4HZAA

Crystal structure of the immunoglobulin variable domain of nectin-2 in monoclinic form
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
124
Chain Sequence
MQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poliovirus receptor-related protein 2
publication title Crystal Structure of the Immunoglobulin variable domain of Nectin-2 in monoclinic form
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 24
structure length 124
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzaA00
5I1KH 2CLRA 4MA3A 1BFVL 4MJ5B 3WO4B 4I48B 4P5TB 4I3RL 2OR8A 1U2HA 4MGXA 3MA7B 5MEPB 3TC9A 4LAJH 5HYQA 3IDUA 1T04A 3C5SA 2VC2H 4LLQB 3C8KA 4GG8A 3ABZA 1FH5H 5AEAA 1T0PB 4GQPH 3MRJA 1CFSA 4NO0D 4O2CB 1NCUA 1A1MA 3QJHB 4YXHH 1CU4H 1F4HA 5HJ3B 3NN8B 4UDTB 3KHOA 2EDNA 1C1EL 1QFWL 3TWCH 1YNKH 5GZNC 3U36A 1VGKB 4MAUL 5TH2A 1I3VA 4XZUA 1EO7A 5C08D 5K9OA 2J8OA 1IFHL 1IL1A 1CF8L 1UXSA 4LKCB 2DQFA 1ACYL 3S96A 5I1DA 4LSDA 4YO0A 1FFPA 1RAMA 2FDBP 5HGDB 5CWSB 3T8XA 4M5YL 1HHJA 3TPKA 5I75B 2GI7A 4H20H 3RVWD 4PJ9B 1YYMH 4KPHH 4X5LA 1MI5A 1SJXA 2W65B 2QQKL 4P57A 1XF2B 3BDBA 4LBEB 1EZVY 1KJ2A 4WHTA 4ZTPH 4XMKL 4YXKL 1HWHB 4XTRC 3T0EB 1U8MB 4ZFGH 1INQB 1OAQH 2X4TB 4JRXD 5EBLA 4KDTA 2AEPH 2Q3AA 3GRWH 4O00A 1BBDH 4N1CA 3TH3T 3QI9A 3LPWA 1UQSA 2IQ9L 4LCWD 4MQSB 5DUMH 1U8LB 4OZFG 3NGBC 4HS6B 3STZB 3L95B 2DJUA 3VJ6A 1FVDB 4HWNA 4HX1A 4AEIH 1AXIB 3LD8C 1BGXH 1RIVH 5EA0H 1I7ZB 3FT4B 1P84J 4WCYH 3DMMC 1T2XA 1T66D 3BH9A 5ACLA 3C5ZD 4U1MB 4NQCD 4BZ1H 4U05A 3KLSA 4PJGF 3ULUD 4GMSH 4M61B 5D2NB 5I8CA 2UY6A 3ALPA 2MCPH 4OF8A 5CZKA 1T1XA 1YEFL 4F7TB 1T1YB 5GGQL 4OF0A 5L6YH 2HVKA 3PQYB 4HW6A 5T3ZD 4GAFB 3MPCA 4FTVD 1F6AA 1KYOK 4XVTH 3RWGB 5C07E 1F3DH 2HAZA 2V9RA 4P59H 4R4NC 1YMMD 1DQLH 5EZOL 1ZTXL 3CU1A 4TSCL 1LK3H 5E1AA 5DI8B 5IM7B 1VKXB 1QSEE 4QEGA 3S36X 3GHEL 1NUNB 5EU6E 3E3QC 2DTML 4P5TD 1DQTA 4KTDH 5TPWL 2XT1B 2JJTA 4Z95H 2R1XA 5HD8C 1BHGA 4LAQL 5DRZA 1YN7B 2RQ8A 1OTSD 2Y7QA 1GJIA 1YDPB 3PWPE 3VXSE 5HPMA 1XZ0B 1CFQA 5DA4A 3MQIA 2OTPA 1ES0B 1F11A 3PWUA 3ARUA 3BIKB 3K2UH 5D7IF 5C6TL 1PYWB 1UM4H 5GHWL 1RZGA 4KKNA 4X8JB 1J8HA 4E5XA 3P9MB 4NQDB 2EIZA 4U2ZA 1BQHA 5F1NA 3CGTA 5J57B 4RGMB 3UTSD 5INDA 4G7VL 5B38A 5ID0A 4XNQB 1FZMB 1PKQB 3BISA 1UCBH 1U3HC 2NW2A 5FKAB 1RUKH 3HRZB 35C8H 5JXED 3DV6B 4LLUB 1A7QH 1UXWA 2O5ZH 3WUWB 4LPWA 5T1LB 5T1KA 5KVGL 2GJJA 4KK6D 2BSTB 1OARL 1TVHB 1RZIB 4HXAL 2BSED 3RKPA 3BWAA 1BFVH 3BP4B 1FFNA 1H0DA 1CGUA 2HRPL 3E6FA 2ITDA 5F1SA 3RVUC 4I3RH 4KI5C 5I1LA 2CDFA 3P4LA 4XAKE 4DKDC 1TVDA 1UYWL 1FYTD 4POUB 2XTJE 3QUKA 4G42A 3ECBB 4X4ZA 3GSUB 4RCAA 2AXHA 1OAKL 4X6CE 3AB0B 4PJHA 2O5XL 3IGAB 5EU4A 3GMMB 1R3HA 2EYTB 2XY1A 4WHYH 5EZIL 1CCZA 3H9SE 4TTDC 3DETC 1C1EH 1QFWH 4L3AA 3BIBX 1LE5B 1NAML 1IGFL 2DWEA 3O3AB 4MAUH 1ULVA 1YY8B 3IAPA 3MYZA 2OTUA 4PJAA 1GGCL 1IFHH 1CF8H 3QCUL 4GRWE 4V1DB 5BRZA 1ACYH 3UTPE 3ULVF 4NO3B 4PG9A 2PO6B 4GLRI 4M5YH 4YUEL 1M1SA 1Z9LA 3CXHJ 3EYOA 3MRKA 5J1AB 1WTGT 1HXYB 2Z8RA 3LPFA 1KTLA 2QQKH 3B5HA 5SX4I 1X5HA 2P43B 4MQ7B 1EV2E 3DARA 4XMKH 4YXKH 5J6HB 5ACZA 5GSVB 1WIPA 1ZT7A 4FQHB 5GGUA 3EGSA 4NQXB 5ANMA 1WCQA 2E9IA 4I9WD 1IEHA 1KTKE 3MV7D 2V5TA 4NKDB 5FYKE 4Z7OE 1IKNA 1FZKA 2CGRL 1F42A 2JE8A 3SKJL 4IJ3B 2IQ9H 2IADA 4ODVL 3SBWA 4P2QB 5T33L 3E1F1 4JLRB 3IKCA 5IK3A 4C54A 5DK3A 2B2XL 3GSXA 1ZHLA 2X4RB 4L3EE 5ERWB 2D03L 3ZHLA 1INEL 1ED3A 1AGEB 3SGKC 2J8UB 3V7MA 4BSWB 5L2KE 1EFXA 4LKXB 1QNZL 1HHKB 1IC7L 4AIZB 3QEUB 2FHFA 4YDLC 3F7PC 1J88A 1G6RL 1WWBX 4WV1C 4H0HB 3SDAD 4AM0A 1YEFH 4ZAKB 3I6LE 1R3KA 3GIVB 5GGQH 5C9JA 3DXAE 1HHIB 3LKQB 2P8LB 4WI5A 2V9TA 4IOFC 2CIIA 3RX7A 2D9CA 3RY5A 5FECA 1UB6B 2EIEA 2X7LB 2BVOB 5EZOH 3GKZA 1XGYL 1ZTXH 4TSCH 3OAYK 3FTGB 3SDYL 1E6JL 3SDXE 3L3JA 1DE4B 3GHEH 4RDQF 3VFUB 4NKOB 1M71A 2DTMH 5TPWH 5FO8B 4XCCL 3SO3C 5IVXB 1UZ6E 2P5ED 4LAQH 5IFHL 4EKXA 4XPGL 4Q6IA 4LVOC 1A1NA 5CBEB 1ZHBB 3R0NA 3SKMB 2H6PA 2XG5A 1D5IL 3OX8B 2RAMA 3F12A 1Z0MA 3T0DA 4OKDA 2AGJL 5ICXB 5C6TH 2BP3A 3TM6A 4OM1L 5GHWH 4CN4A 2NY2D 5EOQL 1UGNA 3N1FC 3WNOA 3O4OB 5E8EB 3MUHL 3D85D 3RBGA 4EVNB 4JM2B 3VXMA 4ZFFA 4G7VH 2NTSP 4V2BA 1NFDA 1BOGB 3ARFA 3DLQR 1ADQL 3EYFB 2NY5C 3RL1B 4R7DA 2GK0B 3MRDB 1VFBA 2YA2A 4IOIA 3OJ2C 5KVDL 4UT6L 3RVXC 2VH5L 5B3JE 5F3HA 4DZBB 4NO2B 5KVGH 3FQXB 3SEPA 1OARH 4HXAH 4JZNB 5SX5K 3MMEB 4ZUVA 5IVZA 2HRPH 4X0KA 3JZ7A 4M03A 5KS9B 2VN7A 3TH4T 1UYWH 1KIQA 3GUTB 2FCBA 1I7UB 3REVB 2GYSA 5IOPA 3CDYA 4UI2A 4CU7A 3BMWA 3MV9D 3ARPA 1OAKH 3VU2A 5F7NC 3GI9L 4W70A 2O5XH 3HE7A 3KPNB 5EUOE 4NKMA 5EU3A 1C16A 5EZIH 4I0PD 4Z0XA 1UM5L 5D2LA 4HWZA 3O4LE 3SGEI 4GFTB 3H3BC 1KUMA 1NAMH 1IGFH 3VFRA 1BFSA 1Y0LA 1XIWD 4QRUA 4PRDA 1GGCH 3GM8A 3QCUH 3STBA 5C0BB 2NNAB 5CZXC 5I2IB 1FNFA 4L4TA 4PRPE 4G8GB 5CGTA 3ROOB 3SCMB 1S7VA 1G1CA 1T4KA 1GAFL 4YUEH 1IGJA 1GGIL 1QQDB 4ELKA 4TRPL 4MQXD 4JGJA 4AQOA 2IH3B 5ETUB 3C6LC 3C08L 3MV7A 2CKBB 1S9VB 3KJ4B 5B8CC 5IVNA 4KUZL 3IXAB 4QHKJ 2NY1D 1K4DA 1I85A 5CJBA 4Y2DB 1P4BL 2ZOLA 4MB4A 1MCKA 2CRIA 2I25N 3HZMA 3U7WL 5HXMA 4GSDL 5I1EL 4UMGA 3MV11 3CZFA 3DVFA 2QV2A 4EUPG 1MI5E 2CGRH 4WUUD 4GAGL 2M26A 3DYPA 