4HZBB

Crystal structure of the type vi semet effector-immunity complex tae3-tai3 from ralstonia pickettii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
NSPEAAAISFYTWFIQHDSDQTYPLSEPDIERYVATDTVGRLRNDYAHAGPPNGVDYFLKVQDYDSRDWLAHIQVQRALMLGDVAVVPVSFGSQDPVHVLVFLKRVDATWKIIKIDDTWEYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the inhibition of type VI effector Tae3 by its immunity protein Tai3
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Hydrolase
molecule keywords Putative cytoplasmic protein
total genus 37
structure length 122
sequence length 122
chains with identical sequence C, E, F
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12883 DUF3828 Protein of unknown function (DUF3828)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hzbB00
2INXA 4HVNA 4IIAA 3GZBA 4XBXA 1GY7A 4XBTA 3RGRA 2OWPA 3EBTA 4HZBB 3CPOA 3FZWA 3FF0A 3B7CA 3DXOA 3EQQB 1WQLB 3MG2A 4K1UA 3NUVA 1OPYA 1O7NB 3EN8A 2YFLB 3MG3A 3NXJA 4OVMA 1VZZA 1OF5B 3CNMA 5KP3A 1O7WB 5IG3A 1CQSA 5KP4A 3G0KA 3KZTA 4HM4B 2Z76A 1UUWB 2QGUA 4LGQA 4X2HA 2RGQA 3EJVA 2STDA 3H51A 4WYKA 5TGNA 2A15A 3WMDA 2HMLB 3MYTA 3Q90A 5AEWB 1AR0A 1NDOB 3JUMA 3KE7A 3UJMA 2GEXA 2RCDA 2YFJB 3OWSA 3EF8A 1JN5A 4R1KA 1O7PB 4L8OA 4XBYA 1ULIB 2B24B 3B8LA 1ZX2A 3G8ZA 3A76A 4FCJA 3SOAA 5BXQA 4K1VA 2GXFA 1W6YA 2I9WA 2XSOB 3G16A 4HM8B 4LEHA 3F7XA 3FF2A 1OCVA 4GB5A 1TUHA 2RFRA 3OV4A 5IENA 4J8TA 1JN5B 3DM8A 3OWYA 2R4IA 3MKIA 4I4KA 2W2CA 1OHOA 4KVHA 4L8PA 3SOYA 5IERA 1IDPA 4HJLB 4HKVB 3F7SA 1U5OA 2Z7AA 1W00A 3IPTA 2BMRB 1HKXA 3M8CA 2GBXB 3F40A 5IG0A 3B4PA 3T8NA 5DRVA 2JQ5A 1OHPA 1Q40A 3JUPA 4WYKB 2XR8B 3LZAA 1STDA 2PZVA 5D83A 5HGRA 1O7GB 1NWWA 2CKFB 3CU3A 3HX8A 3HZPA 1EA2A 3EC9A 1Z1SA 4XDWA 3K7CA 4H3UA 5CK6A 5BVBA 5IEPA 2UX0A 4HM7B 4HM2B 1OUNA 4XB5A 1GYBA 3EHCA 3I0YA 3RGAA 3LYGA 2XRXB 7STDA 4RZMA 3BLZA 5AEUB 3ROBA 2K54A 1EG9B 4HZ9B 4WWUC 5G2GA 5CF1A 3NV0B 1ULJB 1C7HA 3KKGA 1E3RA 1E97A 1GS3A 2BNGA 3GZXB 3FKAA 3GZYB 3JUQA 3MSOA 3NBRA 4HM5B 3SEDA 4CDLA 5JPPA 5AIIA 1DMNA 1JB2A 5CXOA 3VGNA 3JUNA 3MG1A 4ORLA 1ISKA 1DMQA 1BUQA 4FCMA 1TP6A 4MJDA 6STDA 3KSPA 2IMJA 3GWRA 5IEOA 1UUVB 3VSYA 3BB9A 1A2KA 5CLKA 2QIYA 3D9RA 4HM6B 5CF2A 3K0ZA 3OX9A 1JKGB 3FH1A 4R9LA 1Q42A 4N3VA 3H3HA 4LMIA 5AIFA 5AI1A 1GY6A 2B1XB 3DMCA 3F8XA 4HM1B 2Z77A 3FSDA 4STDA 3JUOA 3UNLA 1QJGA 4X2OA 1O7MB 2BMOB 5JPUA 4U13A 5KP1A 3NV0A 1OGZA 3ECFA 3EX9A 3NHXA 1OGXA 3E99A 3DUKA 3OXAA 4HM3B 4L7KA 5FW5A 1ZO2A 3FLJA 1OHSA 3GRDA 5STDA 1OF5A 2GEYA 2HMOB 1W02A 4R9KA 1SJWA 3T8UA 5IG5A 3FGYA 2HMNB 2F86B 2YFIB 1DMMA 1JB4A 2BMQB 1NU3A 3EN1B 1K41A 1S5AA 2F99A 2HMJB 3NM2A 1ASKA 2GBWB 5DREA 3MHEA 5IF6A 3S5CA 2CHCA 3EBYA 3CNXA 4WP5A 1JB5A 1E3VA 1Q40B 4Q53A 2HMKB 2XSHB 3ER7A 3HK4A 4PEJA 1O7HB 5D81A 4XM4A 8CHOA 2HMMB 1GY5A 3DZLA 3B4OA 3F8HA 4XDVA 3F9SA 3OWUA 5AIGA 5IG4A 5AIHA 1QMAA 1JKGA 4J9AA 3STDA 1OH0A 3F14A 1W01A 5EVHA 4HM0B 4OUQA 5D82A 3GZRA 2F98A
chains in the Genus database with same CATH superfamily
2INXA 1WMOA 3HIIA 4IIAA 4XBXA 4IPBA 3RGRA 3DH2A 2OCTA 2OWPA 4HZBB 1WTHA 1RGEA 1BANA 3CPOA 4BL3A 4CPKA 3LXUX 4N6V0 3NUVA 1OPYA 3EE1A 1YIJ3 1GMQA 4BTWA 5KP4A 1VZZA 3CNMA 1BRIA 2V1LA 1UUWB 2W04A 4WYKA 2D1WA 1FGOA 2AADA 3CCU3 1JRQA 4ILFA 2MF7A 1BNSA 1CH0A 1IVUA 1WMNA 1NDOB 3JUMA 3SLUA 3KE7A 3CPW2 3CC23 3AMOB 4L8OA 1UCJA 4JF8A 4R1KA 4BIRA 3G8ZA 4R4KA 4J5KA 1I3IA 2GXFA 2D42A 4N6LA 3LT8A 4LZIA 3OW22 2UGIA 5IENA 3CCE3 1QALA 3LOYA 5IERA 1A2VA 3KSED 5RNTA 1TIJA 2GU1A 1W7CA 3WA3A 1YVSA 3IJEB 3F7SA 1TRQA 1W00A 2GBXB 3CC43 3B4PA 3BNEA 3IMAB 3PZWA 1K734 1DYUA 2XR8B 3MWZA 4N6NB 1TFKA 1YGEA 2KCDA 1NWWA 4EC6A 1LOVA 2XF3A 1GD4A 3D5IA 1Z1SA 2CG0A 1IK3A 3HI7A 4N6TA 1OUNA 4XB5A 4WFOA 1ZS7A 3EHCA 7STDA 1M904 2OTJ3 2KF5A 5AEUB 2SBLA 3DGNA 4O3VA 4FMDA 3SXXA 6GSPA 5G2GA 1VQO3 3NV0B 5AYRB 1LQGC 1DETA 4RBNA 1VQL3 4HM5B 1LOYA 3MSOA 3JUQA 2CFWA 3NBRA 4CDLA 1B21A 1I70A 1N5HA 1DMNA 1JB2A 1YHQ3 3BNCA 2IMJA 3GWRA 3WOFB 1UUVB 5IW9A 2OQEA 4FMAA 1EUIC 4HM6B 1KC84 3OX9A 1D6YA 4R9LA 1BRKA 4N3VA 5AI1A 1BSEA 2BT3A 1FUTA 2UUGC 1B2ZA 2KF4A 1CYVA 7RNTA 3CMA3 4X2OA 4NREA 2BO9B 3NHXA 3DUKA 3DGLA 2OQEC 1ZO2A 1OHSA 3LMLA 1R4YA 1OF5A 2P0MA 1W02A 3N8BA 1SJWA 3T8UA 1HZ1A 1X1UA 3DGYA 2BMQB 1BGSA 2OOVA 1BU4A 2GBWB 3MHEA 3N9HA 5IF6A 1N8QA 4WP5A 2CX1A 5FGOA 1VQN3 4Q53A 3ER7A 1GOUA 4I5QA 5D81A 1O7HB 2IUJA 1N5PA 2HMMB 