4HZBB

Crystal structure of the type vi semet effector-immunity complex tae3-tai3 from ralstonia pickettii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
NSPEAAAISFYTWFIQHDSDQTYPLSEPDIERYVATDTVGRLRNDYAHAGPPNGVDYFLKVQDYDSRDWLAHIQVQRALMLGDVAVVPVSFGSQDPVHVLVFLKRVDATWKIIKIDDTWEYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structural insights into the inhibition of type VI effector Tae3 by its immunity protein Tai3
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Hydrolase
total genus 37
structure length 122
sequence length 122
chains with identical sequence C, E, F
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12883 DUF3828 Protein of unknown function (DUF3828)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hzbB00
1JB2A 1TUHA 1VZZA 1ULIB 3B4PA 1OPYA 1Q40A 4HM6B 4HM0B 4ORLA 2UX0A 1EA2A 4CDLA 3DM8A 1E3VA 4RZMA 4WYKB 3F14A 1STDA 3BLZA 3GZXB 3OWYA 2YFIB 1JB5A 8CHOA 4XDVA 3JUNA 3NUVA 3FLJA 1E3RA 5CF2A 3HK4A 4XBXA 2K54A 1GY7A 1C7HA 5JPPA 2RFRA 3Q90A 3MSOA 5CF1A 1TP6A 1W6YA 5D81A 4FCJA 1ULJB 3UJMA 2HMMB 3DMCA 3SEDA 3B7CA 3SOAA 5D83A 3NXJA 3NBRA 4WP5A 3G0KA 2GEXA 4MJDA 3FSDA 2GXFA 3JUOA 1K41A 3F8XA 3ROBA 3GWRA 3EX9A 3STDA 1O7WB 3EQQB 4HZ9B 1GY5A 4IIAA 2YFJB 3ECFA 1ISKA 1Q42A 3KZTA 3M8CA 4HM2B 1O7NB 1JN5A 3NM2A 5DRVA 3MHEA 5G2GA 3OXAA 2B1XB 1O7GB 2RGQA 3FGYA 1O7PB 1OGZA 4R9KA 3JUMA 1DMMA 2XSHB 2Z7AA 4L8PA 5AIFA 1OHPA 5AEUB 1UUVB 4R1KA 1JKGB 4PEJA 1OGXA 4HKVB 3GZYB 3KKGA 3MG2A 4R9LA 4HM4B 3MYTA 5DREA 1OF5A 3E99A 5AIHA 1O7MB 3EN8A 2STDA 3F9SA 2QIYA 3GRDA 3F7SA 3JUPA 4X2OA 3K0ZA 5BXQA 3FH1A 3FZWA 3EHCA 3FF0A 1Q40B 1HKXA 3OV4A 5D82A 3CU3A 3WMDA 1NDOB 1DMQA 1GS3A 4HVNA 5AIIA 3FF2A 5FW5A 2RCDA 3DXOA 2HMLB 3EN1B 2IMJA 4FCMA 1O7HB 4N3VA 3HZPA 3CPOA 1JB4A 4Q53A 1QJGA 2BMRB 3H51A 5KP3A 2CHCA 5JPUA 4L7KA 1NU3A 3EC9A 3K7CA 3D9RA 3JUQA 1OH0A 2XSOB 5IG4A 1W00A 5IG0A 4U13A 3OWSA 4GB5A 3NV0A 4OVMA 3IPTA 4XB5A 4LMIA 3H3HA 1SJWA 3RGAA 1ZX2A 1NWWA 1UUWB 3DZLA 1JKGA 3VSYA 4I4KA 3A76A 1W02A 4HM1B 1QMAA 5AEWB 2GBXB 2XR8B 3ER7A 5BVBA 2B24B 3MG3A 3LZAA 2PZVA 1GY6A 1DMNA 5IERA 4XBTA 3EBTA 4WYKA 2OWPA 3EF8A 2Z76A 3MKIA 4HZBB 3F8HA 4L8OA 2Z77A 3S5CA 3G16A 1OHSA 3GZRA 1A2KA 2INXA 2HMKB 1CQSA 3NHXA 4HM3B 5AIGA 4HJLB 3BB9A 4HM8B 3GZBA 5IG3A 2JQ5A 4HM7B 5IG5A 4XM4A 2HMJB 4STDA 2BMQB 3EJVA 3EBYA 3F40A 5KP4A 3RGRA 5STDA 2GBWB 4XDWA 3LYGA 7STDA 2F98A 4LGQA 5CK6A 1AR0A 1OF5B 3UNLA 2R4IA 1WQLB 1GYBA 5CLKA 2W2CA 4KVHA 1EG9B 4J8TA 4H3UA 4XBYA 2GEYA 1E97A 5KP1A 2HMNB 4K1UA 1Z1SA 2BMOB 1OHOA 3KSPA 2F99A 3B4OA 3DUKA 3I0YA 4OUQA 4K1VA 3KE7A 1IDPA 5IEPA 4WWUC 1W01A 5CXOA 1ZO2A 3T8UA 1S5AA 2QGUA 3T8NA 1BUQA 1ASKA 2I9WA 3F7XA 3SOYA 2XRXB 3OX9A 5IEOA 2BNGA 5HGRA 1U5OA 3B8LA 5EVHA 3CNMA 2A15A 5TGNA 2HMOB 4X2HA 4LEHA 4HM5B 3VGNA 3FKAA 3OWUA 5IF6A 3NV0B 6STDA 2F86B 2CKFB 5AI1A 1OCVA 5IENA 1OUNA 3CNXA 3MG1A 1JN5B 3HX8A 3G8ZA 2YFLB 4J9AA
chains in the Genus database with same CATH superfamily
3LTCA 1JB2A 3EE1A 1RKYA 1VQO3 1B27A 1DVDA 1BSEA 1D6UA 1TUHA 1VZZA 1VQP3 1ULIB 1YJW3 1LQGC 5EEOA 2O9UX 2RBIA 1U8CB 2XH9A 4LYLB 4RNTA 4EV5A 1JBRA 3B4PA 1OPYA 2P0XA 3NX0A 1Q7Y4 1Q40A 3L0RA 2C11A 1ZGXA 3N9HA 4HM6B 2OQEA 1KC84 4O8SA 4HM0B 4ORLA 1HYFA 3D3LA 2XFSA 3AMOA 3DGNA 3I563 5AYSC 2UX0A 1CYUA 1EA2A 4DKIA 3LOYA 4CDLA 3DM8A 1FGOA 1MNLA 1E3VA 4RZMA 3LTDA 1WMPA 4WYKB 3F14A 1STDA 1B2XA 4AEQA 1V57A 3N8BA 3V98A 3BLZA 3GZXB 1WTHA 3KCHA 2OOVA 3OWYA 3RNTA 1IT7A 1BRGA 2ML5A 1RGLA 2ZHXB 2YFIB 1Y4KA 5M1AA 4H61A 3VF1A 3WODG 1JB5A 3AGOA 3SYUA 1LVNA 3TDGA 2C4BA 2XGNA 8CHOA 1RN4A 1GD3A 2CIUA 2KF4A 1UUGB 4WFOA 1GOVA 4XDVA 3JUNA 4ILFA 1RGCA 3NUVA 3FLJA 3MWZA 1E3RA 5M19A 5CF2A 3HK4A 3X3XA 2KCDA 4XBXA 1T2HA 2CX0A 1W4NA 2K54A 4BL3A 2QEX3 1GY7A 1C7HA 5JPPA 2WOHA 1NB5I 5LC6A 1WMOA 2E2UA 1N9EA 2RFRA 3MSOA 3Q90A 3X41A 5CF1A 1TP6A 1W6YA 5D81A 1FUTA 1G96A 2KAAA 3AHSA 4R4KA 1YI23 3DH2A 4O2HA 4FCJA 1ULJB 3UJMA 2HMMB 3DMCA 3SEDA 1RTUA 2CK3H 3N54B 3B7CA 3SOAA 1UGHI 1SPUA 1JZOA 5D83A 3NXJA 1WMNA 2IYJA 1UCJA 3NBRA 4WP5A 1FUWA 1KD14 3G0KA 2GEXA 4J5KA 4MJDA 6GSPA 3I553 1VQM3 1TJDA 2Y73A 3FSDA 3EB8A 4JF8A 2KF6A 2GXFA 1BRSA 1MGWA 4J5GA 2F5WA 2IY2A 1RGEA 3JUOA 1K41A 1BNFA 3LTBA 3PGBA 3F8XA 1GOUA 1M904 3WOEB 4NHFA 3ROBA 3GWRA 1I0VA 4IT7A 3EX9A 6RNTA 2W04A 3STDA 3CCR3 1VQ83 1SIHA 1MOLA 3S28A 2CFKA 1DVCA 1O7WB 3CC43 3EQQB 