4DN4L 3SKJH 4PP1D 1FGVL 4HULB 3S8WA 5KSVB 4ODVH 1AXSB 2CXGA 5T33H 3PWLB 3A0OA 4RAVA 4TUJA 1JI2A 3RVVC 3MCLL 2B2XH 2D03H 4MNGA 1INEH 4PJ8B 3VXTB 4CADA 5JW3L 4OZFB 1UZ8B 1FPTL 5CLTA 2PR4L 3CC5A 1QNZH 1IC7H 4KRPD 2D0GA 3QUZB 3UTQA 1LHZA 1TZHA 3OTTA 3JV6B 1PDKA 1G6RH 1YN6A 4ZXBC 5BMFL 3TBYA 2I9TB 3V5HB 2ORBL 4E0RA 1FBIL 2B20A 2VERN 3TNNB 2N7BA 1FVCA 2C1OA 1BZQK 2Q7YA 5CUSL 1LVEA 2P5EA 4ZOBA 2IANB 5DJZA 5FYLL 3WIFB 3D48R 1UT9A 4NWTL 1XGYH 2NY4C 4Z76B 1DSFL 1URLA 4HBCL 3SDYH 5ESQB 2BVEA 2P8MB 5MERB 5FCSH 5GRYA 1D5MA 1HKLL 2A73A 3S36L 1OL0A 5HGGS 5CLWA 5MENA 4XCCH 3EYSL 1ZK9A 2YD1A 1NC2B 4M48L 5IFHH 4XPGH 1WAAA 5DRXB 4MYWB 1D5IH 3O3DB 1XF5A 3REWB 3WFEL 4OZIB 1RUML 4D9QD 1FRGL 2AGJH 5A1AA 1JZ2A 1KPRB 2CJUL 4OM1H 3IDJA 5HDQL 5EOQH 1L9NA 3LQAL 3T4AB 1W8NA 3HI6L 2XKSA 2ITCB 1Q0XL 3RZCA 2OJEB 3EJZD 4YX2L 3DGGB 5HGHB 4ZUTA 1KCLA 4YFDB 3KPLA 1I9RL 1ADQH 4OB5L 3I2CL 1BOYA 5LJYH 2YEZA 1J8HE 2VLRD 3P4OB 1RHHA 2D7QA 3DVGA 3NBNA 2X4SB 5KVDH 4GG6F 4UT6H 2RHEA 2VH5H 3QXTA 2D7MA 4X9IA 2BNRD 4POZC 5J12B 4F37F 1NFKA 2ZCKL 4OBSA 4BM7A 5FOBA 2KKQA 3MROB 3OJDB 3P40A 1DVFB 4XPAL 2XWTA 4NZTL 3O3BB 5BW7A 2OL3A 5J3HC 4ONOA 4CVWA 5F6HJ 3TT1L 3FOMA 3TNMA 1P5VA 1HK6A 2OR7A 4JAMB 2WUCL 4ODTL 1F00I 1JMXA 3GI9H 5D93B 5DRWA 1F3DJ 4QOKA 4Y4KA 1NFIB 3CVHB 3O8XC 1KF9B 2A9ML 4JKWA 4YHLL 1ND0B 3AAZB 3D39B 1T2JA 1UM5H 4W6YB 5JA8B 2AQ2A 2VRAA 1A3QA 4UOW1 3LMJL 4NQEA 3MBED 3M45A 1RD6A 4YXLL 1EFQA 2LTQC 1W8OA 3RIAF 2DB8A 1CT8A 5HHXL 1JWMB 3QIBC 1E0OB 4PJCF 2W9LA 4YHML 1GAFH 1GGIH 5CSZA 4TRPH 3G6AA 3PABB 4WFHD 5F7YC 1HH6A 1XF3B 3C08H 5TE6L 4D0CB 1WEJL 5KSBB 4PJXF 4KUZH 1RJLB 3GJFB 4F9LA 4ETYA 1CFBA 3Q3GB 4NO5B 4YIQB 2GTZB 1AR1C 3FO2A 1P4BH 4ZODA 3U7WH 4OFKA 1G7PA 4GSDH 5I1EH 1YNLL 5IP4A 1RJYB 1NEUA 3FCTA 4GAGH 4DN4H 5JHDA 3AXLB 4RFEB 1FGVH 3U30C 2FZ3B 2HMID 4MVBD 1FNAA 3L3GB 4HCRL 5I71B 5ANME 4FG6C 1U8QB 4ZS6C 5KG9B 3MREB 3MCLH 1WCBB 1OY3B 5AG9A 3VXPB 1L7IL 4JDVB 3VCLB 4K71B 5JW3H 1FPTH 2PR4H 4OZ4B 1OD7A 1MCHA 4LP4A 1KGCE 4NBXB 4PJEF 4WW2B 4PJGE 3WFDL 4KI5F 5D1QD 5HHOA 4NFBA 2ADJA 1QSVA 4WWKD 1HHGB 5F89B 5BMFH 1T6WA 4OCMC 4PJ5A 2ORBH 1FBIH 3HPJB 4DAGL 1MNUL 5E00B 1FQ9C 5CUSH 1W0WA 3QEGL 4Y5XC 2H2PC 2P5WD 1A4KB 4UT9L 3LV3B 5C0CA 3ULUC 5FYLH 1BD2E 2W0PA 3BZDA 4NWTH 4N0FA 2VUOA 1FN4B 1DN0B 1DSFH 4HBCH 4GXVL 1GCFA 1RURL 2EZ0D 4WY7L 2BX5A 2FWOB 3WNLA 4G9FB 1HKLH 3S36H 5GZOC 4K7FA 3DRQA 3EYSH 2ZPKL 5SWSD 4UAOC 2CK2A 3A6BL 1UM6L 4JN1L 1JTPA 1P69B 5IBLC 4Z7UB 2H9GB 3LEXB 1OGAD 2WWMC 3WFEH 1RUMH 4BFIB 4GS7C 5DD5L 1FRGH 4TSAL 1F4XL 2CJUH 4P5TC 5HDQH 5D7IE 1Q9LB 3LQAH 3OG6B 3HI6H 5EC1A 3MRIA 4NRZB 4UQ3B 4OI8A 1KLGA 1U41A 8FABB 1Q0XH 5BQ7B 4GG6A 4YX2H 2HT4D 3IDNA 1I9RH 4OB5H 4QYOB 3QFJE 3I2CH 1A02N 2BOCB 4MJ4A 1TFHA 4X5WA 4N0YL 5K9QI 5BJTA 2W91A 1XGUB 4WENB 1MCOL 2ZCKH 3OKOA 2VZ3A 1E27B 2GT9B 4XPAH 2CKNA 4NZTH 2L4OA 1R5VA 2W92A 5A2LH 3CFDB 5CKAA 1N6VA 2ICEA 3SE4C 1MCSA 4FS0A 1D3CA 3RKDC 3TT1H 5JXEC 2AXFA 1BECA 5BV7B 3ZYOA 2YZ8A 5LGJB 2WUCH 4ODTH 4HK0A 2AK4A 1K2DA 1OGTB 1U8NA 4ZFOB 5K93A 4O51B 3BP6B 4HFWB 4AENB 2A9MH 3GEWB 1S5HA 4YHLH 2GAZB 5A2IH 4LSQL 1KB5B 2VZ1A 3LMJH 1OW0C 4QRPE 4WFFD 4YXLH 2AJYL 1TZGL 4QRQB 4HS3A 5HHXH 3VXRB 4PGZA 2WUBL 3ULVE 2X44D 4YHMH 3L5WA 4RNRA 4OIBA 3NCMA 1DEEA 4Q7DA 4XP4L 1Q9KA 5TE6H 1WEJH 3QDJA 1RMFL 4ZPTA 4IRJD 1L7TL 3LZFL 3OKLB 3CFEA 4L4TE 3U4BL 4WGWB 4EOWL 4TVPD 2VIRB 1NAKL 1QRNB 3VRJA 2BSRA 3TPUA 3B9KB 3ULSB 1D7FA 3X13B 3BN3B 5DMKB 1YNLH 5EO0A 3GSQB 3AREB 4J3XA 4XPFL 5D2NC 1DANU 3D3VE 5KANI 3AU1B 5FK9A 4RWHA 3M1BB 3BGMA 3RWFB 4EDXB 1FNHA 2Q6WB 1SHMA 3MGTB 4HCRH 3T1WA 5F8RC 4CGTA 2BERA 3DJ9A 1VPOL 3T2PA 2NW3A 4FXKB 5DJ0B 2C9AA 3O6LL 4JZOA 3VRIB 1JPFA 2XZCL 1I8IA 4LHUA 4RGNB 1TPXC 3IFPA 1L7IH 2Z8SA 3V6FA 4YHYB 2W07A 6CGTA 4NBYB 3RWJB 2XN9D 3D25A 4Y19E 5FYJE 4WTWA 3ARDA 4A6YA 1X5KA 4QHKI 2RCSL 3WEXA 3WFDH 1CE6B 4PP2A 3SN6N 2E7CA 1GGUA 4AEFA 2YC1A 3DHJA 1FV1B 4UUJA 5D1XB 3CXDL 2P8PB 2X70A 4EUPH 4DAGH 1MNUH 2R9HD 3HS0A 4BFBD 3QEGH 4PPTA 4UT9H 2GITB 3FFCB 4NT6B 3DX6A 3LAFA 3SDAC 4GXVH 4JPWL 1DZBA 3DPBA 3ZKNC 1JRHL 1RURH 4WY7H 3TA3D 5C8JB 1C8PA 3CFIC 1QUNA 1NBYB 3IDGB 3MO1B 3VWKB 1TTUA 1JF6A 2ZPKH 2CRMA 3A6BH 1UM6H 2VR4A 4IRSD 1A2YA 2HJKA 1B90A 1FLTX 4JN1H 3KPPB 5GGRB 1AQDB 1MVUB 1QKZL 5DS8B 2X9XA 2QR0A 5I76A 3MLXL 3TCLA 4JANB 5DD5H 5E08L 2PXYD 1MCDA 5MENE 3QG6A 1F4XH 4TSAH 5LVEA 3QIUD 5A3IC 4HHAA 2Z9TA 4J2XA 1CL7L 3D0VA 4P5KB 5FIEA 3VWJD 5D6CA 2XV6B 3OR7B 3PJSA 4GXUN 4NKIL 3LKSB 3O2DA 1TQCC 4IBLT 5FA3A 2IH1A 3I6KA 2CMRL 4XH2B 3ARGD 4N0YH 5DMYA 5T5NF 5C0IB 1MJ7L 3ES6A 3SGKA 4MNQD 4DOHB 4MNHB 3L3OA 1MCOH 4CVXB 3B9VA 3G04A 2ZG3A 3MRFB 5HYJA 2E7LA 4NUJB 1A22B 1EPFA 4QRTA 1VB9A 5CHNB 1S7QB 3BZ4B 3S35X 3NMEA 4PV9A 1S7XB 3U0TB 4WV1A 3SJVD 4F37K 2PO6C 3BP5B 3L9RB 2Z35B 5KN5A 1IGTA 5C0JB 1CGVA 1E28B 4BKLB 4IIQA 4JRYB 3DI3B 4HKXA 1GGBL 1G7HA 2P49B 7CGTA 3ZKXB 2BY1A 2WIIB 4ZO9A 4GQ9L 4LSQH 4P2RD 5IG7A 1T2QL 2LVEA 5K59F 1PG7X 2JIXA 2Y25A 5FUCC 2AJYH 4QOKE 5HGAA 5D1ZD 1TZGH 4HUKB 2A83A 4IJ3C 2WUBH 3S4SA 1OTUD 1MCWM 5E9DD 4U6HB 3D2UB 4PLJD 1FCCA 2APFA 4XP4H 2IFFL 3RIAK 