FNBA 2ARJQ 4JZJA 4YDIL 4RA0C 4Y19D 5HYIA 1F3DJ 1FIEA 2EH8H 1I9JH 3T0VA 2HT4C 5KSUB 2X4QB 5HDOA 2P8LA 4IJ3C 2DQDL 3DECA 4OT1L 3P9MB 4TVPD 1JZ3A 3D3VB 2H32B 2R39A 43CAB 1BHGA 4PRPD 4NJAH 5BS0B 3UPCA 3KR3H 3SKJH 1R5WB 4PRHA 3VE0B 1MF2H 3CFCH 4PJAA 3AAZA 4HDIA 5EBMA 5DYOB 5GS0L 4QRPE 2FX7H 3DBXB 4PR5B 1HHHA 1N2RB 2VQUA 1R5VA 4F33A 4M48L 4JKPH 3CC5A 3BVNA 1EHAA 2V5SA 4NKOA 4P23D 1YDPB 4X5WA 1KACB 1DQJA 1HXYA 4U1GC 1OP5H 2VAAB 1JPST 4XPTL 5I74B 5EH1A 3B2VH 2ESVB 5FO8A 1KJMB 1VEPA 1XFPA 1RIUL 1N8ZB 3LPFA 3QDJD 1KELH 5IB1A 5L2KD 3X11B 1OW0C 3SGEI 4Y1AB 3W39A 4F57L 2NR6D 3AS0A 3O8XD 3PE9A 5LCVH 1AD9B 2F8VA 2FEDC 3BKYH 2Z91B 3F7YA 1IGIH 2X5PA 2ADGB 3UTPE 4YBQC 2HJFA 4YXHL 3P11H 3RRQA 1J11A 4YX2H 1QR1A 2G60L 4PJBE 3NFNB 2DIBA 1B0RB 3OKKB 1A2YA 4F9PA 3QNZA 5C3LD 3K80A 3T8XA 3UTSE 3T2PA 5B8CC 5IFHL 3BGAA 1OCWL 3T4YB 2D7OA 4NO3B 5IVZA 3KPRA 3FOMB 4LIQE 4X6CF 3MO1B 4EOWL 3CVIH 1U92A 4OFYD 1HZHL 1U93A 3JVGA 3MLVL 4ONHB 1FRGH 5AZ2H 5I8EB 4NHCL 4NYLB 2Q7YA 2RQ8A 4HIHB 3UTTA 3HNSH 3ME0A 5F8QC 2BOBA 2ZUXA 3X12B 5A3ID 4X6BA 1V5JA 4U7SA 4YHPA 2F5AL 3VD9A 4M1DL 3H3PL 1XH3A 2GI7A 2VLKB 3TZVB 5IVNA 5DRNB 3V5DB 2DYPD 2RCSH 4FRWA 2R2EB 4UQ3B 1BQLH 1AQDB 3MUGA 1YPZF 3PWUB 3VGFA 3B2UD 3IVKB 3TO4B 4IOFD 3SDAC 1JF1A 3UYOD 4PLKC 4WV1B 5CSBA 1U36A 1AP2A 4G5ZL 1T22A 5GGSB 1I9RL 2E7BA 3VXMD 1TETL 2P47B 4KROC 2BY3A 2BSTA 2QTEA 2UWEA 3JTSB 5H37G 2VZ3A 1NEZB 4A6YA 5GRUL 4F37F 4LSSL 2OTPA 3IFLL 4X4XA 1CVRA 5KJRH 1G6RL 5SX4H 2XA8H 4JN2A 4P5TA 2E9BA 1MCBA 1E28B 3RVXD 1XF4A 1QYGH 4RX4D 2PKDA 3NA9L 3DX7A 5EIVA 1CLZH 5GS0C 1NANH 3S6CA 1B4RA 3U7AA 2UZYB 1OAQH 3QQ3A 1UC6A 5I1CL 5FO8B 1J1PL 3WFHA 2ADIB 4NCC2 2D4DA 4JKWA 1OB1B 4Y5YB 3JV4B 4LLWA 4OCLC 4B5EA 1MWAB 1OT1A 3VXRD 2MCPL 1U3HB 2GY7B 1M6OA 4X7SL 3GIVB 4IMLB 5DUPH 1G7LA 5E9DB 5J6GA 2VWEE 3QXDB 5C0RH 5HBBA 3PV6B 4P2RB 5MEPB 3NFPA 2FGWL 5GRJL 4EQ2A 1U91B 3D85B 3IFPB 1I8KB 2DM3A 1CTOA 3D18B 3AMKA 1UKQA 4JZOB 3BW9B 3FQRA 4X83A 3MRHB 3RTQB 3V0VA 2IPKA 5E4EC 1X5YA 2Q3AA 1MY5A 1EEYB 4NUJB 1OSPH 3IFPA 3WNLA 4UNVA 1ADQL 4XNZC 2XV6B 5FYLE 1ORSA 1KIQA 1JV5B 3WL9B 3DI2B 3LMJH 3LKOA 4K71C 2X10A 4W6YB 4X6DF 2GAZB 4OKDA 3GIVA 3SGDI 1A7NL 4NWUL 4MVBC 3MNWB 1K4DA 4NN5C 2GFBA 1WZ1L 5DMIL 4LNRA 5B39A 8FABB 4O2CB 3BGFC 4UIMA 3P30L 1UJ3B 3IAGC 5CD5C 3MUZ1 4Z8FH 4P59H 2VXVH 4U0RC 2R1WA 5F7YC 5D7IF 1F13A 3KJ4C 7FABL 4NT6A 3RU8L 1YY9D 2N56A 3C8DA 3STLB 4EUPA 4ZNCD 1JF5A 3JSSA 2DWDA 3PIQB 4U3XA 4HEPG 1XGUA 5B39G 1LD9A 4KMQA 5FKPA 3QHZL 3V9FA 3HC3H 2H2SC 3CMOL 3O41A 1CFVH 4LSQL 1BOYA 3KPRD 4HHAA 1FYTA 1FO0L 1G7JA 2P45B 1YZZA 4LCIL 3VXUB 3V7AE 2XY1A 1EGJL 3MV7E 3QHFH 4KJQC 1A1MA 4D0BA 2AVGA 2F8OA 3NIDE 4PY8I 3ZE0E 2XA3A 