2IUKA 4HZ9B 1GY5A 1Q814 1AVKA 1IU7A 1RGAA 1W7CA 2GU1A 4IIAA 4CPKA 1K734 1CYVA 2YFJB 1IVVA 2F5MA 2GU3A 3ECFA 1Q42A 1ISKA 1L5GB 4GSPA 3KZTA 3D4AA 3M8CA 1O7NB 4HM2B 3CPW2 1JN5A 1UW1A 2FXTA 2V1LA 1MWTA 3NM2A 4RNYA 1BSCA 5DRVA 3WA2X 3MHEA 5G2GA 4ZM8A 2L4VA 3OXAA 2R41A 3NBJA 2B1XB 1G0TA 1O7GB 1M1XB 2RGQA 3FGYA 3FG3A 1O7PB 4KFFA 3CCJ3 5G1LA 1J2BA 1OGZA 1QAFA 2H0GA 2SARA 1DMMA 3GAXA 3JUMA 1V58A 4R9KA 2XSHB 2Z7AA 3BU4A 2CG1A 4L8PA 5AIFA 4HOHA 1OHPA 3X3YA 5AEUB 1T3BA 1S723 3Q2PA 1UUVB 4R1KA 2CFGA 2E2VA 1JKGB 3KSED 1FUSA 3A5EA 4PEJA 4BTYA 3U97A 1OGXA 4EXRA 1IQ8A 3J7Yd 2OTL3 1BAOA 1UDII 5FGOA 2P0MA 1I2GA 2OTJ3 4BIRA 1QVG2 1X1UA 4HKVB 3CCE3 1QVF2 1BRHA 1LOYA 2W6JH 2L1SA 3DGYA 4KT3B 3Q3FA 1FGQA 1JV2B 1BVIA 2F56A 1YIT3 3WHOA 3GZYB 3KKGA 1N8QA 3MG2A 4R9LA 1EEJA 1NJI4 2XGLA 4OK0A 1MWUA 1B2ZA 4HM4B 2CC3A 4N6UA 4EC6A 1K9M4 1V74A 1W6CA 4FMAA 3MYTA 5DREA 1B20A 1N9JA 1OF5A 2MF7A 2WOFA 1VQ53 1A67A 1YGWA 2W56B 3E99A 5AIHA 1ROAA 1VQN3 3K63A 4LZIA 1FYSA 1MWSA 1O7MB 3UB1A 3EN8A 1DE3A 2STDA 1RN1A 1BNRA 2FGTA 1I3IA 3F9SA 1QAKA 1RGHA 2ZL8A 1PFPA 3NQYA 1DYUA 2QIYA 3GRDA 1BSAA 3F7SA 1YIJ3 3FG1A 3JUPA 2OCTA 1LOXA 2Z6BA 1ZS7A 1FZUA 4X2OA 4MMYB 3K0ZA 5BXQA 4BTXA 2RSXA 3S29A 4TX4A 1TIJA 3FH1A 1VQL3 3FZWA 1R4YA 3EHCA 1IQXA 1RDSA 1UI7A 4CJNA 4G1MB 3PS8A 3FF0A 1GSPA 2BU4A 1W2B2 4IPBA 1Q40B 1HKXA 4O02B 2CFDA 3WA3A 5ELUA 1AQZA 3CCU3 2P05A 3LT9A 3OV4A 3CMA3 1X1YA 5D82A 2W9PA 1BSDA 3AMOB 3CU3A 1TTOA 3WMDA 3OW22 1NDOB 4JRFA 3PCSA 1LXEA 1PU4A 3FG4A 1DMQA 2FNQA 1GMRA 1IV9A 1GS3A 3IJEB 3BNBA 4HVNA 3V99A 5AIIA 3FF2A 1JJ22 3LTAA 5FW5A 1I70A 2RCDA 5I97A 1FGRA 1RCKA 4NREA 1SIIA 3CCL3 1FW7A 3DXOA 1I2EA 3DGLA 2HMLB 2K0MA 3EN1B 2IMJA 4FCMA 1IQYA 1O7HB 1YJN3 4N3VA 2IA7A 1MWRA 1W2ZA 2JDIH 4N6OB 3HZPA 3CPOA 1STFI 3D5IA 5ELJA 1UGIA 1JB4A 3X3ZA 4Q53A 1IV7A 1QJGA 2BMRB 2D1WA 2MC8A 4BTWA 5JBSA 1K28A 3H51A 4EBGA 2XFTA 1X1XA 2CHCA 3QRDA 5KP3A 5JPUA 3LXUX 2BIRA 3LT8A 2W0QA 1NU3A 3EC9A 3K7CA 3D9RA 3JUQA 3KFQC 4L7KA 1OH0A 1YGEA 2CWUA 2XSOB 3G6E3 1RNTA 1IK3A 1LOVA 2K3DA 2BO9B 3K9MC 1RSNA 2WGOA 5IG4A 1GMQA 1LNHA 1NNVA 1W00A 5IG0A 4U13A 3SX1A 3OWSA 2ZA4A 1BNSA 4GB5A 3CXC2 2KF5A 2KRTA 3NV0A 3IPTA 4OVMA 1A2PA 1CEWI 3DGOA 4XB5A 3UL5A 4LMIA 1PY3A 3H3HA 1SJWA 4BU4A 3RGAA 1N5HA 1JNQA 1RGFA 2W9QA 2LQVA 1ZX2A 1NWWA 1UUWB 3DZLA 3KIIA 4HAAA 5LC7A 1JKGA 3VSYA 1YHQ3 1IT8A 1X1WA 4GL6A 1EKMA 4I4KA 1VQK3 3A76A 1BRNL 1W02A 1BSBA 1AY7A 2LYXA 4HM1B 3ZG5A 1QMAA 1UI8A 5AEWB 5GSPA 1IYYA 2SBLA 4I5QA 2GBXB 5EQLA 3V92A 3CC23 4AKZA 1YJ93 2XR8B 1RGKA 3ER7A 5BVBA 3CD63 2B24B 3ALAA 2OQEC 2PZVA 3LZAA 3MG3A 1AV4A 1T5YA 2ML6A 3MPHA 1R4CA 4MEIA 1GY6A 1DMNA 1B2SA 3PCRA 1D6YA 1TRQA 3PYJA 1BGSA 1RMSA 1SQWA 1TRPA 3HI7A 5IERA 4XBTA 1BOXA 3BNCA 1Q824 1RGGA 2W56A 3HIGA 2J8XB 3EBTA 1CH0A 2E2TA 2YX9A 3KN4A 3S27A 4WYKA 3ZFZA 4RBNA 3RDEA 3SLUA 5RNTA 1RRLA 1N8R4 2OWPA 1UCLA 4CCVA 2OOVC 3EF8A 2Z76A 3MKIA 3BNDA 4HYZA 3CCV3 3IMAB 1I0XA 3HOHA 4HZBB 5BU4A 3F8HA 4L8OA 1BRJA 1Q9EA 2Z77A 3S5CA 1BU4A 3G16A 2CFWA 1OHSA 3GZRA 5IW9A 1BNIA 1A2KA 1B2UA 1BIRA 2INXA 1BNEA 1A90A 2HMKB 1CQSA 3DY5A 3NHXA 4HM3B 5AIGA 4FMBA 2BT3A 2Y74A 4HJLB 1F8NA 3BB9A 4HM8B 3GZBA 5IG3A 2JQ5A 3U1WA 4HM7B 2P38A 1GMPA 5IG5A 4XM4A 3SXXA 7RNTA 2HMJB 3K5TA 3SVAA 4STDA 1SARA 1TFOA 1JZDA 2BMQB 1YNVX 3EJVA 1RLSA 1TU5A 4AKYA 1EUIC 3EBYA 3F40A 4EW5A 5KP4A 1LNIA 4K61A 1VQ73 3RGRA 2CX1A 4QWTA 3S67A 1Q864 1KQS2 3WR2A 3JVCA 4KFDA 1IVXA 3PXMA 2GBWB 5STDA 4XDWA 2RNTA 3LYGA 7STDA 1NB3I 2F98A 3D79A 3LMLA 3G713 3NBBA 4LGQA 5CK6A 1JRQA 1IVWA 3D5GA 1AR0A 1B2MA 1OF5B 2BHMA 3HIIA 1M9GA 2C10A 1M1K4 1ROVA 3UNLA 1EQKA 2CWTA 4HBRA 2KXGA 2R4IA 1WQLB 1GYBA 5CLKA 1UCKA 3URPA 1JBSA 1YVSA 2W2CA 2GSPA 1B3SA 2CH9A 1I3FA 1A2VA 1QALA 2HOHA 1EG9B 1HU9A 4H3UA 4J8TA 1UCIA 4KVHA 4XBYA 2P09A 5M18A 2AADA 2GEYA 1VQ43 1E97A 3BNEA 3WOFB 4EV2A 4NPBA 3ZG0A 4MMXB 5KP1A 2HMNB 3NQZA 1W5ZA 4FCZA 4K1UA 8RNTA 1AVLA 1DETA 1JBTA 1Z1SA 2BMOB 3T0UA 4N6LA 7GSPA 1OHOA 5G1KA 1FGTA 1FGMA 2IUJA 3KSPA 1LOWA 2F99A 3B4OA 3DUKA 3I0YA 3KE7A 4K1VA 1N5PA 4LSOA 4OUQA 1K8A4 1IDPA 1FA3A 5IEPA 2CWVA 2H0IA 1BRIA 4N6MA 1W01A 4WWUC 5BIRA 2KF3A 3QK9A 1HZ1A 5CXOA 2UUGC 1ZO2A 3DGMA 4WHAA 2CFLA 2WGQA 3T8UA 1S5AA 1OACA 1BRKA 1RN7A 1RJOA 2QGUA 4O3VA 1BNJA 4K90B 2D42A 1T2IA 3T8NA 2QA43 1LQMB 1WNHA 4N6TA 1BUQA 1IVUA 1ASKA 2Q07A 4FMDA 4N6NB 2I9WA 2UGIA 2W03A 3F7XA 