4HZBB

Crystal structure of the type vi semet effector-immunity complex tae3-tai3 from ralstonia pickettii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
b'NSPEAAAISFYTWFIQHDSDQTYPLSEPDIERYVATDTVGRLRNDYAHAGPPNGVDYFLKVQDYDSRDWLAHIQVQRALMLGDVAVVPVSFGSQDPVHVLVFLKRVDATWKIIKIDDTWEYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structural insights into the inhibition of type VI effector Tae3 by its immunity protein Tai3
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Hydrolase
total genus 37
structure length 122
sequence length 122
chains with identical sequence C, E, F
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12883 DUF3828 Protein of unknown function (DUF3828)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hzbB00
2YFIB 3SOAA 5DRVA 1GYBA 2IMJA 2STDA 2XSHB 1QJGA 3MKIA 2CKFB 1EG9B 1GY7A 3NV0B 3F7SA 3MSOA 1OGXA 3FZWA 1JKGB 1O7PB 3F14A 3F7XA 3B4PA 2XRXB 1E3VA 4MJDA 1W01A 1A2KA 2RFRA 3T8NA 1NDOB 1E97A 1GS3A 2Z76A 3ER7A 4LMIA 1O7HB 3GZBA 4HZBB 5DREA 3VGNA 4K1UA 3F9SA 1ASKA 3MG3A 1DMMA 3OWUA 3EJVA 1UUVB 1Q42A 4R9LA 3F8HA 4L8PA 3LZAA 3LYGA 1Z1SA 4CDLA 1K41A 3M8CA 3GZXB 1SJWA 3MYTA 2HMOB 1O7GB 2GXFA 3CU3A 1QMAA 5IENA 4KVHA 1BUQA 1Q40B 3EC9A 1JB4A 3CNXA 3OWSA 3G16A 1OF5A 3FGYA 4L7KA 3G8ZA 1WQLB 5AIIA 3SEDA 5D83A 1ULJB 4Q53A 3EN1B 3KSPA 1OHSA 5D82A 2B1XB 1TP6A 2QIYA 2JQ5A 5AEWB 1AR0A 3FLJA 5KP4A 2W2CA 1OPYA 3T8UA 3GZRA 4J8TA 4HM0B 1OF5B 1JKGA 2GEXA 5IG4A 4XDWA 1CQSA 2INXA 2HMKB 3HZPA 3JUPA 4HKVB 3DXOA 1OHOA 1E3RA 1TUHA 1W6YA 3B7CA 3NM2A 1OCVA 4X2OA 5BXQA 3SOYA 1O7WB 4HM7B 3I0YA 2R4IA 4R9KA 3D9RA 5EVHA 3GWRA 1IDPA 1S5AA 3FSDA 2PZVA 5AIHA 4J9AA 5IG0A 3K0ZA 1OGZA 4L8OA 3BLZA 3F8XA 3FF0A 2XR8B 3FF2A 2CHCA 1ZX2A 2F86B 5TGNA 1Q40A 1JN5A 4FCJA 5CF1A 4HM8B 5CF2A 3JUNA 2RGQA 5KP3A 