1REIA 4U1LA 3MGTA 3D3VD 1XIWB 4IOIB 2WIIA 1GHFH 1MHCA 3F58L 5AD0B 2VTFA 1AXSB 2NTFB 2GJ6A 3C08L 3RDTB 4GKZB 3O4LB 1T0MA 4PJ9A 3BQUC 4KJYB 2JKXA 5J6HB 5C8JB 2FIKA 3JUZA 4RRPG 5IKCB 1WC7B 4KTEL 4G6MH 2RIKA 3DROB 5E8PA 2AABL 4WV1C 4Y16C 3WSQH 5I15L 1AGCA 2APFA 5CEYB 4JO4L 5C09A 1IGCL 1UXWA 2VXQH 2Z93B 4XP9H 1RUPH 4YZFE 1CICA 5EO9B 5HDQH 4RFNB 3CCHB 1LO3L 4OD3L 4X99A 3L7EB 4G9FE 1IGYB 4Z78A 5HHOB 4WU5A 2FECL 1XR8B 5JDSA 5E1HB 4P46A 1XF5A 1ADQA 1M71B 4WHYH 1LP9B 1N5YH 3PV6A 4L3EB 4YHKL 3PP3K 3OG6B 1IC5L 5SX4I 4OGZA 3VDBA 2WUCH 3HS0B 4Z76B 1ZT4B 5E00A 3SO3C 3PDOB 4O2EA 3PHQA 4NO2B 1IFHL 3ZDYF 4Z18A 2WNGA 3HUJF 1U3HC 4FG6C 4K23H 4DZ8A 1UACL 4Y89A 3CCHA 5ECJE 1P84K 4ZS7L 4C83A 5LBSH 2XG4A 1I1AB 5MEOB 5F9DC 1BVLA 1BBDH 4DZ8B 1RZIA 5JR1L 5KS9B 5JPNA 1W8NA 3K8LA 3RVUC 4FNLL 4H0GA 1H3VA 1FLRL 2VE6A 3SO5A 2GKIA 5GRVL 5IFHH 5TE7H 1CBVH 3TJHC 4FTVE 4OT1H 4MQXC 1KCSL 1U0QA 3RDTA 3DV6B 3O8XB 3WEXB 1HWHB 4ODSL 3MLVH 1O0VA 1I1AD 2AJYH 1JWMB 1NMBH 4WTXA 4XWGL 4XX1G 1KJ2A 2E27L 3Q1SL 1D5XB 4FXKA 4CN6A 3MLZL 3MRKA 4MA8L 5JW4R 3FQTA 1MAJA 1H0DB 5IP4A 4HWNA 5CEYA 4LU5L 4HWUA 5GZOC 2UV3A 1F42A 3R8QA 1NCDH 2CO6B 4NOFA 4QYOB 5ENWB 1IKNA 3SGDH 3FHQA 5I1EH 4L8BA 5B8CB 1LEIA 3FKUS 4GKZA 3PL6D 3OAYH 1U9KA 1J0IA 4XAKD 3T08A 2CLVB 3G6AB 3VI4F 3ZKSD 2XZCL 5EU3B 4QRSA 2MHAA 4DCQA 1T2XA 4MXVE 4HG4J 3ESVF 3GMQA 3CFEA 5F93C 3REVA 4YPJA 3MRPA 4H25A 2RFXA 3QDGB 3F7PC 3UBXA 3CMOH 4BH7A 4JHWH 4N90D 1HH9B 4TPRH 5F7FA 1A1MB 2VNCA 5F7DA 5DFWH 5CJOL 4BH8A 1H5BA 3VXUA 1QRKA 3OGCA 1GZQB 1Q0YL 3T0EA 4GMSH 3CPLA 3KYAA 3MRNA 3HCVA 5DRWA 4LASH 1DBBH 5ALBH 4RMUA 3U1SL 4U05A 2R1YB 3I6LD 2HN7B 5IB1B 5FHAH 3ULVF 4ZSOE 4JJ5B 2R1WB 3QUKB 4MJ6B 4BM7A 3EOYG 2CIKB 2VABA 3OKNA 1QSVA 5D1XB 4HX1B 4NT6B 1Q9KB 3GSVB 5DJAA 3D39D 2EE3A 5IGXH 4S10A 4AMKH 5EZJB 5I66A 3MGOA 1II4E 3O3AA 3QIUC 1T5XA 3K4ZA 2OX5A 2EXWD 5IHUL 4WVRA 1CCZA 5DI8B 1RAMA 3WUWB 4HPOL 4PTTB 4EEEA 4UILH 5E5UB 1KFAL 1T03H 4Y19E 1RUMH 1IGML 1Q1JL 4JDTL 5AEAA 5C09D 4ZOAA 5C9KA 1DE4B 4L29B 3BEVA 1CDCA 2Y4SA 3RZCA 3ULUD 1UKSA 3CH8A 1YQ2A 4Y5YC 3ARWA 5FDYA 4PJDA 5IV2B 3CMGA 2V7NB 2YMXL 4NRYB 2I9TB 2VRAA 5KS9F 5DS8A 1FYTE 4I0PD 4F15C 1FNEB 3LMJL 2C1PA 2K9UA 4HJGB 5T1MB 4HF5H 2BRRH 4F7PB 3IFLH 1P5UA 4UT7H 4HWZB 3OKDA 1Z0NA 4QKXB 4OV5A 3K81A 5F3HA 4WEBL 3IF1B 3CFBB 4PG2A 3P4MB 4HMEA 3K1DA 4ZFOB 3QXUA 1QBLH 2AKRA 1R3IH 5IVXA 4P5KB 1JPTH 1SY6L 4IMKA 1I1AC 4XAKE 5I18L 4MJID 1M6OB 4G7YH 3LOWA 4O00A 3WJLC 3MYZA 5C92A 2J4WL 3E0GA 5C6PB 3EYVB 2DYPB 1OAKL 2ARWA 1A1NA 1VSCA 4QRRE 4ZAKD 1NAKL 2WBJA 1ZLUK 4JRYA 1NCCL 5LJYH 3RNKB 3ZO0A 1N59B 1OD7A 3PNWB 4PGBA 4JQXA 2ZPKH 3TCLA 4F7EB 1F8TL 3L6FB 1G0XA 2NY2C 4JN2B 1TCMA 4OJFH 