5A0OB 2PNCA 1C54A 3SOYA 1NO3A 2XRXB 3AGNA 3OX9A 2ZDJA 3NM7A 3CCQ3 5IEOA 3AHWA 1PYLA 3BIRA 1B21A 1D6ZA 1Q7HA 2F4YA 2BNGA 5HGRA 4KZ1A 3X42A 1U5OA 2XF3A 2O3OA 1GD4A 1W6GA 2H0HA 3B8LA 2WO0A 5EVHA 3X40A 3CNMA 1BANA 2A15A 3PZWA 1RNBA 5TGNA 2HMOB 1VQ63 4EYCA 2CG0A 3LH4A 4X2HA 1TFKA 4LEHA 1BNGA 3FCSB 1VQ93 4RNZA 4HM5B 3O8YA 1RHLA 3CC73 3VGNA 3CCS3 3FKAA 2AAEA 2XEPA 3OWUA 4R80A 1RRHA 4BL2A 5IF6A 3G4S3 9RNTA 3CCM3 3NV0B 6STDA 2F86B 1RCLA 5HOHA 1VQQA 2CKFB 2CW9A 1US1A 4FMCA 5AI1A 3CME3 4GHOA 1OCVA 1I8VA 5AYRB 3UL6A 5IENA 1KWIA 1G02A 4MMZB 3Q1CA 1OUNA 4KFEA 4FR9A 3CNXA 3MG1A 1JN5B 1KSIA 3GSPA 1MGRA 4N6V0 1YVBI 3HX8A 3G8ZA 1I2FA 1LRAA 1BUJA 3WDGB 1GOYA 2YFLB 4J9AA 2M7OA
chains in the Genus database with same CATH topology
3LTCA 1JB2A 3EE1A 1RKYA 1VQO3 1DVDA 1D6UA 1TUHA 1VZZA 1VQP3 1ULIB 1YJW3 5EEOA 2O9UX 2XH9A 1U8CB 4EV5A 3B4PA 1OPYA 2P0XA 3NX0A 1Q7Y4 1Q40A 3L0RA 2C11A 3N9HA 4HM6B 2OQEA 1KC84 4O8SA 4HM0B 4ORLA 3D3LA 2XFSA 3AMOA 3DGNA 3I563 5AYSC 2UX0A 1CYUA 1EA2A 3LOYA 4CDLA 3DM8A 1FGOA 1MNLA 1E3VA 4RZMA 3LTDA 1WMPA 4WYKB 3F14A 1STDA 4AEQA 3N8BA 3V98A 3BLZA 3GZXB 1WTHA 2OOVA 3OWYA 1IT7A 2ML5A 2YFIB 1Y4KA 4H61A 3VF1A 3WODG 1JB5A 1LVNA 3TDGA 2XGNA 8CHOA 1GD3A 2CIUA 4WFOA 4XDVA 3JUNA 3NUVA 3FLJA 3MWZA 1E3RA 5CF2A 3HK4A 3X3XA 2KCDA 4XBXA 1W4NA 2K54A 2QEX3 1GY7A 1C7HA 5JPPA 2WOHA 1NB5I 5LC6A 1WMOA 2E2UA 1N9EA 2RFRA 3MSOA 3Q90A 3X41A 5CF1A 1TP6A 1W6YA 5D81A 1G96A 1YI23 4R4KA 4O2HA 4FCJA 1ULJB 3UJMA 2HMMB 3DMCA 3SEDA 2CK3H 3N54B 3B7CA 3SOAA 1SPUA 5D83A 3NXJA 1WMNA 3NBRA 4WP5A 1FUWA 1KD14 3G0KA 2GEXA 4MJDA 3I553 1VQM3 2Y73A 3FSDA 3EB8A 4JF8A 2GXFA 3JUOA 1K41A 3PGBA 3LTBA 1M904 3F8XA 3WOEB 4NHFA 3ROBA 3GWRA 4IT7A 3EX9A 2W04A 3STDA 3CCR3 1VQ83 1SIHA 1MOLA 3S28A 2CFKA 1DVCA 1O7WB 3CC43 3EQQB 2IUKA 4HZ9B 1GY5A 1Q814 1AVKA 1IU7A 1W7CA 2GU1A 4IIAA 1K734 1CYVA 2YFJB 1IVVA 3ECFA 2GU3A 1ISKA 1Q42A 1L5GB 3KZTA 3M8CA 4HM2B 1O7NB 3CPW2 1JN5A 1UW1A 2FXTA 2V1LA 4RNYA 3NM2A 5DRVA 3WA2X 3MHEA 5G2GA 4ZM8A 2L4VA 3OXAA 3NBJA 2B1XB 1O7GB 2RGQA 1M1XB 3FGYA 3FG3A 4KFFA 1O7PB 3CCJ3 1J2BA 1OGZA 1QAFA 3JUMA 4R9KA 1DMMA 3GAXA 4BTWA 2CG1A 2XSHB 2Z7AA 4L8PA 5AIFA 1OHPA 3X3YA 5AEUB 1S723 3Q2PA 1UUVB 4R1KA 2CFGA 2E2VA 1JKGB 3KSED 4BTYA 4PEJA 3U97A 1OGXA 4EXRA 1IQ8A 3J7Yd 2OTL3 5FGOA 2P0MA 2OTJ3 1QVG2 4HKVB 3CCE3 1QVF2 2W6JH 1FGQA 1JV2B 1YIT3 3GZYB 3KKGA 1N8QA 3MG2A 4R9LA 1NJI4 2XGLA 4OK0A 1K9M4 4HM4B 4N6UA 2CC3A 4EC6A 1V74A 1W6CA 4FMAA 3MYTA 5DREA 1N9JA 1OF5A 2MF7A 2WOFA 1VQ53 1A67A 2W56B 3E99A 5AIHA 1ROAA 1VQN3 3K63A 4LZIA 1O7MB 3UB1A 3EN8A 2STDA 2FGTA 3F9SA 1QAKA 2ZL8A 1PFPA 3NQYA 1DYUA 2QIYA 3GRDA 3F7SA 1YIJ3 3FG1A 3JUPA 2OCTA 1LOXA 2Z6BA 4X2OA 4MMYB 3K0ZA 5BXQA 4BTXA 2RSXA 3S29A 4TX4A 1TIJA 3FH1A 1VQL3 3FZWA 3EHCA 1IQXA 1UI7A 4G1MB 3PS8A 3FF0A 1W2B2 4IPBA 1Q40B 1HKXA 4O02B 2CFDA 3WA3A 5ELUA 3CCU3 2P05A 3LT9A 3OV4A 3CMA3 5D82A 2W9PA 3AMOB 3CU3A 3WMDA 3OW22 1NDOB 4JRFA 3PCSA 1LXEA 1PU4A 3FG4A 1DMQA 2FNQA 1IV9A 1GS3A 3IJEB 3BNBA 4HVNA 3V99A 5AIIA 3FF2A 1JJ22 3LTAA 5FW5A 5I97A 2RCDA 1FGRA 4NREA 1SIIA 3CCL3 3DXOA 3DGLA 2HMLB 2K0MA 3EN1B 2IMJA 4FCMA 1IQYA 1O7HB 1YJN3 4N3VA 2IA7A 1W2ZA 2JDIH 4N6OB 3HZPA 3CPOA 1STFI 5ELJA 1JB4A 3X3ZA 4Q53A 1IV7A 1QJGA 2BMRB 2D1WA 2MC8A 5JBSA 1K28A 3H51A 4EBGA 2XFTA 5KP3A 2CHCA 3QRDA 5JPUA 3LXUX 3LT8A 2W0QA 1NU3A 3EC9A 3K7CA 3D9RA 3JUQA 3KFQC 4L7KA 1OH0A 1YGEA 2CWUA 2XSOB 3G6E3 1IK3A 2BO9B 3K9MC 2WGOA 5IG4A 1LNHA 1W00A 5IG0A 4U13A 3SX1A 3OWSA 4GB5A 3CXC2 2KRTA 3NV0A 4OVMA 3IPTA 1CEWI 3DGOA 4XB5A 3UL5A 4LMIA 3H3HA 1SJWA 3RGAA 1N5HA 1JNQA 2W9QA 2LQVA 1ZX2A 1NWWA 1UUWB 3DZLA 3KIIA 5LC7A 1JKGA 3VSYA 1YHQ3 1IT8A 4GL6A 1EKMA 4I4KA 1VQK3 3A76A 1W02A 2LYXA 4HM1B 1QMAA 1UI8A 5AEWB 2SBLA 2GBXB 5EQLA 3V92A 3CC23 4AKZA 1YJ93 2XR8B 3ER7A 5BVBA 3CD63 2B24B 3ALAA 2OQEC 2PZVA 3LZAA 3MG3A 1AV4A 1T5YA 2ML6A 3MPHA 1R4CA 4MEIA 1GY6A 1DMNA 3PCRA 1D6YA 3PYJA 1SQWA 5IERA 3HI7A 4XBTA 3BNCA 1Q824 2W56A 3HIGA 3EBTA 2E2TA 3KN4A 2YX9A 3S27A 4WYKA 4RBNA 3RDEA 3SLUA 1N8R4 1RRLA 2OWPA 4CCVA 2OOVC 3EF8A 2Z76A 3MKIA 3BNDA 4HYZA 3CCV3 3IMAB 4HZBB 3F8HA 4L8OA 2Z77A 3S5CA 3G16A 2CFWA 1OHSA 3GZRA 5IW9A 1A90A 1A2KA 2INXA 2HMKB 1CQSA 3DY5A 3NHXA 4HM3B 5AIGA 4FMBA 2BT3A 2Y74A 4HJLB 1F8NA 3BB9A 4HM8B 3GZBA 5IG3A 2JQ5A 3U1WA 4HM7B 2P38A 5IG5A 4XM4A 3SXXA 2HMJB 3K5TA 3SVAA 4STDA 1TFOA 2BMQB 1TU5A 3EJVA 