1GY5A 3SVAA 4BTYA 1T5YA 3QK9A 3Q2PA 4XDVA 3CCL3 3F9SA 1BNEA 1GOVA 5AIGA 2WOFA 1Q824 3STDA 2JDIH 5EVHA 4HM0B 5M1AA 3GZRA 1MNLA 1QVG2 4HVNA 1RGGA 3GZBA 4XBTA 1B27A 3FZWA 3FF0A 3T8NA 1FUSA 4K1UA 1WQLB 1RMSA 4OVMA 3ALAA 3EN8A 1IVXA 2L4VA 1CEWI 2YFLB 5KP3A 1Q7Y4 1BNGA 1LOWA 1O7WB 1WNHA 1CQSA 3PS8A 1JNQA 4N6MA 1B20A 2Z76A 4X2HA 4OK0A 2STDA 1YVBI 2W9QA 2O9UX 2ML5A 2Z6BA 4N6UA 3WMDA 1JBSA 4EYCA 2W56A 1MWUA 5AEWB 4FR9A 4K90B 1VQQA 2XFTA 1RCKA 3V98A 1RGCA 2H0GA 3LTCA 4O02B 3CCQ3 3EF8A 5ELUA 3S67A 1JN5A 2ZA4A 2H0HA 1ULIB 1UCKA 2B24B 3A5EA 1ZX2A 1OACA 3A76A 1TFOA 3B8LA 1SQWA 2K0MA 3LT9A 3WR2A 1Q864 1RSNA 1UCLA 2LYXA 4GB5A 4MEIA 2W9PA 2WO0A 1BOXA 3OV4A 1QVF2 1JN5B 3S28A 3OWYA 4I4KA 3MKIA 2WOHA 4N6OB 1VQ73 1IDPA 1MWSA 4HJLB 4HKVB 1G96A 3WHOA 1US1A 2Z7AA 1I8VA 2AAEA 3X41A 1BSDA 3S29A 2FGTA 2W0QA 4KT3B 3LZAA 3WOEB 1O7GB 4AKYA 3CU3A 1IVVA 2RBIA 3HZPA 4KFEA 3EC9A 1I0XA 1I2FA 3K7CA 4H3UA 5CK6A 3UL6A 3NBBA 3X3XA 5BVBA 5IEPA 3CCM3 3CD63 1IV9A 1X1WA 4LSOA 1T3BA 3LYGA 2XRXB 1UI8A 3UB1A 1GOYA 4QWTA 2K54A 1EG9B 4HZ9B 5CF1A 3O8YA 3I553 1C7HA 3KKGA 1AVKA 4LYLB 3J7Yd 1E3RA 3LTAA 2BNGA 1FUWA 3GZXB 3K63A 1GMRA 1ZGXA 4O8SA 3SYUA 1DE3A 3MG1A 1DMQA 1BUQA 1MGWA 1SIIA 1W2B2 1GD3A 1K28A 1LVNA 1QAKA 5CLKA 2PNCA 3L0RA 2CW9A 1RGHA 3PGBA 1JKGB 5BU4A 1RRLA 4GHOA 4BL2A 2FXTA 1GY6A 2B1XB 3Q1CA 1FW7A 2P05A 1BRSA 4STDA 1IVWA 1QJGA 5M18A 1M9GA 5KP1A 3I563 2WGQA 3EX9A 3OXAA 5FW5A 1OGXA 2E2UA 3D5GA 3E99A 4FMBA 4HM3B 4RNZA 1Q814 3D4AA 5STDA 3V99A 2HMOB 2M7OA 4K61A 1AQZA 4EXRA 2HMNB 4EBGA 4HOHA 1JB4A 1RGLA 4HAAA 1K41A 3KFQC 2HMJB 3NM2A 1ASKA 3FG4A 9RNTA 5M19A 2OTL3 1UI7A 3S5CA 1TJDA 1NB5I 1D6UA 1W2ZA 2KAAA 2XSHB 4FMCA 1KWIA 4XM4A 1G0TA 2C11A 3B4OA 1TRPA 3F8HA 1UCIA 3BIRA 3OWUA 3AGOA 4MMYB 3K5TA 1QMAA 1W6GA 4R80A 5D82A 5D83A 2F98A 3GZYB 3URPA 4MMXB 3GAXA 3NQYA 2W6JH 1GY7A 1DVDA 1RJOA 5IG0A 4AEQA 3DXOA 1LRAA 4GL6A 4BTXA 6STDA 1JBTA 1O7NB 4KFFA 1OF5B 2Y74A 3KN4A 3G0KA 2P0XA 4HBRA 4HM4B 1RNTA 2QGUA 4LGQA 2RGQA 6RNTA 1BUJA 1NB3I 2F4YA 1RLSA 2A15A 5G1KA 3LTDA 1YJW3 2LQVA 3MYTA 1RGFA 1K8A4 1BRGA 2KRTA 1X1YA 1YGWA 5LC6A 2RCDA 2KF3A 2L1SA 1LNHA 2IY2A 2YFJB 3D3LA 4HYZA 4JRFA 4XBYA 2ZL8A 5BXQA 1TTOA 2XGNA 4FCJA 4EV2A 1CYUA 1EQKA 3HIGA 3G16A 1W6YA 2I9WA 2XSOB 3DGOA 1A90A 3F7XA 1OCVA 1UW1A 4FCZA 2RFRA 1BIRA 1RN4A 1IT7A 1UDII 3SOYA 2R4IA 1MGRA 2W2CA 2CFDA 1U5OA 4EV5A 1I2GA 3PCSA 3F40A 1LNIA 3GSPA 2QEX3 1BSBA 2E2TA 2O3OA 5DRVA 2JQ5A 4WYKB 1BNRA 3X3ZA 1DVCA 1STDA 2PZVA 3K9MC 5HGRA 2CFLA 3AHSA 1EA2A 1KQS2 4XDWA 1SIHA 1UGHI 1W4NA 1RTUA 2MC8A 4HM2B 2C4BA 1Q9EA 1F8NA 2CFGA 3I0YA 4RZMA 3ROBA 2BHMA 1ULJB 4ZM8A 1IU7A 3NM7A 2XEPA 4BU4A 1IT8A 3LH4A 5CXOA 3VGNA 4ORLA 1ISKA 2F56A 2BIRA 4FCMA 1TP6A 4MJDA 3G6E3 1IYYA 1LOXA 1L5GB 5IEOA 1N8R4 1V58A 1T2IA 1Q7HA 3BB9A 3RDEA 3VSYA 1I3FA 4J5GA 1K9M4 3CCV3 1JJ22 3K0ZA 3BNBA 1B2MA 1I2EA 1BRHA 2H0IA 3CME3 3CCS3 2C10A 1RGKA 5AYSC 1NO3A 3F8XA 2W03A 2Z77A 2CG1A 1A67A 1VQ53 5JPUA 1HYFA 1RRHA 2GU3A 3DY5A 1OGZA 3NV0A 1IV7A 1V74A 3NQZA 2RSXA 1KSIA 3T0UA 4L7KA 3GRDA 4WHAA 1FGRA 2GEYA 1BAOA 1GSPA 7GSPA 2F86B 1DMMA 1NU3A 3QRDA 3TDGA 3CXC2 1S5AA 2F99A 3U97A 8RNTA 1MWTA 1M1K4 2QA43 2CHCA 1JB5A 1FGTA 1T2HA 3HK4A 3D79A 4PEJA 5ELJA 8CHOA 1JZOA 1WMPA 1X1XA 1YNVX 2IUKA 3EB8A 3CCJ3 1FA3A 3DZLA 3KCHA 2CK3H 2KXGA 3AGNA 1BNJA 3WDGB 5IG4A 2P09A 1JKGA 4J9AA 3KIIA 2P38A 2BU4A 1IQ8A 2XGLA 4CJNA 1EKMA 3RNTA 1ROVA 2CX0A 1B2SA 1JZDA 1BNFA 1Y4KA 1VQK3 1RNBA 3AMOA 1W5ZA 3EBTA 1FGMA 2CH9A 3B7CA 3EQQB 3MG2A 2R41A 1BSAA 1YJ93 3MG3A 3NXJA 1SARA 4O2HA 1TU5A 5IG3A 3Q3FA 2Q07A 3KZTA 1AY7A 1IQYA 2W56B 3ZG0A 3EJVA 3H51A 4KFDA 5TGNA 2ZHXB 3X42A 4DKIA 2HMLB 2RNTA 3Q90A 3CCR3 1LXEA 1AR0A 2CIUA 1I0VA 3AHWA 3MPHA 4IT7A 1QAFA 3V92A 3UJMA 1BRJA 2GEXA 3G4S3 3X40A 3OWSA 3VF1A 1S723 1RHLA 2CWTA 1O7PB 1SPUA 1PYLA 4NPBA 3SOAA 1VQ93 4K1VA 1M1XB 5EEOA 4HM8B 4LEHA 3FF2A 5LC7A 1TUHA 1FYSA 4TX4A 1UUGB 4GSPA 4J8TA 3DM8A 3NBJA 4MMZB 1RN7A 4KVHA 1J2BA 1OHOA 4L8PA 1EEJA 1RN1A 1C54A 3LTBA 2CWUA 3FG1A 3M8CA 3IPTA 2BMRB 1HKXA 1ROAA 1YJN3 1STFI 1OHPA 1Q40A 1UGIA 3JUPA 5EQLA 5G1LA 1IQXA 5HOHA 2WGOA 4H61A 2ML6A 2YX9A 2CKFB 1KD14 3HX8A 5GSPA 1VQ63 1FZUA 3UL5A 2IA7A 1RCLA 2UX0A 3BNDA 4HM7B 3U1WA 1GYBA 1B2UA 1JBRA 3RGAA 2XH9A 1VQ43 2CFKA 3BLZA 5JBSA 4WWUC 2F5MA 4NHFA 1E97A 1GS3A 3FKAA 5JPPA 3SEDA 3HOHA 5AIIA 1U8CB 3FCSB 3X3YA 3JUNA 1MWRA 1HU9A 