1C08B 1F4AA 1KNOB 4KC3B 5IB4A 1IC7L 4R7NA 1ULVA 5D9SB 3D6GA 1Q8MA 1CE6B 5SV3A 5C1MB 1FFRA 4HWBA 2H6PB 4KRNA 3VJ6A 1M71A 5C70A 1U8HB 4P9ML 5T3XD 4HWBL 4XMKL 3V5HA 2LTQC 1S9VB 4P9HH 4EIZC 3QZWA 2EDDA 3C5ZA 1OSZB 3QPQC 2Z93A 4XVUD 1ZGLP 4PRNB 1OAZL 3GB7B 3ZDYE 1YEEL 1EZVY 3GMQB 1CXHA 5BVPL 5DD1L 1R0AL 4QRUA 3VMPA 3MBED 5D1QA 2CRZA 4ODTH 4DGIL 4JO1H 3CVHL 1DVFB 4YLQT 3RWDB 1S5IH 4JFFE 4LK4A 2R15A 1Q9OA 3TBTA 4YXKH 3EYUL 2FIKB 3QQ9D 2H6PA 5IM7A 1OLLA 4KY1L 5B3JF 3HAEB 2JCCE 3ARBC 4WNQA 5BXFB 1LGVA 3T65A 2JJTC 4Q0XH 2AJYL 2FH8A 1D7FA 3LSOA 2YD6A 4NSKB 4CVXB 4RIRB 4WCYL 1CZ8H 3IJSB 3LN4A 4OD3H 2E6PA 4N5EC 3F12B 5SWSA 1MJUL 3DXAA 2LAGB 4POUB 4Y2DD 3DGGA 2DQUH 4V2CB 4EN3D 2EE6A 5J11C 1AD0A 2C3HA 2MNUA 4PJ7F 3VD7A 3D2UD 1H3PL 3N9GH 4HS3A 2FEDD 4QXWA 4X7EC 3R8BB 1XGYH 3OKYA 4GAGH 1LQSR 4Y4FA 2V2TB 1CD9B 5JMRA 2R2HB 3BP5A 3SN6N 3MJ6A 4MZ3A 2IWGA 1CLOH 3C87A 5DMGC 3IDXL 4Z5RB 5HHOD 4TNWF 1PEZA 5IVXB 4E41B 4O2FB 2DQGH 3D48R 3QEQD 3QEGH 5HD8C 1EHLL 4YDLC 4NO5A 3STLA 4Z7QF 4NP4H 1FGVL 3I3DA 4ZPVB 4ODUA 4PJHF 1XCTA 4HV8B 3N06B 3OJMB 1N7ML 1DQLL 4XBPA 3QJFA 4HS8H 3ESUF 3P77B 2WV3A 1R5VB 1YEDB 5IESH 2X40A 2A6DB 3DX8A 1KC5H 4UIMB 4WUUE 4MA3B 4K94H 3HNTL 5L88L 3KPSA 1F90H 1UFUA 1KCSH 4OLUL 4MQXD 4G80B 4U6HA 1T04A 2HT3C 4DVRL 4XP9L 4RCAA 1EHXA 3LKOB 3AC0A 3QQ9C 1MLCB 1KCLA 1N64H 2O5ZL 1OW0A 3C6SA 4HBQA 1EXUA 4PJBF 5J1TC 4DQOH 5AAWA 4OB5H 4XP5L 3FO2B 4JM2B 1QQDB 3RJQB 3O3UN 5BS0A 2CIIA 4ZFFA 3AY4C 1ND0A 3AB0B 3G6DL 3WXVH 3OV6A 5EOCH 3TN0B 4ZPVA 3N1MC 3CZFA 2VLJE 4XPGL 4G6AC 4FZ8L 3CH1B 4AM0B 4PJ5E 2HTLC 3A6CL 3BHBB 4H26A 1RULH 4H5SA 2HFEB 5SWZD 2RJMA 3WBDA 5I1LA 2PR4H 3PP4L 4HKXA 3N85H 4PRDA 3O3BB 4I9WE 3GDBA 4X7TA 1K4CA 2ZUYA 4GXUN 1VCAA 1RQ5A 2B0SH 3LV3B 4JG1L 4XHQA 5JHDE 1PBYA 2NY1B 4H8WL 4C54A 1OP3H 3V7AG 4BH8B 1IQDB 4OTXL 2J88H 5CJ5A 1SMAA 4H26B 4OZFG 1JGVH 1QO3B 4WGWB 1A1OB 1A6VH 2VC2L 1MFNA 4NQEB 4WW2A 1YNKL 5DHYA 3VFUB 4GLRI 1CD1B 2DQFA 2IGFH 4G7VL 2FWOB 5FHBL 4OIIL 1XF3B 3K8MA 1KCRH 2FBJL 4ZO6A 3FONA 3M1BA 2DKMA 5LWYL 4HUXA 3TPKA 4UINH 1X3DA 4L8SB 5HHOE 5I16A 3C5ZC 3F5WB 3E6HA 4WI7A 1MFCH 5J13C 1YEFL 5F9WC 3EDKA 1PFCA 1PX3A 4GRWE 3DWTA 4MQ7B 3E2HB 2VJXA 5DJYA 5LXGL 1FORL 5DTFB 3TJEL 3ZKQD 4YIQB 1G7PB 1TZIB 4LVHB 2J12B 3EO1A 1N0XL 1CDBA 5D6DA 3MROB 4ZSOB 2O5YH 1A3LH 2APBA 1M7DA 3MRGB 4XAWH 5C71A 1LMKA 1LO4H 2OZ4H 4LSUL 1HHGA 4Z95L 3A67H 1T0NB 1DQQB 1FZMA 4M1GL 5D1XD 3DO7B 3O8XA 2D0HA 1FGVH 1I1RA 2NXYD 3MJ9H 1P7QB 4PRID 2NW3B 3I6GA 1T1ZA 4M00A 4XP4L 2AXJA 4Y2DA 4PTUB 5EU6B 3GFUA 2VLRB 1R24B 1JPSH 4WHCA 3BKYL 5IHZB 2R2HA 1PEWA 4Y4HB 4NHCH 3G5VB 4PV8B 2BNRD 4XCYA 3FOLA 1Z9OA 3MRCB 3V2AR 4G9DB 3FQRB 4OFYA 1JGEA 3DV6A 3K3QA 