2WK2A 4NQEE 1EK3A 1XIWC 1RMFH 3LRSB 5AYQA 3QRGL 4LCCB 1D5ZA 4ZOAA 1L7TH 1G7MA 5BS0E 3LZFH 5GRZA 3V5DA 3U4BH 5CGMA 4EOWH 2DLFL 4Y8AA 2JCCF 2MHAA 3UAJC 2DJSA 1NAKH 3WL9A 2Y23A 4OCSL 4KZEL 1UKTA 4HIHA 1G84A 4S11A 1NC4A 3ILQD 5E8OB 4XPFH 3BZFA 3ESVF 2NXYB 4GRLB 1LO5B 4FFZL 4IOSD 2VN4A 1G7IA 1ZHKA 4ZAKC 2G9HA 1KIUA 3KPRE 3BZEB 4M6OL 2NY1C 3R0MA 5D9SB 2C1PA 1RZFL 4OBRA 4XVJL 4NRYA 4HUVA 1VPOH 3MUJA 3X14B 2X5PA 3O6LH 1PGRB 2XZCH 4ZQKA 4LHQB 3DSFL 4EN3B 2QKIA 3VMPA 4KRMB 1BMGA 4L9LB 4XT1C 1YNTA 3W0WE 1JZ8A 1JWSA 3BHBA 4XVUD 2V7NB 2HFFB 3DSNA 2RCSH 3ISWA 1X4XA 5FYKL 4JKPL 3D1MC 1HDMB 4JFED 1BFTA 3BQUB 3ETBF 3CXDH 3PDOA 4JFPB 3T08A 1DDHA 1KLUB 1UA6L 2KZ1B 1GOFA 3GK8L 3TYGL 5BZDA 2VOTA 3FRPA 3O4OC 2RR3A 2N1KA 4BSVA 4QWWD 3IRPX 4M00A 5C07B 2FLRT 3MJ8B 4JPWH 3TIEB 1JRHH 3FQWA 3W9DA 2GFBA 4JHWL 2ICCA 2Z8VC 3C6LA 1QSEB 1F2QA 4YLQT 4YHIB 1CE1L 5EU6B 4B53A 2UUDK 1EUTA 3WJLC 5B8CA 4J3WA 3QG7L 4U3CA 1QKZH 1I9EA 4XNYL 1FAKT 4JDTH 3PWPB 4G6ML 3VXSB 3MLXH 4UU9B 4PRIE 1Q9OB 3VXUB 5E08H 5ESAA 4ZUSA 2A6DA 3OB0H 4NZDA 3U9UA 5IW6A 1CL7H 1HI6B 3ZDZF 4DFHA 5L88L 1NMBL 2BVQB 2ZOKA 4NKIH 3P73A 2PCPA 4I5BA 3IRZA 1X6LA 3MCG1 2F54A 2Q1EA 2FHBA 1BQHG 2CMRH 2PYEA 5B38G 5J1SC 3OG4B 5GGTA 3ZKMD 2NR6D 4PV8B 1X9QA 4QRRD 1QEWB 1U8IA 1MJ7H 1T3FA 4K07A 1S7TB 5AAMA 4GG6E 1V05A 3WD5L 4UOW0 3C09C 1HEZA 4JY4A 3EJZC 4MB3A 1CFVL 1H3UA 4MA8L 2G75A 1FNEB 1F3JB 4HJGB 2YRLA 3PGFL 5EN2B 2APBA 3KHQA 5C09B 4JFOA 2WP3O 4ZXBA 4XX1E 3NH7L 3SCMC 4X99A 3HPLA 4P2RA 2YUXA 2A38A 3NCCB 4JZJA 3L6FA 1N7ML 1LGVA 3CSYB 4P46B 4RMUA 5DQ9B 1JF1B 1GGBH 1HYRC 3FB8B 4WFED 4FQJL 3KGRA 4PGBB 4MJID 4X6CB 3PIQA 1G7QA 3A67L 4GQ9H 4Y2DC 3VFSB 5CEXB 1QSFD 4LSUL 1QZ1A 3RX8A 3TBTB 1T2QH 3JWOC 1KCSL 3H9SB 5BVJA 2IQAA 2AK4E 2YD9A 1T0NA 3QEQA 3ULUF 2YPKA 4GRWB 4RA3A 5TGBB 3JSSA 1QG3A 4OKVA 5LCVL 2D7PA 3O9WB 1IARB 4NJAL 4PJCE 3AGVA 2IFFH 2R0ZL 1CYGA 1G7JA 2IAMB 3DX8A 2NY3D 3QRGH 2FSEB 1Y6NR 3QUXD 5H2BA 4PJXE 4TULL 2DLFH 3J7HA 4F7MA 3DRTB 4OCSH 4KZEH 3MXWL 2LAAA 5IEHA 2DKUA 4Z77A 1YUHA 2BNQA 4K94C 1K3IA 4PRNA 3QDJE 3I6GA 3V95A 3NFSL 2OLDA 4FFZH 4YBHA 1BIHA 3BDXA 5F7DB 4U2YA 4M6OH 4GBXB 1G9NC 4G8FA 1RZFH 3MRNB 3QDGE 4XVJH 4MLIA 3B6SA 5MHSD 4G8EB 3S3JA 3QA3A 1D9KD 4Y7MA 1KJMA 2R2CA 2EYSB 3DSFH 4ETQA 1EVUA 2BMKB 4L3EB 2WQRA 3UZVB 2OZ4A 3PDDA 4HPOL 3NFNA 4DJMA 2A9NL 4XCNB 4YFLF 2VYRE 4PJEE 5FYKH 4JKPH 3O8XA 4KI5E 3HN3A 1U8KB 1KJ2L 4G3YL 1KPVA 4HV8A 1UA6H 1ZANL 2VQ1A 4OUUB 4ELMB 2ATPB 3DXAB 4XXDB 3GK8H 3TYGH 3V0AC 4D3CL 5F1IB 4D2NA 3RTQB 2CUMA 2FJHB 3QIBA 1U8OA 2XOTA 1KT2A 3OZ9L 4WWKC 3THML 1K85A 3QZWG 1NGXB 4JHWH 1NDGA 1UB5A 2E6QA 5DHVA 1CE1H 2AKRA 3GSRA 3KXFA 2GY7B 2FO4B 3RJDA 3QG7H 2KL6A 1A9BA 5EU5B 4XNYH 5J12C 3CDCA 4G6MH 4ONHB 1W72B 2EZ0C 1Q94B 4R2GD 1DVFC 4HG4K 4HGWA 2J1KA 4E42A 3IDMB 2RB8A 5L88H 1NMBH 2OTWB 3DOSA 1WBXA 4MS8D 1EEQA 4GUPA 1AP2B 3IDIB 4NZJA 2FR4A 5AWNL 5D93C 3QXUA 3VFTA 1ITBB 2VL4A 4MJ6B 4EI6B 4GJTB 4XCEB 1OB1B 2AJXL 2FJFA 1KG0A 1WITA 1I7TB 4UQ2B 4NRXB 5FO7B 2Z91A 4U1HB 3NFPB 5CD5D 2OX5A 3WD5H 4JQVA 1W0VA 2EDKA 3DX7B 5EBWB 5JW4R 1CFVH 3FQNA 4NP4L 4MA8H 1MIEL 4D0DA 1ZSDA 3QO1A 3PGFH 2VWEC 4PB0L 3UPRA 4WNQB 3NH7H 1DQJA 2C3VB 2W0FB 3KPQB 2F53D 1N7MH 3MJ6A 3O41B 1GGYA 2HFGL 4P5MA 2WBJB 4FQJH 2ADIA 5HDOA 1FG9C 4Y5XA 1E4XI 5D96B 1NPUA 3GI8L 4K23L 3A67H 3FB5A 3PG2A 5EUOB 1GH7A 4FQXB 4LSUH 1QFOA 3J8F7 3CX2A 1KCSH 4OGXL 4Q9RL 5DEGA 4ESKA 3O4LB 1PG7L 1P7QD 2QBWA 4X7CC 5D7KD 1REIA 3OKKB 5GGSA 4LLVB 2VZSA 1T80A 1AJ7L 4QGTA 4X4YB 1KCVL 1YPZA 4TTGA 1I1AD 5LCVH 4PRPB 2EIBA 4NJAH 4BQ9A 5I71C 2CR3A 5SWZA 4O9HL 3VFVB 2WANA 3HUJB 2R0ZH 3GMQB 1INDL 4MJ5A 1OT2A 3QWQB 4I48A 1F45A 2GJ6D 1Y6MR 4TULH 4K71C 3LS5L 1VACB 1W0YT 4L3CB 3MA7A 5MEPA 5B39G 3MXWH 4LLQA 3NPZB 2DS4A 2M1KA 2QADD 1P5UA 1AXTL 1J0YA 1SBSL 2HVJB 3NFSH 5I8KL 4ERSL 2VJXA 5E5MB 4O2CA 3QJHA 3KG5A 5HJ3A 43CAB 1IM9B 3NN8A 4UDTA 3BXNB 1B4JL 1CZ8L 4RX4A 5CJOL 1VGKA 4WI6A 4LKCA 3CCHB 4CMMB 2A6JB 1AC6A 2WW8A 5AD0B 5HGDA 3SE4A 5CWSA 3IJSB 5CP7B 2OJZL 4R4BB 4F7PB 1CDBA 4HPOH 4PJ9A 5EUKB 2A9NH 2NTFB 1SVCP 2FL5B 5IW1B 1YJDL 1I3RB 3TO4B 2W65A 2M2DA 1XF2A 2D4DA 1U93B 4LBEA 2VLJB 1I1RA 1KJ2H 4G3YH 1TITA 4E41B 3T0EA 1U8MA 3B2UD 1ZANH 1INQA 4U6TA 2BCKB 2X4TA 2ZUQB 1OW0A 1NMCB 2IWGA 4D3CH 1C7TA 1Q72L 2AJVL 3T0WA 4R7NB 3BAEL 4RDQG 3THMH 3OZ9H 1HSBB 3B2VL 1U8LA 5J9PB 2IBZY 4HS6A 3STZA 3L95A 8CGTA 1FVDA 5T1MB 3KYAA 5J7CC 1WC7B 2Y07L 3K74B 1I7ZA 1M7DB 3FT4A 5J11B 1T7XA 1V8HA 3ZSTA 4KGLA 3OGCB 2X41A 5DJ2B 3UZEA 2YD8A 4U1KB 4U1MA 3ILPB 1R3JB 1MY5A 4LPYA 4JFFD 1F58L 4M61A 5D2NA 2VLKE 1DLFL 5GRXG 3SOBL 3QNYB 3PHSA 4R0LB 4IRSC 2DQTL 3I85A 1KNOB 4F7TA 1T1YA 3PQYA 4M3KB 2PW1B 4OFIA 5AWNH 4PG2C 1EO8L 1MJJB 3O3UN 1VCAA 4JHZA 2AJXH 4HUMB 5I66B 5L0QB 1B0WA 5DURD 3MR9B 1RHFA 2DQJL 3QP3A 5DI8A 5IM7A 1VKXA 1T5XB 2X1WL 3LVEA 4NP4H 1MIEH 1DBBL 4EDWL 2I9LB 4KKAD 1YN7A 4PB0H 2PYEE 4JFQB 1QD0A 5DD6B 1BWMA 1YDPA 3TN0D 2OI9B 3T3MF 3MLRL 1YYLL 1TNNA 3QULB 1XZ0A 2HFGH 1ES0A 3CH8A 3BIKA 5IVXF 4K8RC 4OLZL 1PYWA 5DEFB 2P42B 4X8JA 2HLFD 3GI8H 1XF4A 4TUKL 3P9MA 4K23H 2J12B 4NQDA 4APQB 2CUIA 4V2CB 3VGAC 3KPSE 