5IG3A 3NXJA 3FH1A 3HX8A 3MG1A 3EX9A 2GEYA 5FW5A 5CXOA 4PEJA 1HKXA 5JPPA 5IERA 2HMJB 4WP5A 3H51A 1JN5B 1O7NB 2BNGA 4IIAA 2HMLB 1VZZA 4XBTA 2OWPA 5IF6A 4U13A 3JUQA 1GY6A 3EQQB 3JUMA 4XBYA 2BMRB 1C7HA 3EBTA 2GBWB 1JB2A 4HJLB 5IEOA 3A76A 5AI1A 5CLKA 5D81A 7STDA 3CPOA 2BMQB 3UNLA 1NU3A 2Z77A 2HMNB 4XDVA 2GBXB 4FCMA 5HGRA 2F98A 3EN8A 2RCDA 3NHXA 3EBYA 3B8LA 1ISKA 1OUNA 3OX9A 4XB5A 4HM5B 6STDA 5KP1A 5AEUB 4K1VA 3HK4A 2F99A 1U5OA 4X2HA 4HM2B 3ROBA 5BVBA 2A15A 4WYKB 5IG5A 3KKGA 3OV4A 4HM3B 3K7CA 1NWWA 2YFJB 2K54A 2I9WA 5AIFA 3MHEA 3GRDA 2HMMB 3ECFA 3EHCA 5IEPA 8CHOA 5CK6A 3VSYA 3F40A 2UX0A 3DZLA 4HZ9B 2Z7AA 3OWYA 4HVNA 3FKAA 4HM4B 3WMDA 1W00A 3DUKA 2QGUA 1ULIB 3NUVA 3Q90A 4XBXA 1O7MB 4GB5A 3KZTA 3IPTA 2BMOB 4H3UA 3B4OA 3NBRA 3G0KA 3OXAA 4OVMA 5JPUA 1ZO2A 3DM8A 3S5CA 4RZMA 4I4KA 3UJMA 4HM6B 3MG2A 2B24B 3RGAA 4N3VA 1OH0A 5STDA 3BB9A 1DMNA 4XM4A 1GY5A 1JB5A 4STDA 3GZYB 1W02A 4HM1B 4LGQA 1UUWB 3H3HA 4R1KA 4LEHA 3CNMA 4WWUC 5AIGA 3RGRA 3JUOA 3STDA 4WYKA 4ORLA 3E99A 2XSOB 4OUQA 3NV0A 3EF8A 1STDA 5G2GA 3DMCA 1DMQA 2YFLB 1EA2A 3KE7A 1OHPA
chains in the Genus database with same CATH superfamily
1ROAA 3HIIA 2YFIB 1N8R4 4BL3A 3SOAA 3D4AA 5DRVA 1M904 3LTDA 1GYBA 4DKIA 1VQ53 4BTWA 1VQ83 3BNDA 1T2IA 2IMJA 3UL6A 2W03A 2STDA 4HOHA 5GSPA 3OW22 1X1YA 2XSHB 3BNEA 3ZFZA 1R4CA 1QJGA 1W7CA 2CIUA 3MKIA 3SYUA 3GAXA 2W9QA 2CKFB 1EG9B 4KFFA 1BRNL 1GY7A 1RN7A 1W5ZA 3LTBA 3NV0B 3G713 1BNIA 4J5GA 3F7SA 3MSOA 1BNFA 3CCL3 1FGTA 1OGXA 3CCS3 1IT8A 3FZWA 3AGNA 2E2VA 4O2HA 4EBGA 9RNTA 3G6E3 2O9UX 1JKGB 2K3DA 1TIJA 5AYSC 4LZIA 1IK3A 2IA7A 2W0QA 5RNTA 1O7PB 3F14A 3F7XA 2OTL3 1FGRA 3B4PA 2XRXB 4CPKA 1IQXA 2F5MA 1E3VA 1I2GA 4MJDA 1QAKA 4AEQA 1W01A 2IY2A 2LYXA 1TFKA 1VQM3 1A2KA 1BRKA 2RFRA 3T8NA 4EXRA 4O8SA 2QA43 1IT7A 1NDOB 1E97A 1GS3A 