3LEVL 3CUPA 2F5AH 1OCWH 3DVGA 3UZVB 3JWOL 3V8CA 2W0KA 5JHDD 4O2FA 5F1IA 3MOAH 5F97E 4MVBD 4OZGF 1QSEA 4Y5VA 5E1AA 3BZEA 4J3UA 2XWJB 3TZVD 3MLRH 4L9LC 1CYGA 3JWDC 1UJTA 3OGOE 1AI1H 5ID1B 3HI6H 3RU8H 1Q9LA 2BOCA 2CR3A 2LAAA 5I1KL 2F58L 3GIZH 4UBDD 4X4YB 2NPLX 4JJHA 5J9PA 2FZ3B 1A6UH 4MNHB 3KPSD 1GIGH 1ZVYA 1NLDL 1ZHKB 5JHDB 2NY5C 4HBCL 3RL1A 4M8QB 4OGXL 1A64A 2F15A 4DKFH 2B1HL 1IM9A 3WE6A 4XBEH 5TQ2H 4QNPE 1KTLB 4LPUA 3WDHA 2KZWA 3B83A 1KJVA 1J7VR 3SDXB 2MQCA 4XBGB 3VRIA 1INEL 4PJGA 5HGBA 5KTEH 3KPLA 3KPQA 3H9SE 4KV5E 3ULVD 4BZ2L 4OD2A 4YPGB 1JPGB 4AL8L 3WFDL 4MXWH 4R3SA 2VR5A 4DGVL 4P5TD 1SYVB 2QSQA 5IEHB 1CFVL 3RPIA 4YEFA 3CZJA 5GSRA 3PQYE 4L3AA 4W4OC 5IW6B 1DDHA 2YC1A 5GGVL 4UDUA 3QJHB 2ZCHH 1MQ8A 4NWUH 1MVUB 1UJ3C 1ZANH 3WLBB 1CLOL 5SWZA 5D5ME 5F9OL 3QFJD 4URTB 3SQBA 4JM2C 3QO1A 1EAJA 2CKBB 3KS0J 2R1YA 5GGRY 3BGMB 4WRLA 4JY6A 5LCVL 5GSVA 3G08A 3MZGB 1KB9J 5FM8A 3IDJA 3W0WA 2K7PA 4WDIB 4HUNB 5FUOH 2J5LB 2DI8A 3O4LA 1FVDB 3IU3A 4KUCD 3W2DL 2OMNA 4NC1E 2A9NH 1B88A 2PYFB 4PRBB 4IDJH 5AD0A 2OJZH 3PNWA 4PGBB 2NQCA 5ID0B 3BE1H 4LRNH 4OCXH 3FCTB 4WHTB 3UTSB 3FTGB 1CD1A 2B7DT 4OFIA 3DSFH 5FA3A 1DUZB 1KPRA 4FQIH 1D6VL 3O6FC 3FHAA 4PPTA 2JIXD 3CZFB 2IALA 4KDVA 5GS1A 3U0WH 2C4FT 4GT7A 4JE4B 1JFQL 1NGWA 1V7NH 4J3OC 1A2YB 5AYUL 1UJ3A 1BJMA 5C08E 1FAIL 4XTRD 3IKCA 2EXYD 4ALAL 4EBQH 2IEPA 3BKJL 3GGWA 2VDLL 4XI5D 4N8VG 3M45A 5FK9A 4OZIF 2VLKE 3F6IA 4NQSB 4HULB 1XF2B 1SJHB 1S7VB 1OLZA 3ES6B 2WIMA 4OV5B 3UYRL 5E4IA 4YUEH 1D5MB 1WGOA 5C0CE 2FHCA 3QCVH 3MNZB 5IJVA 1KCVL 3OKEB 1U58A 2IPUG 4PRIA 4H0IA 3FN0H 1BD2A 4YHIA 2V7NA 2I9TA 4TTGA 3ARTA 1I9RH 5FYKE 5C0EB 1QFOA 3RA7L 2BNQB 2PTTB 4GW5B 1CZ8L 1EFXD 2EDEA 4CJ0A 2NYYD 2YN5A 3MNVB 4XCCL 4Z7OF 5DQJA 1BQUA 1AQKL 2V7HA 4YHLL 4F7MA 5BV7C 3MLWH 4ODVH 2P5WB 1J0YA 4YWGL 4BQBA 2B4CH 4POZD 4ZXBA 2BX5A 2XTLA 3EO9H 2F54E 3TA3C 4MD0B 5CP7A 3ZMRA 1A6AB 5BO1L 1HHKB 4WTZA 4KI1A 4LLQA 4XXDA 1EFXB 4Y4KC 4JG0L 2W9EH 1RIVL 3IRPX 1CF8H 1DZBA 3IGAB 4YHNA 4NNXA 3UXFA 3GJFB 3VRLE 3BDYL 3QUZB 5CILL 5ETUB 2B8OT 2DIJA 2AEQL 2ED9A 2P5WE 3T0EB 5FCUL 4LAQH 1Q9WA 2DLFH 5LKNA 5LBSL 3AS1A 2DQCH 3UJTL 3JTTB 4Y5XB 2UWEB 5A2LH 1CFTA 4WUKH 2H8PA 4WFGD 3V0WL 4XGZA 3VGGA 1HNFA 3LN5A 1KTKE 2BNQE 3EW3B 1RJZB 4Y4HC 4EUPH 4TSBH 3GNMH 5HHVH 1CBVL 3W9DB 1UCBH 3QIWC 5I0ZA 2IALB 1LE5B 4RIRA 4K3JL 3VFVB 2PYEB 4NSKA 4CVXA 5A40E 5HPMB 2IG2L 4LPYA 3SJVA 5EA0H 2FSEB 3UMTA 4IS6A 4WI4A 3VFTA 4XWGH 2NXYB 2AV1A 3EDFA 1D6VH 4Y5XA 5ESAB 5D6DC 3HC4H 5ALCH 1JMXA 3ZE2F 2IANA 5T5FL 4CVZA 3PJSA 5FYLD 1A6TA 1JF1B 5L0QB 4XP6L 4PJCF 1VDGA 2VLKD 1YC7A 3TFKC 4MNQA 4O58L 2AV1B 1T6VN 4YQXL 3RWGA 1AGEA 4ALAH 2FLBT 5C0CD 3KPTA 2DQJL 3IDGA 4UNUA 