2VKWA 4K55A 3B9KC 1BP3B 4QXTB 5JHLL 4G6FB 4Q9RH 4XNQA 1FZMA 1PKQA 1H15B 3AREC 5GGVL 5K59E 2F8XC 1PG7H 4MWFB 1MVFA 4C56D 5IEKB 5FKAA 3FL7A 3HRZA 3RDTD 1AJ7H 4ORGB 3FQUB 3DV6A 1KCVH 4LLUA 2H1PL 2LABA 3GIZL 3WUWA 2XA3A 3RWDB 5T1LA 1YY9D 1Y18B 2BSTA 4O9HH 4P3CL 1B0GA 1TVHA 1RZIA 1YEIL 1OOAA 3BP4A 3EJYC 4LMQE 3QEQE 4J1UB 1INDH 2V2WB 4KMQA 3ARBD 2CDGB 2Z4QB 1ZKAA 5L2JB 4YHYC 3LS5H 5EO1B 4O2EB 4S2SB 4P2OD 1X5IA 2JCCE 4KRNA 4YHZL 3ECBA 2YPVL 3GSUA 4LDLB 1CICD 5I1AA 3E8UL 4PLJC 2L0DA 1AXTH 1MLCB 4XGZB 2F9BT 1SBSH 3MV8E 3FAWA 1AO7D 3IGAA 4ERSH 3FONB 4MQTB 4PRHD 4YHNB 5I8KH 3GMMA 4OGAD 2EYTA 4YBQD 5DRNA 2K1MA 1HKFA 1B4JH 1EEUA 1LE5A 1CZ8H 5CJOH 3N0PB 3O3AA 2YKLL 1ZLVK 5L8LB 2R69L 5IKCB 1YY8A 1BAFL 4V1DA 3ILQC 5FKPB 2J3SA 3R8QA 4NO3A 2PO6A 4OLUL 4J12A 1ZGLP 2OJZH 3B8SA 1V3JA 2ESVD 4FQCL 3VWKC 3JWNC 4HUWB 2D0HA 1JV5B 1YJDH 1HXYA 1XCQB 1UACL 4PJGB 4MQ7A 5J6HA 2PW2A 5GSVA 1PG7W 4M5ZL 4FQHA 4NOFA 4NQXA 3BPLB 5E99L 3ARTA 4NKDA 4X4XB 4F7CB 2AJVH 1Q72H 3VG9B 3BAEH 5DMGD 1EXUB 1BD2B 1T83C 3BD3A 4JDZB 3B2VH 2C4FU 2WMPA 4P2QA 3KDMB 4JLRA 3MV01 4Y5VB 1RZJC 4R4FL 3T0VA 5DFVD 1J86A 2Y07H 2X4RA 3QT2A 3QZWB 1AGEA 2J8UA 4Y16B 4BSWA 4LQFL 4BJLA 5GS0L 4LKXA 1D6EB 1HHKA 1F58H 3QEUA 4AIZA 1AGBB 1DLFH 2NX5B 3SOBH 5C08E 3TZVB 4POYA 1MCFA 5D7IB 4ZAKA 5HHVL 2DQTH 3KWWB 3GIVA 3S34L 2ZCLL 3SDCB 2VABB 4BA8A 3EDEA 1HHIA 3LKQA 2P8LA 1G0DA 4JRWA 1EO8H 3VI4F 1UH2A 2JF1A 1UB6A 3RGHA 2X7LA 3QFJB 3EAKA 3GDBA 2BVOA 2BVTA 2DQJH 4NN5B 3FTGA 5MEOB 3VFUA 4NKOA 4XX1G 5FA4B 5FO8A 5IVXA 1DBBH 1WJ3A 4JRXE 3QXVA 4U31A 1LP9F 4EDWH 1RUPL 1EEZB 4QHLB 3QSKB 2VXVL 4EJ1C 5CBEA 1ZHBA 3MLRH 1YYLH 1D5BB 2FEDD 1TJGL 3SKMA 3OX8A 5HHQB 5BXFB 3HE6D 3S37L 4LCWE 3H42L 1NBVL 5ICXA 4OLZH 3X11B 2DOCA 4LCCC 5IT2L 4TUKH 5E8EA 4YJZL 1C5CL 4EVNA 1BVKB 4JM2A 2DKMA 3QUMB 4OZIF 3VFWB 5JHLH 1KCKA 3VRLF 4LCIL 1BOGA 3HR6A 5GGVH 4NQCE 3EYFA 4GRLC 3RL1A 3HB3D 3ULUE 1CXIA 1N59B 2VZOA 2GK0A 3MRDA 4L4VD 4QRPB 3WJLA 3WFBL 4KJPC 3EDKA 4NDMB 3JXAA 2H1PH 3GIZH 1KYOJ 2ARWA 2YMXL 4FZEL 4DZBA 4NO2A 3FQXA 2DTSA 4P3CH 4CL7A 1YEIH 4JZNA 3MMEA 4A2MA 4FTVE 1BJMA 4RRPG 4EN3C 3UTTD 2I27N 1S8DB 3QCTL 5KS9A 2OL3L 2IFGA 2MKWA 4UIKL 3GUTA 3REVA 1I7UA 4YHZH 3SHSA 2YPVH 3MLUL 3E8UH 1BIIB 3QJFB 4HQQH 2DQEL 1V3MA 3KPNA 3FQTB 3D3VB 1CDYA 4ODUA 5CMAB 3QUXC 5B39B 3MSPA 1UH4A 1I7RB 3RL2B 1FCGA 4K2UL 5IHBA 4JO1L 2KDGA 2YKLH 2N7AA 1IKFL 2R69H 1BAFH 4ODWB 4ZD3L 5C0BA 2FB4L 2NNAA 5I2IA 4ZG1A 4G8GA 4KK8C 3OSKA 4OLUH 3ROOA 2FBJL 3SCMA 1QQDA 1JPGB 5F70A 1QLFB 1VADB 2IH3A 4FQCH 3UTSE 1OLZA 5ETUA 4U1JB 2CKBA 4Y19B 1FC2D 1S9VA 3IKKA 1UACH 1WBZB 3IXAA 2P4AB 3FT2B 4Y4FD 4Y2DA 4M5ZH 5DJAB 3GGWB 1J9CT 5E99H 5D5MB 3RUGF 4JN2B 4OD3L 5IHLB 4P9ML 1I8MB 4LDEB 3UXFA 4UTAL 3C8HA 6FABL 5KSVA 3MUY1 1AXSA 1FNGA 3PWLA 3CDFA 1IGYB 4M93B 4R4FH 5I15L 2F5BL 1EZVX 1UWXK 2NYYC 4OCRL 1QLEH 4OT1L 1X7QB 2A2QT 4PJ8A 4U4BA 3VXTA 4OZFA 1UZ8A 4LQFH 1FORL 5GS0H 3MLTB 1WSST 2YXMA 3O81A 3QUZA 3P9WB 3AY4C 3MC0A 3PL6B 3JV6A 5B4MC 4KROB 4MXVF 5E56A 2DM3A 3AS0A 3M07A 4HIJB 5HHVH 3RPIB 2I9TA 2YOCA 5FYLD 3S34H 2ZCLH 3V5HA 4P46C 4MAYD 3TNNA 2ERJB 5IR1B 1L4IA 2V7HB 5D2NE 4DKAA 2IANA 3T1FB 3WIFA 2AS5M 3HG1D 4Z76A 5KVEL 1CDUA 2P8MA 5MERA 4QHUB 3QUYB 4I9WE 4JO3L 1RUPH 1NC2A 5DQJB 1I8LC 1EAPB 1UKSA 2VXVH 2DQDL 3SE9L 1G9ML 2D7NA 5DRXA 1TJGH 3O9WC 3VFNB 3O3DA 3REWA 4HF5L 2WBKA 3S37H 3BUTA 5CD5C 4OZIA 3VI3F 3H42H 5D4QA 1QFWM 1NLDL 4Y1AB 1NBVH 2IAMC 1KPRA 1N5AB 3IFLL 5IT2H 2YRPA 4LLWB 4I3GA 2WM0A 3BD4A 2PN5A 3T4AA 3HZYB 1C5CH 1FVEB 1ZWIB 5F72S 2NXZB 2ITCA 3D18B 3DGGA 1AIFB 5HGHA 4LCIH 2PETA 2Z31D 3CIQA 1JK8B 3BJLA 3HZVA 3P4OA 2X4SA 4NQDE 3WFBH 4K3DL 1FGNL 4GBXC 5KBNC 1FE8L 5AYUL 1Z9SA 2ID5A 2YMXH 4FZEH 4LCYB 4CKVX 2EIDA 1PKQE 1R3LB 3MROA 3OJDA 1DVFA 3L3KB 3QDMD 1AKJD 1NL0L 3RWHB 3O3BA 4NC1C 3QCTH 2OL3H 2CUHA 4UIKH 2I07B 1OAZL 5BS0B 3ARRA 1TJIL 1I1AC 3MLUH 4JAMA 3UTOA 5A43C 1CVSC 2ENYA 2DQEH 2IBGA 1EAJA 1NFIA 3CVHA 3TVMD 2DM4A 4RWYL 1ND0A 3UJJL 3AAZA 3D39A 1OTTC 4K2UH 1DQML 1T22B 3IJYB 4JO1H 3WDIA 3KPRB 1WFTA 1HYSD 1VFOA 1IKFH 4Q2ZB 4UDUB 2D7TL 2EKJA 2AQ1A 1S5IL 4ZD3H 2FB4H 2DQUL 2D7OA 3RTQC 1JWMA 1HWGB 3AMKA 2FBJH 1ZGLB 3O2WL 3PABA 1N26A 4N5ED 2OP4L 1CL7I 3LKNB 4NFDA 1XF3A 4D0CA 2BVUA 4KKCD 3W0WB 4V1DE 5KSBA 1S7RA 4YC2C 2IBBA 2B7DT 1RJLA 3GJFA 4JGMA 1EBPA 3Q3GA 4HIXL 4NO5A 4XBGB 4YIQA 2GTZA 1JP5A 5KSUB 1QLRB 3U1SL 4OZGF 3VXOB 2EDXA 1RJYA 4WO4B 4OD3H 4P9MH 1RJCA 4NWUL 3P0YL 4KK9C 4UTAH 2OM5A 3AXLA 4RFEA 2FBOJ 3HLAB 2FZ3A 1CWVA 3OXSB 3L3GA 2R2EB 4GKNB 4MDJB 3EOBB 2EECA 1U8QA 5KG9A 3MREA 1CG9B 3VGDA 5I15H 2F5BH 1FO0B 3Q5YA 4WEMB 5JW5B 3MV9E 5FUCE 2NY0D 2A77L 4OCRH 4MHHG 3VXPA 1HQRB 4HAGA 3VDCA 4JDVA 4OT1H 3UO1L 3VCLA 3RHWF 5JLZB 2OSLB 2UZXB 1KEGL 3OBAA 4JFXB 4OZ4A 1FORH 1EHAA 1WICA 2Z8WC 4P3WA 2J8HA 1BJ1H 5FHBL 1NUFA 3W11D 5EH1A 4A6YL 4F3FB 4WW2A 2LQRA 4PRIB 5JOPD 3QQ9C 1HHGA 5F89A 3BT2L 3HPJA 4D94A 5E00A 2K7QA 2DKSA 3RWIB 4X9HA 2WBJC 1NQBA 1RULL 5T5NG 1ZVHA 1A4KA 3WN5B 3LV3A 3TBVB 3D9AL 5D96C 3NCYS 1LK2B 3MFFB 4GLRH 1FNLA 1FN4A 5KVEH 1DN0A 4FQXC 1OT1A 1NLBL 1SVZA 2FWOA 3U46B 1WISA 2X1PA 4NC2B 