1LOWA 4JRFA 1GOYA 6GSPA 1D6ZA 2UGIA 2Z76A 3ER7A 1A2PA 1FUSA 3NBJA 4LMIA 2KXGA 1G96A 2ZA4A 3PCRA 1RGFA 1O7HB 4N6V0 3GZBA 4HZBB 2L4VA 3QRDA 5DREA 1RGLA 3VGNA 4NPBA 3FCSB 2SBLA 4K1UA 3F9SA 1K28A 1ASKA 1RTUA 4BTXA 2XEPA 3LH4A 3MG3A 1DMMA 3OWUA 3EJVA 5G1LA 1R4YA 1UUVB 2CFWA 1ZS7A 4MEIA 1LOXA 1Q42A 2KAAA 4R9LA 4N6UA 3F8HA 4L8PA 5IW9A 3LZAA 4GHOA 1BIRA 1S723 3LYGA 1Z1SA 4CDLA 1K41A 1T3BA 3M8CA 1BSCA 3GZXB 1B3SA 2H0HA 3EB8A 1NNVA 1SJWA 1RKYA 1TRPA 1FUTA 3MYTA 3SVAA 1UI8A 1JBTA 3GSPA 3CCU3 2HMOB 3WHOA 1JBRA 1O7GB 2GXFA 3SX1A 1NB3I 1Q7Y4 1RGCA 8RNTA 3K63A 4IT7A 3EE1A 1TTOA 3CU3A 4HYZA 2CX1A 1QMAA 3AHWA 2QEX3 1W2ZA 2C10A 4KZ1A 1KWIA 5IENA 3X42A 4KVHA 1BUQA 1Q40B 3KCHA 3EC9A 5EQLA 2CFGA 1JB4A 1B2ZA 1RMSA 1DETA 3CNXA 3OWSA 3G16A 2CG0A 3LMLA 1WMNA 4MMXB 1OF5A 2MC8A 1B21A 1GOUA 3FGYA 4L7KA 3UL5A 3G8ZA 1WQLB 5AIIA 1LQMB 2P38A 1RSNA 1LRAA 2BU4A 2WOHA 2FXTA 3SEDA 5D83A 4WHAA 1ULJB 1FA3A 2C11A 1YNVX 4Q53A 3U1WA 4EV5A 1CEWI 3EN1B 1GD3A 3KSPA 2XGLA 1MGRA 1KQS2 1OHSA 1YJN3 5D82A 1CYVA 3I563 1YVBI 2B1XB 1UCJA 1TP6A 4N6LA 1LVNA 1MWUA 2QIYA 2JQ5A 2OQEA 5AEWB 1AR0A 5G1KA 3FLJA 5KP4A 1A2VA 2JDIH 2W2CA 3N8BA 2WO0A 1OPYA 1UGHI 3FG1A 4RBNA 2YX9A 3A5EA 3T8UA 1V57A 3GZRA 3CC73 1RN1A 5BIRA 1W2B2 2KF6A 4J8TA 1TFOA 3PGBA 2W6JH 4HM0B 1UI7A 1OF5B 1VQ43 2Y73A 3BIRA 3PYJA 1JKGA 4GL6A 1GD4A 2GEXA 1IYYA 5IG4A 4XDWA 1CQSA 2INXA 1BGSA 1YVSA 2HMKB 2O3OA 3HZPA 3JUPA 1LNIA 4HKVB 3CC23 1YJ93 3CME3 3DXOA 2PNCA 1OHOA 3PS8A 1E3RA 2E2TA 3CCQ3 1TUHA 3BNCA 1W6YA 1I2EA 3B7CA 3NM2A 2P09A 1OCVA 1SPUA 1BRIA 1N5PA 3PXMA 4HAAA 4X2OA 5BXQA 3SOYA 3T0UA 3LOYA 2GU1A 1M1K4 2F5WA 3SXXA 1O7WB 1TRQA 1Q9EA 1Q824 4HM7B 1NO3A 3CD63 1RNBA 1Y4KA 3I0YA 1NB5I 2CFKA 1I70A 3DGOA 1VQP3 3G4S3 1CYUA 2R4IA 4CJNA 3HIGA 4R9KA 3D9RA 5EVHA 3GWRA 4BTYA 2KF5A 4BL2A 1IDPA 