4AKYA 3EBYA 3F40A 5KP4A 4K61A 1VQ73 3RGRA 4QWTA 3S67A 1Q864 1KQS2 3JVCA 4KFDA 1IVXA 3PXMA 2GBWB 5STDA 4XDWA 3LYGA 7STDA 1NB3I 2F98A 3G713 3LMLA 3NBBA 4LGQA 5CK6A 1JRQA 1IVWA 1AR0A 1OF5B 2BHMA 3HIIA 1M9GA 2C10A 1M1K4 1ROVA 3UNLA 1EQKA 2CWTA 4HBRA 2KXGA 2R4IA 1WQLB 1GYBA 5CLKA 2W2CA 2CH9A 1A2VA 1QALA 4KVHA 1EG9B 1HU9A 4H3UA 4J8TA 4XBYA 2P09A 2GEYA 1VQ43 1E97A 3BNEA 3WOFB 4EV2A 4MMXB 5KP1A 2HMNB 3NQZA 1W5ZA 4FCZA 4K1UA 1AVLA 1Z1SA 2BMOB 3T0UA 4N6LA 1OHOA 1FGTA 1FGMA 2IUJA 3KSPA 2F99A 3B4OA 3DUKA 3I0YA 3KE7A 4K1VA 4LSOA 1N5PA 4OUQA 1K8A4 1IDPA 1FA3A 5IEPA 2CWVA 4N6MA 1W01A 4WWUC 3QK9A 5CXOA 1ZO2A 3DGMA 4WHAA 2CFLA 2WGQA 3T8UA 1S5AA 1OACA 1RN7A 1RJOA 2QGUA 4O3VA 4K90B 2D42A 3T8NA 2QA43 1WNHA 4N6TA 1BUQA 1IVUA 1ASKA 2Q07A 4FMDA 4N6NB 2I9WA 5A0OB 2W03A 3F7XA 2PNCA 3SOYA 1NO3A 2XRXB 3OX9A 2ZDJA 3NM7A 3CCQ3 5IEOA 1D6ZA 2BNGA 5HGRA 4KZ1A 3X42A 1U5OA 2XF3A 2O3OA 1GD4A 1W6GA 3B8LA 2WO0A 5EVHA 3X40A 3CNMA 2A15A 3PZWA 5TGNA 2HMOB 1VQ63 4EYCA 2CG0A 3LH4A 4X2HA 1TFKA 4LEHA 3FCSB 1VQ93 4RNZA 4HM5B 3O8YA 3CC73 3VGNA 3CCS3 3FKAA 3OWUA 2XEPA 4R80A 5IF6A 1RRHA 3G4S3 3CCM3 3NV0B 6STDA 2F86B 2CKFB 2CW9A 3CME3 1US1A 4FMCA 5AI1A 1OCVA 5AYRB 3UL6A 5IENA 1KWIA 4MMZB 3Q1CA 1OUNA 4KFEA 4FR9A 3CNXA 3MG1A 1JN5B 1KSIA 4N6V0 1YVBI 3HX8A 3G8ZA 3WDGB 2YFLB 4J9AA 2M7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB2 A;  1TUH A;  1VZZ A;  1ULI B;  3B4P A;  1OPY A;  1Q40 A;  4HM6 B;  4HM0 B;  4ORL A;  2UX0 A;  1EA2 A;  4CDL A;  3DM8 A;  1E3V A;  4RZM A;  4WYK B;  3F14 A;  1STD A;  3BLZ A;  3GZX B;  3OWY A;  2YFI B;  1JB5 A;  8CHO A;  4XDV A;  3JUN A;  3NUV A;  3FLJ A;  1E3R A;  5CF2 A;  3HK4 A;  4XBX A;  2K54 A;  1GY7 A;  1C7H A;  5JPP A;  2RFR A;  3Q90 A;  3MSO A;  5CF1 A;  1TP6 A;  1W6Y A;  5D81 A;  4FCJ A;  1ULJ B;  3UJM A;  2HMM B;  3DMC A;  3SED A;  3B7C A;  3SOA A;  5D83 A;  3NXJ A;  3NBR A;  4WP5 A;  3G0K A;  2GEX A;  4MJD A;  3FSD A;  2GXF A;  3JUO A;  1K41 A;  3F8X A;  3ROB A;  3GWR A;  3EX9 A;  3STD A;  1O7W B;  3EQQ B;  4HZ9 B;  1GY5 A;  4IIA A;  2YFJ B;  3ECF A;  1ISK A;  1Q42 A;  3KZT A;  3M8C A;  4HM2 B;  1O7N B;  1JN5 A;  3NM2 A;  5DRV A;  3MHE A;  5G2G A;  3OXA A;  2B1X B;  1O7G B;  2RGQ A;  3FGY A;  1O7P B;  1OGZ A;  4R9K A;  3JUM A;  1DMM A;  2XSH B;  2Z7A A;  4L8P A;  5AIF A;  1OHP A;  5AEU B;  1UUV B;  4R1K A;  1JKG B;  4PEJ A;  1OGX A;  4HKV B;  3GZY B;  3KKG A;  3MG2 A;  4R9L A;  4HM4 B;  3MYT A;  5DRE A;  1OF5 A;  3E99 A;  5AIH A;  1O7M B;  3EN8 A;  2STD A;  3F9S A;  2QIY A;  3GRD A;  3F7S A;  3JUP A;  4X2O A;  3K0Z A;  5BXQ A;  3FH1 A;  3FZW A;  3EHC A;  3FF0 A;  1Q40 B;  1HKX A;  3OV4 A;  5D82 A;  3CU3 A;  3WMD A;  1NDO B;  1DMQ A;  1GS3 A;  4HVN A;  5AII A;  3FF2 A;  5FW5 A;  2RCD A;  3DXO A;  2HML B;  3EN1 B;  2IMJ A;  4FCM A;  1O7H B;  4N3V A;  3HZP A;  3CPO A;  1JB4 A;  4Q53 A;  1QJG A;  2BMR B;  3H51 A;  5KP3 A;  2CHC A;  5JPU A;  4L7K A;  1NU3 A;  3EC9 A;  3K7C A;  3D9R A;  3JUQ A;  1OH0 A;  2XSO B;  5IG4 A;  1W00 A;  5IG0 A;  4U13 A;  3OWS A;  4GB5 A;  3NV0 A;  4OVM A;  3IPT A;  4XB5 A;  4LMI A;  3H3H A;  1SJW A;  3RGA A;  1ZX2 A;  1NWW A;  1UUW B;  3DZL A;  1JKG A;  3VSY A;  4I4K A;  3A76 A;  1W02 A;  4HM1 B;  1QMA A;  5AEW B;  2GBX B;  2XR8 B;  3ER7 A;  5BVB A;  2B24 B;  3MG3 A;  3LZA A;  2PZV A;  1GY6 A;  1DMN A;  5IER A;  4XBT A;  3EBT A;  4WYK A;  2OWP A;  3EF8 A;  2Z76 A;  3MKI A;  4HZB B;  3F8H A;  4L8O A;  2Z77 A;  3S5C A;  3G16 A;  1OHS A;  3GZR A;  1A2K A;  2INX A;  2HMK B;  1CQS A;  3NHX A;  4HM3 B;  5AIG A;  4HJL B;  3BB9 A;  4HM8 B;  3GZB A;  5IG3 A;  2JQ5 A;  4HM7 B;  5IG5 A;  4XM4 A;  2HMJ B;  4STD A;  2BMQ B;  3EJV A;  3EBY A;  3F40 A;  5KP4 A;  3RGR A;  5STD A;  2GBW B;  4XDW A;  3LYG A;  7STD A;  2F98 A;  4LGQ A;  5CK6 A;  1AR0 A;  1OF5 B;  3UNL A;  2R4I A;  1WQL B;  1GYB A;  5CLK A;  2W2C A;  4KVH A;  1EG9 B;  4J8T A;  4H3U A;  4XBY A;  2GEY A;  1E97 A;  5KP1 A;  2HMN B;  4K1U A;  1Z1S A;  2BMO B;  1OHO A;  3KSP A;  2F99 A;  3B4O A;  3DUK A;  3I0Y A;  4OUQ A;  4K1V A;  3KE7 A;  1IDP A;  5IEP A;  4WWU C;  1W01 A;  5CXO A;  1ZO2 A;  3T8U A;  1S5A A;  2QGU A;  3T8N A;  1BUQ A;  1ASK A;  2I9W A;  3F7X A;  3SOY A;  2XRX B;  3OX9 A;  5IEO A;  2BNG A;  5HGR A;  1U5O A;  3B8L A;  5EVH A;  3CNM A;  2A15 A;  5TGN A;  2HMO B;  4X2H A;  4LEH A;  4HM5 B;  3VGN A;  3FKA A;  3OWU A;  5IF6 A;  3NV0 B;  6STD A;  2F86 B;  2CKF B;  5AI1 A;  1OCV A;  5IEN A;  1OUN A;  3CNX A;  3MG1 A;  1JN5 B;  3HX8 A;  3G8Z A;  2YFL B;  4J9A A; 