3N54B 3KSPA 4KZ1A 4CCVA 3CC73 1A2KA 3NX0A 1BNIA 3BU4A 5A0OB 2Y73A 2QIYA 4RNYA 1RKYA 3D9RA 5CF2A 1G02A 1PY3A 1MOLA 2OOVC 3FH1A 3ZFZA 1Q42A 2IYJA 2CC3A 3H3HA 3DGMA 4LMIA 5AIFA 3S27A 1VQM3 1R4CA 3PYJA 3JVCA 4HM1B 1B2XA 3DMCA 4RNTA 3FSDA 4AKZA 1AV4A 3G713 3JUOA 1GMPA 2J8XB 1VQP3 1W6CA 3UNLA 5I97A 1NNVA 1O7MB 2BMOB 2K3DA 4U13A 3PCRA 1BSCA 3ECFA 4G1MB 2GSPA 3PXMA 1VQ83 3FLJA 1PU4A 2FNQA 2ZDJA 4R9KA 5IG5A 1YIT3 3FGYA 1NJI4 1BVIA 2YFIB 1B3SA 3EN1B 2F5WA 3WA2X 2E2VA 5DREA 3EBYA 1BRNL 3CNXA 3SX1A 1Q40B 1E3VA 1YI23 1LQMB 1N9JA 2HMKB 1N9EA 1AVLA 3FG3A 4EW5A 1JV2B 1V57A 3WODG 3ZG5A 1D6ZA 2HOHA 2XFSA 1PFPA 1RDSA 1FGQA 5AIHA 1RGAA 1A2PA 1OH0A 1W01A 2KF6A 3F14A 4OUQA 2CWVA 2SARA 5BIRA
chains in the Genus database with same CATH topology
2INXA 1WMOA 3HIIA 4IIAA 4XBXA 4IPBA 3RGRA 2OCTA 2OWPA 4HZBB 1WTHA 3CPOA 3LXUX 4N6V0 3NUVA 1OPYA 3EE1A 1YIJ3 4BTWA 5KP4A 1VZZA 3CNMA 2V1LA 1UUWB 2W04A 4WYKA 2D1WA 1FGOA 3CCU3 1JRQA 2MF7A 1IVUA 1WMNA 1NDOB 3JUMA 3SLUA 3KE7A 3CPW2 3CC23 3AMOB 4L8OA 4R1KA 4JF8A 3G8ZA 4R4KA 2GXFA 2D42A 4N6LA 3LT8A 4LZIA 3OW22 5IENA 3CCE3 1QALA 3LOYA 5IERA 1A2VA 3KSED 1TIJA 2GU1A 1W7CA 3WA3A 3IJEB 3F7SA 1W00A 2GBXB 3CC43 3B4PA 3BNEA 3IMAB 3PZWA 1K734 1DYUA 2XR8B 3MWZA 4N6NB 1TFKA 1YGEA 2KCDA 1NWWA 4EC6A 2XF3A 1GD4A 1Z1SA 2CG0A 1IK3A 3HI7A 4N6TA 1OUNA 4XB5A 4WFOA 3EHCA 7STDA 1M904 2OTJ3 5AEUB 2SBLA 3DGNA 4O3VA 4FMDA 3SXXA 5G2GA 1VQO3 3NV0B 5AYRB 4RBNA 1VQL3 4HM5B 3MSOA 3JUQA 2CFWA 3NBRA 4CDLA 1N5HA 1DMNA 1JB2A 1YHQ3 3BNCA 2IMJA 3GWRA 3WOFB 1UUVB 5IW9A 4FMAA 4HM6B 1KC84 3OX9A 1D6YA 4R9LA 4N3VA 5AI1A 2BT3A 1CYVA 3CMA3 4X2OA 4NREA 2BO9B 3NHXA 3DUKA 3DGLA 2OQEC 1ZO2A 1OHSA 3LMLA 1OF5A 2P0MA 1W02A 3N8BA 1SJWA 3T8UA 2BMQB 2OOVA 2GBWB 3MHEA 3N9HA 5IF6A 1N8QA 4WP5A 5FGOA 1VQN3 4Q53A 3ER7A 5D81A 1O7HB 2IUJA 1N5PA 2HMMB 1GY5A 3SVAA 4BTYA 1T5YA 3QK9A 3Q2PA 4XDVA 3CCL3 3F9SA 5AIGA 2WOFA 1Q824 3STDA 2JDIH 5EVHA 4HM0B 3GZRA 1MNLA 1QVG2 4HVNA 3GZBA 4XBTA 3FZWA 3FF0A 3T8NA 4K1UA 1WQLB 4OVMA 3ALAA 3EN8A 1IVXA 2L4VA 1CEWI 2YFLB 5KP3A 1Q7Y4 1O7WB 1WNHA 1CQSA 3PS8A 1JNQA 4N6MA 2Z76A 4X2HA 4OK0A 2STDA 1YVBI 2W9QA 2O9UX 2ML5A 2Z6BA 4N6UA 3WMDA 4EYCA 2W56A 5AEWB 4FR9A 4K90B 3V98A 2XFTA 3LTCA 4O02B 3CCQ3 3EF8A 5ELUA 3S67A 1JN5A 1ULIB 2OQEA 2B24B 3B8LA 1ZX2A 1OACA 3A76A 1TFOA 3LT9A 1SQWA 2K0MA 1Q864 2LYXA 4GB5A 4MEIA 2W9PA 2WO0A 3OV4A 1QVF2 1JN5B 3S28A 3OWYA 4I4KA 3MKIA 2WOHA 4N6OB 1IDPA 4HJLB 4HKVB 1G96A 1US1A 2Z7AA 3X41A 3S29A 2FGTA 2W0QA 3LZAA 3WOEB 1O7GB 4AKYA 3CU3A 1IVVA 3HZPA 4KFEA 3EC9A 3UL6A 3X3XA 3K7CA 4H3UA 5CK6A 5BVBA 3NBBA 5IEPA 3CCM3 3CD63 1IV9A 4LSOA 3LYGA 2XRXB 1UI8A 3UB1A 4QWTA 2K54A 1EG9B 4HZ9B 5CF1A 3O8YA 3I553 1C7HA 3KKGA 1AVKA 3J7Yd 1FUWA 1E3RA 3LTAA 2BNGA 3GZXB 3K63A 4O8SA 3MG1A 1DMQA 1BUQA 1SIIA 1W2B2 1GD3A 1K28A 1LVNA 1QAKA 5CLKA 2PNCA 3L0RA 2CW9A 3PGBA 1JKGB 1RRLA 2FXTA 1GY6A 2B1XB 3Q1CA 2P05A 4STDA 1IVWA 1QJGA 1M9GA 5KP1A 3I563 2WGQA 3EX9A 3OXAA 5FW5A 1OGXA 2E2UA 3E99A 4FMBA 4HM3B 4RNZA 1Q814 5STDA 3V99A 2HMOB 2M7OA 4K61A 4EXRA 2HMNB 4EBGA 1JB4A 1K41A 3KFQC 2HMJB 3NM2A 1ASKA 3FG4A 2OTL3 1UI7A 3S5CA 1NB5I 1D6UA 1W2ZA 2XSHB 4FMCA 1KWIA 4XM4A 2C11A 3B4OA 3F8HA 3OWUA 4MMYB 3K5TA 1QMAA 1W6GA 4R80A 5D82A 5D83A 2F98A 3GZYB 4MMXB 3GAXA 3NQYA 2W6JH 1GY7A 1DVDA 1RJOA 5IG0A 4AEQA 3DXOA 4GL6A 4BTXA 6STDA 1O7NB 4KFFA 1OF5B 2Y74A 3KN4A 3G0KA 2P0XA 4HBRA 4HM4B 2QGUA 4LGQA 2RGQA 1NB3I 2A15A 1YJW3 3LTDA 2LQVA 3MYTA 1K8A4 2KRTA 5LC6A 2RCDA 2YFJB 1LNHA 3D3LA 4HYZA 4JRFA 4XBYA 2ZL8A 5BXQA 2XGNA 4FCJA 4EV2A 1CYUA 1EQKA 3HIGA 3G16A 1W6YA 2I9WA 2XSOB 3DGOA 1A90A 3F7XA 1OCVA 1UW1A 4FCZA 2RFRA 1IT7A 3SOYA 2R4IA 2W2CA 2CFDA 1U5OA 4EV5A 3PCSA 3F40A 1VQ73 2QEX3 2E2TA 2O3OA 5DRVA 2JQ5A 4WYKB 3X3ZA 1DVCA 1STDA 2PZVA 3K9MC 5HGRA 2CFLA 1EA2A 1KQS2 4XDWA 1SIHA 1W4NA 2MC8A 4HM2B 1F8NA 2CFGA 3I0YA 4RZMA 3ROBA 2BHMA 1ULJB 4ZM8A 1IU7A 3NM7A 2XEPA 1IT8A 3LH4A 5CXOA 3VGNA 4ORLA 1ISKA 3G6E3 4FCMA 1TP6A 4MJDA 1LOXA 1L5GB 5IEOA 1N8R4 3VSYA 3RDEA 3BB9A 1K9M4 3CCV3 1JJ22 3K0ZA 3BNBA 3CME3 3CCS3 2C10A 5AYSC 1NO3A 3F8XA 2W03A 2Z77A 2CG1A 1A67A 1VQ53 5JPUA 1RRHA 2GU3A 3DY5A 1OGZA 3NV0A 1IV7A 1V74A 3NQZA 2RSXA 1KSIA 3T0UA 4L7KA 3GRDA 4WHAA 1FGRA 2GEYA 2F86B 1DMMA 1NU3A 3QRDA 3TDGA 3CXC2 1S5AA 2F99A 3U97A 1M1K4 2QA43 2CHCA 1JB5A 1FGTA 3HK4A 4PEJA 5ELJA 8CHOA 1WMPA 3EB8A 2IUKA 3CCJ3 1FA3A 3DZLA 