2CWVA 5BU4A 1S5AA 1RGEA 4MMZB 5M19A 1RLSA 2D1WA 3FSDA 4FMCA 1IVUA 2PZVA 5AIHA 1FYSA 3LXUX 1BSBA 1BOXA 7RNTA 1T5YA 4J9AA 5IG0A 3K0ZA 1OGZA 4L8OA 3N9HA 3BLZA 1AY7A 2R41A 1L5GB 3F8XA 3FF0A 2XR8B 3FF2A 4EC6A 2CHCA 3X3ZA 1W6GA 1V74A 1ZX2A 2F86B 1K734 1U8CB 5TGNA 3NBBA 1D6UA 3KN4A 1BRJA 1HYFA 1Q40A 2ML6A 2WGOA 3S28A 1JZOA 1JN5A 3J7Yd 4FCJA 5CF1A 1WMPA 4HM8B 3WOFB 1RHLA 1US1A 5CF2A 1B2UA 3JVCA 3JUNA 2RGQA 4AKZA 2CK3H 1YI23 3WA2X 5KP3A 1Q7HA 2ZL8A 3BNBA 2SARA 2BIRA 5IG3A 1BVIA 2KRTA 3D5IA 3Q3FA 3UB1A 1I0XA 1GMRA 3NXJA 1FUWA 2CH9A 3FH1A 3HX8A 3MG1A 1NJI4 1TU5A 1RRHA 1VQL3 4FR9A 3EX9A 1IU7A 3CMA3 3CCM3 3CPW2 1JNQA 2GEYA 1IVVA 4CCVA 2P05A 3NQYA 1KC84 2F56A 2V1LA 1ROVA 5FW5A 1MNLA 5CXOA 3V92A 5HOHA 3QK9A 4PEJA 1HKXA 1EEJA 3LTAA 2BO9B 2W04A 1BU4A 5JPPA 1RGAA 5ELUA 5IERA 2HMJB 1RDSA 4WP5A 3H51A 1JN5B 1O7NB 2BNGA 4IIAA 2HMLB 1VZZA 3AMOA 4XBTA 1DE3A 2OWPA 5IF6A 4U13A 1RN4A 3NQZA 2RSXA 3S67A 3JUQA 1DVDA 1GY6A 2CX0A 3EQQB 1I3FA 2MF7A 3HOHA 2WOFA 3JUMA 4XBYA 1YHQ3 1IQYA 2BMRB 2ZDJA 3TDGA 1C7HA 1STFI 1CH0A 2OOVC 3EBTA 5A0OB 2GBWB 1BRHA 1GMPA 1LNHA 1N5HA 1W6CA 3DGNA 1PU4A 2XGNA 1FGMA 6RNTA 1JB2A 4HJLB 2H0IA 5IEOA 5LC6A 2OTJ3 3A76A 5AI1A 5CLKA 1JJ22 3DY5A 5D81A 2BHMA 7STDA 1UW1A 1GSPA 1BUJA 3DH2A 2HOHA 2W9PA 3CPOA 2BMQB 1UGIA 1YJW3 3UNLA 1VQO3 3MWZA 1B20A 1NU3A 5FGOA 2KF4A 1FGOA 1T2HA 2GSPA 2Z77A 4K90B 2HMNB 1BNEA 1I3IA 2H0GA 1BAOA 2GBXB 3KIIA 4XDVA 3WOEB 1BSEA 5M18A 3SLUA 4FCMA 4O3VA 2M7OA 5HGRA 1GMQA 3WDGB 1IVXA 3Q1CA 3AMOB 2F98A 3ALAA 1RRLA 1RGKA 1I2FA 3EN8A 4R80A 1Q864 2RCDA 4KFEA 1A67A 2D42A 2FNQA 2CFDA 1B2SA 3NHXA 1SARA 3EBYA 3B8LA 3IMAB 1ISKA 4EYCA 4EW5A 4IPBA 4O02B 3LT9A 4RNZA 3X3XA 1OUNA 3L0RA 3OX9A 4XB5A 3CCE3 4HM5B 2J8XB 2XF3A 1N8QA 6STDA 5KP1A 1BSDA 3U97A 3PCSA 1EQKA 5AEUB 4K1VA 1X1UA 2CW9A 3HK4A 