#chains in the Genus database with same CATH topology
 3LTC A;  1JB2 A;  3EE1 A;  1RKY A;  1VQO 3;  1B27 A;  1DVD A;  1BSE A;  1D6U A;  1TUH A;  1VZZ A;  1VQP 3;  1ULI B;  1YJW 3;  1LQG C;  5EEO A;  2O9U X;  2RBI A;  1U8C B;  2XH9 A;  4LYL B;  4RNT A;  4EV5 A;  1JBR A;  3B4P A;  1OPY A;  2P0X A;  3NX0 A;  1Q7Y 4;  1Q40 A;  3L0R A;  2C11 A;  1ZGX A;  3N9H A;  4HM6 B;  2OQE A;  1KC8 4;  4O8S A;  4HM0 B;  4ORL A;  1HYF A;  3D3L A;  2XFS A;  3AMO A;  3DGN A;  3I56 3;  5AYS C;  2UX0 A;  1CYU A;  1EA2 A;  4DKI A;  3LOY A;  4CDL A;  3DM8 A;  1FGO A;  1MNL A;  1E3V A;  4RZM A;  3LTD A;  1WMP A;  4WYK B;  3F14 A;  1STD A;  1B2X A;  4AEQ A;  1V57 A;  3N8B A;  3V98 A;  3BLZ A;  3GZX B;  1WTH A;  3KCH A;  2OOV A;  3OWY A;  3RNT A;  1IT7 A;  1BRG A;  2ML5 A;  1RGL A;  2ZHX B;  2YFI B;  1Y4K A;  5M1A A;  4H61 A;  3VF1 A;  3WOD G;  1JB5 A;  3AGO A;  3SYU A;  1LVN A;  3TDG A;  2C4B A;  2XGN A;  8CHO A;  1RN4 A;  1GD3 A;  2CIU A;  2KF4 A;  1UUG B;  4WFO A;  1GOV A;  4XDV A;  3JUN A;  4ILF A;  1RGC A;  3NUV A;  3FLJ A;  3MWZ A;  1E3R A;  5M19 A;  5CF2 A;  3HK4 A;  3X3X A;  2KCD A;  4XBX A;  1T2H A;  2CX0 A;  1W4N A;  2K54 A;  4BL3 A;  2QEX 3;  1GY7 A;  1C7H A;  5JPP A;  2WOH A;  1NB5 I;  5LC6 A;  1WMO A;  2E2U A;  1N9E A;  2RFR A;  3MSO A;  3Q90 A;  3X41 A;  5CF1 A;  1TP6 A;  1W6Y A;  5D81 A;  1FUT A;  1G96 A;  2KAA A;  3AHS A;  4R4K A;  1YI2 3;  3DH2 A;  4O2H A;  4FCJ A;  1ULJ B;  3UJM A;  2HMM B;  3DMC A;  3SED A;  1RTU A;  2CK3 H;  3N54 B;  3B7C A;  3SOA A;  1UGH I;  1SPU A;  1JZO A;  5D83 A;  3NXJ A;  1WMN A;  2IYJ A;  1UCJ A;  3NBR A;  4WP5 A;  1FUW A;  1KD1 4;  3G0K A;  2GEX A;  4J5K A;  4MJD A;  6GSP A;  3I55 3;  1VQM 3;  1TJD A;  2Y73 A;  3FSD A;  3EB8 A;  4JF8 A;  2KF6 A;  2GXF A;  1BRS A;  1MGW A;  4J5G A;  2F5W A;  2IY2 A;  1RGE A;  3JUO A;  1K41 A;  1BNF A;  3LTB A;  3PGB A;  3F8X A;  1GOU A;  1M90 4;  3WOE B;  4NHF A;  3ROB A;  3GWR A;  1I0V A;  4IT7 A;  3EX9 A;  6RNT A;  2W04 A;  3STD A;  3CCR 3;  1VQ8 3;  1SIH A;  1MOL A;  3S28 A;  2CFK A;  1DVC A;  1O7W B;  3CC4 3;  3EQQ B;  2IUK A;  4HZ9 B;  1GY5 A;  1Q81 4;  1AVK A;  1IU7 A;  1RGA A;  1W7C A;  2GU1 A;  4IIA A;  4CPK A;  1K73 4;  1CYV A;  2YFJ B;  1IVV A;  2F5M A;  2GU3 A;  3ECF A;  1Q42 A;  1ISK A;  1L5G B;  4GSP A;  3KZT A;  3D4A A;  3M8C A;  1O7N B;  4HM2 B;  3CPW 2;  1JN5 A;  1UW1 A;  2FXT A;  2V1L A;  1MWT A;  3NM2 A;  4RNY A;  1BSC A;  5DRV A;  3WA2 X;  3MHE A;  5G2G A;  4ZM8 A;  2L4V A;  3OXA A;  2R41 A;  3NBJ A;  2B1X B;  1G0T A;  1O7G B;  1M1X B;  2RGQ A;  3FGY A;  3FG3 A;  1O7P B;  4KFF A;  3CCJ 3;  5G1L A;  1J2B A;  1OGZ A;  1QAF A;  2H0G A;  2SAR A;  1DMM A;  3GAX A;  3JUM A;  1V58 A;  4R9K A;  2XSH B;  2Z7A A;  3BU4 A;  2CG1 A;  4L8P A;  5AIF A;  4HOH A;  1OHP A;  3X3Y A;  5AEU B;  1T3B A;  1S72 3;  3Q2P A;  1UUV B;  4R1K A;  2CFG A;  2E2V A;  1JKG B;  3KSE D;  1FUS A;  3A5E A;  4PEJ A;  4BTY A;  3U97 A;  1OGX A;  4EXR A;  1IQ8 A;  3J7Y d;  2OTL 3;  1BAO A;  1UDI I;  5FGO A;  2P0M A;  1I2G A;  2OTJ 3;  4BIR A;  1QVG 2;  1X1U A;  4HKV B;  3CCE 3;  1QVF 2;  1BRH A;  1LOY A;  2W6J H;  2L1S A;  3DGY A;  4KT3 B;  3Q3F A;  1FGQ A;  1JV2 B;  1BVI A;  2F56 A;  1YIT 3;  3WHO A;  3GZY B;  3KKG A;  1N8Q A;  3MG2 A;  4R9L A;  1EEJ A;  1NJI 4;  2XGL A;  4OK0 A;  1MWU A;  1B2Z A;  4HM4 B;  2CC3 A;  4N6U A;  4EC6 A;  1K9M 4;  1V74 A;  1W6C A;  4FMA A;  3MYT A;  5DRE A;  1B20 A;  1N9J A;  1OF5 A;  2MF7 A;  2WOF A;  1VQ5 3;  1A67 A;  1YGW A;  2W56 B;  3E99 A;  5AIH A;  1ROA A;  1VQN 3;  3K63 A;  4LZI A;  1FYS A;  1MWS A;  1O7M B;  3UB1 A;  3EN8 A;  1DE3 A;  2STD A;  1RN1 A;  1BNR A;  2FGT A;  1I3I A;  3F9S A;  1QAK A;  1RGH A;  2ZL8 A;  1PFP A;  3NQY A;  1DYU A;  2QIY A;  3GRD A;  1BSA A;  3F7S A;  1YIJ 3;  3FG1 A;  3JUP A;  2OCT A;  1LOX A;  2Z6B A;  1ZS7 A;  1FZU A;  4X2O A;  4MMY B;  3K0Z A;  5BXQ A;  4BTX A;  2RSX A;  3S29 A;  4TX4 A;  1TIJ A;  3FH1 A;  1VQL 3;  3FZW A;  1R4Y A;  3EHC A;  1IQX A;  1RDS A;  1UI7 A;  4CJN A;  4G1M B;  3PS8 A;  3FF0 A;  1GSP A;  2BU4 A;  1W2B 2;  4IPB A;  1Q40 B;  