2CK3H 2KXGA 3WDGB 5IG4A 2P09A 1JKGA 4J9AA 3KIIA 2P38A 2XGLA 1IQ8A 1EKMA 1ROVA 1VQK3 1Y4KA 3AMOA 1W5ZA 3EBTA 1FGMA 2CH9A 3B7CA 3EQQB 3MG2A 1YJ93 3MG3A 3NXJA 4O2HA 1TU5A 5IG3A 2Q07A 3KZTA 1IQYA 2W56B 3EJVA 3H51A 4KFDA 5TGNA 3X42A 2HMLB 3Q90A 3CCR3 1LXEA 1AR0A 2CIUA 3MPHA 4IT7A 1QAFA 3V92A 3UJMA 2GEXA 3G4S3 3X40A 3OWSA 3VF1A 1S723 2CWTA 1O7PB 1SPUA 3SOAA 1VQ93 4K1VA 1M1XB 5EEOA 4HM8B 4LEHA 3FF2A 5LC7A 1TUHA 4TX4A 4J8TA 3DM8A 3NBJA 4MMZB 1RN7A 4KVHA 1J2BA 1OHOA 4L8PA 3LTBA 2CWUA 3FG1A 3M8CA 3IPTA 2BMRB 1HKXA 1ROAA 1YJN3 1STFI 1OHPA 1Q40A 3JUPA 5EQLA 1IQXA 2WGOA 4H61A 2ML6A 2YX9A 2CKFB 1KD14 3HX8A 1VQ63 3UL5A 2IA7A 2UX0A 3BNDA 4HM7B 3U1WA 1GYBA 3RGAA 2XH9A 1VQ43 2CFKA 3BLZA 5JBSA 4WWUC 4NHFA 1E97A 1GS3A 3FKAA 5JPPA 3SEDA 5AIIA 1U8CB 3FCSB 3X3YA 3JUNA 1HU9A 3N54B 3KSPA 4KZ1A 4CCVA 3CC73 1A2KA 3NX0A 5A0OB 2Y73A 2QIYA 4RNYA 1RKYA 3D9RA 5CF2A 1MOLA 2OOVC 3FH1A 1Q42A 2CC3A 3H3HA 3DGMA 4LMIA 5AIFA 3S27A 1VQM3 1R4CA 3PYJA 3JVCA 4HM1B 3DMCA 3G713 4AKZA 3FSDA 1AV4A 3JUOA 1VQP3 1W6CA 3UNLA 5I97A 1O7MB 2BMOB 4U13A 3PCRA 3ECFA 4G1MB 3PXMA 1VQ83 3FLJA 1PU4A 2FNQA 2ZDJA 4R9KA 5IG5A 1YIT3 3FGYA 1NJI4 2YFIB 3EN1B 3WA2X 2E2VA 5DREA 3EBYA 3CNXA 3SX1A 1Q40B 1E3VA 1YI23 1N9JA 2HMKB 1N9EA 1AVLA 3FG3A 1JV2B 3WODG 1D6ZA 2XFSA 1PFPA 1FGQA 5AIHA 1OH0A 3F14A 1W01A 4OUQA 2CWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INX A;  4HVN A;  4IIA A;  3GZB A;  4XBX A;  1GY7 A;  4XBT A;  3RGR A;  2OWP A;  3EBT A;  4HZB B;  3CPO A;  3FZW A;  3FF0 A;  3B7C A;  3DXO A;  3EQQ B;  1WQL B;  3MG2 A;  4K1U A;  3NUV A;  1OPY A;  1O7N B;  3EN8 A;  2YFL B;  3MG3 A;  3NXJ A;  4OVM A;  1VZZ A;  1OF5 B;  3CNM A;  5KP3 A;  1O7W B;  5IG3 A;  1CQS A;  5KP4 A;  3G0K A;  3KZT A;  4HM4 B;  2Z76 A;  1UUW B;  2QGU A;  4LGQ A;  4X2H A;  2RGQ A;  3EJV A;  2STD A;  3H51 A;  4WYK A;  5TGN A;  2A15 A;  3WMD A;  2HML B;  3MYT A;  3Q90 A;  5AEW B;  1AR0 A;  1NDO B;  3JUM A;  3KE7 A;  3UJM A;  2GEX A;  2RCD A;  2YFJ B;  3OWS A;  3EF8 A;  1JN5 A;  4R1K A;  1O7P B;  4L8O A;  4XBY A;  1ULI B;  2B24 B;  3B8L A;  1ZX2 A;  3G8Z A;  3A76 A;  4FCJ A;  3SOA A;  5BXQ A;  4K1V A;  2GXF A;  1W6Y A;  2I9W A;  2XSO B;  3G16 A;  4HM8 B;  4LEH A;  3F7X A;  3FF2 A;  1OCV A;  4GB5 A;  1TUH A;  2RFR A;  3OV4 A;  5IEN A;  4J8T A;  1JN5 B;  3DM8 A;  3OWY A;  2R4I A;  3MKI A;  4I4K A;  2W2C A;  1OHO A;  4KVH A;  4L8P A;  3SOY A;  5IER A;  1IDP A;  4HJL B;  4HKV B;  3F7S A;  1U5O A;  2Z7A A;  1W00 A;  3IPT A;  2BMR B;  1HKX A;  3M8C A;  2GBX B;  3F40 A;  5IG0 A;  3B4P A;  3T8N A;  5DRV A;  2JQ5 A;  1OHP A;  1Q40 A;  3JUP A;  4WYK B;  2XR8 B;  3LZA A;  1STD A;  2PZV A;  5D83 A;  5HGR A;  1O7G B;  1NWW A;  2CKF B;  3CU3 A;  3HX8 A;  3HZP A;  1EA2 A;  3EC9 A;  1Z1S A;  4XDW A;  3K7C A;  4H3U A;  5CK6 A;  5BVB A;  5IEP A;  2UX0 A;  4HM7 B;  4HM2 B;  1OUN A;  4XB5 A;  1GYB A;  3EHC A;  3I0Y A;  3RGA A;  3LYG A;  2XRX B;  7STD A;  4RZM A;  3BLZ A;  5AEU B;  3ROB A;  2K54 A;  1EG9 B;  4HZ9 B;  4WWU C;  5G2G A;  5CF1 A;  3NV0 B;  1ULJ B;  1C7H A;  3KKG A;  1E3R A;  1E97 A;  1GS3 A;  2BNG A;  3GZX B;  3FKA A;  3GZY B;  3JUQ A;  3MSO A;  3NBR A;  4HM5 B;  3SED A;  4CDL A;  5JPP A;  5AII A;  1DMN A;  1JB2 A;  5CXO A;  3VGN A;  3JUN A;  3MG1 A;  4ORL A;  1ISK A;  1DMQ A;  1BUQ A;  4FCM A;  1TP6 A;  4MJD A;  6STD A;  3KSP A;  2IMJ A;  3GWR A;  5IEO A;  1UUV B;  3VSY A;  3BB9 A;  1A2K A;  5CLK A;  2QIY A;  3D9R A;  4HM6 B;  5CF2 A;  3K0Z A;  3OX9 A;  1JKG B;  3FH1 A;  4R9L A;  1Q42 A;  4N3V A;  3H3H A;  4LMI A;  5AIF A;  5AI1 A;  1GY6 A;  2B1X B;  3DMC A;  3F8X A;  4HM1 B;  2Z77 A;  3FSD A;  4STD A;  3JUO A;  3UNL A;  1QJG A;  4X2O A;  1O7M B;  2BMO B;  5JPU A;  4U13 A;  5KP1 A;  3NV0 A;  1OGZ A;  3ECF A;  3EX9 A;  3NHX A;  1OGX A;  3E99 A;  3DUK A;  3OXA A;  4HM3 B;  4L7K A;  5FW5 A;  1ZO2 A;  3FLJ A;  1OHS A;  3GRD A;  5STD A;  1OF5 A;  2GEY A;  2HMO B;  1W02 A;  4R9K A;  1SJW A;  3T8U A;  5IG5 A;  3FGY A;  2HMN B;  2F86 B;  2YFI B;  1DMM A;  1JB4 A;  2BMQ B;  1NU3 A;  3EN1 B;  1K41 A;  1S5A A;  2F99 A;  2HMJ B;  3NM2 A;  1ASK A;  2GBW B;  5DRE A;  3MHE A;  5IF6 A;  3S5C A;  2CHC A;  3EBY A;  3CNX A;  4WP5 A;  1JB5 A;  1E3V A;  1Q40 B;  4Q53 A;  2HMK B;  2XSH B;  3ER7 A;  3HK4 A;  4PEJ A;  1O7H B;  5D81 A;  4XM4 A;  8CHO A;  2HMM B;  1GY5 A;  3DZL A;  3B4O A;  3F8H A;  4XDV A;  3F9S A;  3OWU A;  5AIG A;  5IG4 A;  5AIH A;  1QMA A;  1JKG A;  4J9A A;  3STD A;  1OH0 A;  3F14 A;  1W01 A;  5EVH A;  4HM0 B;  4OUQ A;  5D82 A;  3GZR A;  2F98 A; 
