4HZAA

Crystal structure of the immunoglobulin variable domain of nectin-2 in monoclinic form
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
124
Chain Sequence
MQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poliovirus receptor-related protein 2
publication title Crystal Structure of the Immunoglobulin variable domain of Nectin-2 in monoclinic form
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 24
structure length 124
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzaA00
1B4RA 2IANE 3DIFB 3VU2A 1RMFH 1TCMA 3TPKA 3QHZH 4M43H 3QUXD 1EGJH 2UVEA 1NUNB 2J8UF 2X6MA 2E5EA 5IMOA 1UJ3C 2DICA 4NKOB 2PXYB 4FQ1L 3VXUB 3OXSA 3SDDA 5FM5O 5DA0B 1HK6A 2Z4QB 4LVHB 3IFOB 1MFCH 3EIFA 5EA0L 3G6JA 4DQOH 2RIKA 3EFFA 1JVKA 1KJ2A 4WI7A 1XGQB 3ARDD 3HI6H 5SWQA 2N7BA 4U1NA 3TA3A 1HYSD 5GRYA 5HPMA 4PV8A 3QFDB 1K4DA 2HRPH 3V6ZB 4NFDA 2X1WL 3ES6A 1IBGH 2VLRE 1NMAH 4N0CD 2VC2H 1KNOB 2D4DA 2BNRA 4JO2L 1P7HL 2EDEA 4M3KB 3REWB 1HKLL 4JM2B 3T3ME 1CVSC 4X6BB 4WWKC 4LOUD 4ZTOH 4U4BA 3RVWC 1F6AB 1VERA 3ZKMC 4F9LA 1NANI 4Q6IC 1A5FL 1Q0XL 1S9XB 1EXUB 3SCMA 3SDAB 1KIRA 2HTKC 3KPQB 3D0LA 2VB5A 3D3VB 4D0BB 1NCDL 2A77H 3HZVB 2CPCA 3E8UL 4FQXD 3RP1A 4F2MB 2FBOJ 5F72S 1YEGH 4QHMB 4UDUB 4P2RA 5TDNB 3HC3H 5HJ3B 3I6GB 5ESAA 2IBGA 4M7LT 4ONFL 1I4FA 3P11H 2EYSA 4HGWB 3GSQA 1YPZA 5F9OH 4DFHA 2PO6B 2COQA 4F15C 3TH4T 1YEJL 5I1KL 3OWEA 2OXHA 3HC0B 2AXHA 3MV7B 1FLRH 5CHNA 2UYLA 1JMXA 3UPRA 2PW1A 4K23H 3PABA 5E8DL 5SWZD 1OQXA 3QCUL 1WBXA 2CRYA 3KPNB 5JUEH 2R23B 2YPVL 1YQVL 2E27L 2DOCA 3LQZA 4KRPB 2EC8A 4Y5VC 5IEHA 5DJYB 1WBYB 5D5MA 2D7MA 3ARGB 3HMXL 1I75A 2A6IA 4APQB 3MLVL 4NNYB 3ECBB 4NN5B 4HUXA 3U7AA 3BPCB 4QXTB 4H25A 4RWYH 3ZYZA 1HHHA 4X7SL 1Q1JL 1CBVH 2P5WA 3KWWA 3NCYP 1MWAL 1Y18A 1D9KA 4CNIA 1SYSB 4F7PA 5DMYA 5F9JA 5E4EB 3T4YB 4Z7UB 3TNNA 5EZOL 3MRIB 1FJ1B 4WWID 5C0CB 5B3JF 3BX7C 4MZ3A 3T65A 5CP3H 4OLXL 1OTTD 3NZHH 2WUBL 4HWZB 1J1XL 2IQ9H 3EJZC 2V7HA 5EU5A 2GT9A 1P7QA 3S9DB 1S7QA 1S5IH 1K85A 2F54D 1C5CH 4ZAKD 5C2UB 3X11B 3TT1H 1OLZA 4RGNB 2FX7L 1EZVX 5I6XB 3O6MH 5I76A 2AQ2A 1U8PB 1A7RH 1WIUA 1NCUA 4N8CH 4HUWB 5EPMA 1KXQE 2VXQL 4OCYH 3C8KB 3G6AB 3TT3H 4JPWL 1TQBB 1I8LA 3FN9A 3MOQA 4L4VD 1YNKH 3DX9A 3ZDYF 2CMRL 2JIXB 2VISB 5F1IB 4PRID 4ZFGH 5DUML 3IB4A 4HAGA 4TUOB 1XR9A 5GISL 1IGJA 5GGQH 4PY7A 1EJOL 3OAYK 4S1DC 3S34L 1TNMA 1I9EA 1FQ9C 2X1OA 2R8SH 2Y6SD 3GBNH 4KU1A 5AZEL 4Y4FC 4I18B 1KLGB 1RSFA 4WENB 4NWTL 5E8NB 4MJ5B 4Y19D 3QEUB 1R3LA 3SBWC 1ZGLM 5ICXA 1IMHC 2BFVH 2I27N 2YUXA 2CLVA 4QRSB 3AVEA 4OBSA 1CFQB 2NXYC 2VERN 3MJ9A 2NY0B 2X4PA 4XVTL 4FG6D 2R9HC 3VA6A 5IKCA 1OAXH 3ILQD 3OSKA 4MD0A 4Y4HC 4NRZA 3C6SB 1HHGB 4I3GA 1HQ4B 4KJYB 4PB9H 2LVCA 5FKAA 1IM3B 3VXTA 2X10A 5JNYA 2YC1B 2ZSVA 4K8RH 4IS6B 3GSNH 5DK0A 1MRCL 5C0BA 2R69L 3I75B 4HWEH 4G9FB 1CK0L 2OK0L 3ALPA 4I5BB 5CINL 5I1IH 3FT3B 4KROD 5D1QB 4GAJH 1ZA6B 2NX5E 5F8RC 1BECA 3LMJH 4RFNB 2IALA 4KK9C 2OLDA 4PJAF 3EGSB 3EJJX 1G7IB 4UI2A 4FQIL 3MRRB 2NW3A 3QG7H 3RBSA 3PF2A 1P6FA 4E5XA 3HUJB 4WV1C 5C0AA 3C09B 1OSZB 5L0QB 4P3DA 3CXDL 4KDTA 3IJHA 4XNYH 5DI8A 3BW9A 1FORH 4YFLF 3PWJA 5FYJH 3ULSB 3QIBC 3TV3H 2VABA 2YA0A 4AH2B 4JHZA 4QWWC 5BCAA 3MXWL 3CVHL 4MAUH 1WCBA 1D5ZA 5LBSH 2A83A 1IT9H 1MCEA 2D0HA 3UEZA 4PJFA 5DJ6B 1GOHA 3O6FB 4JG1L 4TNWK 3A6CH 2IQAA 4KVCH 2OTWB 3ZTJG 3E2HC 5C7XL 4OD2A 5JOFA 5TGBB 4F8TA 3ARSA 4OCSH 2Z8WC 3JWDC 1MFAH 1NQBA 5IK3B 5DQDL 4X98A 3R1GH 1R0AL 1VEPA 4HJJL 3Q48A 5T5FH 2V2XA 2ZOLB 4QO1A 1MVUA 4OLUH 4IRSC 2B5IB 2Q86A 3OX8B 5BOZG 4XAKD 1HDMB 3VGAB 4NKMB 5BS0A 1FO0H 3ABZA 1NGYA 5IOPB 4OGXH 2YZ8A 2ADFL 3QPXL 4G6JH 5C9JB 3ROOA 4JFHE 3STZB 2F53E 3IAGC 4JG0L 5AG8A 1CGUA 2FATL 5IB4A 5K9JH 4LSPH 3GBLA 1YDPB 5K33A 5M7QA 5B21A 2OJZH 3VD5A 4EN3D 3QZWG 4M7KL 1NBYA 1MY5A 1CDJA 5DHXB 1I7ZA 1NL0L 2ZUYA 4JPIA 4XVUD 5TH2B 4AYFA 4F7TB 1S3KL 1R5WA 3MUZ1 3T0EA 2IAMA 4FQJL 3VFWB 4KTDL 4IMKA 4BH7A 2OR7A 1LEKB 3H2WA 4HWBA 3OQ3B 1OSPL 4CL7A 2WSKA 1UM5L 3ULVF 5EZIL 1NC2A 5JDSB 3OL2A 2QQQA 3JWOL 5BV7C 3FHAA 1T6VN 1QBBA 4P99A 5DGRA 1BQHA 1U8OA 5C8JB 1RZJC 5DRWA 3UJIH 2AKRB 3T3PE 3BGMB 2H3NB 4K8RD 5E99H 5DRZA 5BOPA 2BOCB 3O8XA 2CJUL 4HV8A 4Q74A 3BQUA 5HDBE 1NCBL 5CJ5A 2HFGL 4G8GB 4L4TE 4BK4A 3RWIA 1VACA 5ICZA 1N5YL 1P4IL 5H37H 3BHBA 1U8IA 3QAZC 3WJJC 1G7LA 3KPOB 5C09B 2F58L 3IU3A 3MBXH 2XA8L 3NFSL 3IFPB 2ADGA 5ISZA 4JFDE 4BSJA 4KV5F 4ZXBA 3O4LD 1ZHBB 4CVZA 3MRLA 5I0ZA 2D4FA 1DQDH 1NCWL 2R0KH 3LD8C 4IDLA 4Z18A 2K3TA 4TSBH 3QWRA 5C0EB 25C8L 4OQ1A 5FO7B 3UP1A 5IFJA 2XT1B 5FYJD 3V5DA 4GFTB 4KY1L 4LCWA 4NC1E 5D7JB 5DJAB 1ZLSL 1EFXB 4XC1L 1CS6A 4C55A 3S37X 1QFOA 5FECB 1W72B 3VXUA 2V17L 1KTKE 3NACH 4R7DB 5CJ8A 2APWA 1I1AD 3RRQA 1BIIA 1FGNL 5JOPE 1DBKH 2A9NH 2G2RA 4FTVD 3VJ6B 5T3ZL 2AJUL 3C60C 4JQVC 5KN5B 4O4YH 3D87B 2D03L 1KIQA 1DQTA 1D5MA 5CILH 1KEGL 1K8IB 1NFIA 4HMDA 1KPRA 2Y06L 5F1NA 3JVGC 4Q9QL 1KNOA 2C4XA 1ND0A 1OTSC 3U4BH 2WBJB 43C9B 4JRYA 3UJJH 4MNGB 4X5LA 2NCMA 2DBLH 5DFVD 4NFCA 4JM2A 3RY6A 5F9DC 5HI3D 2MPAL 5EFIB 1GC1C 4UQ3A 3VWKD 5IGXL 3GSVB 3V6OA 4LKCA 4G43B 3JTSA 4WHCA 4S1RL 2B39A 1AI1H 5IF0A 1A6AB 4MNHA 