1HKX A;  4O02 B;  2CFD A;  3WA3 A;  5ELU A;  1AQZ A;  3CCU 3;  2P05 A;  3LT9 A;  3OV4 A;  3CMA 3;  1X1Y A;  5D82 A;  2W9P A;  1BSD A;  3AMO B;  3CU3 A;  1TTO A;  3WMD A;  3OW2 2;  1NDO B;  4JRF A;  3PCS A;  1LXE A;  1PU4 A;  3FG4 A;  1DMQ A;  2FNQ A;  1GMR A;  1IV9 A;  1GS3 A;  3IJE B;  3BNB A;  4HVN A;  3V99 A;  5AII A;  3FF2 A;  1JJ2 2;  3LTA A;  5FW5 A;  1I70 A;  2RCD A;  5I97 A;  1FGR A;  1RCK A;  4NRE A;  1SII A;  3CCL 3;  1FW7 A;  3DXO A;  1I2E A;  3DGL A;  2HML B;  2K0M A;  3EN1 B;  2IMJ A;  4FCM A;  1IQY A;  1O7H B;  1YJN 3;  4N3V A;  2IA7 A;  1MWR A;  1W2Z A;  2JDI H;  4N6O B;  3HZP A;  3CPO A;  1STF I;  3D5I A;  5ELJ A;  1UGI A;  1JB4 A;  3X3Z A;  4Q53 A;  1IV7 A;  1QJG A;  2BMR B;  2D1W A;  2MC8 A;  4BTW A;  5JBS A;  1K28 A;  3H51 A;  4EBG A;  2XFT A;  1X1X A;  2CHC A;  3QRD A;  5KP3 A;  5JPU A;  3LXU X;  2BIR A;  3LT8 A;  2W0Q A;  1NU3 A;  3EC9 A;  3K7C A;  3D9R A;  3JUQ A;  3KFQ C;  4L7K A;  1OH0 A;  1YGE A;  2CWU A;  2XSO B;  3G6E 3;  1RNT A;  1IK3 A;  1LOV A;  2K3D A;  2BO9 B;  3K9M C;  1RSN A;  2WGO A;  5IG4 A;  1GMQ A;  1LNH A;  1NNV A;  1W00 A;  5IG0 A;  4U13 A;  3SX1 A;  3OWS A;  2ZA4 A;  1BNS A;  4GB5 A;  3CXC 2;  2KF5 A;  2KRT A;  3NV0 A;  3IPT A;  4OVM A;  1A2P A;  1CEW I;  3DGO A;  4XB5 A;  3UL5 A;  4LMI A;  1PY3 A;  3H3H A;  1SJW A;  4BU4 A;  3RGA A;  1N5H A;  1JNQ A;  1RGF A;  2W9Q A;  2LQV A;  1ZX2 A;  1NWW A;  1UUW B;  3DZL A;  3KII A;  4HAA A;  5LC7 A;  1JKG A;  3VSY A;  1YHQ 3;  1IT8 A;  1X1W A;  4GL6 A;  1EKM A;  4I4K A;  1VQK 3;  3A76 A;  1BRN L;  1W02 A;  1BSB A;  1AY7 A;  2LYX A;  4HM1 B;  3ZG5 A;  1QMA A;  1UI8 A;  5AEW B;  5GSP A;  1IYY A;  2SBL A;  4I5Q A;  2GBX B;  5EQL A;  3V92 A;  3CC2 3;  4AKZ A;  1YJ9 3;  2XR8 B;  1RGK A;  3ER7 A;  5BVB A;  3CD6 3;  2B24 B;  3ALA A;  2OQE C;  2PZV A;  3LZA A;  3MG3 A;  1AV4 A;  1T5Y A;  2ML6 A;  3MPH A;  1R4C A;  4MEI A;  1GY6 A;  1DMN A;  1B2S A;  3PCR A;  1D6Y A;  1TRQ A;  3PYJ A;  1BGS A;  1RMS A;  1SQW A;  1TRP A;  3HI7 A;  5IER A;  4XBT A;  1BOX A;  3BNC A;  1Q82 4;  1RGG A;  2W56 A;  3HIG A;  2J8X B;  3EBT A;  1CH0 A;  2E2T A;  2YX9 A;  3KN4 A;  3S27 A;  4WYK A;  3ZFZ A;  4RBN A;  3RDE A;  3SLU A;  5RNT A;  1RRL A;  1N8R 4;  2OWP A;  1UCL A;  4CCV A;  2OOV C;  3EF8 A;  2Z76 A;  3MKI A;  3BND A;  4HYZ A;  3CCV 3;  3IMA B;  1I0X A;  3HOH A;  4HZB B;  5BU4 A;  3F8H A;  4L8O A;  1BRJ A;  1Q9E A;  2Z77 A;  3S5C A;  1BU4 A;  3G16 A;  2CFW A;  1OHS A;  3GZR A;  5IW9 A;  1BNI A;  1A2K A;  1B2U A;  1BIR A;  2INX A;  1BNE A;  1A90 A;  2HMK B;  1CQS A;  3DY5 A;  3NHX A;  4HM3 B;  5AIG A;  4FMB A;  2BT3 A;  2Y74 A;  4HJL B;  1F8N A;  3BB9 A;  4HM8 B;  3GZB A;  5IG3 A;  2JQ5 A;  3U1W A;  4HM7 B;  2P38 A;  1GMP A;  5IG5 A;  4XM4 A;  3SXX A;  7RNT A;  2HMJ B;  3K5T A;  3SVA A;  4STD A;  1SAR A;  1TFO A;  1JZD A;  2BMQ B;  1YNV X;  3EJV A;  1RLS A;  1TU5 A;  4AKY A;  1EUI C;  3EBY A;  3F40 A;  4EW5 A;  5KP4 A;  1LNI A;  4K61 A;  1VQ7 3;  3RGR A;  2CX1 A;  4QWT A;  3S67 A;  1Q86 4;  1KQS 2;  3WR2 A;  3JVC A;  4KFD A;  1IVX A;  3PXM A;  2GBW B;  5STD A;  4XDW A;  2RNT A;  3LYG A;  7STD A;  1NB3 I;  2F98 A;  3D79 A;  3LML A;  3G71 3;  3NBB A;  4LGQ A;  5CK6 A;  1JRQ A;  1IVW A;  3D5G A;  1AR0 A;  1B2M A;  1OF5 B;  2BHM A;  3HII A;  1M9G A;  2C10 A;  1M1K 4;  1ROV A;  3UNL A;  1EQK A;  2CWT A;  4HBR A;  2KXG A;  2R4I A;  1WQL B;  1GYB A;  5CLK A;  1UCK A;  3URP A;  1JBS A;  1YVS A;  2W2C A;  2GSP A;  1B3S A;  2CH9 A;  1I3F A;  1A2V A;  1QAL A;  2HOH A;  1EG9 B;  1HU9 A;  4H3U A;  4J8T A;  1UCI A;  4KVH A;  4XBY A;  2P09 A;  5M18 A;  2AAD A;  2GEY A;  1VQ4 3;  1E97 A;  3BNE A;  3WOF B;  4EV2 A;  4NPB A;  3ZG0 A;  4MMX B;  5KP1 A;  2HMN B;  3NQZ A;  1W5Z A;  4FCZ A;  4K1U A;  8RNT A;  1AVL A;  1DET A;  1JBT A;  1Z1S A;  2BMO B;  3T0U A;  4N6L A;  7GSP A;  1OHO A;  5G1K A;  1FGT A;  1FGM A;  2IUJ A;  3KSP A;  1LOW A;  2F99 A;  3B4O A;  3DUK A;  3I0Y A;  3KE7 A;  4K1V A;  1N5P A;  4LSO A;  4OUQ A;  1K8A 4;  1IDP A;  1FA3 A;  5IEP A;  2CWV A;  2H0I A;  1BRI A;  4N6M A;  1W01 A;  4WWU C;  5BIR A;  2KF3 A;  3QK9 A;  1HZ1 A;  5CXO A;  2UUG C;  1ZO2 A;  3DGM A;  4WHA A;  2CFL A;  2WGQ A;  3T8U A;  1S5A A;  1OAC A;  1BRK A;  1RN7 A;  1RJO A;  2QGU A;  4O3V A;  1BNJ A;  4K90 B;  2D42 A;  