#chains in the Genus database with same CATH topology
 2INX A;  1WMO A;  3HII A;  4IIA A;  4XBX A;  4IPB A;  3RGR A;  3DH2 A;  2OCT A;  2OWP A;  4HZB B;  1WTH A;  1RGE A;  1BAN A;  3CPO A;  4BL3 A;  4CPK A;  3LXU X;  4N6V 0;  3NUV A;  1OPY A;  3EE1 A;  1YIJ 3;  1GMQ A;  4BTW A;  5KP4 A;  1VZZ A;  3CNM A;  1BRI A;  2V1L A;  1UUW B;  2W04 A;  4WYK A;  2D1W A;  1FGO A;  2AAD A;  3CCU 3;  1JRQ A;  4ILF A;  2MF7 A;  1BNS A;  1CH0 A;  1IVU A;  1WMN A;  1NDO B;  3JUM A;  3SLU A;  3KE7 A;  3CPW 2;  3CC2 3;  3AMO B;  4L8O A;  1UCJ A;  4JF8 A;  4R1K A;  4BIR A;  3G8Z A;  4R4K A;  4J5K A;  1I3I A;  2GXF A;  2D42 A;  4N6L A;  3LT8 A;  4LZI A;  3OW2 2;  2UGI A;  5IEN A;  3CCE 3;  1QAL A;  3LOY A;  5IER A;  1A2V A;  3KSE D;  5RNT A;  1TIJ A;  2GU1 A;  1W7C A;  3WA3 A;  1YVS A;  3IJE B;  3F7S A;  1TRQ A;  1W00 A;  2GBX B;  3CC4 3;  3B4P A;  3BNE A;  3IMA B;  3PZW A;  1K73 4;  1DYU A;  2XR8 B;  3MWZ A;  4N6N B;  1TFK A;  1YGE A;  2KCD A;  1NWW A;  4EC6 A;  1LOV A;  2XF3 A;  1GD4 A;  3D5I A;  1Z1S A;  2CG0 A;  1IK3 A;  3HI7 A;  4N6T A;  1OUN A;  4XB5 A;  4WFO A;  1ZS7 A;  3EHC A;  7STD A;  1M90 4;  2OTJ 3;  2KF5 A;  5AEU B;  2SBL A;  3DGN A;  4O3V A;  4FMD A;  3SXX A;  6GSP A;  5G2G A;  1VQO 3;  3NV0 B;  5AYR B;  1LQG C;  1DET A;  4RBN A;  1VQL 3;  4HM5 B;  1LOY A;  3MSO A;  3JUQ A;  2CFW A;  3NBR A;  4CDL A;  1B21 A;  1I70 A;  1N5H A;  1DMN A;  1JB2 A;  1YHQ 3;  3BNC A;  2IMJ A;  3GWR A;  3WOF B;  1UUV B;  5IW9 A;  2OQE A;  4FMA A;  1EUI C;  4HM6 B;  1KC8 4;  3OX9 A;  1D6Y A;  4R9L A;  1BRK A;  4N3V A;  5AI1 A;  1BSE A;  2BT3 A;  1FUT A;  2UUG C;  1B2Z A;  2KF4 A;  1CYV A;  7RNT A;  3CMA 3;  4X2O A;  4NRE A;  2BO9 B;  3NHX A;  3DUK A;  3DGL A;  2OQE C;  1ZO2 A;  1OHS A;  3LML A;  1R4Y A;  1OF5 A;  2P0M A;  1W02 A;  3N8B A;  1SJW A;  3T8U A;  1HZ1 A;  1X1U A;  3DGY A;  2BMQ B;  1BGS A;  2OOV A;  1BU4 A;  2GBW B;  3MHE A;  3N9H A;  5IF6 A;  1N8Q A;  4WP5 A;  2CX1 A;  5FGO A;  1VQN 3;  4Q53 A;  3ER7 A;  1GOU A;  4I5Q A;  5D81 A;  1O7H B;  2IUJ A;  1N5P A;  2HMM B;  1GY5 A;  3SVA A;  4BTY A;  1T5Y A;  3QK9 A;  3Q2P A;  4XDV A;  3CCL 3;  3F9S A;  1BNE A;  1GOV A;  5AIG A;  2WOF A;  1Q82 4;  3STD A;  2JDI H;  5EVH A;  4HM0 B;  5M1A A;  3GZR A;  1MNL A;  1QVG 2;  4HVN A;  1RGG A;  3GZB A;  4XBT A;  1B27 A;  3FZW A;  3FF0 A;  3T8N A;  1FUS A;  4K1U A;  1WQL B;  1RMS A;  4OVM A;  3ALA A;  3EN8 A;  1IVX A;  2L4V A;  1CEW I;  2YFL B;  5KP3 A;  1Q7Y 4;  1BNG A;  1LOW A;  1O7W B;  1WNH A;  1CQS A;  3PS8 A;  1JNQ A;  4N6M A;  1B20 A;  2Z76 A;  4X2H A;  4OK0 A;  2STD A;  1YVB I;  2W9Q A;  2O9U X;  2ML5 A;  2Z6B A;  4N6U A;  3WMD A;  1JBS A;  4EYC A;  2W56 A;  1MWU A;  5AEW B;  4FR9 A;  4K90 B;  1VQQ A;  2XFT A;  1RCK A;  3V98 A;  1RGC A;  2H0G A;  3LTC A;  4O02 B;  3CCQ 3;  3EF8 A;  5ELU A;  3S67 A;  1JN5 A;  2ZA4 A;  2H0H A;  1ULI B;  1UCK A;  2B24 B;  3A5E A;  1ZX2 A;  1OAC A;  3A76 A;  1TFO A;  3B8L A;  1SQW A;  2K0M A;  3LT9 A;  3WR2 A;  1Q86 4;  1RSN A;  1UCL A;  2LYX A;  4GB5 A;  4MEI A;  2W9P A;  2WO0 A;  1BOX A;  3OV4 A;  1QVF 2;  1JN5 B;  3S28 A;  3OWY A;  4I4K A;  3MKI A;  2WOH A;  4N6O B;  1VQ7 3;  1IDP A;  1MWS A;  4HJL B;  4HKV B;  1G96 A;  3WHO A;  1US1 A;  2Z7A A;  1I8V A;  2AAE A;  3X41 A;  1BSD A;  3S29 A;  2FGT A;  2W0Q A;  4KT3 B;  3LZA A;  3WOE B;  1O7G B;  4AKY A;  3CU3 A;  1IVV A;  2RBI A;  3HZP A;  4KFE A;  3EC9 A;  1I0X A;  1I2F A;  3K7C A;  4H3U A;  5CK6 A;  3UL6 A;  3NBB A;  3X3X A;  5BVB A;  5IEP A;  3CCM 3;  3CD6 3;  1IV9 A;  1X1W A;  4LSO A;  1T3B A;  3LYG A;  2XRX B;  1UI8 A;  3UB1 A;  1GOY A;  4QWT A;  2K54 A;  1EG9 B;  4HZ9 B;  5CF1 A;  3O8Y A;  3I55 3;  1C7H A;  3KKG A;  1AVK A;  4LYL B;  3J7Y d;  1E3R A;  3LTA A;  2BNG A;  1FUW A;  3GZX B;  3K63 A;  1GMR A;  1ZGX A;  4O8S A;  3SYU A;  1DE3 A;  3MG1 A;  1DMQ A;  1BUQ A;  1MGW A;  1SII A;  1W2B 2;  1GD3 A;  1K28 A;  1LVN A;  1QAK A;  5CLK A;  2PNC A;  3L0R A;  2CW9 A;  1RGH A;  3PGB A;  1JKG B;  5BU4 A;  1RRL A;  4GHO A;  4BL2 A;  2FXT A;  1GY6 A;  2B1X B;  3Q1C A;  1FW7 A;  2P05 A;  