3KPSA 1EXUA 1MCNA 5KVGL 3DO7A 5B22A 3B9KD 3KPQA 1INDL 2EKSB 1DN2A 1A3QA 3K8LA 1HSBB 5F8QC 5HYQA 2Y1VA 3WUWG 5FHBH 4GRMA 3I6GA 5IBTL 1FN4B 3C5ZD 2GSIB 4OZGE 3V0WL 5FO9B 1WF5A 1LO2L 2LU4A 3NAAH 3PDOA 1KT2B 1QTYT 4HLZG 4FZ8H 2PTTA 3MV7A 3AS3A 3ARFA 1LP9A 4XCCH 3D85D 2IBBA 4Y2OA 3V4UL 4L3EB 4BSVB 3HN3A 1RV6X 1JCKA 2EYRB 5DRNA 1DCLA 5IB2B 2R23A 5FK9B 2E8YA 4WCYH 3MO1A 2AK4E 4PRHD 1M7DB 5I1GH 5L2KB 4I3RH 1DSFL 5ERWB 4X6DE 3QO0A 3ARGA 2W0FA 3RTQD 5I1AB 3K4AA 2VDLH 4NNYA 4UU9A 3T0DA 2BOBA 3ECBA 1N3NB 4QXTA 4YUEH 4OB5L 1HH6B 3HG1E 3INUL 1NGQL 5DURD 4LSDA 1AE6L 2DL2A 1AQKL 1SYSA 4P23D 4AT6B 3IDYC 5K9KB 2A38A 4Z7UA 3MLYL 4XP5L 2FL5A 1FJ1A 1IGFL 1JGEB 2H1PH 4W68A 3W2DL 1VDGA 3L1OH 3HE7A 4NQEB 5D71H 4G80A 1QBLL 3J7HA 4HWZA 5BQ7A 5FUCC 2RR3A 1A6PA 4DGVL 3RAJL 4YXHL 3QUMH 4XZUA 4HMEA 4XB7A 2Q3AA 5LWYL 4XP1L 4E42B 3F7PC 4PP1C 4L4JA 3B3IA 4KI5D 3G6AA 3QEHB 1WBZA 3LY6A 2Z8VC 3MRPA 4KJWD 2JIXA 1VA9A 2A74B 3FRUB 1DVFD 2OTUA 1FYTB 2X9YA 1XAUA 5GHWL 2ZG2A 3WKNA 4XVSH 2NY4D 3QISA 4BJLA 5E8NA 2X7LB 4MJ5A 4HIJB 4GRWF 2AGJH 1B4JL 4N9OB 5ITFB 3HNSL 3UROR 1CFQA 4D0DA 5FHAL 1WV7T 1MAML 5FKPB 1YN7B 2JK5B 5J06A 3BKMH 4NWUH 3VFGL 4NQDE 3MGAA 2QSCH 4KJYA 3L3DB 3GJFK 1IM3A 4KUZH 2X2YA 5KJRH 5JDJA 3JZ7A 4UTBH 4UUJB 4H20L 4LSSH 4K07A 2XQBL 3S3PA 2APVA 3GSOB 4QRQB 2OR9H 1OPGL 4KKCC 3IAPA 2DQHH 1JRHI 4I5BA 4LF3B 4C57C 1UA6H 3G04B 3S88L 1GIGH 3QUZB 4UZGA 4X5XB 1QFWM 2DQTH 2HFEB 4IMLB 1ZA6A 3O6LL 4LASL 4JFOA 2DDQH 5KVDH 4X5WA 3RUGE 3UTZB 5HHPB 2G9HB 2FGZA 5F3HA 3EGSA 4KKBD 1G7IA 4DN4H 2XQYG 1SBSH 1KTLA 2FYYB 3T0WA 4WUKH 4PRBB 3GBMH 4DW2H 5CJOH 5CSBA 3PL6C 4ODWB 1RUQL 4D9QD 5JW4Q 2VH5L 5CD5C 2ENYA 4JQXC 2PYEE 5C07D 4CN1A 1DQJB 4MNQE 1Z0NA 4YWGH 3MMEB 3O6FA 3WS6A 4TOYH 3D0VA 4OD3H 1MLCA 2XNAB 4TQEH 1KEMH 3MBEC 1K6QH 3AS2A 2MQ0A 2I60H 5TGBA 3EDJA 2W60B 3MJ8A 5EOQL 1UFUA 2XFXB 1GGUA 1IILE 4GW4B 2UWEE 3L3HB 1HYRC 2J7LA 3K2MC 3SDYH 3SHSA 4K7FB 4RNRA 4U1KB 4YPGA 4QNPE 4BFIB 2BHUA 1S9KC 3O3EB 4M02A 1KBGH 1FNSL 1DEEB 3X3FH 1HDMA 2VLRA 1LK3L 4K2UH 4NKMA 1FIGL 2DD8L 2VLJA 5DJXB 1FNHA 5CZVH 2ENSA 4FQCH 3QRFM 1V7ML 3CZFB 5MEOA 2OP4H 3WIHA 4LQFH 3KXFB 3LH2H 4Z7WB 3HRPA 4G6FB 5C9JA 4GRLC 1SHMA 5EZJA 1QSVA 1OAQH 2N7AA 2BXZA 4MMZC 1YDPA 4P2YA 1BD2D 3Q6GH 3ULVL 3PP4L 4DVRH 3A6BH 2ZNWA 1NBVL 5E6IB 1OAKL 3T2OA 5JMRA 5L8LB 1HH9A 3GSWA 3IU4H 4AENB 2C9AA 1T83C 3VFWA 4G6KL 1K2DB 4YHZL 1JHLH 5TPWL 4LHUA 2BZDA 1CR9L 2R4RH 5T1KD 2VQ1A 3GB7B 3NA9L 1PX4A 4OQTL 2CKBA 3IF1B 4NSKA 4FP8H 4WWKD 2HLAB 2MSPA 5CSGA 4X4YA 1U3HB 2FIKB 3VWJA 4G8FA 3VXNA 3SE9H 3ZKMD 3CLEL 2P5EE 3WNMA 4HC1A 3PWLB 1MQKL 2HTKD 3KPRB 1J8HD 2H3NA 5KVEL 2P43B 1RUAH 1A21A 4P5KA 2YD7A 1BOGA 4KZDL 1I1YA 1E4XI 5DVLA 1Z5LB 4BZ2H 2R0LH 4EXKA 1EVTC 1C5BH 1E4KC 3EKCA 1B0GA 4Z0BL 5C09A 4YXKH 3IGAA 5CCKH 1MPAH 4TTGA 3QFJD 3VRJB 5CEXB 4UTAH 1GZPB 3MRFA 2D9QB 3QUYC 1Z3GH 4ODVL 2QBWA 4Y8AA 3RWGB 4NM4H 1EV2E 3V5HA 4ZOEA 1CFVL 5HDOA 1ZEAH 5C0EA 3RGVA 4P2QB 4DOHE 1AHWC 5D7JA 4K3EH 1EFXA 5SV4A 1SY6A 4K55A 4U6VL 5FECA 2RHEA 1OAYH 4ZODA 1QO3A 3UC0H 5DUBB 3ROLA 4MCYA 1IL1A 4JFED 3X17A 1MVFA 2J2ZA 3U0TA 2W0KA 3GNML 5I1JL 1ZAGA 4HD9A 2YD6A 5KSAB 1QRKA 2CO7B 5KN5A 2IADA 4H1LB 1WC7B 1MCBA 1NJ9B 4JPVL 2B20A 1K8IA 1XGYH 4F58L 3AMKA 5GSRB 2Z35B 1QACA 2ED9A 4S2SA 1KIPB 3H9SB 43C9A 2B0SH 1K5NB 3TA3C 3BP5A 1QEWB 3EJZD 5GRXG 5DVNA 1BFVH 5EFIA 1RZGB 3GSVA 3JWDH 4XWOC 3ZE1F 4G43A 3QXAA 2ITCB 3ETBF 1HI6B 1A6AA 3MACL 1J1PL 4I48A 4Z77A 1JYXA 2Z31A 4XPTL 5B3NA 3H9HB 4U05A 2XZCL 1OY3B 4BYHA 2WIMA 5F6IB 4NQVA 4OAWA 3OAYH 2VIRB 3PWUB 1HSBA 1TPXC 2GAZB 4QXGH 5JZ7C 4HG4K 3FO1A 3I6LD 1FN4A 4S1DD 4OZFH 3ZL4L 1TCRB 1TVBB 3HFMH 2IFFL 4Y4FD 3SJVD 1DBML 3HPLB 2LQRA 4OLWL 4O9HL 2BSSA 1IQDA 2ITDB 1ZK9A 2QL1A 1ADQH 1C16B 1U58A 2J3SA 5D7IF 3FOMB 3CMOL 3DX7B 3D3VE 3WL9A 1MCSA 2VE6A 4NYLB 2NXYD 2YZ1A 3LRGA 2BC4B 4L1HA 3RNQA 4LIQH 4FA8A 3RU8H 2R9HD 1G1YA 1HCFX 2NY2B 4JDVB 4LLUB 4OCRH 5FK9A 5BV7H 4YDIL 4IRZL 1E28B 4Y4HD 3VG9B 1ZT4B 2VDRL 3GKWH 4L8SA 1RZJH 1UM6L 4AQOA 5I1AA 4QF1A 2QTEA 1UWEH 4X9BA 3FMGL 3T04D 5GS3A 2GJ6D 4JZJB 2R1YA 1KLFA 4A6YH 1KCSL 4PJHF 2YPLB 5F7EH 4H0HB 4ZSOB 1OTUC 4XAWH 2ZUXA 1QRNB 3WLBB 3O11A 4AT6A 4OCXL 1TQCC 1S9YB 5HXMA 3K46A 3WN5A 3NPSB 5IBUB 1YJDC 4U7SA 4KK9D 1JGEA 3V4VH 1ZLWH 1XF2A 4NFBA 1AO7E 4S0SD 3OGCB 3FQTB 4RMWA 1LO0H 4P5TB 1IC7H 7CGTA 1U8NA 1DBBH 1QLRB 5ID1B 4ZFFA 3QIBD 4GMTL 1S7RB 4J3OC 2FO1A 3CMGA 4QWWD 5J11C 3HI5H 5DK3A 3QO1A 2O26U 4M6NL 3QEHA 1P5UA 5D2NE 5GJSL 2Q76A 4JJHA 1M4KA 4RSVA 5KOVC 3V0VB 5C0CE 4L5FL 4QHLA 3BYYA 3PWVA 5CZXC 3VRLF 5D2LE 3S36X 4OI8A 2Q1EA 2QKIB 3WFZA 3LEXB 4NC2B 1FYTA 3CXHJ 2ATPB 3QQ3B 4YXLL 1VCAA 1LEGA 1MRFH 5JW5A 5JMOC 1CLZH 2FO4B 3FQNB 2X7LA 2R2CA 4HIJA 4Y2DB 1FBIL 1XIWC 3MLPA 4IRSD 2E7HA 1B3JA 3MRKB 3P0GB 4TNVF 1RJZB 2GK0B 1WVZA 2AEQL 3LVEA 3B5GA 4FHBD 3CAFA 4Q9CA 5FKPA 3Q5YA 4K7PX 4IJ3B 1KULA 1ZT7B 3CSYA 1GC1H 1X9QA 3CFCH 3VH8G 2AJXH 1P84K 4ZFZB 3EDDA 4N8VB 2AK1L 1NC4B 1I9IH 1QNZL 4JFQB 3LN4B 5E2UH 3NABH 1RULH 1S5HA 5DJZB 2JB5H 3QI9A 1AGBB 3PV6B 4UUJA 3MRQB 5IW6A 5C92A 1Y6KR 1CDIA 5CLTA 3LSOB 4UINL 3MLWH 4W6XB 1I7UB 