4G9FA 2HFTA 4JO3H 4J23A 2XQBL 5SX4H 2MJWA 2BZDA 4Z7UA 2DQDH 3TYFB 3SE9H 1G9MH 1T7VA 4OF5A 3O6FD 5DDHB 5F1OB 1PQZB 2H9GA 3LEXA 3T3ME 4HF5H 1ZVSB 3DMMB 4BFIA 5D7JB 1NLDH 4X4MA 5IVXE 3IFLH 3QIWD 1Q9LA 3WLBB 3WCYA 4NRZA 4UQ3A 5D72L 5CZVL 5IB4B 4KKAC 5HYSG 8FABA 3L5IA 3TN0C 4N1EA 2XWBB 5C2BL 3O2DL 2X05A 4QYOA 1I8KB 4XHJC 1M7IB 2BOCA 1IJ9A 4K3DH 1ZEAL 1JE6A 1FGNH 1WLHA 5HPOA 4NNXB 1FE8H 5AYUH 3GNML 4ZNEE 4HH9B 1XGUA 1V7NL 5F3BB 1E27A 4PJCB 2GT9A 5LKNA 4L8CB 1QACA 3RVTC 1NL0H 5ADPL 4JFDD 3CFDA 5EO9B 3WJJA 1PAMA 1OAZH 3W5MA 1PX3A 4PJXB 4JFYB 5DTFB 3TJEL 1HNFA 5LGJA 5JPMB 1YY9C 5ELIA 2NZ9C 5F88B 1OGTA 2RIKA 1PY9A 4ZFOA 4PG2A 3BP6A 4HFWA 4AENA 3TO4C 1NEZG 3BRDA 3ARBC 2GAZA 4RWYH 3UJJH 4LLAA 1KB5A 1WK0A 1DQMH 4YDIL 1TNMA 1QVOB 3G9AB 1X4YA 5C92A 2D7TH 4LEXL 3WNPA 5FB8B 3QDGB 3OAZK 1S5IH 5EOTB 3RPKA 3BSZL 2FYYB 5C6WH 2DQUH 4FQQB 4D9QE 4QRQA 3JUZA 3MBXL 3VXRA 2XXMB 1U3HB 1RV6X 1JL8A 3RNQB 2FNBA 3MRRB 3O2WH 1BF2A 4OI9A 4YBQC 2VITB 5FGRA 5GSRB 2OP4H 2DL9A 5E2UL 1N8ZB 4XB7A 5KAQF 4X6DF 4KAQL 5J11C 1KELL 3K1DA 5CFHA 3OKLA 5DJYB 4G8GE 1NUDA 4HIXH 4PJEB 1RZKL 5IQ7L 2VLRE 3FRUB 2VIRA 1QRNA 2SEBB 4A2LA 3U1SH 3UBXB 3B9KA 2EDTA 2K7PA 4MD5B 3ULSA 3X13A 3ZYZA 2W59A 2BNRE 5DMKA 4N0CD 3GSQA 3AREA 4Y4HB 3W39B 3AU1A 4KVNL 4NWUH 3M1BA 3RWFA 3P0YH 4R0LC 2V5SA 3NVQA 1T0MB 2ZCHL 5E4EC 2Q6WA 4P23B 4PLKD 3MGTA 1WZMA 3B3IB 4LPXA 2HT2C 4FXKA 5DJ0A 4YE4L 5LGHL 3VRIA 2DM7A 2W9EL 4Z0BL 2A77H 1ZAGA 3UO1H 2J5LB 5IB2B 3RWJA 4D9RE 5C0GB 1GXEA 2X89D 1KEGH 5D8JL 4GXUM 5FHBH 1MHCB 3I3BA 5IHUL 3ARSA 4PRBB 7FABL 4ZUUB 4A6YH 1Z5LB 3V4PL 1CE6A 2EEDA 1GC1C 3N1PC 2EDOA 2OI9C 2H2SD 3BT2H 5LWYL 3RRQA 4PY8I 5D1XA 3SDDB 3F7QA 5FGBA 2P8PA 3TJHD 2IPUK 4EXKA 1OCWL 5E6ID 5ISZB 1AR2A 1BQUA 3U4AA 3Q5OA 3D9AH 2GITA 3L7EB 4WFHE 5EZJB 3VI4E 3FFCA 4KTYA 4APQC 4NT6A 1JGEB 2EXYD 4QHNB 1BFOB 4FRWA 1NLBH 5C8JA 3MLZL 3OGOE 1M6OB 1NBYA 2PTTB 3IDGA 3MO1A 3UYPA 3VWKA 3SE8L 1J05B 2XQBH 2IANE 5AG8A 5GGRA 3KPPA 1LP9E 4K7PX 1AQDA 2FGWL 1MVUA 4MX7B 5DS8A 4CBPA 3BGFB 5CSBA 2VQTA 3H7LA 5IV2B 1KC5L 2D4FA 5B21A 4JANA 4NYLB 5D72H 5CZVH 3U82B 4YDLB 4P5KA 3QQ4B 3OR7A 1T83A 4XWOD 5C2BH 3LKSA 4U1NB 3C60B 3O2DH 1RK1B 4OZIE 3P0GB 3VRLE 3FN9A 2BK8A 4XH2A 1ZEAH 4MXQD 5GGTL 5KSAD 2VDLL 3GNMH 3JBG7 4PJFF 1IQWL 1J0HA 4LNVA 2DAVA 1V7NH 3KLDA 4MNHA 5E5RB 4CVXA 2BJML 3LY6A 5EC2B 4NUJA 3UP1A 5JA9A 5ADPH 5CHNA 1S7QA 3BZ4A 2P5WE 1S7XA 3HB3C 3U0TA 1GOGA 1A6VL 3SO3B 3BP5A 2Z35A 3R4DA 4I0CC 5DC0A 5LAXB 4B50A 5C0JA 3IFNL 2BHYA 1E28A 5C9KA 1U8JB 3TJEH 5D7LB 4BKLA 1MOEA 4JRYA 5EFIB 5CIPB 2VSDA 2WIIA 4OGZA 3S3PA 1RZ8B 3B5GA 5FFLA 3A6OA 4YDIH 1MLBB 1NGZB 4HMEA 4XAKD 3BPLC 1S7UB 3KS0J 1OGAE 4LEXH 2XTJD 3BSZH 3VG9C 4X6BB 2GCYB 2N4IA 4QGYA 3MBXH 4U0QB 5DSCB 1VDGA 1A6ZB 3KPTA 1JMZA 4P3DB 4U6HA 3D2UA 4KKLD 4S1DC 3DV4B 1TLKA 1YA5A 4Y5VC 4PLOB 2P45B 3LRSA 3MLSL 5E2UH 1JZ7A 4KAQH 4LCCA 1C12B 2DYPB 3VXNB 1KELH 4DKFL 1ODAA 1RZKH 5IQ7H 2COQA 4NHUB 4Y16C 1BZ7B 4XB8A 5E7FA 2EDBA 5E8OA 3RUGE 4GRLA 1LO5A 4KVNH 3BPOB 4Y5YB 2HT3D 3KPOB 2F58L 2ZCHH 3BZEA 4NJ9L 1WTLA 2PUQT 4Y4FC 5D9SA 1G9EA 3OQ3B 3X14A 5IF0B 4YE4H 5LGHH 3EOTL 2W9EH 4Z0BH 15C8L 2YPLD 3EBAA 4HKBB 4M4RA 1D6VL 4FMFA 3RGVD 4EN3A 2A74B 4X98B 5FYKD 4MA3B 1MCNA 4NN5C 4L9LA 5D8JH 5CP3A 3FFDA 4NN6B 1EDQA 4YAQB 2OZ4L 1QYGL 5IHUH 3ZTJG 3ORJA 2V7NA 7FABH 2HFFA 1N0XL 3V4PH 3RHWK 1GOHA 3GJEB 4MXVE 3PNWB 1HDMA 5LWYH 4QF1B 2DDQL 3TBWB 3BQUA 4JFPA 4PLNC 2YD3A 1KLUA 1OCWH 5TFSL 5IHZB 3AC0A 5L2KD 1A1MB 2I5YL 4HZLB 1SEBB 4X7DC 3DBXB 5C07A 3MJ8A 5F9DC 3TIEA 4ELMF 5E5UB 1PJ9A 2QLVB 3VH8B 4TVPE 3I6LD 3MLZH 4LNRB 2Y5TB 4EI5D 4HKJB 3PGCB 2APXA 2NY6D 3SE8H 1QSEA 4YHIA 5EU6A 2IGFL 3V8CA 1MRCL 3CDGB 5E8NB 1JZ5A 2FGWH 2R4SL 4NFCA 3ULVC 3JVGC 3PWPA 3VXSA 4UU9A 1KC5H 5F9WC 2FEEL 4FHBD 4G9FE 1Q9OA 3BYYA 3KNBB 1FFOB 3VXUA 3VI3E 2JK5B 5H8DA 1N0LA 1HI6A 2IALB 2BNUB 3VDBA 2YD2A 2BVQA 4Y89A 1FFRA 3FZUD 3KPSB 3RY4A 2XN9E 2UYLB 4C4KO 3I75B 4Q97A 4ZTOL 2RFXB 1XT5A 4RMTA 4X7FC 5HYSB 5GGTH 4PV8A 4ZS7L 1QEWA 2VDLH 5DC9B 1IQWH 1S7TA 1BJ1J 2BJMH 4GO6B 4YH6A 1K8DB 1FNEA 3AY4A 1F3JA 4HJGA 1C08B 5EN2A 1A3LL 3R1GL 5C09A 3PWJA 1HOCB 1A6VH 4R8WL 4KH2A 3IFNH 4KU1A 2GSGB 4P4KD 4OQTA 4XP5L 3CSYA 4P46A 5DQ9A 3OKEB 1JF1A 2JCCB 3FB8A 2GUOB 5EOCL 4PGBA 1X5FA 3MV8B 4X6CA 4UBDD 3SGJC 5C0AD 4IHOB 3VFSA 5CEXA 5SV3A 1XMWA 3TBTA 3MJ7B 5E2WL 3VG0L 1J0ZA 5HVFB 3H9SA 4HUUB 1X44A 3EYUL 5E2TL 1NEZB 2C26A 1N2RB 5D70L 2E8YA 1I8LA 5TGBA 3S3SA 2DLHA 1MCEA 4QT5B 3MGOB 4LIQL 2B1HL 2E7MA 2V2TB 5FXCH 4M93C 3WS3B 3MLSH 2IAMA 2I26N 3CSGA 2FSEA 4DKFH 4ODBD 5I16B 1BPVA 2ARJB 1I4FB 4HJ0D 3I9GL 3DRTA 1CGXA 4FFYL 3HUJF 1ORSB 4E5XB 5IBUG 5H35B 1HIML 3PL6C 4OZGE 4S1SL 3UX9B 5F7MC 4KROC 3IAGC 5F7DA 2F58H 5GRVK 4NJ9H 5HGBB 4GBXA 1RK0B 2X4UB 3BN9D 1MHHB 1F4YL 2GEEA 1J11A 3MRNA 2BHUA 1KLFA 2ERJC 4G8EA 3EOTH 3RA7L 5JNYB 4QY8B 15C8H 1XF1A 5BZWB 5ID1B 2EYSA 1D6VH 5DVNA 3BKCL 1IAIM 2BMKA 5DEZA 1MI5D 2LTQB 4L3EA 3ZE1F 5KVMC 1FFNB 4M3JA 3EO0B 2OZ4H 1QYGH 4NO0B 1N0XH 4XCNA 5IJKA 1S3KL 2C3HA 4GAYB 1MCLA 2NY0C 1JNNL 5C08B 1U8KA 1P7KB 2DDQH 1K6QL 2FD6L 2AXGB 4KUCD 4OUUA 4ELMA 3QI9D 