1BRS A;  4STD A;  1IVW A;  1QJG A;  5M18 A;  1M9G A;  5KP1 A;  3I56 3;  2WGQ A;  3EX9 A;  3OXA A;  5FW5 A;  1OGX A;  2E2U A;  3D5G A;  3E99 A;  4FMB A;  4HM3 B;  4RNZ A;  1Q81 4;  3D4A A;  5STD A;  3V99 A;  2HMO B;  2M7O A;  4K61 A;  1AQZ A;  4EXR A;  2HMN B;  4EBG A;  4HOH A;  1JB4 A;  1RGL A;  4HAA A;  1K41 A;  3KFQ C;  2HMJ B;  3NM2 A;  1ASK A;  3FG4 A;  9RNT A;  5M19 A;  2OTL 3;  1UI7 A;  3S5C A;  1TJD A;  1NB5 I;  1D6U A;  1W2Z A;  2KAA A;  2XSH B;  4FMC A;  1KWI A;  4XM4 A;  1G0T A;  2C11 A;  3B4O A;  1TRP A;  3F8H A;  1UCI A;  3BIR A;  3OWU A;  3AGO A;  4MMY B;  3K5T A;  1QMA A;  1W6G A;  4R80 A;  5D82 A;  5D83 A;  2F98 A;  3GZY B;  3URP A;  4MMX B;  3GAX A;  3NQY A;  2W6J H;  1GY7 A;  1DVD A;  1RJO A;  5IG0 A;  4AEQ A;  3DXO A;  1LRA A;  4GL6 A;  4BTX A;  6STD A;  1JBT A;  1O7N B;  4KFF A;  1OF5 B;  2Y74 A;  3KN4 A;  3G0K A;  2P0X A;  4HBR A;  4HM4 B;  1RNT A;  2QGU A;  4LGQ A;  2RGQ A;  6RNT A;  1BUJ A;  1NB3 I;  2F4Y A;  1RLS A;  2A15 A;  5G1K A;  3LTD A;  1YJW 3;  2LQV A;  3MYT A;  1RGF A;  1K8A 4;  1BRG A;  2KRT A;  1X1Y A;  1YGW A;  5LC6 A;  2RCD A;  2KF3 A;  2L1S A;  1LNH A;  2IY2 A;  2YFJ B;  3D3L A;  4HYZ A;  4JRF A;  4XBY A;  2ZL8 A;  5BXQ A;  1TTO A;  2XGN A;  4FCJ A;  4EV2 A;  1CYU A;  1EQK A;  3HIG A;  3G16 A;  1W6Y A;  2I9W A;  2XSO B;  3DGO A;  1A90 A;  3F7X A;  1OCV A;  1UW1 A;  4FCZ A;  2RFR A;  1BIR A;  1RN4 A;  1IT7 A;  1UDI I;  3SOY A;  2R4I A;  1MGR A;  2W2C A;  2CFD A;  1U5O A;  4EV5 A;  1I2G A;  3PCS A;  3F40 A;  1LNI A;  3GSP A;  2QEX 3;  1BSB A;  2E2T A;  2O3O A;  5DRV A;  2JQ5 A;  4WYK B;  1BNR A;  3X3Z A;  1DVC A;  1STD A;  2PZV A;  3K9M C;  5HGR A;  2CFL A;  3AHS A;  1EA2 A;  1KQS 2;  4XDW A;  1SIH A;  1UGH I;  1W4N A;  1RTU A;  2MC8 A;  4HM2 B;  2C4B A;  1Q9E A;  1F8N A;  2CFG A;  3I0Y A;  4RZM A;  3ROB A;  2BHM A;  1ULJ B;  4ZM8 A;  1IU7 A;  3NM7 A;  2XEP A;  4BU4 A;  1IT8 A;  3LH4 A;  5CXO A;  3VGN A;  4ORL A;  1ISK A;  2F56 A;  2BIR A;  4FCM A;  1TP6 A;  4MJD A;  3G6E 3;  1IYY A;  1LOX A;  1L5G B;  5IEO A;  1N8R 4;  1V58 A;  1T2I A;  1Q7H A;  3BB9 A;  3RDE A;  3VSY A;  1I3F A;  4J5G A;  1K9M 4;  3CCV 3;  1JJ2 2;  3K0Z A;  3BNB A;  1B2M A;  1I2E A;  1BRH A;  2H0I A;  3CME 3;  3CCS 3;  2C10 A;  1RGK A;  5AYS C;  1NO3 A;  3F8X A;  2W03 A;  2Z77 A;  2CG1 A;  1A67 A;  1VQ5 3;  5JPU A;  1HYF A;  1RRH A;  2GU3 A;  3DY5 A;  1OGZ A;  3NV0 A;  1IV7 A;  1V74 A;  3NQZ A;  2RSX A;  1KSI A;  3T0U A;  4L7K A;  3GRD A;  4WHA A;  1FGR A;  2GEY A;  1BAO A;  1GSP A;  7GSP A;  2F86 B;  1DMM A;  1NU3 A;  3QRD A;  3TDG A;  3CXC 2;  1S5A A;  2F99 A;  3U97 A;  8RNT A;  1MWT A;  1M1K 4;  2QA4 3;  2CHC A;  1JB5 A;  1FGT A;  1T2H A;  3HK4 A;  3D79 A;  4PEJ A;  5ELJ A;  8CHO A;  1JZO A;  1WMP A;  1X1X A;  1YNV X;  2IUK A;  3EB8 A;  3CCJ 3;  1FA3 A;  3DZL A;  3KCH A;  2CK3 H;  2KXG A;  3AGN A;  1BNJ A;  3WDG B;  5IG4 A;  2P09 A;  1JKG A;  4J9A A;  3KII A;  2P38 A;  2BU4 A;  1IQ8 A;  2XGL A;  4CJN A;  1EKM A;  3RNT A;  1ROV A;  2CX0 A;  1B2S A;  1JZD A;  1BNF A;  1Y4K A;  1VQK 3;  1RNB A;  3AMO A;  1W5Z A;  3EBT A;  1FGM A;  2CH9 A;  3B7C A;  3EQQ B;  3MG2 A;  2R41 A;  1BSA A;  1YJ9 3;  3MG3 A;  3NXJ A;  1SAR A;  4O2H A;  1TU5 A;  5IG3 A;  3Q3F A;  2Q07 A;  3KZT A;  1AY7 A;  1IQY A;  2W56 B;  3ZG0 A;  3EJV A;  3H51 A;  4KFD A;  5TGN A;  2ZHX B;  3X42 A;  4DKI A;  2HML B;  2RNT A;  3Q90 A;  3CCR 3;  1LXE A;  1AR0 A;  2CIU A;  1I0V A;  3AHW A;  3MPH A;  4IT7 A;  1QAF A;  3V92 A;  3UJM A;  1BRJ A;  2GEX A;  3G4S 3;  3X40 A;  3OWS A;  3VF1 A;  1S72 3;  1RHL A;  2CWT A;  1O7P B;  1SPU A;  1PYL A;  4NPB A;  3SOA A;  1VQ9 3;  4K1V A;  1M1X B;  5EEO A;  4HM8 B;  4LEH A;  3FF2 A;  5LC7 A;  1TUH A;  1FYS A;  4TX4 A;  1UUG B;  4GSP A;  4J8T A;  3DM8 A;  3NBJ A;  4MMZ B;  1RN7 A;  4KVH A;  1J2B A;  1OHO A;  4L8P A;  1EEJ A;  1RN1 A;  1C54 A;  3LTB A;  2CWU A;  3FG1 A;  3M8C A;  3IPT A;  2BMR B;  1HKX A;  1ROA A;  1YJN 3;  1STF I;  1OHP A;  1Q40 A;  1UGI A;  3JUP A;  5EQL A;  5G1L A;  1IQX A;  5HOH A;  2WGO A;  4H61 A;  2ML6 A;  2YX9 A;  2CKF B;  1KD1 4;  3HX8 A;  5GSP A;  1VQ6 3;  1FZU A;  3UL5 A;  2IA7 A;  1RCL A;  2UX0 A;  3BND A;  4HM7 B;  3U1W A;  1GYB A;  1B2U A;  1JBR A;  3RGA A;  2XH9 A;  1VQ4 3;  2CFK A;  3BLZ A;  5JBS A;  4WWU C;  