3QUZA 4X5XA 4Y89A 1KCVL 3A67H 1RJLB 5KS9A 1MWAB 1MHPL 4PGBB 3UTZA 4JFFD 5HHPA 1OGAB 5KVFL 3ALXA 1FNEA 12E8H 4JFDA 1ZVSB 3BPOC 4PJ7A 4QTHB 2FYYA 3U83A 4PRBA 2DTMH 4XP4H 2Z92B 1H3TA 2ZUQB 3JV6A 3WDIA 3DVGB 3LIZH 5DYOB 2XTJE 4QRTA 3G5VB 35C8L 1UB5A 1SYVA 3KYKH 3D18B 3N1GC 4ODUA 4G9FE 4NBZB 4JR9L 4GSDL 1BGXL 5T1LB 1C7TA 4K9EC 5IJKA 4HUNB 2XG4A 1DQJA 5E1AA 1VEOA 8FABA 1P4LB 4KDTC 4NUJB 2CH8A 1VPOH 2EH8H 2XNAA 3I6KA 1NAML 2X1QA 4NZUH 2BJML 5IESH 2OL3H 5ACLA 2W9EH 2XFXA 5DEFB 3HUJE 4GW4A 4LRIA 1J5OH 3L3HA 1QG3A 1DDHB 1V8HA 3GMPB 2RFXB 4K7FA 5EOTB 4P4RB 2Y5TA 3UMTA 1FZKB 2WIIA 1A1NB 1WAAE 4PJ8A 1DEEA 1JE6A 4YE4H 3SE8L 5DJXA 3ZSTA 1K3ZA 4XNUL 1YUHB 1A6WL 3DUUB 3CFKB 2R4SL 1NMCC 1I8MB 2FEEI 3KXFA 2O5ZH 4Z7WA 2AI0H 3LS5L 3CFBA 1TJGH 3WXWH 1G7PB 3F6IA 4MQ7B 3C60D 5F6HJ 3P4MB 4Y5YB 3SOBL 5B4MC 5GJTL 1YY9C 3MRMB 2O93L 4LSTL 5C9KA 4UOW1 4QOKA 3HE6C 1NGZB 4CAGA 2ZJSL 3GIZH 4XMLH 4P59H 1OTSD 1DZBA 1GAFH 3PGDB 1DLHA 1C5DB 1J9CT 2QR0A 4R6UA 2Y36H 3PXHA 2IAMC 4QT5B 3FB7B 1OP3H 1KTDA 4OKDA 2I9TB 5IT2L 1U8QA 5D1ZB 4DN3H 2VSDA 5I8EB 1JYVA 3G5ZB 3KPRA 5TQ0H 1FG9C 2B2XL 4RA3A 4OF7A 1CGSL 4RA0C 4KMTL 1F3DH 4J7RA 3ZT6A 2FR4A 3QG6A 3TCLB 5CSZA 1ORSB 3OKNA 1DLFL 2SEBA 4LGRB 1CWVA 2AW2A 5FV2A 3DTXB 3CVHB 1YYLL 1ZTXL 2GHWB 3MODL 1S7XB 1NDMB 1T1YB 3VRJA 3ZKQD 5CEXA 3FRPA 1XH3B 3BQUC 3RWGA 1UH4A 5J9PB 1AXSA 4P2QA 2NPLX 3L5WB 1JTOA 4G8GE 4P5MB 3BJ91 4M43L 2R2HB 3N1FC 3CVIH 4AL8L 1KACB 4JGUA 5GZNC 4MSWA 3RHWF 4F37F 1FNLA 4HJGB 4KVNH 2X4SB 3ZYOA 5J6GB 2I9LB 1T7YA 2JF1A 4JQIH 5FYKU 4PRAB 1MFCL 4AM0A 1RFDL 4Y1AE 1HSAA 5I9QB 4HCRA 3CH1A 1E6JL 4TRPH 3WFEH 4H1LA 2PXYC 1WC7A 3UTPE 1NJ9A 2Y7QB 5DEGB 4LVHC 1MRDH 4DTGH 1PAMA 2A6JA 2Z35A 4UV7L 5FOJA 5GSRA 1AGCA 5INDA 4EXPX 3VE0A 5J6HA 3ZYIA 1A2YA 5IM7A 4LEOB 4DGIH 1KUMA 4Z0XB 3C8DA 2CLZB 5E08H 5HHVH 2YBRB 1R5IB 3SDCB 2VLKA 3BD3A 3EOBA 1C1EH 4PLKC 2ITCA 4J3XA 1HI6A 3AM8A 5F71A 3UYRL 5I8CB 3P30L 3NIFF 3P3YA 3BPLB 3MJ7B 5IVXF 1B6DA 1FNAA 4KI5F 4PP1D 5MENA 3H9HA 5GGSY 5GGUB 2D0FA 5FO8A 2VIRA 1WWCA 3PWUA 5DTFB 5ESVB 8CGTA 4G8EB 4XP6L 1BQLH 4HHAB 1KB9K 1IKNA 1M05A 4MNGE 5FM4A 3NZ8B 1HILB 2BNQB 5IMLB 3SDAC 1TCRA 4PJEB 1T1WB 3M8OH 2YD1A 3ZDZE 4KGLA 4Z78B 3WNOA 4TPRH 4B53A 1KV3A 4XVJL 2J8UB 4X83A 5F9OL 5TDPB 4JKKA 3VXSB 1VESA 1FVEB 1A22B 1C16A 3UTSB 4X4ME 4GW1A 1U8HB 1I1FA 1PVHA 3AXLB 4U1JB 3X12A 1A3LH 4U0QB 5B39A 3ZHDA 2BC4A 4J8RB 3KYOB 4NHUB 3WIIH 3PWPE 4WJ5B 3GJFH 3S8WA 2NY3B 2PO6C 4IDJL 5KZCB 3MNZB 4KAQH 3U6RB 3RUGA 5FV1L 5F9WB 3NFNA 3QDGE 2O5XH 1D6EB 4GXUN 4XCYB 5EBWB 1NGXA 2E6QA 5GGVL 1JP5A 1L6ZA 2Y07H 1AKJB 2MJWA 5J1SC 3FONA 3VFPB 3U4AA 5KW9L 3VFRA 4HKZB 4KKCD 4KRPC 3TBYB 4HS3A 4Z7QE 4L3EE 4AQ1B 4UIKH 3ARGC 1EEYA 2ICWA 1BJ1H 3KLSA 4APQC 5L8KB 4NN5C 2DLFL 2X40A 5L2KE 2E9IA 1TETL 5FA4B 2P8PB 4P4KA 4GBXA 4MCZA 2CGRL 4X6CE 4NQCB 3OGCA 3FQTA 1UACH 1L7IL 5E5UB 3L6FB 3CK0H 4C59B 2IPTH 3KGRA 5E4EC 2IQ9L 1OVZA 2UWEA 1TZHB 1Q9WA 3PL6D 4FFZL 4KDWA 2C4FU 4PTUB 4UV4L 1NLDH 3V5KA 3QNZB 5IB1B 1XF4B 5ID1A 2XI9A 1S5IL 1S7RA 1MIML 5CD5D 5HYSB 1CGVA 4XBPA 1F4XH 3FZUC 4GG8A 4V1DB 3O6ML 4PPTA 4YIQA 1MHHB 4R90H 5DHYB 1MFEL 1BBDL 1TIUA 3TT3L 3MBED 1T4KA 2IG2L 4NQEE 1KFAH 5D4QA 3NCFB 4U1GB 5I6XC 3EJYC 2ATPA 3QQ3A 2P24B 1F3JB 3S37H 3DSFL 4F7EA 2G5RA 2NTFA 1UCTA 5HHNB 2FO4A 1NBQA 1MREH 3CD4A 1TQBC 2VDKL 4PJ5D 5LJYH 1CL7L 4Y2DA 3MTRA 4JFHD 1EHXA 4PJIB 2F53D 3MRKA 1QSFD 2OCFD 1RJZA 1ROWA 3D69B 5IMKA 4RCAA 3ME0A 2XOTA 4NNXB 1CXEA 3FL7A 5E9DB 2Q8AL 4EOWL 1ZS8B 3QEQE 4GRLD 2ZOKA 3MV9E 4I18C 5E00B 1ZT7A 3BT2H 5DDHB 2CRMA 3QIWA 3QJHA 3U9PL 5C0DB 3MR9B 4ZFZA 4N8VA 3SY0A 4DCQA 1GSMA 2OSLB 3L9RA 4ODHL 2EO9A 3D48R 4JFQA 2P5EA 1S7UB 1LO5A 5HHMB 3SDXF 3TBSB 4ZD3H 2NY0C 1AGBA 3PV6A 4WDIA 5EU7E 5LGHH 3B43A 4RFEA 3HMWH 5GRJL 3LSOA 4LLDB 3H3PH 3RWFA 1T21B 3NCMA 5IIEB 4PJDB 2PCPB 3VDAA 1BJ8A 1MJUH 1IM9D 4KHTL 2EDWA 4PGBA 1QBML 1K9TA 4GAJL 4P2OA 1RZ7H 1ZVSA 4L4TD 1F4YL 3LKOB 3T0XA 2GITA 4LCIL 4QTIH 5SX4H 5D1QC 1VFUA 3DVGA 5DYOA 1BVLA 1HHIA 5GGTH 3G5VA 4CN6A 1Q8MA 4RFNC 3CSGA 5F96L 4CMMB 4YX2L 1CLOL 5FYLH 5T1LA 4LLWA 1ZHKB 3QJFA 5L0QC 4PB0H 4P9HL 5EC2B 2AXFB 2GJJA 2WV3A 3X13B 5L88H 4JDTH 4RAUA 3QUYD 4FQ2H 4RMSA 4HSQA 5IEKB 4RQQB 5DEFA 4UBDC 1QR1A 4LNRB 4OCWH 1ZOXA 1DQLH 4MYWB 4DK6A 1DDHA 2O5YH 4QCIA 1F6LL 3O81A 3L5JA 3TC9A 3U30C 5FDYA 3O6FC 3STLB 3WS6C 2HKFH 1F6FB 4JHWH 5JOPD 4LLVB 1A1NA 4BM7A 2EIBA 1NFDB 2G75A 1MI5E 4BSWB 2EEDA 3DURB 1YJDH 3GZKA 1JPGA 1MIEL 1KJ2L 3DUUA 3HRZB 4OFYD 4WUUA 5D96B 5DJCB 1QLEH 1RHFA 2B1HH 1JPTL 4HBQA 2O61B 1REIA 4QXWA 1IGML 4NC0B 1TZGL 4MQ7A 5I66B 2B5IC 3EYUL 4OFDA 3P4MA 5H8DA 2X70B 1A7OH 4U1LA 1VEMA 3VGAC 4LSPL 3MCLL 1RUMH 1P69B 4WO4A 1F8TL 5HVFB 2I07B 1RUKH 4J1UB 4HMCA 1T2QL 3QNYB 1Y0LA 4PJAB 4YBLB 1C5DA 5FGBC 3QZWB 4FOMA 3GRWA 3TA3D 5EO9B 1MHCB 4XWOD 3WS3B 4QT5A 1NANH 2GKIA 3E6FB 3FB7A 4ODXB 2VDPH 4NO0D 5D1ZA 5I8EA 4JVUA 4JLRB 3LN5B 4MD4B 4OZIB 1H9VA 4QXUL 2NR6C 2BVPA 3P0VL 5DD3L 2KBGA 5HYJB 3NFPB 3RIFF 4UT6H 3P77A 1ORSA 4CJ1A 3PGCA 3TYFB 1ZE3C 3FQRA 1DFBL 2XIDA 4Y0GA 1MLBA 3D6GA 5H2BB 5I15L 3U82B 1T0MB 1NDMA 1T1YA 4ZUSB 2V2WB 5TE6H 2FH8A 