7GSPA 1KD14 2F99A 3WODG 1U5OA 3PZWA 2IUJA 3ZG5A 1YIT3 3KSED 3AHSA 3LTCA 4X2HA 1AVKA 1RGGA 1G0TA 4HM2B 4ILFA 2OCTA 3ROBA 1N9EA 5BVBA 2GU3A 2A15A 1RJOA 3WR2A 1JZDA 1G02A 3CXC2 1B27A 2KCDA 4WYKB 3FG4A 1RNTA 5IG5A 3URPA 3KKGA 1PFPA 1J2BA 5M1AA 3OV4A 4HM3B 3K7CA 3RDEA 1TJDA 1NWWA 4GSPA 3O8YA 1YIJ3 4RNTA 3V98A 3DGMA 3FG3A 2C4BA 2YFJB 2K54A 1PY3A 4AKYA 1YGWA 2I9WA 2RBIA 1FGQA 5AIFA 5LC7A 3VF1A 3D5GA 3MHEA 2LQVA 3GRDA 4H61A 2Z6BA 3CCJ3 3DGYA 4OK0A 2HMMB 3ECFA 1LOYA 3EHCA 1ZGXA 1AVLA 1M1XB 2W56A 2XH9A 4I5QA 8CHOA 5IEPA 1RCLA 5CK6A 4KFDA 3VSYA 3F40A 2UX0A 3DZLA 2Y74A 4HZ9B 2Z7AA 3OWYA 4N6NB 3ZG0A 1RCKA 1Q814 1VQ63 2WGQA 1HZ1A 4MMYB 2AAEA 2CWTA 4HVNA 4JF8A 3FKAA 4HM4B 1MOLA 4NHFA 3WMDA 4TX4A 3WA3A 1W00A 1I0VA 3DUKA 3MPHA 2QGUA 1ULIB 3NUVA 3D79A 4G1MB 3CCV3 3Q90A 2FGTA 4XBXA 4R4KA 3V99A 4NREA 1BNGA 1AV4A 1O7MB 3KZTA 4GB5A 1VQ93 4ZM8A 3IPTA 3LT8A 2BMOB 1UCLA 3KFQC 4H3UA 1YGEA 1JBSA 3B4OA 4K61A 3NBRA 2P0MA 1K9M4 3G0KA 2RNTA 3OXAA 4OVMA 1X1WA 4BIRA 3X40A 3K5TA 5JPUA 2E2UA 3BU4A 1ZO2A 4FMAA 3Q2PA 3DM8A 3DGLA 1RGHA 2CC3A 2W56B 1B2MA 1VQN3 3S5CA 4RZMA 1UDII 4QWTA 1QVG2 3IJEB 4I4KA 1W4NA 1VQ73 1IVWA 2AADA 5ELJA 3UJMA 4HM6B 1WTHA 4LYLB 2CWUA 3MG2A 2B24B 3X41A 1K8A4 1A90A 1IV7A 1EUIC 3RGAA 4N3VA 3S27A 1OH0A 2KF3A 1GOVA 3BB9A 1DMNA 5STDA 1BANA 1EKMA 4XM4A 1GY5A 4N6TA 1JB5A 1BNJA 4STDA 4FCZA 2IYJA 1AQZA 2IUKA 3GZYB 1W02A 3K9MC 3S29A 4HM1B 4LGQA 5AYRB 1JV2B 1VQQA 5JBSA 1BNRA 2K0MA 3CC43 1MWSA 2OQEC 2F4YA 1SQWA 1MGWA 4N6MA 1UUWB 3H3HA 1QVF2 1BSAA 1M9GA 1C54A 1IV9A 4RNYA 4R1KA 2BT3A 2ML5A 4LEHA 3CNMA 1IQ8A 4WWUC 1HU9A 1N9JA 4LSOA 4EV2A 1SIHA 1DYUA 5AIGA 1MWTA 1BNSA 3RNTA 1QALA 1X1XA 3NM7A 2Q07A 1V58A 2OOVA 3RGRA 3JUOA 3I553 2XFSA 4FMDA 3STDA 1OACA 1BRSA 1D6YA 4WYKA 1LOVA 1LXEA 4ORLA 3CCR3 2CFLA 2ZHXB 5I97A 1I8VA 