2F5M A;  4NHF A;  1E97 A;  1GS3 A;  3FKA A;  5JPP A;  3SED A;  3HOH A;  5AII A;  1U8C B;  3FCS B;  3X3Y A;  3JUN A;  1MWR A;  1HU9 A;  3N54 B;  3KSP A;  4KZ1 A;  4CCV A;  3CC7 3;  1A2K A;  3NX0 A;  1BNI A;  3BU4 A;  5A0O B;  2Y73 A;  2QIY A;  4RNY A;  1RKY A;  3D9R A;  5CF2 A;  1G02 A;  1PY3 A;  1MOL A;  2OOV C;  3FH1 A;  3ZFZ A;  1Q42 A;  2IYJ A;  2CC3 A;  3H3H A;  3DGM A;  4LMI A;  5AIF A;  3S27 A;  1VQM 3;  1R4C A;  3PYJ A;  3JVC A;  4HM1 B;  1B2X A;  3DMC A;  4RNT A;  3FSD A;  4AKZ A;  1AV4 A;  3G71 3;  3JUO A;  1GMP A;  2J8X B;  1VQP 3;  1W6C A;  3UNL A;  5I97 A;  1NNV A;  1O7M B;  2BMO B;  2K3D A;  4U13 A;  3PCR A;  1BSC A;  3ECF A;  4G1M B;  2GSP A;  3PXM A;  1VQ8 3;  3FLJ A;  1PU4 A;  2FNQ A;  2ZDJ A;  4R9K A;  5IG5 A;  1YIT 3;  3FGY A;  1NJI 4;  1BVI A;  2YFI B;  1B3S A;  3EN1 B;  2F5W A;  3WA2 X;  2E2V A;  5DRE A;  3EBY A;  1BRN L;  3CNX A;  3SX1 A;  1Q40 B;  1E3V A;  1YI2 3;  1LQM B;  1N9J A;  2HMK B;  1N9E A;  1AVL A;  3FG3 A;  4EW5 A;  1JV2 B;  1V57 A;  3WOD G;  3ZG5 A;  1D6Z A;  2HOH A;  2XFS A;  1PFP A;  1RDS A;  1FGQ A;  5AIH A;  1RGA A;  1A2P A;  1OH0 A;  1W01 A;  2KF6 A;  3F14 A;  4OUQ A;  2CWV A;  2SAR A;  5BIR A; 
#chains in the Genus database with same CATH homology
 2INX A;  1WMO A;  3HII A;  4IIA A;  4XBX A;  4IPB A;  3RGR A;  2OCT A;  2OWP A;  4HZB B;  1WTH A;  3CPO A;  3LXU X;  4N6V 0;  3NUV A;  1OPY A;  3EE1 A;  1YIJ 3;  4BTW A;  5KP4 A;  1VZZ A;  3CNM A;  2V1L A;  1UUW B;  2W04 A;  4WYK A;  2D1W A;  1FGO A;  3CCU 3;  1JRQ A;  2MF7 A;  1IVU A;  1WMN A;  1NDO B;  3JUM A;  3SLU A;  3KE7 A;  3CPW 2;  3CC2 3;  3AMO B;  4L8O A;  4R1K A;  4JF8 A;  3G8Z A;  4R4K A;  2GXF A;  2D42 A;  4N6L A;  3LT8 A;  4LZI A;  3OW2 2;  5IEN A;  3CCE 3;  1QAL A;  3LOY A;  5IER A;  1A2V A;  3KSE D;  1TIJ A;  2GU1 A;  1W7C A;  3WA3 A;  3IJE B;  3F7S A;  1W00 A;  2GBX B;  3CC4 3;  3B4P A;  3BNE A;  3IMA B;  3PZW A;  1K73 4;  1DYU A;  2XR8 B;  3MWZ A;  4N6N B;  1TFK A;  1YGE A;  2KCD A;  1NWW A;  4EC6 A;  2XF3 A;  1GD4 A;  1Z1S A;  2CG0 A;  1IK3 A;  3HI7 A;  4N6T A;  1OUN A;  4XB5 A;  4WFO A;  3EHC A;  7STD A;  1M90 4;  2OTJ 3;  5AEU B;  2SBL A;  3DGN A;  4O3V A;  4FMD A;  3SXX A;  5G2G A;  1VQO 3;  3NV0 B;  5AYR B;  4RBN A;  1VQL 3;  4HM5 B;  3MSO A;  3JUQ A;  2CFW A;  3NBR A;  4CDL A;  1N5H A;  1DMN A;  1JB2 A;  1YHQ 3;  3BNC A;  2IMJ A;  3GWR A;  3WOF B;  1UUV B;  5IW9 A;  4FMA A;  4HM6 B;  1KC8 4;  3OX9 A;  1D6Y A;  4R9L A;  4N3V A;  5AI1 A;  2BT3 A;  1CYV A;  3CMA 3;  4X2O A;  4NRE A;  2BO9 B;  3NHX A;  3DUK A;  3DGL A;  2OQE C;  1ZO2 A;  1OHS A;  3LML A;  1OF5 A;  2P0M A;  1W02 A;  3N8B A;  1SJW A;  3T8U A;  2BMQ B;  2OOV A;  2GBW B;  3MHE A;  3N9H A;  5IF6 A;  1N8Q A;  4WP5 A;  5FGO A;  1VQN 3;  4Q53 A;  3ER7 A;  5D81 A;  1O7H B;  2IUJ A;  1N5P A;  2HMM B;  1GY5 A;  3SVA A;  4BTY A;  1T5Y A;  3QK9 A;  3Q2P A;  4XDV A;  3CCL 3;  3F9S A;  5AIG A;  2WOF A;  1Q82 4;  3STD A;  2JDI H;  5EVH A;  4HM0 B;  3GZR A;  1MNL A;  1QVG 2;  4HVN A;  3GZB A;  4XBT A;  3FZW A;  3FF0 A;  3T8N A;  4K1U A;  1WQL B;  4OVM A;  3ALA A;  3EN8 A;  1IVX A;  2L4V A;  1CEW I;  2YFL B;  5KP3 A;  1Q7Y 4;  1O7W B;  1WNH A;  1CQS A;  3PS8 A;  1JNQ A;  4N6M A;  2Z76 A;  4X2H A;  4OK0 A;  2STD A;  1YVB I;  2W9Q A;  2O9U X;  2ML5 A;  2Z6B A;  4N6U A;  3WMD A;  4EYC A;  2W56 A;  5AEW B;  4FR9 A;  4K90 B;  3V98 A;  2XFT A;  3LTC A;  4O02 B;  3CCQ 3;  3EF8 A;  5ELU A;  3S67 A;  1JN5 A;  1ULI B;  2OQE A;  2B24 B;  3B8L A;  1ZX2 A;  1OAC A;  3A76 A;  1TFO A;  3LT9 A;  1SQW A;  2K0M A;  1Q86 4;  2LYX A;  4GB5 A;  4MEI A;  2W9P A;  2WO0 A;  3OV4 A;  1QVF 2;  1JN5 B;  3S28 A;  3OWY A;  4I4K A;  3MKI A;  2WOH A;  4N6O B;  1IDP A;  4HJL B;  4HKV B;  1G96 A;  1US1 A;  2Z7A A;  3X41 A;  3S29 A;  2FGT A;  2W0Q A;  3LZA A;  3WOE B;  1O7G B;  4AKY A;  3CU3 A;  1IVV A;  3HZP A;  4KFE A;  3EC9 A;  3UL6 A;  3X3X A;  3K7C A;  4H3U A;  5CK6 A;  5BVB A;  3NBB A;  5IEP A;  3CCM 3;  3CD6 3;  1IV9 A;  4LSO A;  3LYG A;  2XRX B;  1UI8 A;  3UB1 A;  4QWT A;  2K54 A;  1EG9 B;  4HZ9 B;  5CF1 A;  3O8Y A;  3I55 3;  1C7H A;  3KKG A;  1AVK A;  3J7Y d;  1FUW A;  1E3R A;  3LTA A;  2BNG A;  3GZX B;  3K63 A;  4O8S A;  3MG1 A;  1DMQ A;  1BUQ A;  1SII A;  1W2B 2;  1GD3 A;  1K28 A;  1LVN A;  1QAK A;  5CLK A;  2PNC