3UTTB 2ORBL 4AMKL 1T03L 2AK4D 1MCHA 4Z7NE 4HBCL 2XZAL 4DFIA 1SM3L 4RMUA 3WSQL 3L5WA 5FYLD 3WKML 1U95B 4U7MA 1DUZB 2H8PA 2R2HA 2JJTA 1S8DB 3HG1D 3GIVB 2DMCA 4HFWA 1G7JB 1OCWL 3ZKXB 1RZIA 4OIAA 4LSVH 5J56B 2DM7A 5KSVB 4GRWE 1AO7A 4PRAA 5D7JC 4R26H 3QEGH 2DQCH 3B2UC 3BKCH 3BKYL 1AXTH 2QHRH 5HGDB 2Y7QA 3RJDA 3OXRA 2DTSA 1OTUD 3GHEH 3GJEB 2R2BB 4IBLT 4K9EH 3K81A 3VXPB 4ETQB 1IZKA 4OLEA 5D2NA 5JW3L 4DVBB 4MJIB 3E6HA 1T1XB 4X9GA 5EU3A 1TENA 2W0PA 4XNMB 2VAAB 5C0IA 4Z76B 1A7QL 2MCPL 4DZ8B 5A2IH 5I8CA 1R3KB 3QH3B 3TWCH 3MJ7A 2WBJC 1BVZA 4O00A 2AJSH 2YUWA 4DUWA 2H41A 1P7QD 4OF8A 5ESVA 2GJZA 5HHQB 1MHEA 5BRZB 5CZXD 4K3DL 2XRAH 2R29H 2VXSH 3MZGB 1CXHA 2BNQA 3MNVA 1JZ5A 2DWEA 4GXUM 4ZYKB 2X4NB 1I8KA 2XN9E 4N0YH 2FZ3A 3WFDH 3MPCA 15C8L 1G6RA 5E1HB 3WUWB 2J8UA 1XIWD 5IFHH 3MJ9L 5TDPA 4NO3B 1FVEA 3UTSA 4RAHA 1F2XK 5IHZA 2IGFH 1U8HA 1KJVB 2W59A 4KGJA 3TN0A 5JXEC 2KZ1B 4D9RE 5FF6B 3AXLA 4U1JA 1CG9B 4J8RA 5BZWB 4Y16C 4NRYA 5HVHB 3W9DA 3HAEG 5ANMB 4KWUA 1LNUB 3BIKB 3WXVL 1TFHA 4YPJA 1T66C 5J12B 1D6EA 2GUOB 5EBWA 2ZUWA 2DRUA 1TLKA 4K94L 2YK1H 4Q0XH 2H6PB 2J5LB 3H42H 5D7SH 5I19H 2FX9L 1JWMA 1ACYH 3KNBA 2BX5A 4CU8A 5CBAB 3L3JB 5CMAB 3UCRA 6FABH 1I9JH 5HGGS 3UTQB 2F5AL 1BLNB 1UZ8B 5TFSH 5EIIB 3ZO0A 2FX8H 5EUOF 2DS4A 4X8XA 2L0DA 2VLLB 3CC5B 2H1PL 3BPNB 3L1OL 2VZTA 3L6FA 5ID0B 4F80A 4M5ZL 2X1XR 4MNQD 4PTUA 3WEXB 3W9EB 3QNZA 1PLGH 3WFHB 3UDWA 4QRRD 2YPLE 1N0XH 4CJ0A 3U9UB 1IEHA 5JO5B 5CGTA 5IMMB 4Z8FL 4V1DA 5JORA 3TBVB 1QA9A 3VXMB 3RY5A 1QRNE 1KB9J 1MHHA 1WTLA 5D7KD 5KSBB 4P46B 2BY3A 3KS0J 4X6FB 4HFUH 3P9WB 4G3YL 3RL2B 4JY6B 3KPLB 4OLVH 3U0WH 2X89D 4OZFG 3T77B 4HIHA 4WW1B 4HIXH 4AEEA 1U8KA 3RPKA 2OMBA 4F57H 1HXYB 4CDHA 1FAIL 1SEQL 2JJWA 3AREB 1YYML 3DETC 4OM1L 4NCC2 2R0WH 3D69A 5JIIA 1MCCA 2AGJL 2R1WB 4IIQB 3GM0A 5EN2A 3K80A 1EFQA 3U4EA 1J05A 5IWLA 4NNXA 3RDTB 4XNZB 5MHSE 1ZS8A 2E7LA 1DJSA 3KLDA 5E00A 4ONHA 1D5BB 1K3IA 4HS8L 4O2EB 1ZGLB 3FB5B 5I8OH 5EU7C 2DJ4A 5IJVA 1OT2A 5IV2A 2FBJL 3MR9A 4YFEA 4NZRL 1I9RH 3VCLB 5B4MD 3WIFA 3D9AH 3VFTB 4YDKH 1YY9D 2OSLA 4N0UA 4FXKA 3HCVB 3FFCB 4U1SB 2VDQL 4WFGE 3T3MF 3TBSA 3MRDB 4LCUB 1GPOH 3HE6D 4YBQC 1FFNB 5CJXA 4KUZL 2HT4C 4Y5XB 3SEPA 4C54A 1Q9OA 1T21A 2BDNH 4JO3L 2PCPA 2YPKA 4YFLI 1E4WH 2DQHL 3MLRL 5FYKE 4GKZB 3EW3B 5DMIH 4F33A 3R06A 4LVNB 5E8PB 1F2QA 5EBLB 3LKOA 3DI2B 4GUPA 3OMZA 3FO0L 5IB5B 5DQ9B 2W65A 1OT1A 1PW3A 3QUZC 3IETA 1T5WA 4U3XA 5I71B 3L5IA 3NN8B 4O5LL 4CMMA 4GG6B 2JJSA 1AP2B 4OT1H 1U8MA 2F54E 4PLOB 2BY0A 3ZE1E 4RZCB 3BJLA 2ADJB 5F7KC 4FMKA 3OB0K 1OGAE 2QSVA 4NKIH 1WLHA 4X7CC 5EC2A 3F7VA 2YOCA 3SGEI 3S35L 4TOYL 3Q6FA 5B38G 5C2BL 2VTFA 4RQQA 4L4VE 5IJKC 1Q38A 4MXQC 4RFOH 5IW1A 4LCCB 5DC9B 3OJ2C 2DYPD 1CLCA 4LLVA 1F90L 3PUCA 1D5IH 2DQFB 2AEPH 4C56A 4WHTA 2J8HA 5GZND 5B8CA 1I85A 3DURA 4A2MA 2XKNA 5DJCA 3NTCH 1CLYL 3X3FL 5SWSB 2JELH 4AIOA 3WFCL 2BP3A 5CBEB 1CZ8H 2DN7A 4K3HA 3ORJA 2VXTH 3LH2L 1NEZG 4XBGA 2A0LC 3P4NB 4LHUG 3FO2B 3SPVB 1OAQL 4ENEC 2PXYD 4OZHB 1QFUH 1ZKAA 5I8KH 5LVEA 1W8OA 4N0RA 4DVRL 1NCAL 3A6BL 3MROB 3KJ6H 4KMLB 4KHXH 5JHDB 4J1UA 3HI1B 3D39B 4MA7L 3TNMB 3QR2A 1A0QL 1GGCH 3PV7A 3EO1A 3LDBB 3QZWA 4PJAA 2DQEL 5EO9A 4ERSL 5E6IC 1XF5B 2PTUA 4M6MH 5KG9A 3PHQB 2GTZA 4J4PC 2CIIB 4PLKD 5JOEA 2OX5A 3BAEL 4HXBL 3IFLH 1C12B 3MA7B 5JPNB 4JO4L 4ODXA 5DMGC 4M1GL 1JNLH 3OKKB 1WISA 3S36H 3LN5A 4LGPB 4X8JA 5LCVL 3U0PB 5EOCJ 3RWHB 4R96A 1FNFA 2CIKA 5HYJA 1UXWA 1U3HC 3DLQR 3RWCB 4PBXA 1MJ7L 4OGAC 1AGDB 2HAZA 3S7GA 1F42A 2B1AL 3TYFA 2UVFA 3SDAD 1L9MA 1JTTA 4J12A 5IR1A 2DBJA 2R0LL 3D3VD 4UT7L 3S5LG 2DI8A 4OM0H 3QUXB 4U6TA 4ZUSA 5DQJA 2V2WA 2KQNA 3QRGL 5CCKL 3MRGB 4QRUB 3D25A 4K7PH 1RVFH 3H6JA 1MAKA 1VADB 2V9QA 3FQWA 1NAMB 3U7WL 2LU3A 3DX8B 1CICC 4I2XE 1G0DA 2XXCB 1J8KA 2L7JA 2PO6D 4XCFH 5IHUH 1I7RA 3DNKA 4PREA 4FABH 1FYHB 3F12B 1IJ9A 2ESVB 1F4WL 1JPFB 3K2UL 3MV7D 2X4QA 2P44B 1MCKA 4U6YB 3K1KC 1A4KA 1S7SB 4FFYL 1IQWL 4Q2ZA 1TTGA 4XT1C 1J1OH 1GGYA 1CU4L 4J6RL 3IDNB 1ITCA 3C08L 5HY9B 4KRPD 5HGDA 3W5MA 3AS1A 3GJEA 3TZVB 2FD6H 4POUB 4M48H 2ERJB 4APQD 3HS0B 1A4JB 4EDXA 5EZLA 5KSAC 5CIPB 2YMXL 5D1XC 2G60H 5KANG 4OLYH 4JFPA 2OZ4H 4RGOL 4N90E 2B7DT 1NLBL 1KB5A 1F45A 2HJLB 2ICEB 2VAAA 4XNMA 4BH8B 3BUYB 4AEIL 4KKAC 4DZ8A 1QHPA 2IC2A 1R3KA 3QH3A 5C0CD 1N64H 2B4CC 1RURL 2GYSA 3RWDB 4PRPB 3FZUD 3DYPA 2M26A 1EHLL 4PV9A 1U2CA 5I1LB 4MDJA 5CLWA 1X5IA 1H3XA 4PJCE 5EBMA 1YMME 3MV8B 1RK1B 4QHNB 3EJYD 2QSTA 4WU5A 1CE1L 1T1ZB 4PJBE 4ZYKA 2X4NA 3PXJA 2VQUA 2VKWA 5SWZB 4I3SH 5F6IC 3L5XL 4I0PA 4D94A 5DEZA 3FT4A 4G9DB 4TUKH 4PRDB 3WUWA 5L2JB 2VSCA 1IC4H 4UQ2A 4NO3A 4KPHH 3LOWA 3BEVB 1LMKA 5C08B 1FDLH 4R0LC 5FF6A 2RBLA 3MLXH 4RGMC 4NHCL 2V9RA 4EUPG 1CGWA 1CG9A 2VOTA 3V52H 1HE7A 3VD7A 2XG5A 3B4NA 5BVPH 1JPSL 1QSEA 5FYJE 4I8DA 4TUJA 2D7QA 5BZDA 3TF7C 4PJEE 4TN9A 2VDML 5JA9A 1LILA 1X4ZA 2VWEC 3FN3A 3SKMB 2NY0D 2H6PA 2NY2C 4E41B 3FB6B 3Q1SH 3VXSE 3N50A 4NGHL 4JRXE 3VG9C 4R7NA 1JRHH 3VW3H 2ZKHH 3V6FA 1UXSB 5DHVA 5FM8A 3UTQA 1CN4A 3OKLB 2ZCLL 4ZAKB 1IC1A 1OWWA 3P4OB 5EIIA 5HI4D 2IH1B 4WEUD 4JZJC 4NZDA 2VLLA 1CFBA 1G7MB 5ENWA 2J6EL 4G9FD 5C6PB 