4GXVL 1VPOH 4F80A 1EEUA 1S9XA 3S5LB 1DQTA 3ULUF 2NR6C 3QO0B 1ZSDA 3S36X 1ZS8B 5FFLA 4QT5B 4BZYA 3GRWA 3RGVC 2R56L 5HVWA 5E8DL 2BOBB 1AHWB 5H35A 1TZHA 5E56A 3LY6A 1QSEB 1FFOB 3LQMA 1NGQL 3T3ME 2BP3A 3B9EA 4UT6H 1HIML 1T5WA 3FMGL 2CDEA 1KSRA 3MO1A 1K9TA 1I1AA 1J8HA 3U30C 5GJTH 5KSBA 2CKBH 4CW1A 4GQ9H 4MSWA 1BD2B 4NFCA 4NQXA 5IROA 5D2LB 2Z35B 4XC1L 2Q6WA 2E7MA 4HIXL 4HUUA 1RULL 1QLRA 3HFMH 3LS5H 3H9SD 4GKNA 5DUBB 3LKPA 5TDOA 5HGAA 4V2BA 2AXFA 5CJXA 4LDLB 4G6JL 3UTTE 1JZ8A 3I6KA 1VENA 4MA8H 2FBOJ 5JNYB 1A6UL 3HI5H 3P4MA 4CBPA 2WLYA 4IJ3B 1NJ9B 1VKXA 1CTNA 4OLEA 1GRWA 2P48B 1JYNA 4OD1H 1JNLH 1RUKH 1N5AA 5TFSH 3ZDXF 4JPVH 4OI9A 3U0WL 5EC1A 2C7UA 3D9AH 4K3GA 3O3AB 2HRLA 4M7LT 4J3VA 2Q76B 3QDMD 4CMMB 2ZG1A 3BAEH 3DUUB 1NC4B 5BJTA 5D96C 3KXFB 5LGKA 1CWVA 4L9LB 2V5RA 1I7ZA 4IDJL 3CC5B 4LVNC 4KTDH 4CU6A 3G5XB 1D5ZB 3QFJA 4YIQA 3BUYB 4KH2A 2Z31D 3HC0B 1A4JA 3VXQB 3MLTB 4EZMA 3HZKB 3FRPA 4HS6A 5FYLL 5DZNA 1VKXB 4M6ML 4OFDA 2HKFL 5T33L 3HMWL 2ZG2A 4HPYH 4NZRL 4HSQA 1I8IA 3SQOL 3ZYOA 2Y7QA 3F5WA 2AV7A 5H8DA 15C8L 1JL8A 2XZZA 1HOCA 1CFQB 1MCFA 2WWKT 3ULVH 4AENB 2FDBP 3I3EA 2F53D 4MNGA 3T0XA 1OAXL 3T0EC 1TVHB 1FH5H 1U3JA 5DHVB 2OXGA 2XXMB 5HHXH 4XMKH 2EYRB 4FQJL 3DV4A 2WSKA 5FCUH 1VEOA 4MDIA 3FQUB 3MXVL 1VPOL 2BDNL 4IRJD 5ERWA 5FA3B 1Q0XH 2CK2A 2DOCA 3OKLB 4Y4KB 1D5IH 2CXKA 4C56A 3HLAB 4R2GB 2OCFD 4JGJA 4QY8B 4PRBA 3WS3A 3D3VE 5EN2B 1IARB 2J8OA 1YMMB 4HJJL 4JCLA 3GUTA 4QHKI 4XXCC 43C9A 3VGAB 1QP1A 4Q6IC 3SJVD 3BMVA 5D71L 3TVMB 1VGEL 5L8LB 2JB6B 1KIQB 1S9XB 4KGLA 4PJFE 5FOBB 4EI5A 5KJRL 3PQYD 1R5IB 4WHDA 4BFEA 3CLFL 2ADFL 1BX2A 2FIRT 5AAMA 1AIFA 1QBML 4V1DE 1AI1L 1GC1H 1MUJB 1JRHL 4Y19B 4ETYA 1YC8A 4KQ4L 3MV9E 3L1OL 1BFVH 1B0GB 1JYXA 1P1ZB 2AJVH 2AJSL 3VXRE 2YZ1A 1YN6A 2E9WA 2YRLA 2HMID 1U8LA 4KUCF 4GQPH 3PP3H 3I9GH 3UPAA 1NUDA 3FB6B 4KK8C 2ZUQB 3L5HA 4QRTB 1GOHA 5D8JL 3LS4L 2NMSA 1MJ8L 1IC7H 2OTWA 1DQMH 3ISWA 4CMMA 2WBJD 1VGKB 2A6JA 1AGDB 4Z77A 4KHTH 4MX7A 4KTYA 1S9KC 3VWJD 1CFNB 2K3TA 4MNHA 4NNPL 1TFHA 4JPVL 5ISZE 3VXMB 4H0HB 3WFDH 3PHQB 5D1ZA 5CBAA 4OUUB 4XRCB 1NJ9A 3VDAA 3ZKND 2AXHA 2KQMA 4MJ5B 2VXUL 2XWJA 1RK0B 1I1FB 2O61A 3QUZA 4LLWB 3O3EB 1H5BB 1R0AH 4DVRH 4P4RA 4KZEH 4K2UL 4RMSA 4GG6B 1L0XA 3U48A 1L7IL 1HH9A 5E99L 3GMMB 4PG2C 3V4VL 3DRTA 3O6FA 1O7SA 4EBQL 3LQAH 5F7UA 5IMOA 2Z0BA 1ZSDB 3BEWB 1AR1D 3MRPB 5FUOL 1SEBB 5IVOA 5DDHA 1QFPA 1JGDA 2XI9A 2BRQA 1GPOH 1RUKL 4ZFOL 1QTYT 1H3TA 1WWBX 3GBMH 3QDMA 4GAJL 3DSFL 4U1KA 2GUOB 1HKFA 3UZEA 4CDGC 5JA9A 4CVZB 2PTTA 4WV1A 3B9KC 2R0LH 4OLVL 4QYOA 2X9WA 4HQQH 5I9QC 1QA9A 1NLBH 5GS2H 4EN3A 3QIUA 3RNQA 3IDGB 4JFHD 1HHIB 2J8UA 1FFNB 2FX7L 1ZLVH 5I8KL 3GMNB 2GJJA 2X4OB 2ZCLH 2CO7B 4KJYA 