5TFSH 2ATPA 5E9DE 3DXAA 1KXVC 1NDMB 4XXDA 1P6AB 1TVBB 2I5YH 5F1IA 3TCXA 4KHXL 3W11C 4PB9L 4BFEA 1ZGLM 2DMKA 3RTQA 2FJHA 2NXZC 3FMGL 4S1RL 4BZ2L 5C3TA 1NGXA 2F8VA 2VMFA 5JPNB 4LRIC 4IMKC 4LLYB 3DVNB 4IM8A 1IEBB 5DHVH 1YC8A 2IGFH 3QHZL 1MRCH 3V7AE 3FFCE 5C0NC 2FO4A 4JRXB 3BWUC 2R4SH 4K7PL 4KK5D 3GZKA 2B4CC 5EU5A 2V6HA 3KYOB 3MOBL 5CEYA 4ONHA 5FO9B 1W72A 1Q94A 1SY6A 2C3WA 1AI1L 3CVIL 4LCWB 1M05B 4YK4C 3IDMA 1ZT7B 3WS6C 2Y1VA 4HWEL 4FA8A 3U48A 2DL2A 2OTWA 4RFOL 5CJ8A 5SV4A 1AP2A 3IDIA 4JPVL 1X5YA 4HD9A 4QCIB 4MJ6A 4EI6A 4ZTOH 3C5ZB 1OB1A 1S78C 4NQCB 5DD0L 1I7TA 4UQ2A 4NRXA 3MRPB 3BESR 4ZS7H 5FO7A 4U1HA 4AY0A 4U6XB 3NFPA 4HK3N 3DX7A 4M7ZC 3PWNB 5E70A 1A7NL 1A3LH 3R1GH 4KI1A 3LN4B 4WNQA 3T4YB 4FTVB 4R8WH 1J8HD 2C3VA 2DN7A 2W0FA 3KPQA 3O41A 4XVSL 4XP5H 2X09A 2VDML 5DD1L 2HYMA 4IRZL 1YMMB 2WBJA 5DF0A 4AG4L 5EOCH 3ZYJA 2ARJQ 1DN2A 3VD3A 4GS7B 4P99A 5CKGA 2J88L 3BX7C 1SMAA 3VMNA 1JZ4A 2ZG1A 5EUOA 5E2WH 3VG0H 2OQJB 1CLOL 2P47B 4JRYE 3EYUH 3O4LA 4WO4C 5E2TH 3EHBD 4FZ8L 4G9DB 5T1KD 3L1OL 5D70H 3OKKA 2WZPD 4LLVA 4X4YA 1F5WA 4URTB 1MWAB 4PRPA 4LIQH 2B1HH 3VFVA 3SE3C 3HUJA 3GMQA 3VD5A 2OYPA 3UTSB 4X6DE 5TF1L 4KJQC 3I9GH 4L3CA 2V2XB 1H8OA 4FFYH 4QRRE 4DGIL 1HIMH 1KCRL 3G08B 4S1SH 4N8VB 5FGCB 2HVJA 2Y4SA 1QSZA 5F9AC 3G5VB 3DYMA 4HK3J 5BRZD 43CAA 1IM9A 2UY7A 2HTKC 1F4YH 3BXNA 4R6UA 2BDNL 1NANH 4WI8A 3PHOB 3WN5C 2LV4A 4N0CC 1FYTB 3CCHA 4CMMA 1U92B 2IMNA 4WFEE 3BKCH 4H1LG 5AD0A 2EYRB 5HY9A 3IJSA 5CP7A 3RBSA 3H3KA 4H26B 4R4BA 4M9PA 4F7PA 1VENA 1YC7A 5EUKA 2NTFA 1S3KH 1O7SA 2FL5A 5IW1A 1I3RA 4UOJA 3TO4A 3WHE0 5JZ7D 5BOZG 1RUAL 5T5FL 1U93A 1AQKL 1JNNH 1WFOA 4WIQA 4PD4K 1XH3B 4R9HA 3TFKC 1K6QH 4RISL 4E41A 2FD6H 4JO4L 4XNZC 4G43B 2YA0A 2X1OA 4PJDE 4ZYKB 1EH9A 2BCKA 5D7JC 1SJEB 4KJWD 5SWQB 5C0EB 4KHXH 2YD7A 4R7NA 3IETB 4PB9H 5J6GB 3FMGH 4O4YL 3ARVA 1SEQL 4J3UA 1HSBA 4S1RH 2H2SC 4AT6B 4BZ2H 2HTLD 3OXRB 5J9PA 1MRFL 1VEPA 3OKYA 5T1MA 1EFXD 3QHZH 1WC7A 3LQZB 2EDHA 1M7DA 1IGJB 1MCBA 3OGCA 4F57L 4K7PH 1AFVL 4NHCL 2Q87A 1T03L 1TPXB 3MV7B 4U1KA 2EXYC 3ILPA 3MOBH 1R3JA 1I1YB 5DD3L 1AI1H 1K8IB 3CVIH 4UIMB 5MHSE 3EO1B 5JORB 3L3DB 2ZOLB 4H5SB 1MCIA 3QNYA 1AD9A 4HWEH 4R0LA 3VDAA 1KNOA 4RFOH 2E6JA 2PW1A 1F02I 3V4UL 4JPVH 2GK2A 3VXUE 1FIEA 1MJJA 1CK0L 1EHNA 5CCKL 3NIFF 5FF6B 1HINL 5DD0H 5I66A 3FQRB 2H3NB 5GS1B 1MF2L 1ZS8B 3MR9A 1F4WL 2DMBA 4PJFE 4C55A 1T5XA 5CEZE 1HSAB 3SDAB 5LBSL 3MTRA 4KKBC 1U91B 1JUFB 1A7NH 2I9LA 5DD6A 5CINL 3G5XB 4Z7WE 4MXQC 1CXLA 3NZ8B 3QULA 4DK6A 4XVSH 2DLTA 1A8JH 2VDMH 5A16B 5DD1H 4IRZH 5IMLB 1JZ3A 1NCAL 4AG4H 3VXMD 5DEFA 3ARFD 5C09E 4APQA 4HG4J 2J88H 1FVCB 3IU3B 4HLJA 3Q6FB 2P5EB 4QXTA 5EZLB 1ORQB 4GAJL 1KXTB 1CLOH 4DCQB 1H15A 1JIBA 4Y4HC 4MWFA 4N5UA 4FZ8H 3L1OH 1TQCB 5IEKA 1HHHB 1QHPA 4M1CC 2D9QB 4ORGA 3FQUA 4P23C 3RWDA 1ZT4B 1TJHL 1Y18A 2NY2B 5FGSA 3CD4A 3IAQA 3D85B 3CK0L 4J1UA 2V2WA 2UVFA 1U3ZA 2CDGA 2Z4QA 3RWEB 5TF1H 2J5LC 3G6JE 4F2MB 5L2JA 5EO1A 2DI9A 3HE7D 4O2EA 4Z7VB 2VR5A 1IZJA 4S2SA 4DGIH 1KCRH 4KKLC 1MLCA 4XGZA 1G0YR 3S5LG 5MEQB 5IJVB 4YHNA 3FONA 2VQUA 4FFWD 2HKFL 3O6ML 3AM8C 3S7GA 3SDDC 5IBUB 2BDNH 4L4TD 5IKCA 1JGVL 1DUYB 3IVKB 2GHWB 1XGPB 5FKPA 1CGWA 5EIIB 2VISB 4TN9A 4NNPL 3MV9B 2AK1L 1OSPL 2APTA 2D31B 2R1YB 2Q8AL 2IPUG 2VAAB 1H9VA 1E4XL 5C0RL 4GW4B 4HUWA 1AH1A 2CKBL 2WSKA 1JV5A 4I0PB 4NNYB 1XCQA 1RUAH 1DQDL 4PJGA 5T5FH 5D7KE 1XIWB 1AQKH 4NC1E 4J4PC 2AEWA 4W68A 4LSSL 4RISH 3BGFC 4X9GA 4JO4H 2R1WB 4X9BA 5T3XE 3V6OC 4R96B 3JWOL 3LEYL 1ZLSL 4JFHD 4XP9L 4X4XA 4F7CA 2F5AL 3T2NL 1P4LB 1WZ1L 3ESUF 3GMPB 2HJFB 1GHFL 4U3XA 1EXUA 3MLWL 1WV7T 4O4YH 1BD2A 1SEQH 2GJ6E 1BZ9B 5EIQA 4JDZA 3C60C 2XFXB 2XTLA 5D5MF 3Q1SL 4ELME 3KDMA 1MRFH 4LPTA 2NY1B 2FO1A 3BD5A 4WU7B 1SYVB 3OF6A 5GS0D 4PJ7B 1WGOA 1MUJB 5F6IC 5GRWA 2NY7L 1N64L 4KTEL 1ONQB 3QQ3B 3HZKB 4F57H 3QZWA 1AFVH 4NHCH 4I0KA 4ODHL 1T03H 5JOFB 5FV2A 4Y16A 5DJ6B 4DTGL 1IAOB 1D6EA 4WUUB 5DD3H 1AGBA 5DMIL 3K46A 1WWWX 1UENA 4H25B 2NX5A 3L5XL 4K94L 1IRAY 4GRMB 3TZVA 4JE4B 4RFNC 2MQCA 3QQNA 4OFYA 5D7IA 3KWWA 1SMOA 3ZL4L 4YDJB 2VABA 3SDCA 1KN2L 4G5ZL 1R5WB 1CDGA 3V4UH 3I50L 4C57C 1GZQB 1VSCA 1CK0H 5CCKH 3MLPA 4CVZB 1H5BC 1HINH 3QFJA 1FNSL 1RSFA 4KRPB 5MEND 1GSMA 1MF2H 3BO8B 3DTXB 1F4WH 4GKSB 5IESL 5MEOA 1R0AL 3VGBA 5LBSH 2CLVB 4FQIL 5FA4A 4HWUA 2MQ0A 5DFTA 1EEZA 4QHLA 1MSPA 4J8RB 5CINH 2EEAA 1A7RL 1D5BA 3K3QA 1MFBL 1NBQA 3N9GL 1KB9K 5HHQA 5BXFA 4MA1B 1FL3B 4U1LB 2A6KB 3SPVB 3DUUB 1FC1A 1NCAH 3RZCD 3X11A 3KJ6L 4JCMA 1XGQB 4G6KL 4BH8B 2NPLX 4U6VL 4QHMB 4NM8L 1BVKA 1PKOA 1TQBB 1DR9A 3QUMA 4L29B 4WGVB 4GAJH 4PGJA 1XFPA 3AROA 4JFFE 1CVRA 3K0WA 3BPOC 4Y5YC 1WFNA 3T3PF 1N59A 3N1MC 4QRPA 1B3JA 4OZHB 4NDMA 1GL4B 4FN0A 1TJHH 4HLZG 3VD7A 4DK3A 5HI5D 3C87A 2H8PB 4N8PA 4K3GA 1FZJB 4MXWL 5GJTL 2AV7B 3CK0H 2V17L 2A0LD 3EOAB 3C09B 3LRHA 2PYFB 3TESA 1S8DA 1ZA6B 4P0DA 4QOKD 3V5KB 4Y4KD 4NN6C 1VFUA 5AZ2L 2VLRB 2WWKO 5CD3B 2GW5A 4PJBF 3HUJE 3O45B 1BIIA 2UVEA 3QJFA 4RZCB 3CUPA 1A1OB 2BNRB 3FQTA 2HKFH 2OXGA 3CVHL 4NQED 1IC5L 1A4JB 3D3VA 3O6MH 5CMAA 5B39A 5J0BA 2HG5B 4JVUA 1I7RA 3RL2A 1FIGL 2R56L 1ZE3C 1JGVH 5IWLC 4MD0B 