4KJQC 5D1QD 3OKOA 4MA1B 3MRNA 4HF5L 4ZUUA 1RZKL 3W9EA 1FVCB 3NPSC 1LEIB 2CDFA 4PRIB 1VB9A 5L8JB 3L3GB 3SE3C 4XX1E 4O58H 3LAFA 3DUHA 1B0RB 3DMMA 3RPIB 1I3GL 1ORQB 5A3ID 5ACZA 2D7TL 3RVVD 5I16B 1C08B 4P5TC 3RL2A 1QKZH 1G0YR 1XGPA 4GKSA 4JHAL 1DBAH 5AWNL 3UXFA 4UBDD 3R0MA 1W72H 4DKFH 3SE4A 3NIDE 3O6FD 4W81A 4OF5A 3WIHL 3SKJH 3OHXA 3PE9A 5GS1B 1N7ML 3LQAL 1GL4B 4IRJB 3QDJA 4Q7DA 2R1WA 1MFBH 2RCSH 3CCHA 1CT8B 4IIQA 1A7NL 1F97A 4RX4D 2N1KA 4MAYB 2W9DL 5GQBA 2FIRT 3FB5A 3VXRB 3B2VH 5AEAA 4N1HB 4FQLH 2CUMA 4CVWA 1X5KA 3CDFA 1A47A 3DROB 4ZUTA 3C6LA 3TO2A 2WANA 3GKZA 4U1SA 3HZKB 5F3BB 1JWSB 4NM8L 5T33H 3MRDA 1QPPA 4LCUA 5KBNC 4PS4H 5ADOH 2ADIA 5E2JA 2NW2A 4IJ3C 2CKBL 2HKHH 4PJIE 1BAFL 3VH8B 1NKOA 1AFVL 1V7NL 5DD0L 1XGUA 5ALCL 1PKQB 2DQGH 4HS6B 5E9DE 3WFBH 4FZEL 4XMKL 1CDUA 1K4CB 4HC1L 2X9WA 3DXAB 1AR2A 1B90A 1H3UA 1R3HB 5BW7A 5IUSA 4XC3H 1QPXA 4MVBC 1MCPL 5EBLA 2CXKA 4F7CA 2Q7YB 1LO3L 5EOCL 4OKVB 5IB5A 2AEIT 5DQ9A 3F7YB 5GS2H 2NR6D 3QWOB 3LQMA 1IAKB 3M45A 1KGCE 5DVOA 4QRPA 2G5BB 3HR5A 5D7LB 1INQA 2IH3B 1BEYH 1E4XH 1MFDH 2BSTB 3BEWA 4HUVA 4P3WA 3LCYA 4NNPH 3GSXA 4PJDE 1EA9C 4QGYA 5I1DB 5IVNA 1EAPA 3S3JA 2YA2A 4OV6F 2ZUQC 3NMEA 2FGWH 3O2DH 1JFQL 4HWUA 4X7EC 4G8GD 4JY5H 2NLJB 4HXAL 2P48B 5BO1L 3RGHA 4PLJC 2DLGA 4NZUL 4OV5A 4X6DF 1SY6L 5IESL 1TZIA 1UCBL 3B6SA 4LCCA 1T0NA 1YEKL 1KPVB 3WLWC 1J5OL 4FXGB 3BZ4A 4P9ML 3BDXA 4ODSL 4HT1H 1NGPL 5AD0B 4Y1AD 5FB8A 3IFNH 2ZCKL 1T6WA 4EN3B 3IKCB 5SWSA 1CXIA 4M7ZB 1ZT1B 3UTPD 3C5JA 5CBEA 2D9CA 3SN6N 5JIKA 3G5YB 3D1MC 3M17B 5LAXB 1EFXD 3WD5H 1X44A 3P4NA 3BDYH 3B2UD 5CJQH 2IPKB 4S1QL 1IGCH 4Z7VB 5BXFA 4LK4A 4YHMH 3LZFL 3U48A 4KQ4L 2AV7A 1MAJA 2VMFA 3MROA 1GJIA 1ED3B 4GS7B 1N4XL 4FQHA 1KENH 5TQ2L 1A14H 3HI1A 1NFDE 3CFJB 3D39A 4PJGE 2PYFA 3TNMA 2HMID 1SVZA 3QDMB 3OV6A 3OZ9H 3VRIA 5A16B 4Y5YC 5DD5H 3W0WB 1XF5A 3GI8L 4GH7B 3T1FB 3PHQA 2FB4L 2BCKA 3OF6A 5H94B 1GGIH 3MA7A 1TJIL 3TYGL 5JPNA 5F89B 1MNUL 1WZ1H 2WBJD 1V05A 4XWGL 1KN2L 5E95B 3OKKA 3UBXA 2CR6A 5FCUH 4DN3L 4OZ4B 3O3BB 1ZHNA 3FRPG 5TF1H 1R3JB 3MV01 1YEEL 5DJ2A 2AABL 3GO1H 3MA9H 3RWCA 3RZCB 1N6QH 1T5XA 4YHIA 5HHOA 4ELMB 3OKDB 1IGIH 2EDDA 2QADB 3GI9L 1IEAB 1OGTB 4Z95L 3QUXA 3KYNA 4D9QE 5L9DH 5D8JH 1UB6A 5TF0A 2NY7H 3C2AL 4TTDC 3MRGA 3CU1A 3PQYB 1QBAA 1EBPA 4ZTPL 3IRZA 5JXED 3KR3L 1OAZL 5SX5K 1UWXK 1WZLA 3D2UD 4MDIB 1I1AB 3QDGD 3BRDA 3SO3B 2CUHA 4Y16D 5JW4N 1TJHL 5IMOB 3ARDA 1F58H 3OXSB 2FHFA 3SDDB 3F12A 2ESVA 4XRCA 3I50L 4KC3B 1T66D 1QVOA 4JJ5B 4PUBL 4U6YA 1S7SA 2HP4A 2FH6A 3EFFB 4L3ED 2BVOB 1KJ2B 1JGVH 3EDKA 3VXQA 5SWQB 4ZNEA 3UTTE 4JCMA 4NJ9H 4U1NB 1WWBX 4RDQF 3IDNA 1J86A 2J88L 5HPMB 5L2KD 5HY9A 3AROA 4L8CA 1X5XA 2IF7A 4TRPL 3WFEL 3ES6B 1YNTB 1VGEH 2DKSA 1BD2E 2BNRB 3T09A 5C71A 5L6YH 1MRDL 3HS0A 5C3LD 4AIXA 1UKSA 1T22A 5A40E 1ZANL 2KZWA 5CIPA 5I9QC 1JHKL 3VD4A 1ZLUK 3B9KB 2UZIL 4UOJA 2W07A 4HQQH 1P1ZA 1UM4L 2HJLA 2ICEA 4FQXA 5CD3A 1E6OL 3BUYA 3ELAT 1T80A 4XNQA 1G7HA 1KCLA 2DQUL 1VFBB 3BP4A 3SCMB 1PG7L 3RWDA 4XGZA 5GS0L 2FLBT 3D0LB 3MLSH 4NQED 2QSQA 3E0GA 3K74B 4JN2B 1P53A 2VZUA 5T1DL 3U79A 5J13C 3H0TA 4QNPF 3SDCC 1FRGH 2DMKA 4P2RB 1FE8H 4PR5A 5D9SB 4JREB 3JWOC 4YHOH 4MJIE 3FFDB 2P8LA 3BPLC 4F9PC 3PNWA 5B39G 4Q9RH 4M62H 1CD1A 1OM3L 5CZKA 3P0YL 5HBBA 1GHFL 5SWZA 4JEGB 4CU6A 3KJ4B 4M4RA 3M8OL 4G9DA 1HHKA 4PRDA 3IKKA 3S4SG 5L2JA 3DETD 3HC4H 4G5ZL 2UYLB 3BEVA 3O2WL 4RDQG 2PW1B 3PABB 5E2WH 1FYTD 5ALBH 1G6VK 1WBXB 5IW3A 2YKLH 1P9MA 4TYUA 5BRZE 3OPZH 2EZ0D 5BVJA 4NN6B 3LQZB 1MEXH 4K3JH 3THMH 4B7LA 1P4BL 3WNNA 5DURB 5D5MB 3VI3E 3O0RH 4X99A 2P8MA 2A6IB 3I9GL 5CEYB 4ZOBA 4XPBL 3CFEB 3MGTA 5CUSH 2YXFA 1JMZA 3QDHA 4H25B 4WGVB 1HHHB 4YBQD 4ZUWB 4JHBA 2JCCE 4JFEE 3FB6A 3LEVL 5DT1L 2MCG1 1BQSA 2NY3C 1CF8L 1BOYA 2HT4D 1Y18B 3DX6B 2YD3A 2WLYA 2Z93A 3ZMRA 5F70A 3SKOA 2C1OA 2ICWJ 3KG5A 3BIBX 1UXSA 5F9WC 5AYUL 3TNNB 1HN1A 4H8WL 5E56A 1EJ6A 2F54A 1L4IA 4ZAKA 1TTUA 2R2EA 4OIBA 4LSUL 2IH1A 1A02N 4XCNB 3T65B 5FFLA 4P57A 3P9LB 5EU5B 4K71B 5ILTH 4L4VA 4BQBA 5I76B 1LEIA 3ZE2F 4PRIA 5HYFA 3AAZB 4ONGH 4G7VL 3T2NL 1CDHA 4GXVL 2EE3A 5EPMB 1H8OA 3I3DA 4OF3A 1B0RA 3TLRA 4H5SA 3DX9B 1ORQA 5I16A 4DUVA 4I0KA 4Y19A 1GXEA 1IGJB 3G9VA 4UILL 4OSUL 3MOBH 1MI5D 2NZIA 1A6TA 2ICES 1AJ7H 5D7IA 4F3FB 2JJUA 4MXQD 1KOAA 4WI3A 1CL7I 3I6LE 1R3LB 3KAAA 4JPKH 5ICXB 3WBDA 5GS1A 2FECL 3B8YA 3M1BB 2B8OT 3EFDH 2EDKA 3SJVE 4U1GC 1CT8A 2YEZB 3V0AC 2HFFA 5KSBE 4N9GA 5IKCB 4H1LH 2AJVL 3VXOA 4MD0B 3RL1B 5E7FA 2A0LD 1FH5L 3VXRA 2JLLA 5ADPH 2HT2D 4ENED 4IHOA 1U6AL 4PJHA 5CEZH 5HHXH 3BMVA 3N85H 1T0PB 5FKAB 3VXTB 2B4CH 5JNYB 4OLZH 5IWLC 3ZZ1A 2ZSVB 4KTEH 4O02H 4TSCH 4G6FD 5DK0B 5C0BB 1HNGA 2XWBB 4YQXH 2MFNA 4ZD3L 1JL8A 2HA1A 1YEFH 3T1WA 1MCDA 4HS6A 3PWNA 2GJ6E 3RZWA 5E6ID 1WJ3A 2HVKB 3FQUB 1MJUL 4J4PD 3IYLW 1R3HA 3QCVL 5CJXC 5D70L 3QYCA 3S6CA 2C5DC 3AY4A 4E5XB 4RMVA 5DMGD 5C0AB 1NEUA 1J0KA 1UQSA 2MKLC 4XXCC 4OKVA 3FFCE 4P3DB 5C07B 3O6KL 2X9XA 1EEZB 4J3TA 3SQOH 3IJHB 3QWOA 3BW9B 2ED8A 3PWJB 4LPVA 2G5BA 1U3HD 5D7LA 1EDQA 2JTDA 5CP3A 4I2XA 4ZQKB 2BSTA 4OGAD 1YEIH 5GGSA 1WCBB 5IBLC 1ZMYA 5DD6B 1NUFA 3KPRD 2EE2A 5DWUL 