4LDOB 4NP4L 1CDIA 1S9YA 3R06B 3LRSA 5DD6A 5FHBH 1WEJH 4K3DL 1ZGLM 3GUTB 4Y1AE 4KQ4H 2HFFB 4JQVC 5J11B 4HGWB 4ZUUB 1P2CB 4DN3L 1DR9A 3P0VH 1CU4H 3MGTB 3DETC 4EN3C 2WWMC 3G6JF 4ZMAT 1JNNL 3QXAA 3FQUA 5TGBA 5ISZD 1FNSL 5JZ7C 2I9LB 4I8DA 1YY8A 2NY4C 1HH6B 3KYMB 5A2IH 1XGQA 3QRGL 1A5FH 1NGQH 1WIPA 1RJZA 4KK9C 1B0RA 1MJUH 3JV6B 1NGPL 4OZGB 1QD0A 1X5AA 2R2BB 3O6KL 5EFIB 2J6EA 3IU3B 1CQYA 3F7YB 3JWOC 3S35X 1J8KA 1LD9B 1IEHA 5EU6D 2XACC 1MJJA 4D8PA 4JRXB 4TSAL 2ENSA 5C6TH 4L3EA 3LKRB 3RTQC 3QQ4B 4I3GA 3PABB 1KJ2H 5HHXL 3HE7D 5DFVD 1MCLA 3S7GA 4L4TA 3IFNH 3L5XH 4NOBA 3QPXH 4NQDA 4GJTB 1OWRM 1VGKA 2A6JB 4NC0B 1FPTH 5FOJA 5DJ6A 4HXAL 1VADA 4DUVA 3RX8A 2WWKO 1N4XH 1S78D 3CSYA 1Q72L 3EYFA 4OTXH 2IQ9H 5HYFA 4TUKL 5JUEH 1CDJA 2DI7A 4HS6B 4HD9A 1WV7T 3D0LA 3RDTC 4NWTH 2P1YA 4J4PA 1IAII 1G1CA 2HVJB 5IB3B 2AEIT 1UCBL 3CFBA 4I4WB 3WYRA 3TO2A 1CXIA 2VLJB 3EJZC 5GPRA 5ACZA 3DLQR 3D3VA 5I0DA 3O2VL 1ZXQA 5B3JE 4M61A 1CD0A 1T66C 1RJCA 1YEGH 3M8OH 2BSRA 1BPVA 4L4TB 3SDAB 3GSWA 4MD4B 4XMLL 5T1LB 4ZQKA 2XWTB 3GKZA 1OY3B 3VH8B 2CGRL 1L4IA 2KBGA 1J8HB 3UO1H 4ONGL 3OQ3B 2ATPA 1F97A 3HG1A 5KN5A 4JLRA 3HPLB 1I4FB 1DE4A 3MV7D 1SM3H 1OVZA 3BJ91 3WS3B 5F7LB 1QSFA 4WFHD 3CFDB 3L9RB 5CEXA 3MRDA 2GSIA 5ESVB 4O02H 1IGCH 4UAOC 3QA3B 4QOKA 3RTQD 3QUXD 1UEYA 4OBRA 2A6KB 2MPAL 4JRXE 1V3LA 5CP3H 2UUDH 3DXAB 4MCZA 2YA2A 4O51B 1H8SA 4R7DA 4XAWL 2X1WL 1K6QH 4F2MB 2AGJL 5IFAH 3R1GH 1YECH 3VJ6B 2J8HA 4ZFZA 4HKBA 3L5WB 1E6OL 3OAZK 3DYMA 3F7RA 5BCAA 2G2RB 4M3KB 4NN6B 5AYUH 4NCC1 3VGDA 3WXWH 1TTUA 2JCCF 2AXGB 5HJ3A 3BGFB 9CGTA 2BNRA 4XVSH 4ZS7H 5T3ZL 1A1NB 3O6MH 3TBWA 3KGRA 1SEBA 2AJUL 1F4YH 3CVHB 4G42A 5I1EL 3QXVA 4RAVB 3MSPA 4M8QA 1WFUA 3WFEH 2KL6A 4UQ2B 1HE7A 4K71B 4NO0D 1FBIL 3DRTB 3BUTA 3O6FB 5D5MA 3FB8A 3OAZH 4RMVA 4I3RH 3O9WC 1JPGA 3TGXA 2R0WH 1VACB 1Z6JT 5F7EL 1DBAL 2WUBL 2YS4A 3FN0L 3TBVA 4RZCA 4F7TB 2PW1B 4PJGB 5EIQA 3VD5A 4LP4A 4JM2F 4LPWA 2IH1B 3GMLB 2FL5B 3FQNA 5JA8B 1MWAA 1T1WA 4LARH 4LOUC 3QUZD 1Z9LA 4ODXB 3OAUH 4X0KA 4XPHH 4Z77B 1MCQA 5DEGB 1CL7H 3RWEA 3FT3A 2LU3A 4U7KA 4WWKA 1IGTA 1EO8H 3RZCB 4U31A 5GISH 3INUL 1UA6H 4TTDD 4XPBL 1M4KA 2ZUUA 4PG9A 4RRPA 3VDCA 5CJXC 4E5XA 2W92A 2ATKA 3L3HB 3C60D 3DYPA 4FFYL 4XT1C 2Q86B 3W5MA 2X4UB 1RIVH 2VZ1A 1B4JL 5I71C 5F89A 4NKIL 3LKSA 3BMWA 2K7QA 1LDPH 4OF0A 4MJIE 1RD6A 5DJAB 5F7NC 2GK0B 3DGCR 4G8GA 1MHEB 1DQDL 4OLYH 3PWLA 3SDCA 4MJ6A 4HAFA 5FM5O 4JHBA 4ZNEA 2XZCH 4X6CB 5MENE 4UDTB 4NKDB 3CSGA 4MHHI 3DVNB 3K4AA 1R24A 5D7JD 5BV7L 5TQ0L 2UZXB 1U2HA 2QQNL 4HDIB 3S5LG 5F9JA 5HHVL 2I25N 4JRXA 1FE8L 2OL3L 3EO0B 2EYSA 3MJ7A 4LF3B 5FO7B 1XR9A 2YPVH 1BZ7A 3H0TA 5L2KB 4D0CA 5F7DB 4PP1D 1T2QL 1XR8A 5JDSB 3TBYB 4C56B 