1T2I A;  3T8N A;  2QA4 3;  1LQM B;  1WNH A;  4N6T A;  1BUQ A;  1IVU A;  1ASK A;  2Q07 A;  4FMD A;  4N6N B;  2I9W A;  2UGI A;  2W03 A;  3F7X A;  5A0O B;  2PNC A;  1C54 A;  3SOY A;  1NO3 A;  2XRX B;  3AGN A;  3OX9 A;  2ZDJ A;  3NM7 A;  3CCQ 3;  5IEO A;  3AHW A;  1PYL A;  3BIR A;  1B21 A;  1D6Z A;  1Q7H A;  2F4Y A;  2BNG A;  5HGR A;  4KZ1 A;  3X42 A;  1U5O A;  2XF3 A;  2O3O A;  1GD4 A;  1W6G A;  2H0H A;  3B8L A;  2WO0 A;  5EVH A;  3X40 A;  3CNM A;  1BAN A;  2A15 A;  3PZW A;  1RNB A;  5TGN A;  2HMO B;  1VQ6 3;  4EYC A;  2CG0 A;  3LH4 A;  4X2H A;  1TFK A;  4LEH A;  1BNG A;  3FCS B;  1VQ9 3;  4RNZ A;  4HM5 B;  3O8Y A;  1RHL A;  3CC7 3;  3VGN A;  3CCS 3;  3FKA A;  2AAE A;  2XEP A;  3OWU A;  4R80 A;  1RRH A;  4BL2 A;  5IF6 A;  3G4S 3;  9RNT A;  3CCM 3;  3NV0 B;  6STD A;  2F86 B;  1RCL A;  5HOH A;  1VQQ A;  2CKF B;  2CW9 A;  1US1 A;  4FMC A;  5AI1 A;  3CME 3;  4GHO A;  1OCV A;  1I8V A;  5AYR B;  3UL6 A;  5IEN A;  1KWI A;  1G02 A;  4MMZ B;  3Q1C A;  1OUN A;  4KFE A;  4FR9 A;  3CNX A;  3MG1 A;  1JN5 B;  1KSI A;  3GSP A;  1MGR A;  4N6V 0;  1YVB I;  3HX8 A;  3G8Z A;  1I2F A;  1LRA A;  1BUJ A;  3WDG B;  1GOY A;  2YFL B;  4J9A A;  2M7O A; 
#chains in the Genus database with same CATH homology
 3LTC A;  1JB2 A;  3EE1 A;  1RKY A;  1VQO 3;  1DVD A;  1D6U A;  1TUH A;  1VZZ A;  1VQP 3;  1ULI B;  1YJW 3;  5EEO A;  2O9U X;  2XH9 A;  1U8C B;  4EV5 A;  3B4P A;  1OPY A;  2P0X A;  3NX0 A;  1Q7Y 4;  1Q40 A;  3L0R A;  2C11 A;  3N9H A;  4HM6 B;  2OQE A;  1KC8 4;  4O8S A;  4HM0 B;  4ORL A;  3D3L A;  2XFS A;  3AMO A;  3DGN A;  3I56 3;  5AYS C;  2UX0 A;  1CYU A;  1EA2 A;  3LOY A;  4CDL A;  3DM8 A;  1FGO A;  1MNL A;  1E3V A;  4RZM A;  3LTD A;  1WMP A;  4WYK B;  3F14 A;  1STD A;  4AEQ A;  3N8B A;  3V98 A;  3BLZ A;  3GZX B;  1WTH A;  2OOV A;  3OWY A;  1IT7 A;  2ML5 A;  2YFI B;  1Y4K A;  4H61 A;  3VF1 A;  3WOD G;  1JB5 A;  1LVN A;  3TDG A;  2XGN A;  8CHO A;  1GD3 A;  2CIU A;  4WFO A;  4XDV A;  3JUN A;  3NUV A;  3FLJ A;  3MWZ A;  1E3R A;  5CF2 A;  3HK4 A;  3X3X A;  2KCD A;  4XBX A;  1W4N A;  2K54 A;  2QEX 3;  1GY7 A;  1C7H A;  5JPP A;  2WOH A;  1NB5 I;  5LC6 A;  1WMO A;  2E2U A;  1N9E A;  2RFR A;  3MSO A;  3Q90 A;  3X41 A;  5CF1 A;  1TP6 A;  1W6Y A;  5D81 A;  1G96 A;  1YI2 3;  4R4K A;  4O2H A;  4FCJ A;  1ULJ B;  3UJM A;  2HMM B;  3DMC A;  3SED A;  2CK3 H;  3N54 B;  3B7C A;  3SOA A;  1SPU A;  5D83 A;  3NXJ A;  1WMN A;  3NBR A;  4WP5 A;  1FUW A;  1KD1 4;  3G0K A;  2GEX A;  4MJD A;  3I55 3;  1VQM 3;  2Y73 A;  3FSD A;  3EB8 A;  4JF8 A;  2GXF A;  3JUO A;  1K41 A;  3PGB A;  3LTB A;  1M90 4;  3F8X A;  3WOE B;  4NHF A;  3ROB A;  3GWR A;  4IT7 A;  3EX9 A;  2W04 A;  3STD A;  3CCR 3;  1VQ8 3;  1SIH A;  1MOL A;  3S28 A;  2CFK A;  1DVC A;  1O7W B;  3CC4 3;  3EQQ B;  2IUK A;  4HZ9 B;  1GY5 A;  1Q81 4;  1AVK A;  1IU7 A;  1W7C A;  2GU1 A;  4IIA A;  1K73 4;  1CYV A;  2YFJ B;  1IVV A;  3ECF A;  2GU3 A;  1ISK A;  1Q42 A;  1L5G B;  3KZT A;  3M8C A;  4HM2 B;  1O7N B;  3CPW 2;  1JN5 A;  1UW1 A;  2FXT A;  2V1L A;  4RNY A;  3NM2 A;  5DRV A;  3WA2 X;  3MHE A;  5G2G A;  4ZM8 A;  2L4V A;  3OXA A;  3NBJ A;  2B1X B;  1O7G B;  2RGQ A;  1M1X B;  3FGY A;  3FG3 A;  4KFF A;  1O7P B;  3CCJ 3;  1J2B A;  1OGZ A;  1QAF A;  3JUM A;  4R9K A;  1DMM A;  3GAX A;  4BTW A;  2CG1 A;  2XSH B;  2Z7A A;  4L8P A;  5AIF A;  1OHP A;  3X3Y A;  5AEU B;  1S72 3;  3Q2P A;  1UUV B;  4R1K A;  2CFG A;  2E2V A;  1JKG B;  3KSE D;  4BTY A;  4PEJ A;  3U97 A;  1OGX A;  4EXR A;  1IQ8 A;  3J7Y d;  2OTL 3;  5FGO A;  2P0M A;  2OTJ 3;  1QVG 2;  4HKV B;  3CCE 3;  1QVF 2;  2W6J H;  1FGQ A;  1JV2 B;  1YIT 3;  3GZY B;  3KKG A;  1N8Q A;  3MG2 A;  4R9L A;  1NJI 4;  2XGL A;  4OK0 A;  1K9M 4;  4HM4 B;  4N6U A;  2CC3 A;  4EC6 A;  1V74 A;  1W6C A;  4FMA A;  3MYT A;  5DRE A;  1N9J A;  1OF5 A;  2MF7 A;  2WOF A;  1VQ5 3;  1A67 A;  2W56 B;  3E99 A;  5AIH A;  1ROA A;  1VQN 3;  3K63 A;  4LZI A;  1O7M B;  3UB1 A;  3EN8 A;  2STD A;  2FGT A;  3F9S A;  1QAK A;  2ZL8 A;  1PFP A;  3NQY A;  1DYU A;  2QIY A;  3GRD A;  3F7S A;  1YIJ 3;  3FG1 A;  3JUP A;  2OCT A;  1LOX A;  2Z6B A;  4X2O A;  4MMY B;  3K0Z A;  5BXQ A;  4BTX A;  2RSX A;  3S29 A;  4TX4 A;  1TIJ A;  3FH1 A;  1VQL 3;  3FZW A;  3EHC A;  1IQX A;  1UI7 A;  4G1M B;  3PS8 A;  3FF0 A;  1W2B 2;  4IPB A;  1Q40 