5I1DA 5DXWA 2OJEA 4JO1L 3JTTA 4LPXA 5JOFB 2V7NA 3ZLQC 2HRLA 1BZQK 4AJ0A 4MB4A 1KSRA 5FUZL 1CICD 3L7FA 4ZS7L 4ZNCD 4FXGA 2WBKA 2V2XB 1MVUB 1TNNA 4UOW0 2Q86B 4FQ1H 1YEDB 3FCTA 3T2QA 4GG6E 1IAIL 1H0DA 3H8NA 1UYWH 3TO4D 4EN3A 1FPTL 2CQVA 4OFVA 5EA0H 4HCRL 5H35A 1JK8A 4C58B 4F8QA 4LPTA 2C3GA 2B1HL 3SDXB 4CVXB 5LAXA 5IB4B 5ETUB 4NIKB 4JFYA 3EUUA 5EU6B 2IPKA 4JPIB 3VA2C 5D96C 1R5WB 3T0EB 2H9GA 1HXMB 2GSGA 3SGJA 4M1DL 2VL4A 1A7PH 4JO2H 2Z0BA 5KSAD 5D1XD 1HKLH 3QDMA 3VMNA 1NC2B 2UZXB 1J8HB 1YECL 2XZZA 4YZFE 1OP5H 1G9ML 3T1FA 3GSNA 4KKAD 5E2TL 1TMCB 1A5FH 2E6JA 1U8OB 5CEZD 1FL6B 4YDJB 5DRWB 3QXDA 4OZHE 3H9SD 5D2LF 4M5YL 1BZ7A 4YBLC 2VDOL 1NCDH 1QR4A 3N1QC 3E8UH 5DRZB 4JFFE 2VDPL 3O8XB 4MD5A 1OAUL 4HV8B 5JW4M 1OLLA 5EUOE 5EDXA 5JHDE 1R3JA 2IFGA 4F15B 4LAQL 3ARBD 4W4OC 2XN9D 3O4LA 3N1PC 3RWIB 1VACB 5ICZB 4LLYB 4AG4L 1U8IB 1G7LB 5E4IA 1JPST 4ZDHA 3IU3B 1IEAA 1VSCA 1HZHL 2ADGB 4HH8A 3L5HA 4D9RD 4ZXBB 5JHLL 1YEJH 5I1KH 1IARB 5FYKH 1NAKH 2NY1C 4UNUA 2FHBA 2DKMA 1KN4L 2Q6WB 3BGAA 1NCCL 5E8DH 3RQ3A 3SKNB 3HPJA 5IFJB 3V5DB 3QCUH 1I1AA 1WZKA 4MDIA 2DLIA 4LCWB 5TE7L 3EYQC 2VZSA 3CLFL 5GGRY 2YPVH 2DJUA 2YWZA 1KELL 1OD7A 4FTVA 1X5ZA 2HT3C 4H26B 1MUJB 2K1MA 3HMXH 4JJ5A 4KH2A 1BIIB 4NP4L 4G8IB 2BVOA 1PEZA 2NY6B 2G2RB 2NY5L 4BFGA 4LCYA 2QQKL 1W8NA 1L7TL 2NY2D 4FMFA 4LSVL 3EOTH 3QXWA 1Q1JH 4Q9BA 5A2JH 1MWAH 1KIQB 1D5MB 1HNFA 1NFIB 5C70A 2HTLC 3ZKXC 1KPRB 1CD0A 4EI6A 1YNTA 5F1NB 3VWKA 4HGKC 2E9BA 3ILPA 2RB8A 1ND0B 1J7VR 4JRYB 1MY7A 4OLXH 1Q0YL 3RKPA 2WUBH 1J1XH 3NBNA 2YPLD 3B9KA 4UQ3B 3F58L 5HPOA 4LKCB 3JTSB 4KJQD 1LDPH 1QRND 3ULVC 5IF0B 4FNLL 4GQ9L 4JZNB 2FX7H 4MNHB 3KPSB 1VFBA 3P40A 3DO7B 4YH6A 1KPUA 3KLAB 2VXQH 1NUGA 3HUJF 4JN2A 2A2QT 3C5ZA 4JPWH 2CMRH 1XCTB 5HYQB 5DZNA 4P5TD 3VG0L 4JFZL 5DUMH 1G9NL 4JVPA 4UB0L 5JIHA 5GISH 3ARVA 4GRMB 4KK8C 1WAAF 5D9SA 3S34H 2E7CA 3FFDA 3K4ZA 5AZEH 5C0RL 1A9EB 4HKXB 2NXYB 4NWTH 3PDOB 3X14B 5BMFL 5MHSD 1YC8A 2PTTB 4HH9A 4N0YL 2N56A 4PRHA 3ARFB 1LP9B 4PRPE 3KPPB 5I74B 3IS0X 4XVTH 2A73A 3O45B 5DRNB 5F44A 3RTQA 3IDMA 3I2CL 4M6AA 3MO1B 4WFGD 3SGKA 3MV8E 5JQ6L 2XY2A 4POYA 4R4ND 3QO0B 1U41A 2W0FB 1CI5A 4P23A 3ARQA 5CEYA 4UU9B 2BOBB 3CFEA 5M95B 4D3CL 2FJHA 3OKEA 4ZUWA 5FYKD 4X7TA 3HAEB 5HVHC 1U2HA 2R69H 5DC4B 3O3AB 4ORZC 3DX6A 4A2LA 1CK0H 4NKDB 4HZAA 5C08E 5CINH 4PJXE 5I19L 3DBXA 4WI2A 5J12C 1NC4D 2FL5B 2D31A 4ODTL 4BUGA 2GY5A 1R3IL 3NGBB 3HE7B 5IB3A 3QIBB 1JTPA 4XCNA 2L7UA 5DJ0B 4G80B 4MVBD 4ODBD 3WO4B 2J5LC 1CXLA 3P9LA 5BQ7B 3BSZL 3CUPB 1CFSA 2JB6A 5IVXA 1LHZA 3CXDH 3VD9A 2AQ1A 2D3VA 5T3XE 4XZUB 3C9NA 4WTXA 5A2LH 1OGAD 2VDNL 3LKSB 4G6MH 3E2HB 3CVHH 3AAZA 1CFTA 5FUCE 1DVFA 2XQYK 4EI5B 3B3IB 3DWTA 1WBZB 4MB5A 4JG1H 4HX1A 1B2WL 3MRPB 4XXDB 4W4NA 1F4HA 5AUMB 5C7XH 5HGAA 2OTUB 5JXAL 1W0WA 1Q9KA 1T89C 4PLJD 2PR4L 4R8WL 4F3FA 2DQIL 5DQDH 3ARYA 3X3GL 1R0AH 1J0ZA 1JUFA 3WV0A 4HJJH 3WLWD 4YDLB 3JWNC 5DFTA 1VKXB 4P46C 1JJUA 1WGOA 5FGRA 5FDWA 3DYOA 4KDVA 3M1BA 4O2FB 1WTGT 4D0DB 2YEZA 2ADFH 1IVLA 3QPXH 3TJEL 4JG0H 4HKBA 1YA5A 2FATH 3RL1A 3AREC 4M7KH 1VFAB 2EDOA 1NL0H 5AAMA 5A2FA 3CH8A 1S3KH 4IIQC 4HPYL 4X4XA 2HFTA 4FQJH 3RDTC 4KKNA 5MP6H 3GRWL 4XNZC 4KTDH 4YDKL 1VHPA 2E3VA 2WWKO 2XWBA 5IROA 3WHE0 2EDBA 4L3CA 1OSPH 3MUHL 1UM5H 3O41A 1UG9A 3QA3A 5EZIH 1X4XA 3IDXL 2EDFA 2F19L 3JWOH 1JNNL 1OW0A 2HVKA 4JFOB 4X5WB 3AS0A 5F88B 3FQUA 5F3HB 1ULVA 5EC1B 3L3IA 2AP2A 4OI7A 1KTLB 4MQSB 5J0BA 4Y5XC 4RIRA 5FGCB 5DLML 5C07A 2JJVA 1U8JB 4WEBL 1LQSR 2BVQB 3K4DA 1EEZA 2CJUH 2IANB 3ESUF 1X5HA 1JV5B 3ZDZF 1NCBH 3CGTA 4TVPL 4ONOA 1TDQA 4WNQB 1XR8A 4ZQKA 2BNUB 4GAFB 1P4IH 4LVNC 5DJ8A 5CKAA 2Y72A 1N5YH 4OFKA 5GRUH 2R15A 1PKQE 5DD6A 1XF3B 2F58H 4O2CB 1OARL 2XA8H 3NFSH 4WW2F 3QUMA 3OAZH 4J3UA 3D0VB 1MLCB 3DXAE 5SX5H 4EBQL 5CP7A 5EWIL 3ARPA 2KQMA 1NCWH 4M03A 4TTDD 5I71C 1UJ3A 3MJ8B 4RBPK 3CX5J 25C8H 4GLRI 4RNRB 4YPGB 2A9ML 1ZLSH 2WP3T 4XC1H 5J57B 5E0QA 1YEDA 1YMHA 2VLRB 4Q58C 2V17H 2VLJB 4K7PY 5B38B 1LE9A 3AGVA 3GHBL 1OD9A 2HWZL 5MEOB 1D5IL 1AGEB 4PJ5E 4Z7QF 1FGNH 5EZJB 4LCCC 2WWMC 5T3ZH 1QSFE 1EBAA 3SDXA 2AJUH 4CVXA 5ETUA 1PQZA 3OR7A 1UH2A 3QHFL 4UAOC 5EU6A 2D03H 1PSKL 1J18A 4X6CF 5T1KA 1HH9B 3GSWB 2Y06H 1HXMA 4WWKA 4N90D 4Q9QH 1WWWX 5C0JA 1NEZB 3RWJA 1I1CA 4Q6IA 4LHUB 1X5JA 5AG9A 1H8SA 2VQ1B 4KZEH 2VZ3A 2CKBB 5I2IA 2MPAH 5IGXH 4NSKB 1J8HA 5I1EL 4LFHD 3GK8L 1P7KA 3SGDI 4X4YB 3VWJB 4S1RH 1FL3A 2CO6B 1SMOA 4G8FB 3VXNB 1KG0A 4POZC 4M6ML 1FL6A 4YNYA 4JKWA 4YDJA 5KVGH 2NYYC 4I1NB 1INDH 1YMMD 4Z7VE 3KYMB 3LDBC 4NO2B 5HVWA 4P5KB 2E7BA 1BOGB 3SDCD 3QFJA 1I1YB 1E0OB 4LLYA 2ZCHL 5IBTH 4LVOB 1G6RL 1B0GB 1NMBL 1ZSDB 1HOCB 3RIAF 3IGAB 4HUMB 4XMPL 4RAVB 1UKTA 3MRFB 4OM0L 3V5HB 1PZ5B 1KJ3L 3MOAL 3RGVB 2J4WH 2Q6WA 3V4UH 2MKWA 4Y5VA 3SKNA 2YA1A 1ZWIB 3S5LB 1FGVL 5E03A 4CGTA 4MA8L 3BVNA 4FFVC 3PHSA 1IC5L 2PTVA 1QO3B 3ROLB 4MCYB 1DSFH 1IL1B 3VXSD 3U0TB 1KCKA 4H26A 1R24B 4JRXD 3G9AB 1MUJA 1WUNT 5I0DA 5F9AC 4G8IA 3IDYB 1QYGH 4OB5H 5I30L 3INUH 3GSRA 2NQCA 1NGQH 2NY3D 3PQYE 5KZCD 1AE6H 2IADB 5D72L 5DD1L 1AQKH 1IKFL 4RMQA 4LSRL 3VFSA 4LSQL 1B88A 3NCYS 4KFZC 2DQDL 2X4UA 3BKJL 3MLYH 