3C5SA 2DKUA 2P5WD 3DX6A 4AYFA 5JO5A 1D5BA 3HG1D 2JIXA 1WAAE 2IFFL 4F7CA 1S7TB 4YHLH 1SJEB 4RBPK 3S37H 2VDQH 4YHOH 1XZ0A 3FB7B 2R23B 4JJ5A 3MV9B 3RWIA 5J1AB 4X8XA 1DLFH 3NFNA 3CFDA 4LKXA 3SCMC 4LMQE 1OAQL 1L7IH 3O41B 5DO2D 1IQDA 4HGWA 2VDKL 4ZUUA 4MDJA 2D7MA 4JQXC 3KG5A 3L95B 4X8JB 1CXLA 5ACMA 1I8IB 1Y6NR 3RIFK 5AZ2L 4TUJB 4Z7WB 1FNSH 1KIRB 2X2YA 4CGTA 3U83A 4RMTA 2YUVA 1GGCH 1KYOJ 3ARYA 1S7WA 3CFKB 2NTFA 4LPVA 3RVUD 2PN5A 3MXWL 4PUBH 3GJFA 4JO2H 3VRLF 2EYTA 1TJGL 4NNXB 2QBWA 1I85A 5IWLC 1IAIH 3GM0A 1XGPA 4GBXD 3WNNA 4P4KB 3GSWB 1NGPH 3SDCC 5F7HA 4BH7B 1URLA 2W60A 4NM8H 2ZOLB 4BA8A 4OCYH 2G60H 4IMKC 4P5MB 3MV01 1EDQA 5BJTB 5B39B 4YDKH 3KPSE 4NJ9L 3CFEB 5ISZB 3LSOB 2HT2D 1DBBL 4R3SB 4OF5A 1LK3L 1SQ2N 2EZ0D 5ALBL 1KJ2L 3RVVD 3SJVE 4Z7WA 4HC1L 3DMMD 5C0DB 4ODVL 2D4FA 1OTTC 1FDLH 3UX9B 4F8TA 5ITFB 4YAQA 4FQQB 4X6CE 1WZLA 4GXUM 1L9MA 4XCCH 1XGUB 4NUJA 3L7FB 2EDJA 5I17B 1T7WA 5E8OA 2QHLA 2VUOA 5IQ9B 1VFUA 3BEWA 5J12B 15C8H 2X4PA 1S8DA 3HE6D 3NN8B 4GG6A 1WCBA 1E6JH 4NWTL 3TT3L 3P4NB 5CINH 5TPWH 5MI0C 1EEZA 3RVWC 1BLNB 1U6AL 1TITA 3TH3T 1OAYL 4CADB 5AWNH 4LOUD 5JW4N 4OZIE 3QCTL 1NCAH 1UZ8A 1V8HA 5JHLL 4BKLA 2C3GA 5TDOB 4K3EH 4ELKA 3O2WH 3O9WA 5EWIH 4OM1H 5TQ0H 1ZS8A 1BIHA 3UAJD 3T3PE 1V7NL 3ZE1F 3MBEA 3HZMB 5D1QD 3I84A 3BFOA 2FX9L 2XIDA 3PGFH 1XGTA 3MRJA 3EOAB 4JZOA 1QVOA 5EUOE 5E2VH 2ZJSL 5E8PB 4OZHB 4KVNH 3RKDD 3IJYB 2ADJB 2PW1A 1I7TB 1OP9A 3CDFA 4Z5RA 2QQKH 3U0TB 3U6RB 5DJ0A 3B2UC 4PTUA 4O5LL 1SBBA 2IH1A 5F88B 3LS5L 2MCG1 4G8GD 2W59A 4HC1A 4MAYD 1BD2E 4J8RA 1NDGB 4U1JA 3HMWH 4KKCD 5C0CA 2ZZUT 5JLZB 5D7JA 3FT3B 1S7RB 1WAAF 5DT1L 2WUBH 1DN0B 3PP4H 5DRXB 2OZ4A 4HLZG 3QIBA 3RWJB 3CVHA 4G42B 1MSPA 4G5ZH 5CWSB 1DDHB 2O26U 3NH7L 2FJGA 4N0UA 3DOSA 4NM8L 5MEQB 4PJEE 2YPKB 4W81A 1YMHB 3C9NA 4U3HA 1NEZA 1SVCP 4PJIF 25C8L 3ARQA 1X5LA 4JB9H 4WO4A 1ADQH 3GMOA 4HC1H 3RGHA 4PGZA 5JOFA 4CL7A 4ONHA 4D3CH 4YHZH 4YGAB 3ZT6A 2G5BB 1U8MB 3TM6A 1ZKAA 5T3ZD 4I3RL 5J57B 3RNKA 5T1KA 1DLFL 5K9OA 1MI5A 5JPMB 1FQ9C 1ZVHA 3GZKA 1SEQH 1KTRL 1FORH 4JANB 4K55A 4PJAF 4CAGA 1CLZL 4MD0A 5CP7B 3VXSA 1YEHL 5FYJH 3GKWH 5D7LE 2NY3B 1K4CB 3G5ZB 3NMEA 3BIKA 4GBXA 4OF7A 2OP4H 4JFEB 5IUSA 4WUUD 3L3JB 4TVPH 4X5XA 3OF6A 3FQXB 4FFWC 4QXTB 2IAMC 3DX9B 3GSXA 1N59A 5IR1B 1EEQA 4LPTA 3WIHH 1YEJH 2G75B 3TP4A 4X9FA 4L8CB 3NABH 1A6AA 3ZDZF 4HGKC 1HXYB 3T4YA 3VH8A 4H8WH 3MBEB 3OX8A 1BQSA 2C1PB 5H94B 2OXHA 4R0LB 1A7QH 2IBZY 4CNIA 2VXTH 4M1CC 2NX5D 4LKCB 5KG9A 4M61B 5JORA 5CEXB 5DUML 3MCKA 2IAMD 4MLSA 1W0WA 4LSVL 3WHE0 2EO1A 2P46B 5E9DA 3EO0A 5HGDB 1D6EA 1OAZH 5EDXA 2LE9A 4Y5YA 1H8OA 3AU1A 1JGLL 4KRPB 4KJWC 7FABH 1NAMA 5BQ7B 4NUGH 1LO2H 4KK8D 2PR4L 4MSWB 4R4FL 4C56E 