4EZMA 5BJTB 4ODWA 4KWUA 4NNPH 2GTWB 2AK1H 4YFEA 1OSPH 5HI4D 4XC1L 1J0IA 1Q0YL 1TZIB 2Q8AH 1ERNA 3ZE1E 5GGVY 1JPGA 1QLFA 1LO3L 1VADA 3HMWL 5EOCJ 1E4XH 5C0RH 1AGFB 2VNCA 2W1NA 4Y19A 2CKBH 3MZGB 4H1LB 3OKDB 3BRFA 1WBZA 1M7XA 1DQDH 4G7YL 1DUZB 4C56E 3SGJA 3FT2A 3MBEB 5D6DC 3EDFA 4LSSH 4HWBA 5DJAA 1G1YA 3GGWA 2FHCA 4NC0B 3I02B 3TT3L 1FL6B 4CDHA 5JHDD 1CQYA 3JWOH 1KPUB 3LEYH 4JN2A 5D5MA 1XGTB 1L6ZA 1ZLSH 3KLHD 4XP9H 5E94B 1I8MA 2F5AH 3T2NH 2PNDA 4JEGB 1WZ1H 5KOMC 3WE6B 1GHFH 1ZMYA 4XRCB 2X9YA 2VLJE 3MLWH 4XPBL 4XWGL 3VFPB 4E41E 2WNGA 3Q1SH 5DJXB 3V7AG 4OFVA 3H9ZA 4U7SA 1PFCA 2HJLB 5FEBA 1IGYA 5IQ9B 1F3RB 4LASL 2NY7H 1N64H 1JPTL 4KTEH 4ZSOE 4XI5C 4CNIB 4PRHE 1X7QA 1QBBA 4ODHH 3AS2A 4MB5A 5HHOD 1LP9B 4OZFH 4DTGH 4X7EC 1F2XK 3MLTA 1LDPL 1HCFX 4L9DA 1E6JH 4W4NA 1X5XA 4PJ5D 3PL6A 5DMIH 2HLAB 2GQHA 2EXWD 3D87B 5DC4B 3L5XH 4K94H 4HIJA 3RPIA 5C0CD 1EHXA 5TQ2L 3ZL4H 2C4XA 1K3ZA 1KN2H 3C2AL 4G5ZH 4Q0XL 2WP3T 3I50H 5IR1A 2V7HA 3BYTA 1N4XL 3T1FA 2CSPA 1FNSH 4FMKA 2KQMA 2FGZA 4PS4L 5IESH 5M7QA 5D1QB 5H94B 1R0AH 1MFDL 5J4MA 4QHUA 4WWKB 1EVTC 3KYNB 4FQIH 4F15B 5TDOB 3N1QC 3DO7B 3QUYA 2BXZA 3JUYA 5DQJA 4IEFB 1EAPA 1LMKA 2EDFA 1MJ8L 1A7RH 1XR8B 2P5WB 1MFBH 3N9GH 3VFNA 4CVUA 1TMCB 4WFGE 3K81A 4Y1AA 1FG2B 1JNJA 1N5AA 3KJ6H 4LLWA 5GS2H 3NPSC 5C3LD 1Q9WB 3DUHA 3IF1B 4G6KH 3HZYA 4I1NB 3W9EB 1I1CA 4U6VH 4NN7B 1FVEA 1ZWIA 4NM8H 3WDHA 3D18A 1TTGA 1L0YA 2D0FA 3ARQA 5EBMB 5SWSB 3U83A 1FYHB 1AIFA 2BRRL 3S9DB 2N56A 1B9ZA 4LRIA 3TH2T 4IMKA 4M6NL 1JK8A 1OGAB 3HAEG 1OSZB 4KJYB 1LO2L 2O61B 3GSNB 1II4E 4LCYA 5GJTH 5KAQG 4MXWH 1R3LA 4F33B 3EDDA 4QXGL 3L3KA 2V17H 5ACMA 3FB7B 4PIRF 3RWHA 4HBQA 4ZOEA 4S10A 2AK4D 1TTFA 3T2OA 2I07A 4DKEL 5BS0A 1CD0A 3PP4L 5AZ2H 2EDWA 5BV7L 1U6AL 4R4ND 1GPOL 1QO3B 1HZHL 4ZFOL 2LE9A 3CVHH 1IC5H 3IDYB 3RUGB 1T1WB 1KB5L 5HD8D 1CDHA 1T22A 3IJYA 1FIGH 1WWAX 2ATKB 3OPZL 3KPRA 3TEUA 4C58B 2R56H 3S5LB 4Q2ZA 4UDUA 4BK5A 3RNKB 2Q86B 2DQHL 3QDJD 3RVWC 4XC1H 1Q0YH 3IDXL 1ZGLA 5GISL 1NGWB 1IC1A 1LO3H 3HMWH 3LKNA 4PV9B 3WLWD 3W0WA 3MNZB 4G7YH 3GJFH 1OF2B 4XBGA 5KSUA 1QLRA 1YJDC 2EDLA 3TT3H 1AHWB 1LE9B 4CMHB 1CIDA 3VXOA 4YPJA 4DW2L 1WUNT 4WO4A 1QBLL 1F90L 1QR4A 25C8L 1XCTB 1VEOA 4XPBH 2H32B 4XWGH 1CLZL 2VDRL 3HLAA 3UTTE 5I73B 4LHUD 2Q8BL 3OXSA 4IRJB 3RVUD 1T21B 4KI5D 2R2EA 3E6HB 4GKNA 4MDJA 3EOBA 3SE3A 1OP9A 3QAZB 1T66C 1CG9A 1FO0A 5JW5A 3C5ZC 4LASH 3MXVL 3SBWC 1JPTH 1HQRA 3ARDD 1CFNB 4WW1B 5JLZA 2Z93B 2OSLA 2E8ZA 4Z7NE 1J1OL 1KTDB 1YEDB 3HCVB 4JFXA 1LDPH 3EZJB 2HTLC 3OWEA 1BX2B 1IBGL 4TTDD 4R97C 4F3FA 3DETD 5JOEA 3W2DL 3BDYL 3BJ91 4PRIA 4KDVA 3MUGB 2UWEF 4WI2A 2FH8A 4LMQI 5TQ2H 4M48H 3UCRA 1HN1A 2YD6A 3C2AH 4WHCA 4Q0XH 3RWIA 3DNKA 4B5EA 1YZZA 3HTLX 4YQXL 3WN5A 3TBVA 2XN9B 4EEEA 2NX5E 5HDBF 1N4XH 1LK2A 3MFFA 2YWZA 3UDWC 2AEIT 3MA9L 3NIFE 2HFEB 4CDGC 4PS4H 5F21B 4U1GB 5I18L 3U46A 1MFDH 1LDSA 1OTSC 4PGCB 3BIAX 3D0LB 4CJ1A 1MJ8H 3TYFA 1X6NA 2VXQL 3QEHB 5DDHA 1PQZA 5JR1L 4L8BB 4CU8A 1ZVSA 3DMMA 1PBYA 4M7KL 4OUOA 5D7JA 4Q9CA 1RU9L 3TA3B 3WLBA 3U4EA 4OLEA 3BEWB 5IB4A 1IE5A 2FX7L 3LSOB 2XRAL 2XWBA 4P4RB 3LCYA 4ZMAT 4IRSB 3L3IB 2L7UA 3MRMB 1RZJL 1NGPL 3EIFA 4M6NH 1CS6A 1M7IA 5HYJD 4KK6C 3RWCB 4P9HC 1LO2H 1HCVA 3O0RL 3ARFC 4NNXA 3NCJL 2PXYB 3ARYA 1G0XA 4HH9A 3QIUB 4RMSA 5F3BA 3HR5B 3DROB 4BUGA 1DLHB 4XP1L 4PJCA 4GW5B 4QXGH 2VDPL 3VWJB 4L8CA 2PTVA 1NSNL 4IOFD 5EO9A 4DKEH 1UKQA 2VR9A 3PP4H 1NBZB 4PREB 4PJXA 2EDRA 4JFYA 3PP3H 5DTFA 3HG1E 1R5IB 3ZT6A 1U6AH 2JTDA 5BV7H 3ARGB 5JPMA 5F88A 1GPOH 4G6AD 4RRPA 1HZHH 5CGYD 2Y6SD 32C2B 4MNQB 4OZGB 2E7BA 2JIXD 3LH2L 4LF3B 1KB5H 1OP3H 4XBPB 3OPZH 1QVOA 3VGAB 3LKOB 3SJVB 2W60B 2DIBA 5FB8A 3QDGA 5EOTA 2FYYA 5DZLA 1VA9A 1X5AA 4FQQA 2I24N 5DJDB 4K9EL 2FEEI 2DQHH 1PZ5B 3NABL 1PSKL 1U3HA 4N0RA 3RNQA 5I0ZA 3Q48A 3IDXH 3MRRA 3U6RB 2VITA 4WDIB 4NBZB 5GISH 5GSRA 1CDJA 5I8EB 1N8ZA 3IJHB 4X99B 4P2RB 4JZJB 1NC4D 1RUQL 1MFCL 5DJYA 4UZGA 4OTXL 4P2YA 4PJEA 4ISVB 3FRUA 3MRCB 2SEBA 4RMRA 3UBXA 5D1ZB 4MD5A 1IGML 4DWHA 1QBLH 4Y4HA 1S9XB 1F90H 25C8H 5E9DB 3W39A 4TPRL 3F58L 4WRLA 3QDME 4H8WC 1KSRA 1BF8A 1HH9B 4RBPH 4U1SB 4HEPG 2EE2A 1T0MA 4WHYG 1CLZH 2VDRH 4U1IB 4P23A 2Q8BH 1BLNB 4L1HA 3B3IA 2R0LL 5D5ME 2P7TB 2FRGP 3C6SB 4LQ1A 3MXVH 3MOQA 5GS1C 2KZWA 5CJXC 5IB2A 1JHKL 1J1OH 5C0GA 5FUZL 1SJHB 1MPAL 1CN4A 1MHCA 3AUVA 4MDIB 1IBGH 4PRBA 4ZUUA 3T0XA 1Z5LA 3T65B 3W2DH 1YEGL 3BDYH 3QNZB 4M1GL 5L8KB 4WEBL 2G5BB 4HGMA 3AM8A 1VGEL 4TVSa 4WHDA 3H8NA 3F7YB 5ISZA 4YQXH 5DK0B 3L7EA 4D8PB 5EZJA 3MA9H 1A6WL 3C6LD 1JGEA 2VLKD 4QHNA 1BFOA 1YQVL 5I18H 4K3EL 1KJMB 5DYOB 1M6OA 2PTTA 4JFEB 4D9LL 1J05A 5IMMB 4H0IA 2GJZB 4JKKA 5TDNB 2EO9A 4MX7A 2VXQH 3CZJA 3LN5B 5JR1H 2NY2C 4C83B 4WI3A 5IV2A 4M7KH 4NYLA 3TO2B 4HXBL 3BKYL 1RU9H 1NANI 3CX5K 2F54D 2AVGA 3GKWL 1B4RA 2FX7H 2XQYK 3QQ4A 1OAUL 2XRAH 2PYED 4PTUB 4U1NA 4FQPA 3C60A 5JIPA 1RK1A 3W81A 5CEZL 3QWRA 4Y1AE 1IGIL 4U33A 5HHMD 1RZJH 1NGPH 2YUWA 3RZCC 1RIUL 5DUML 2X4PB 3T3PE 3MYJB 3KLAB 3O0RH 3K8KA 3NCJH 3GB7B 1WVZA 1IVLA 4EQ3A 1WIUA 4ZXBD 4XP1H 5EC2A 1DTUA 4LLDB 4ONFL 2VDPH 2R2HB 3HAEB 2YS4A 2EDJA 5JW4M 1NSNH 4OF3A 4GW1B 