1HWGB 2CK0L 2V5SA 1IGFH 1RJCA 2A1WL 4S2SB 2UY6A 4X0KA 2VITA 3NCJH 3LRHA 2FD6L 3EHBC 1AKJD 1QBLH 3KPMB 5IFAL 3BP5B 1SJHA 3G6JE 5T3ZD 3HKFA 2IPUG 4DGVH 3NVQA 3TZVC 4LPCA 4LQ1A 3QXAB 4YXHH 2ERJC 4JZNA 3LKPB 3BISA 1N5AB 4I48B 2YS4A 4Z77B 2Z31B 5LWYH 3BZDA 4XP1H 3I02A 3F7RA 4PGEA 2IBZY 2UY7A 3KLAA 5M94B 3IJSA 4HUUA 4NQVB 4OAWB 4NQCD 4LPWA 5HSFA 3EYSL 1PBYA 4JAMA 1XCTA 4Y4FA 3DI3B 2BNRE 3SJVA 4FS0A 2M8XA 2PN5A 2CDEB 3FO1B 4XPHL 3SBWA 4NBXB 4N0FB 5GHWH 3EO9L 4KQ3L 3ZTJH 1A9EA 4HKXA 3CXHK 5FA3A 2BSSB 3X14A 1IQDB 5K9OB 1B4JH 4QGTA 5DRXA 1U58B 4HIIA 3O9WD 4Y4HA 3KPPA 3WL9B 3MC0A 3HNSH 2VE6B 5FHAH 1H3GA 4ZOAA 3RNQB 4C4KT 3O45A 1MAMH 2K7QA 2EEAA 1FDLL 4PGDB 1G0XA 1RIUH 4P2RE 3T0AA 2NX5B 5ELIA 1GGBH 4L8SB 4WFFE 4M7LL 1YPZE 4QF1B 5FYLE 4EUPB 4OIIL 4LRNL 4WEMB 5E9DD 4H20H 2R1YB 1FNGA 3HAEA 2XQBH 4HLJA 1OPGH 3O3AA 2MHAA 2FEDC 4NKDA 3HNTH 5TE4H 4HJ0C 4BA8A 4JANB 3S88H 4WV1A 3O11B 4LASH 4Y4KC 3WN5B 2EDTA 2Q3ZA 4Z6AT 3KLHC 5HHMD 1JF1A 1IE5A 3IDJA 1KGCD 3QIBA 5DJ0A 1XF2B 2EYTA 3CUPA 3BO8A 1DQQB 1U8NB 4JN1H 3O2VL 1FFPA 4ZFFB 1RUQH 1S78C 2P5WE 2VH5H 3LKSA 1EO7A 3Q0HA 4RRPG 1FFOB 3OJVC 5JR1L 2WQRA 5IBLD 3QO1B 1D5XA 4EI5A 4U1HA 4Z7NF 3DUSA 4GW5A 2XKSA 4IEFB 1PFCA 2F8XC 4WY7L 2Q76B 2NXZD 3DVNB 4XXDA 5LXGL 4XPAH 1CIDA 4P3CL 4QHLB 5AUMA 4MA1C 3PWVB 4G7YL 1EERB 3SGEH 2HVJA 3MRBA 4BKLA 4AK1A 4QEGA 1FFQA 5E2VL 5EOQH 3V8CA 1HWHB 1H3PL 1NCTA 1LEGB 1QKZL 3HHRB 1OHQA 5JW5B 3FB8B 4S1SL 4XP9L 2Z91A 1GRWA 4FRWA 3W39A 5AZ2L 5HDQL 1VKXA 1FNSH 1F13A 4X7FC 4OZFA 1LK3H 3EZ8A 1FIGH 5MEPB 4O2FA 5CGMA 3U7YH 1V7MH 1MCIA 1UKQA 3JV0A 4YHYB 2X42A 3CSYB 1ADQA 1JWUA 1KCUL 3QIUC 3IXTA 4RWHA 3ULVH 3PP4H 1H15B 5GS1C 1VFAA 3VI4E 5IQ9B 1NBVH 5C6WH 1OAKH 3LS4H 2H45A 4IRJC 1S5HB 5ACMA 1IM9B 2WLZA 4G6KH 3QI9B 5IW6B 4YHZH 1A3RL 3ZKNC 3OAUL 5IP4A 4MAYC 1BM3L 1BBJA 5TPWH 3PP3K 4GOSA 1W2KT 4PS4L 5EUOA 4JDZA 1CR9H 3QUKA 1X7QA 2HKHL 3NA9H 1U91B 3BE1L 4OQTH 1OQOA 1YN6A 5KS9B 4JM4L 5F7YC 3GMQA 5F88A 1J0JA 3CLEH 3LV3B 2VZVA 1FNEB 2CR3A 5EC1A 1JGLH 4JFDB 4DK3A 4PJ7B 2YN3A 1EUUA 2Y9RT 1MQKH 4NZTH 3WJJA 1U8JA 3GSUB 1EMTH 2X4OA 3RNKB 2BVQA 3JV6B 3RFZC 3STBA 2IANA 1JV5A 3EZJB 2J6EA 4QRTB 4Y7MA 3ZTNL 1MCWM 1UB5B 1SYVB 3RWEA 4ODUB 4WNQA 4H88H 4TULL 2BNUA 4I77L 3QUYB 3AY4C 4LLMB 1XF3A 1BEYL 5E1AB 4Z0BH 4O2CA 1BVKA 2DQJH 3N9GL 8FABB 3I6KB 4L8BA 2ID5A 4QRRE 5D93B 1U42A 4ODVH 2VL5B 1CFVH 2DIBA 1KC5L 2NY1D 2FGWL 5D7KE 2FJGB 5DR5L 4HLZH 1JZ3A 5HTSA 4MB3A 2Y5TB 2WIIB 3ZE0F 1K8DA 3EYQD 2LABA 3LRSB 4I4WB 1HIML 1O0VA 3CSPA 4PJ8B 3WJLC 4U6VH 3FKUS 2R0ZH 2F5BL 3UTTD 5B38A 4JQVA 4BZYA 4ALAL 3TVMB 4PJFE 4HT1L 1AGEA 1GVIA 3GNMH 5I1JH 3HB3C 3UZVB 3CFBB 1HHJA 3DVFA 3VDCA 4YK4B 4LDOB 4JPVH 3LHPH 4NQTA 2I5YL 4F58H 1D6VL 2HTLD 4QOKB 2DLHA 1YNLL 4M7ZC 1GCFA 1AGFA 1DP0A 3PDDA 5DK2A 1NEZA 1DLHB 1KB5L 4LEXL 2QR0B 5BS0E 5HI5C 5IQ7L 2F9BT 3IAQA 3UBXG 4ZOCA 5E8OA 4ZS6C 3RVWD 1RU9L 3ULVD 1TITA 5E8EA 4OZGB 5KANI 1RAMA 3MACH 1J1PH 1KTDB 4NN7B 4GS7C 3O3DA 4U31A 1MCJA 4XPTH 1U8QB 3BESR 4D8PA 3KYMA 4NO2A 4LU5L 1EHNA 4MJID 4YFDB 3T0EE 3P9MA 4DKEH 3TJHC 2FR4B 1BMGA 3QG6B 2BY1A 3D5OF 5E5RB 5CSZB 4KK8D 4MXVE 4JKPH 3OKNB 2GIYA 2XACC 4IM8A 2SEBB 4HK3N 2QQNL 4LDLB 4XHJC 3ZL4H 3FO9B 1ZSDA 2IFFH 1HOCA 3CNKA 1DBMH 3V4PH 1JYWA 4OLWH 4O9HH 4RAVA 2ZUVA 3ZE2E 5LQBL 3DV6A 4K3GA 3B9EA 2EDLA 2H26A 5BRZD 1Z2KA 1PZ5A 4O51A 3RZCC 3CMOH 3MGOA 1JF6A 1AXSB 2Y4SA 3RHWK 1ZWIA 2QADC 3S35X 4NQXA 4F37K 3VD3A 3S5LA 5I73B 2Q8BL 2FSEB 2YUZA 4YDIH 4IRZH 3MSPA 3UO1L 2OL3A 4MSWB 4S11A 5K59F 2VDRH 4P9HC 1DTUA 1R24A 2PNDA 5ISZE 3IDIA 2LTQC 5DJDA 4AM0B 3FMGH 2BMKA 1I1AC 4ZPVA 1TQCB 1Y6NR 2C3WA 4MZ2A 3SO3C 1HSAB 1KCSH 5ESQA 3CH1B 2KDGA 4W6WB 4ZFOL 3SDDC 1QD0A 3G5XB 4NJ9L 3JV5A 1A64A 3FN0L 3MZTA 1M7IA 2A6JB 5INDB 4LCWE 5J6HB 1AGCB 4OCXH 3VE0B 1JGUH 1B0WA 1FFRA 1JNJA 1A2YB 5IM7B 3VXUE 4MA3A 2CUIA 3VGBA 1SEBA 2ICCA 5L6YL 2LVEA 3KPMA 1RIVL 3VFVA 3LEYL 4MQTB 4HULB 3BZEB 2VLKB 3BGFB 3EOBB 2N4IA 4GMTH 2EE9A 3LKPA 3QCTL 3UX9B 1N5AA 3JUZA 5TDOB 5FXCH 4YR6B 5MENB 2BK8A 4M6NH 4U1IA 4BZ1L 2EICA 1AY1L 5GJSH 5FO8B 1M71A 4L5FH 4JRYE 1M05B 4F9LC 2CDEA 5E94B 3SCMC 4N0FA 4LGSB 4YXLH 2AJZB 3V6OE 4FQQA 4NQDB 3VXMD 4Q97A 1LVEA 3A6OA 3QPQC 4M62L 4NOBA 1SQ2N 4P0DA 1FBIH 5K9OA 4P46D 2ED7A 1WEJL 3KPSE 4GW1B 1IGYB 1I1FB 4JREC 2EO1A 2AEQH 1RJYA 5B39B 3X12B 2C4FT 3HC4L 1DANU 4H0GA 3ISWA 4PGDA 3KJ4C 1ETZA 3MRHA 2NX5A 4YDVA 3RUGB 3ARED 4M6OL 1T20B 3VFUB 3NFNB 2AK1H 1QNZH 4HPOL 4X80L 1AC0A 1NGXB 3OR6B 4EUPA 4BFEA 2EDJA 3RDTD 4C83A 1T2XA 2OQJA 3FONB 3MV7E 1TXKA 6CGTA 3VFRB 3SGKC 2VQTA 2WP3O 3DJ9A 1LP9E 3HNVL 4NN6C 1QFHA 4UINH 3EO0A 4HS3B 4R4BA 4JANA 2MOVA 2XZQH 4U1MB 1EEYB 1KCVH 2ICWB 5GSVB 2PYEB 1MHPH 3FFCD 1V5JA 5KVFH 3PL6A 2YRZA 2AVGA 1MH5B 4P4KB 4GBXB 4MCZB 5CJBA 5EORL 2UZYB 1F11A 1D9KC 1D7FA 4JQXA 1CFNB 5JPMA 3MUJA 1DQQA 2UWEB 3V5KB 1Q9WB 1FVDB 3BP7A 1YEHL 2JE8A 1EAJA 3DGGA 3GMOB 4JR9H 4GSDH 1BZ9B 3MBEA 1FFOA 4XBPB 4GG8B 4YIQB 3UTOA 4V2CB 4Z7UE 3V7MA 4K71C 3DVNA 5FAAA 3RX5A 1NAMH 2YD4A 4PJ5A 1T4KB 2BJMH 2F53A 3K1DA 1QSFA 4FFWC 4F7EB 2NTFB 3HZYB 2EEBA 3FB8A 3UYPA 2ZPKL 1NSNH 1ODAA 4NJAH 2BXYA 