5EIIA 4HH8A 2MQ3A 3WEXA 1R3LB 4K94C 3STZB 1BVKA 1Y0LA 3TO2B 3QUKA 1AKJD 1RUPL 2P7TA 3RWHB 4D9QD 2VXQL 1HDMA 1T04B 5CS7A 1EERB 4GRMA 5HGDA 5FK9B 5IF0A 2HRPH 4J4PC 2AEPH 1MCDA 4FQQA 5EFIA 1T1XA 2X7LB 1V7ML 3EYOA 1IVLA 4XZUB 2WWMD 3DETD 4P9HL 3B9AA 4ORGA 1UH4A 5JOEA 1TTGA 3TYGH 1NFKA 4GS7C 4Z0BH 4JB9L 1N5YL 2JCCB 5DMYA 1ZOXA 2R2EA 3IFOA 5T3XH 1UB6A 1YPZA 3A6CH 3OXSB 1LEGA 4XNMA 4LRIC 4LCWB 5EBGA 2KDGA 1X5FA 5DXWA 5EPMA 5GQBA 5KVEL 2AERT 5HHQA 2XNAB 2UWEF 3QCTH 1JWUB 1NC2A 2ZCKH 1J12A 4I48A 3NIDF 2LU4A 3SKOB 4CRPA 1DCLA 5IK3A 4D8PB 1OARL 1JNLL 2DBJA 5IIEB 1KIRA 4X7TB 5DD6B 4I77H 4CMHB 3TPUA 1N7MH 1LP9A 2BDNH 3WNPA 2I07A 5LGJA 3BIBX 2CK0L 3E6FA 2VXVL 5CIPH 5E0QA 4WW2C 1QRNA 3QP3A 4OZFB 4WFED 4X80L 1FAKT 1I7RA 1MI5B 4IRSA 4AIOA 4PRNA 2R9HC 2CH8A 3MUJA 4G9FB 4S1SL 1IC1A 4P2QB 4EI6A 2A9NL 1QSED 4N1EA 4WO4D 5ILTL 3VGBA 5I30H 2WZPD 3U4AA 1BFOB 3ZTNL 4X7DC 4Y16B 4QRRB 4APQC 3H2WA 2CLZB 3ARSA 3T1WA 3PWNA 1IEAA 5F7WC 1QSFE 2HFGH 3LH2H 3LPWA 2ZOKA 1MHPL 3SDXA 5FA4A 3OPZH 4OQTL 5ANMA 3GBLA 4Y1AA 3W39B 3V4VH 4GKSA 3SCMD 5DJ2A 4K3DH 1NAML 4J3TA 5A3IC 1FG2B 1AE6H 1NMAH 2OQJB 4MJ2A 3E8UL 3KPPB 1HKLL 3DNKA 3O9WD 1IAOB 2BJMH 3TNMB 1MNUH 2NY6D 12E8L 1KIUA 4D9QE 3PWLB 3T2NH 5HVGB 3U36A 5DWUH 1YYMH 4X6EA 1TPXC 2Z4QA 2GCYA 1F3RB 1H3XA 4S0SD 2VITB 4X6DA 4QCIB 5IGXL 3BI9X 1JPFB 5DJ0B 2Q87A 1E0OB 1QEWA 1J5OH 3D39B 4HIJA 5C9JB 2B1HH 2NTSP 4OGXH 4DKFL 2ZOKB 1WBXA 3G9AB 3FO9B 4GAJH 2EZ0C 4JDTH 2BHZA 5D7IA 2HA1A 4LCCA 2ZJSH 5C0EA 2WP3O 5E2VL 1FV1B 4GH7B 1TZGH 3DPBA 4DJMA 3DTXB 3GO1L 4P57A 2XRAH 1U8IB 4KK5C 1SMOA 4M6OH 3QIUD 5C3TA 1LO5B 2F54D 5KTEL 1INEH 4DW2H 1MCWM 1H15B 3GK8H 5FXCH 4EI5C 3IXTA 2ZG3A 3U2SA 4F3FB 3D87B 1MCPL 1P7QD 2F19L 3BT2L 4M5ZL 5F21B 3QISA 3HZYA 4IRSB 3MRRA 3SDDA 5KVDH 4Y4FC 4F33B 4NQSA 4XXCA 1XF2A 1FLTX 4PREA 1P6FA 4JFPA 2F74A 2XN9B 4S1QH 4Z0XB 1I9JL 1OWWA 1MCNA 4PLJC 1LEKA 1K5NA 1N6QL 1G7HB 1DQQA 3SBWA 4TQEH 1AGBB 1E6JL 1FZJB 4BSVB 1GGIL 4X99B 5CILH 2JB5H 5ISZA 3UEZA 2N1KA 1MUJA 1WJ3A 4LSTH 4RAVA 4WFFD 1K8DA 1LO0H 5M7QA 5HHQB 1UZ6E 1C8PA 2BCKB 5DC9B 5I8CB 2VABB 1CLCA 3QFDA 5KSAA 1RU9L 1CIDA 4TVPL 2CRIA 4DOHE 3FT4A 1XT5A 4UAOB 1UB6B 2YR3A 2F53E 4NDMA 2XPGA 4MXWL 1JHLL 4OCWH 4A6YH 2JJSA 5CGYD 5T3ZH 1FZOA 4G3YH 1LILA 5F1NA 2QQQA 2UVEA 5EBLB 1G9MC 1J0ZA 3MOBH 3IDNA 3KPOA 1T0MB 3DVIA 4LHUB 3S37X 4CVUA 1CGXA 4OJFL 3LD8B 1C12B 5ETUA 3HE7A 1Q72H 5E2UL 2WIIB 1MLBB 1KGCD 1RFDL 3MGAA 3MV9A 1R3IL 3DVFA 4GAFB 3BZFB 3STBA 4HH9B 5F3BB 5JPMA 1F4XL 3BESR 3HE6B 1WFTA 3STZA 4JQIL 3MJ9L 4RFOL 4WI3A 3MRQB 3FB5A 1CN4A 3TVMC 1FO0B 2H3NA 5JOPE 4NQCE 4JFYA 3LV3A 4HH9A 1PQZB 1QRND 1YMMD 3IDNB 5HHME 2GSIB 5GGUA 4AMKL 5KSAC 4ZUSA 4I5BB 3DRQB