2QQLL 2GIYA 1UWEL 4NPYB 5LAXA 4X6DB 1U8JA 4YDVB 5D7LA 1KBGL 4OCYL 3OJVC 3EW3B 4OQTL 5EFIA 4YEEA 3MRHB 2NY4D 5CIPA 4QRRB 4PJBE 4I0PC 4IS6B 2OR9L 4S1QL 3ZKSD 3QEQD 3LH2H 1RZ8A 5F6HI 3ZDXF 1LWRA 2R39A 1MLBA 1NGZA 4MCYB 1Q38A 1S7UA 1G6VK 1RFDL 3OB0K 2EDQA 3HMXA 4LVEA 1O5DT 4MQXC 4X6BA 2GCYA 1JGDB 4K9EH 1H3WM 2P24B 1A6ZA 3NABH 1PSKH 2YSSB 5DLML 5ENWB 4P3DA 3CFBB 4MJIB 2XKNB 1ZSDB 3DV4A 3GO1L 4CU6A 3ZE0F 2EE6A 1QSFB 1C12A 2DYPA 3VXNA 1RUQH 1MFCH 2BNQD 4OTXH 3CFJB 4NHUA 4FP8L 4FOMA 1BZ7A 3Q5TA 5F8QC 3F5WB 1IGMH 1BQLL 1ZLUK 4F9LC 4PP1C 4PJDB 3MGAA 4POZD 4TPRH 3F58H 4Y5YA 2R23B 3AVEA 5ICZB 4JFDE 3KPOA 3BEVB 3JWDC 4JFZL 2NY3B 4CJ0A 3QUXB 5IF0A 5J3HD 2R0LH 4HJJL 3FT3B 1YPZB 4HKBA 1R24B 3KLHC 3X12B 1UWGL 2R2BB 4KRPC 1IM3B 4GKZB 2A74A 4X98A 1JHKH 4TQEL 5FUZH 3KYMB 3RJQB 3O8XD 5CP3H 1MPAH 5T3XL 1KIPB 4YAQA 3EOYG 1YEGH 3GMRB 3H3PL 4M1GH 4WEBH 3GJEA 2C7UB 3PNWA 2VLKA 4LL9A 1KN4L 4QF1A 3SKOB 1VGEH 3TBWA 3K8LA 1D9KB 2EC8A 4MA1C 1DCLA 4X6FB 1K9TA 4NZUL 5IHZA 3QIBD 2MFNA 5IWLA 5DXWA 4AZ8A 4UB0L 4HZLA 1SEBA 2EXWC 2G60L 1A6WH 3DBXA 4PJHF 1TQBC 3KXFD 1YQVH 3BH8B 4K3EH 3VH8A 1KTRL 3UPCA 4LNRA 2Y5TA 4BQCA 4HKJA 3PGCA 1AR1D 4PJFB 4D9LH 1IAKB 3CDGA 5E8NA 3VW3L 2XXCB 2I60L 4PJAF 3P0VL 5D6DA 4N8CL 1CFTB 5HYIA 4Z7WB 3H9YA 3KNBA 1W72L 4JY5L 1FFOA 3RY6C 4FFVD 1G9MC 1E4KC 1SY6L 4HXBH 3BKYH 2JK5A 3GKWH 1OQOA 4FG6D 3K4ZA 3CLFL 1I9IL 4ZS6D 2DRUA 3V8OA 2IALA 2BNUA 2KBGA 2VZVA 1OAUH 4I13B 1YMHB 3DECA 3W5NA 3KPSA 5CEZH 2UYLA 2MWCA 2EICA 3I75A 1IGIH 2VDNL 2HWZL 2RFXA 4KXZH 3OMZA 1RIUH 2OS7A 5HYSA 5JDSB 5C7XL 3U7AA 4R2GB 4XMPL 1IT9L 3VFOB 3VGEA 2XNAB 5C71A 4ONFH 1K8DA 4DQOL 2AJ3B 1C08A 3MRBB 1T1ZB 1HOCA 2QQLH 2H2PD 3UZQA 1UWEH 5KZCD 2JELL 3G6JB 1LQSR 2GSGA 1KBGH 4OCYH 3MCKB 3IT8D 4OQTH 1VFMA 4YPGB 3OKEA 2JCCA 1CTOA 2GUOA 2OR9H 4S1QH 3MV8A 5GZOD 1QBAA 3MBEC 2DLIA 4IHOA 2AEQL 3WFHB 2EH7L 3V79C 3MJ7A 5GS3A 5IBLD 3DO3A 4HUUA 4W81A 1CGYA 1RFDH 4P48A 1NEZA 1N2RA 2WWMD 5SWZD 2BSSB 1A6TB 2VE6B 2F53B 3EFFB 4GRWH 4OAWB 3IFOB 5DLMH 1DL7L 4UNUA 4QT5A 3MGOA 3MNVB 4BH7B 3GO1H 2W0LA 4ZDHB 5J56B 2V2TA 3WS3A 4WTZA 5GIRB 2AV1B 5I16A 2ARJA 1I4FA 5IVOA 4J7RA 1LD9B 4FP8H 1P7QB 3PF2A 1ORSA 3SO5A 1XF4B 1BQLH 5H35A 1KOAA 5DFWH 4JO2L 1I1AB 1PD6A 3ZTNL 2HMIC 4MVBC 4NOBA 3WLWC 4RX4D 1ZT1B 5IMOB 4N68A 5HGBA 1RK0A 2X4UA 3G5ZB 1MHHA 4JFZH 5DK2B 3LKRB 2GJ6B 3RKDD 3M8OL 4HJJH 5JNYA 4Y88A 4QY8A 5BZWA 5ID1A 1UWGH 1NFDF 4RQQB 2QADB 1EHLL 5IB5B 4PJ9D 4Q6YA 1B0GB 5DUPL 4TQEH 5D1QC 2XACC 4YHOL 5T3XH 3EO0A 4NO0A 4F15C 5E8DL 3F6IA 3T0ED 3H3PH 5DVOA 1FDLL 4GAYA 4P2CG 1KN4H 3FN3A 2B8OT 5I1AB 2APVA 5C08A 1P7KA 3ARDC 4YC2B 2UWEE 1L6XA 1IC4L 5EWIL 2AXGA 4NZUH 3F7VB 4NGHL 4AMKL 1K5NB 1YEKL 1NDMA 2CPCA 5I1CL 3F6LA 5DRNB 4UB0H 1TVBA 4Q58C 2G60H 5HDBE 4NN7C 5CAYB 4L8SB 1KENL 3PGDB 4CN6A 3MRLB 5JPNA 1N5YL 1JBJA 3JV0A 5ISZE 4M7LT 4LLYA 5HHNB 3BPNB 3NOIA 3DVNA 5D2LF 1IEBA 4XNMB 3LDBB 3VW3H 1FHGA 1MREL 4RA0C 4JRXA 2I60H 3T0BA 3P0VH 3ROLA 2YXFA 4N8CH 3KYOA 5I1JL 4Z18A 5FO9A 1W72H 2WV3A 4JY5H 3I3DA 1SY6H 3PQYD 4LCWA 1M05A 1C5DB 3CLFH 1I9IH 1F6LL 2HT4C 2X4OB 2YPLE 3DIFB 1KFAL 1A9EB 3S37X 3V6OE 2DIAA 1J87A 4QCIA 2VDNH 2HWZH 3C5ZA 2AI0L 4NQCA 3JTSB 3QRFM 3IDYC 5C7XH 4JFFB 3MRPA 4U6XA 4XMPH 3H7BB 1IT9H 4JM4L 1WIOA 4I18B 1H8NA 4DQOH 3CPLB 3PWNA 4FQLL 3LPGA 5F71A 5HYFA 2IC2A 3V0VB 3NA9L 4MMZC 1GC1L 4XAWL 3VFGL 3HI5L 3LN4A 1UFUA 3T4YA 4FTVA 2E7LC 2JELH 4JPIB 3GSOB 5FYKU 2ADGB 4G8IB 4DEPC 4NQDD 4OLWL 5C1MB 2YUZA 2MMXA 4WUKL 1DP0A 1YMMA 2VZTA 2J6EA 1I9JL 1TIUA 3L5HA 5DURB 3ZKND 1F6FB 3A6CL 3UDWA 3FO9B 4IIQC 4N9OB 3V6BR 4PRAB 2AEQH 4P5TA 3QH3B 2EH7H 4HUNB 1AHWC 4HDIB 2C3GA 4CMHC 5D7LE 1S9WB 2OQJA 1P9MC 3Q6GL 4C59B 3TN0B 3V6ZB 3GHBL 5T1LD 3LHPL 1LEGB 4G9DA 4G6AC 1EIBA 1MHEB 3AS3A 4TYUA 5CGYC 5J13B 2Y6SC 4LU5L 5I73C 1E4WL 1DL7H 1MWAA 4IRJC 5A3ID 1JTTA 2AJZB 2D3VA 3QAZC 3V52L 3UTSA 1C5BL 1PX4A 4YGVB 5CS7A 5DVMA 3TBSB 2V2XA 4C56B 4AK1A 3HC4L 3RDTB 5DZOA 1V7ML 1B6UA 1RZKC 1WAAF 3G08A 4JO2H 5JXEA 4N8VA 3ZTNH 3WUZA 2HP4A 3WKNA 3FO0L 4AL8L 3G5VA 4Z7VF 3GBML 2BOBB 4CW1B 4V1DD 1UJ3B 5KVFL 3DUSB 3L3HB 3IXTB 3K2MC 3ARBB 3CU7A 1QRKA 2PO6D 3O11B 3M8OH 5IROC 3PHOA 3JV4B 3HA0A 4P2OB 5L8JB 1FYTA 1U92A 5DJ8B 1CICB 2Y36L 4M7JL 1EHLH 5JTWA 2EYRA 5DUPH 2CXKA 4NSKB 1AO7B 4U1GC 4AEHL 1NAMB 4H26A 3STLB 2AJSL 4YHOH 4ZSOB 5C0AE 3M17B 4PRHB 3LN9A 5E8DH 3ZMRA 1FDLH 5GGSY 3SKNB 2R9HC 2O26U 3UPAA 1XH3A 4WJ5B 1IC4H 5EWIH 4G43A 4NGHH 4AMKH 4ZYKA 1YEKH 5I1CH 1SJEA 4ODUB 2BXYA 2P48B 5SWQA 4P2QD 3TA3C 1GZPB 5C0EA 2ESVB 3IETA 5J6GA 5C86A 1KENH 3OAYH 4LGSB 4AT6A 3ZO0A 3OXRA 3AFLA 1N5YH 5E4EB 1NCNA 1K4CB 2XWJB 3FHQA 3UAJD 3LQZA 1MREH 2VLLB 1U0QA 3RWGA 4WU5B 5JO5B 2PXYC 3O2VL 3SY0B 3QIUC 2CLZB 5I1JH 1KIRB 3MUZ1 4ZAKD 1OHQA 1I1YA 2FJGB 3VWJC 4PJ7F 1K8IA 1S7WB 4U7MA 4UIMA 3EO1A 5JORA 3L3DA 4YNYB 4H5SA 5ECJE 5EB9A 3P4NB 5IMKB 1T7ZA 4XNXL 5E6ZA 1KFAH 3BFOA 4KZDL 3ARGC 4HIEB 1G6RB 4QRSB 5DHXB 2AI0H 5FF6A 3FQRA 2H3NA 5GS1A 2FX8L 1ZS8A 1FNGB 5CJXA 4YBLB 1IAMA 2FECL 1DBKL 4JM4H 5K33A 4X7SL 1HSAA 5SX5H 3SDAA 1BQSA 3PUCA 2DICA 1U91A 2YD4A 4FQLH 4OGXH 1JUFA 3NA9H 3JTTB 1GC1H