A;  3L0R A;  2CW9 A;  3PGB A;  1JKG B;  1RRL A;  2FXT A;  1GY6 A;  2B1X B;  3Q1C A;  2P05 A;  4STD A;  1IVW A;  1QJG A;  1M9G A;  5KP1 A;  3I56 3;  2WGQ A;  3EX9 A;  3OXA A;  5FW5 A;  1OGX A;  2E2U A;  3E99 A;  4FMB A;  4HM3 B;  4RNZ A;  1Q81 4;  5STD A;  3V99 A;  2HMO B;  2M7O A;  4K61 A;  4EXR A;  2HMN B;  4EBG A;  1JB4 A;  1K41 A;  3KFQ C;  2HMJ B;  3NM2 A;  1ASK A;  3FG4 A;  2OTL 3;  1UI7 A;  3S5C A;  1NB5 I;  1D6U A;  1W2Z A;  2XSH B;  4FMC A;  1KWI A;  4XM4 A;  2C11 A;  3B4O A;  3F8H A;  3OWU A;  4MMY B;  3K5T A;  1QMA A;  1W6G A;  4R80 A;  5D82 A;  5D83 A;  2F98 A;  3GZY B;  4MMX B;  3GAX A;  3NQY A;  2W6J H;  1GY7 A;  1DVD A;  1RJO A;  5IG0 A;  4AEQ A;  3DXO A;  4GL6 A;  4BTX A;  6STD A;  1O7N B;  4KFF A;  1OF5 B;  2Y74 A;  3KN4 A;  3G0K A;  2P0X A;  4HBR A;  4HM4 B;  2QGU A;  4LGQ A;  2RGQ A;  1NB3 I;  2A15 A;  1YJW 3;  3LTD A;  2LQV A;  3MYT A;  1K8A 4;  2KRT A;  5LC6 A;  2RCD A;  2YFJ B;  1LNH A;  3D3L A;  4HYZ A;  4JRF A;  4XBY A;  2ZL8 A;  5BXQ A;  2XGN A;  4FCJ A;  4EV2 A;  1CYU A;  1EQK A;  3HIG A;  3G16 A;  1W6Y A;  2I9W A;  2XSO B;  3DGO A;  1A90 A;  3F7X A;  1OCV A;  1UW1 A;  4FCZ A;  2RFR A;  1IT7 A;  3SOY A;  2R4I A;  2W2C A;  2CFD A;  1U5O A;  4EV5 A;  3PCS A;  3F40 A;  1VQ7 3;  2QEX 3;  2E2T A;  2O3O A;  5DRV A;  2JQ5 A;  4WYK B;  3X3Z A;  1DVC A;  1STD A;  2PZV A;  3K9M C;  5HGR A;  2CFL A;  1EA2 A;  1KQS 2;  4XDW A;  1SIH A;  1W4N A;  2MC8 A;  4HM2 B;  1F8N A;  2CFG A;  3I0Y A;  4RZM A;  3ROB A;  2BHM A;  1ULJ B;  4ZM8 A;  1IU7 A;  3NM7 A;  2XEP A;  1IT8 A;  3LH4 A;  5CXO A;  3VGN A;  4ORL A;  1ISK A;  3G6E 3;  4FCM A;  1TP6 A;  4MJD A;  1LOX A;  1L5G B;  5IEO A;  1N8R 4;  3VSY A;  3RDE A;  3BB9 A;  1K9M 4;  3CCV 3;  1JJ2 2;  3K0Z A;  3BNB A;  3CME 3;  3CCS 3;  2C10 A;  5AYS C;  1NO3 A;  3F8X A;  2W03 A;  2Z77 A;  2CG1 A;  1A67 A;  1VQ5 3;  5JPU A;  1RRH A;  2GU3 A;  3DY5 A;  1OGZ A;  3NV0 A;  1IV7 A;  1V74 A;  3NQZ A;  2RSX A;  1KSI A;  3T0U A;  4L7K A;  3GRD A;  4WHA A;  1FGR A;  2GEY A;  2F86 B;  1DMM A;  1NU3 A;  3QRD A;  3TDG A;  3CXC 2;  1S5A A;  2F99 A;  3U97 A;  1M1K 4;  2QA4 3;  2CHC A;  1JB5 A;  1FGT A;  3HK4 A;  4PEJ A;  5ELJ A;  8CHO A;  1WMP A;  3EB8 A;  2IUK A;  3CCJ 3;  1FA3 A;  3DZL A;  2CK3 H;  2KXG A;  3WDG B;  5IG4 A;  2P09 A;  1JKG A;  4J9A A;  3KII A;  2P38 A;  2XGL A;  1IQ8 A;  1EKM A;  1ROV A;  1VQK 3;  1Y4K A;  3AMO A;  1W5Z A;  3EBT A;  1FGM A;  2CH9 A;  3B7C A;  3EQQ B;  3MG2 A;  1YJ9 3;  3MG3 A;  3NXJ A;  4O2H A;  1TU5 A;  5IG3 A;  2Q07 A;  3KZT A;  1IQY A;  2W56 B;  3EJV A;  3H51 A;  4KFD A;  5TGN A;  3X42 A;  2HML B;  3Q90 A;  3CCR 3;  1LXE A;  1AR0 A;  2CIU A;  3MPH A;  4IT7 A;  1QAF A;  3V92 A;  3UJM A;  2GEX A;  3G4S 3;  3X40 A;  3OWS A;  3VF1 A;  1S72 3;  2CWT A;  1O7P B;  1SPU A;  3SOA A;  1VQ9 3;  4K1V A;  1M1X B;  5EEO A;  4HM8 B;  4LEH A;  3FF2 A;  5LC7 A;  1TUH A;  4TX4 A;  4J8T A;  3DM8 A;  3NBJ A;  4MMZ B;  1RN7 A;  4KVH A;  1J2B A;  1OHO A;  4L8P A;  3LTB A;  2CWU A;  3FG1 A;  3M8C A;  3IPT A;  2BMR B;  1HKX A;  1ROA A;  1YJN 3;  1STF I;  1OHP A;  1Q40 A;  3JUP A;  5EQL A;  1IQX A;  2WGO A;  4H61 A;  2ML6 A;  2YX9 A;  2CKF B;  1KD1 4;  3HX8 A;  1VQ6 3;  3UL5 A;  2IA7 A;  2UX0 A;  3BND A;  4HM7 B;  3U1W A;  1GYB A;  3RGA A;  2XH9 A;  1VQ4 3;  2CFK A;  3BLZ A;  5JBS A;  4WWU C;  4NHF A;  1E97 A;  1GS3 A;  3FKA A;  5JPP A;  3SED A;  5AII A;  1U8C B;  3FCS B;  3X3Y A;  3JUN A;  1HU9 A;  3N54 B;  3KSP A;  4KZ1 A;  4CCV A;  3CC7 3;  1A2K A;  3NX0 A;  5A0O B;  2Y73 A;  2QIY A;  4RNY A;  1RKY A;  3D9R A;  5CF2 A;  1MOL A;  2OOV C;  3FH1 A;  1Q42 A;  2CC3 A;  3H3H A;  3DGM A;  4LMI A;  5AIF A;  3S27 A;  1VQM 3;  1R4C A;  3PYJ A;  3JVC A;  4HM1 B;  3DMC A;  3G71 3;  4AKZ A;  3FSD A;  1AV4 A;  3JUO A;  1VQP 3;  1W6C A;  3UNL A;  5I97 A;  1O7M B;  2BMO B;  4U13 A;  3PCR A;  3ECF A;  4G1M B;  3PXM A;  1VQ8 3;  3FLJ A;  1PU4 A;  2FNQ A;  2ZDJ A;  4R9K A;  5IG5 A;  1YIT 3;  3FGY A;  1NJI 4;  2YFI B;  3EN1 B;  3WA2 X;  2E2V A;  5DRE A;  3EBY A;  3CNX A;  3SX1 A;  1Q40 B;  1E3V A;  1YI2 3;  1N9J A;  2HMK B;  1N9E A;  1AVL A;  3FG3 A;  1JV2 B;  3WOD G;  1D6Z A;  2XFS A;  1PFP A;  1FGQ A;  5AIH A;  1OH0 A;  3F14 A;  1W01 A;  4OUQ A;  2CWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...