B;  1HKX A;  4O02 B;  2CFD A;  3WA3 A;  5ELU A;  3CCU 3;  2P05 A;  3LT9 A;  3OV4 A;  3CMA 3;  5D82 A;  2W9P A;  3AMO B;  3CU3 A;  3WMD A;  3OW2 2;  1NDO B;  4JRF A;  3PCS A;  1LXE A;  1PU4 A;  3FG4 A;  1DMQ A;  2FNQ A;  1IV9 A;  1GS3 A;  3IJE B;  3BNB A;  4HVN A;  3V99 A;  5AII A;  3FF2 A;  1JJ2 2;  3LTA A;  5FW5 A;  5I97 A;  2RCD A;  1FGR A;  4NRE A;  1SII A;  3CCL 3;  3DXO A;  3DGL A;  2HML B;  2K0M A;  3EN1 B;  2IMJ A;  4FCM A;  1IQY A;  1O7H B;  1YJN 3;  4N3V A;  2IA7 A;  1W2Z A;  2JDI H;  4N6O B;  3HZP A;  3CPO A;  1STF I;  5ELJ A;  1JB4 A;  3X3Z A;  4Q53 A;  1IV7 A;  1QJG A;  2BMR B;  2D1W A;  2MC8 A;  5JBS A;  1K28 A;  3H51 A;  4EBG A;  2XFT A;  5KP3 A;  2CHC A;  3QRD A;  5JPU A;  3LXU X;  3LT8 A;  2W0Q A;  1NU3 A;  3EC9 A;  3K7C A;  3D9R A;  3JUQ A;  3KFQ C;  4L7K A;  1OH0 A;  1YGE A;  2CWU A;  2XSO B;  3G6E 3;  1IK3 A;  2BO9 B;  3K9M C;  2WGO A;  5IG4 A;  1LNH A;  1W00 A;  5IG0 A;  4U13 A;  3SX1 A;  3OWS A;  4GB5 A;  3CXC 2;  2KRT A;  3NV0 A;  4OVM A;  3IPT A;  1CEW I;  3DGO A;  4XB5 A;  3UL5 A;  4LMI A;  3H3H A;  1SJW A;  3RGA A;  1N5H A;  1JNQ A;  2W9Q A;  2LQV A;  1ZX2 A;  1NWW A;  1UUW B;  3DZL A;  3KII A;  5LC7 A;  1JKG A;  3VSY A;  1YHQ 3;  1IT8 A;  4GL6 A;  1EKM A;  4I4K A;  1VQK 3;  3A76 A;  1W02 A;  2LYX A;  4HM1 B;  1QMA A;  1UI8 A;  5AEW B;  2SBL A;  2GBX B;  5EQL A;  3V92 A;  3CC2 3;  4AKZ A;  1YJ9 3;  2XR8 B;  3ER7 A;  5BVB A;  3CD6 3;  2B24 B;  3ALA A;  2OQE C;  2PZV A;  3LZA A;  3MG3 A;  1AV4 A;  1T5Y A;  2ML6 A;  3MPH A;  1R4C A;  4MEI A;  1GY6 A;  1DMN A;  3PCR A;  1D6Y A;  3PYJ A;  1SQW A;  5IER A;  3HI7 A;  4XBT A;  3BNC A;  1Q82 4;  2W56 A;  3HIG A;  3EBT A;  2E2T A;  3KN4 A;  2YX9 A;  3S27 A;  4WYK A;  4RBN A;  3RDE A;  3SLU A;  1N8R 4;  1RRL A;  2OWP A;  4CCV A;  2OOV C;  3EF8 A;  2Z76 A;  3MKI A;  3BND A;  4HYZ A;  3CCV 3;  3IMA B;  4HZB B;  3F8H A;  4L8O A;  2Z77 A;  3S5C A;  3G16 A;  2CFW A;  1OHS A;  3GZR A;  5IW9 A;  1A90 A;  1A2K A;  2INX A;  2HMK B;  1CQS A;  3DY5 A;  3NHX A;  4HM3 B;  5AIG A;  4FMB A;  2BT3 A;  2Y74 A;  4HJL B;  1F8N A;  3BB9 A;  4HM8 B;  3GZB A;  5IG3 A;  2JQ5 A;  3U1W A;  4HM7 B;  2P38 A;  5IG5 A;  4XM4 A;  3SXX A;  2HMJ B;  3K5T A;  3SVA A;  4STD A;  1TFO A;  2BMQ B;  1TU5 A;  3EJV A;  4AKY A;  3EBY A;  3F40 A;  5KP4 A;  4K61 A;  1VQ7 3;  3RGR A;  4QWT A;  3S67 A;  1Q86 4;  1KQS 2;  3JVC A;  4KFD A;  1IVX A;  3PXM A;  2GBW B;  5STD A;  4XDW A;  3LYG A;  7STD A;  1NB3 I;  2F98 A;  3G71 3;  3LML A;  3NBB A;  4LGQ A;  5CK6 A;  1JRQ A;  1IVW A;  1AR0 A;  1OF5 B;  2BHM A;  3HII A;  1M9G A;  2C10 A;  1M1K 4;  1ROV A;  3UNL A;  1EQK A;  2CWT A;  4HBR A;  2KXG A;  2R4I A;  1WQL B;  1GYB A;  5CLK A;  2W2C A;  2CH9 A;  1A2V A;  1QAL A;  4KVH A;  1EG9 B;  1HU9 A;  4H3U A;  4J8T A;  4XBY A;  2P09 A;  2GEY A;  1VQ4 3;  1E97 A;  3BNE A;  3WOF B;  4EV2 A;  4MMX B;  5KP1 A;  2HMN B;  3NQZ A;  1W5Z A;  4FCZ A;  4K1U A;  1AVL A;  1Z1S A;  2BMO B;  3T0U A;  4N6L A;  1OHO A;  1FGT A;  1FGM A;  2IUJ A;  3KSP A;  2F99 A;  3B4O A;  3DUK A;  3I0Y A;  3KE7 A;  4K1V A;  4LSO A;  1N5P A;  4OUQ A;  1K8A 4;  1IDP A;  1FA3 A;  5IEP A;  2CWV A;  4N6M A;  1W01 A;  4WWU C;  3QK9 A;  5CXO A;  1ZO2 A;  3DGM A;  4WHA A;  2CFL A;  2WGQ A;  3T8U A;  1S5A A;  1OAC A;  1RN7 A;  1RJO A;  2QGU A;  4O3V A;  4K90 B;  2D42 A;  3T8N A;  2QA4 3;  1WNH A;  4N6T A;  1BUQ A;  1IVU A;  1ASK A;  2Q07 A;  4FMD A;  4N6N B;  2I9W A;  5A0O B;  2W03 A;  3F7X A;  2PNC A;  3SOY A;  1NO3 A;  2XRX B;  3OX9 A;  2ZDJ A;  3NM7 A;  3CCQ 3;  5IEO A;  1D6Z A;  2BNG A;  5HGR A;  4KZ1 A;  3X42 A;  1U5O A;  2XF3 A;  2O3O A;  1GD4 A;  1W6G A;  3B8L A;  2WO0 A;  5EVH A;  3X40 A;  3CNM A;  2A15 A;  3PZW A;  5TGN A;  2HMO B;  1VQ6 3;  4EYC A;  2CG0 A;  3LH4 A;  4X2H A;  1TFK A;  4LEH A;  3FCS B;  1VQ9 3;  4RNZ A;  4HM5 B;  3O8Y A;  3CC7 3;  3VGN A;  3CCS 3;  3FKA A;  3OWU A;  2XEP A;  4R80 A;  5IF6 A;  1RRH A;  3G4S 3;  3CCM 3;  3NV0 B;  6STD A;  2F86 B;  2CKF B;  2CW9 A;  3CME 3;  1US1 A;  4FMC A;  5AI1 A;  1OCV A;  5AYR B;  3UL6 A;  5IEN A;  1KWI A;  4MMZ B;  3Q1C A;  1OUN A;  4KFE A;  4FR9 A;  3CNX A;  3MG1 A;  1JN5 B;  1KSI A;  4N6V 0;  1YVB I;  3HX8 A;  3G8Z A;  3WDG B;  2YFL B;  4J9A A;  2M7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...