1I8LC 3BOVA 4RGNE 5EBGA 1A9BA 5E5MB 4RISL 3MREA 5IMKB 1A6WH 4NQSB 5MEPA 2R4SH 4GMSL 3CPLB 2AJYH 2ZOKB 3WO3B 3LS5H 1T3FA 3HE6B 1INEH 2P49B 3QIWB 3QJHB 4V2BA 1H15A 3SOBH 3SY0B 4DCQB 5IQ9A 4TSAL 3TIEA 5GJTH 3L9RB 4LSTH 2P5EB 1LO5B 4NO5A 5A43C 5CIPH 2OMNA 1IM9A 3N85L 1A6UL 4EVNA 4WDIB 3AB0B 3UAJC 2ZJSH 4RFEB 4KTEL 5I17A 4XHQA 1RUPL 3RWFB 4N1CA 1JZ7A 4L4TA 4GKOA 1U91A 4YQXL 3MLZL 4LVEA 2EH7L 5EO0B 3LV3A 3VFMA 1QQDA 2IJ0C 4P2OB 4POZD 4JB9L 4PJCF 5JHDD 2NYYD 5IT2H 1UJTA 2GITB 4B50A 4KKBC 4K94C 4HKJB 3EOAB 3GSUA 5DMKB 3RNKA 4OFPA 4PJBF 4LPUA 1CGSH 1BVLB 4KMTH 1HHIB 1BF8A 5DC0A 2BRQA 4KRLB 4DOHB 1G9EA 3SQOL 3TIDB 3QUYA 1DLFH 4LLMA 1DQML 4LLWB 3QJFB 1YYLH 1ZTXH 3MODH 1PDKA 1LD9A 2QQLL 1AHWA 1IFHL 4RAUB 2VL5A 1LO4L 5JLZB 1QR1B 5FGCE 1CD8A 2FJGA 3BXNB 4OFYA 4PJEF 4QCIB 4IOFC 3LRSA 4I4WA 1X5AA 1JNHA 4B0MM 4FFVD 4AL8H 1I3RB 4NRXA 2G75B 1IAII 1JPGB 3LPFA 3MRJA 5T3XH 4WUUB 4KXZI 3GMRA 3TVMA 3BH9A 1UYWL 1NBZB 4LFHG 1UZ6E 4YHPB 1RFDH 3C5SA 1SBBA 1E6JH 2ZZUT 4MXWL 3UJTL 1AQDA 4U1LB 4U6XA 1U3JA 2ESVD 1FL5B 4UV7H 2BSRB 4WO4B 4R3SB 1KYOJ 1MJJA 3IS1X 4DGYL 4C4KO 1KLUA 3EHBD 1Y0LB 2VLJE 2UV3A 4M8QA 4NPYA 1A7PL 4R4FH 3DVIA 4LHJB 4NO0A 1QFPA 1UWGL 3F8UB 3NA4A 3T0EC 4D9LH 3TZVD 4QKXB 4OZGA 4J3SA 3UYRH 4IMKC 3UPAA 3P30H 1L0QA 1T7ZA 1BFTA 5C6TH 4XPGL 3RIFK 2DLEA 3CFIC 3PGFH 3H3KA 1YZZA 4X6EB 1DUYA 1QOKA 2BVPB 2OI9B 4JGMA 5DS8A 5FUOH 4XP6H 3NIDF 5L7XL 3P77B 4OD1L 4OCMC 1MCFA 2NMSA 3PGCB 3FQRB 5I1HH 3VMOA 2AERT 2AK4A 3FO9A 4YEEA 4PRPD 1MLBB 5GGTA 2Q20A 3TBTA 4X6DA 5DSCA 1I7TB 2HN7A 3O8XC 1EH9A 3FAXA 4XVJH 1MF2H 4F7MA 2YWYA 5ICYB 3MV8D 3HG1A 3V8OA 1U93B 5FYKL 2XYCA 1NAKL 5BJTB 3B9VA 1RMFL 3DRTA 4IDJH 1C8PA 2FSEA 3QHZL 4ZXBC 1EGJL 2H8PB 2LU7A 1IEBA 4PJIF 4BFBD 4HFWB 4UNVA 1RZIB 3E3QE 4N68A 5C09E 5C08D 5GGVH 1AO7B 4XX1G 4DQOL 3WCYA 5KW9H 4M1CC 1JIBA 2ICWI 2FEDD 3HI6L 3G5XA 3EOTL 4HJ0D 3OXRB 3NOIA 1ZA3A 4Y4KD 1FG2B 1KXVC 2HRPL 3KLHD 2NY6C 4OGZA 3U46A 1X5YA 5T3XD 1IBGL 2DLFH 1TETH 5D2NB 1NMAL 3K0WA 2VC2L 4E41D 1QFWH 1E27A 2CGRH 3E6HB 3CDGA 5EU3B 1L7IH 3HTLX 5HYSG 1NUDA 5D2LB 4PJDF 1EIBA 5C0IB 3BZEA 5IVOA 4UIMA 4UV4H 4FFZH 2AV1A 3QQ4A 4U33A 4ZTOL 2AJ3B 3NIGF 1IZJA 1MIMH 1S78D 1LDPL 5TDOA 3IJYA 1ZHLA 2CK2A 1N2RB 4YR6A 1E4JA 4JM2C 3RY6C 2FWOB 2V9TA 1CVRA 2A77L 3V6OC 1MFEH 2GJZB 1V3LA 1BBDH 1MHEB 4MJ6A 5H37G 3AU1B 1H8NA 4L29A 2QJDA 4KMQA 2H32B 2IG2H 1XIWA 3QWQB 4FN0A 5E94A 1JBJA 4PGZA 1MOEA 1YEGL 3MNVB 3SQBA 3DSFH 2DWEB 3HC3L 2AJZA 4GAYB 1I8IA 1I8KB 4NQDA 2FZ3B 4BQ6A 2VDKH 3C2SA 3P11L 1G6RB 3H9YA 4CVUA 1CL7H 2W92A 1IGYA 5IHZB 3RI5F 3P4LA 3TN0B 2J8OA 1FLRL 5EIQA 3VGEA 2Q8AH 4EOWH 3RVTC 4NRYB 3W9DB 3QDAA 4K23L 1XGTA 4AZ8A 1PKOA 3QIUD 3RA7H 3S4SA 4G42A 4QHKJ 3U9PH 5JUEL 1NFDF 2PW2A 4PJGF 4CW1A 1TVHB 1T20A 3VFUA 4DEPB 3ARFC 4R2GB 1C7SA 4ODHH 5I74C 3PP3H 4IRJD 1I3UA 3OR6A 1FSKB 4XTRC 3IDUA 3KHOA 3ZKND 4MAYD 5GRJH 2GTWA 2XTJB 4RWYL 4J2XA 1JWMB 3KNBB 4M93B 3VXRD 4GT7A 2WINB 4J3VA 1CBVL 4LLQA 2BHZA 4U1MA 4KHTH 5GSVA 4PGCA 2PYEA 1QBMH 4MNQA 1EO8H 1MH5A 1AR1C 1F4YH 4QRRA 2IEPA 4P49A 5DZOA 1KJMA 4LCIH 1CFNA 3NZHL 1DL7H 3ULUE 1FVDA 1JN6A 4MWFB 5JW4R 1C5CL 3GMOA 5F96H 3DXAD 1ZLWK 1BZ9A 1CLOH 3TT1L 1XCQA 3NGBC 2CRZA 4YX2H 2X89A 3HE7C 5JORB 3WO4C 1QA9B 4MQXC 1A7RL 2VXUH 4G6ML 1U36A 4N8CL 4OZIF 4P9HH 1PG7X 2EIEA 4OCYL 3U30B 1YNKL 3O3UN 4RGNC 4HIHB 5D7LD 1FZMA 4ZFGL 4WI5A 1U8KB 4WFEE 5GGQL 1XGRA 3HZYA 4EI5C 2R8SL 1FZOB 3OB8A 3GBNL 5E5MA 2DM3A 3EYFB 2AS5M 1OF2A 2BVUA 1MIEH 1KJ2H 4NQSA 4PD4K 3U4EB 1W0VA 4GAGH 5EN2B 1J05B 4U3HA 2BFVL 3CPLA 5GGRA 3QNXA 1JPTH 3HB3D 4AEHH 1IGMH 3JV4A 3OGOE 4ONHB 5A2KH 3L3KB 3HE6A 4OUUA 4YDLC 1TZGH 4HW6A 3SO5A 1OAXL 5IJVB 5IV2B 3W82A 3EYUH 1FYTE 2DM2A 3PDGA 3WIFB 4JGJA 4N0UB 3K3QA 4FXKB 3MCLH 4PB9L 1F8TH 2R39A 2VN7A 1A6ZA 2V2TB 1T2QH 5MP6L 2VAJA 3Q2CA 3BI9X 4IOIA 4K8RL 5HI5D 3CDYA 1PY4A 1Q9OB 3GSNL 4HWEL 2YPKB 3BP6A 3L95A 4F33B 3WE6B 4ZS6D 5I1IL 3R06B 5EO0A 1ES0A 3WNLA 4OUOA 3LMJL 4JY4A 3LKRA 4GUPB 3FJTA 4HKJA 3QDMD 4NZJA 3QG7L 3EOAA 4QXUH 2W65B 5DMKA 3H3BC 3P0VH 3MUGA 3AMLA 3WHE1 1F02I 3IETB 5DD3H 1Z9LA 3W0WD 1V3MA 1T5WB 3TJHD 3OJDB 4XNYL 2C1PA 4I9WE 3TIDA 1FORL 5FYJL 3TV3L 4XHJD 1UH3A 4PRNB 1U8MB 2H2PC 1DFBH 3F7QA 4MAUL 3C09C 5GRUL 2C3VB 5KS9E 5LBSL 5I15H 1IT9L 4HUKB 3F7VB 1CYGA 2DYPA 4AMKH 2ORBH 5AYQA 3Q6FB 1EEQA 3A6CL 4MX7B 4PJ7E 4KVCL 4QY8B 1T03H 4XCEA 5JLZA 3RZCD 4Y1AB 4HBCH 3BDBA 2XZAH 3VI3F 3BXNA 2WNGA 1RZKC 5IW1B 4OCSL 1J0YA 1F5WA 1SM3H 2QADD 3V7AE 3DIFA 3WSQH 2VLME 1MFAL 3WKMH 1I3RA 3R1GL 3EYOB 2BHYA 4WHTB 4C56B 5B8CB 2JCCF 3EYVB 4ZO8A 5T5FL 5EU4B 1SMAA 1OCWH 2XKNB 4OLUL 3PQYD 4NKOA 2PXYA 1CXFA 2R1XB 1OL0A 2EDHA 1NBZA 2P42B 2Z4QA 3IFOA 1FO0L 4YHPA 4HDIB 4OGXL 3PIQB 4XBGB 4G6JL 2Q7NA 1G7QB 4LARH 1SVCP 3BKYH 1XGQA 2IWGA 3SDDD 5K9JL 1FL5A 3B9DA 2OJZL 4WVRA 3QFDA 2BSRA 4R3SA 3LQAC 3V6ZA 3BYTA 3DOSA 3Q5TA 2EXYC 2HJFB 5HDLA 4JKMA 3EO1B 5JW3H 2M2DA 2OM5A 4KKLC 4JFXB 3KXFE 4Y8DC 4Z7WE 3REWA 5KG9B 3AFLA 4KZEL 1A7QH 2GTZB 2MCPH 5C3TA 4X7DC 4X6BA 5MI0B 2BNRD 1F6AA 3IVKB 1DE4B 3H9ZA 5KVMC 2DKUA 1S9XA 4QOKE 4X8JB 3SDAA 3UJIL 4X6EA 4R96B 1AXIB 4DWHA 2CIKB