1F8NA 1WMOA 2UUGC 4FMBA 2P0XA 4BU4A 4N6OB 1UCIA 1UUGB 1FW7A 3NX0A 3E99A 2CG1A 1WNHA 1BRGA 3X3YA 2XSOB 4KT3B 1UCKA 4OUQA 3D3LA 3N54B 3NV0A 3EF8A 1VQK3 1STDA 1PYLA 5EEOA 4WFOA 1JRQA 5G2GA 1LQGC 1DVCA 2XFTA 1KSIA 1B2XA 1QAFA 1DMQA 3DMCA 3HI7A 2YFLB 4HBRA 1EA2A 3AGOA 3KE7A 1FZUA 1SIIA 4J5KA 1OHPA 1MWRA 2L1SA
chains in the Genus database with same CATH topology
1ROAA 3HIIA 2YFIB 1N8R4 3SOAA 5DRVA 1M904 3LTDA 1GYBA 1VQ53 4BTWA 1VQ83 3BNDA 2IMJA 3UL6A 2W03A 2STDA 3OW22 2XSHB 3BNEA 1R4CA 1QJGA 1W7CA 2CIUA 3MKIA 3GAXA 2W9QA 2CKFB 1EG9B 4KFFA 1GY7A 1RN7A 1W5ZA 3LTBA 3NV0B 3G713 3F7SA 3MSOA 3CCL3 1FGTA 1OGXA 3CCS3 1IT8A 3FZWA 2E2VA 4O2HA 4EBGA 3G6E3 2O9UX 1JKGB 1TIJA 5AYSC 4LZIA 1IK3A 2IA7A 2W0QA 1O7PB 3F14A 3F7XA 2OTL3 1FGRA 3B4PA 2XRXB 1IQXA 1E3VA 4MJDA 1QAKA 4AEQA 1W01A 2LYXA 1VQM3 1TFKA 1A2KA 2RFRA 3T8NA 4EXRA 4O8SA 2QA43 1IT7A 1NDOB 1E97A 1GS3A 4JRFA 1D6ZA 2Z76A 3NBJA 3ER7A 4LMIA 2KXGA 1G96A 3PCRA 1O7HB 4N6V0 3GZBA 4HZBB 2L4VA 3QRDA 5DREA 3VGNA 3FCSB 2SBLA 4K1UA 3F9SA 1K28A 1ASKA 4BTXA 2XEPA 3LH4A 3MG3A 1DMMA 3OWUA 3EJVA 1UUVB 2CFWA 4MEIA 1VQL3 1LOXA 1Q42A 4R9LA 4N6UA 3F8HA 4L8PA 5IW9A 3LZAA 1S723 3LYGA 1Z1SA 4CDLA 1K41A 3M8CA 3GZXB 3EB8A 1SJWA 1RKYA 3SVAA 3MYTA 1UI8A 3CCU3 2HMOB 1O7GB 2GXFA 3SX1A 1NB3I 1Q7Y4 3K63A 4IT7A 3EE1A 3CU3A 4HYZA 1QMAA 2QEX3 1W2ZA 2C10A 4KZ1A 1KWIA 5IENA 3X42A 4KVHA 1BUQA 1Q40B 3EC9A 5EQLA 2CFGA 1JB4A 3CNXA 3OWSA 3G16A 2CG0A 3LMLA 1WMNA 4MMXB 1OF5A 2MC8A 3FGYA 4L7KA 3UL5A 3G8ZA 1WQLB 5AIIA 2P38A 2WOHA 2FXTA 3SEDA 5D83A 4WHAA 1ULJB 1FA3A 2C11A 4Q53A 3U1WA 4EV5A 1CEWI 3EN1B 1GD3A 3KSPA 2XGLA 1KQS2 1OHSA 1YJN3 5D82A 1CYVA 3I563 1YVBI 2B1XB 1TP6A 4N6LA 1LVNA 2QIYA 2JQ5A 2OQEA 5AEWB 1AR0A 3FLJA 5KP4A 1A2VA 2JDIH 2W2CA 3N8BA 2WO0A 1OPYA 3FG1A 4RBNA 2YX9A 3T8UA 3GZRA 3CC73 1W2B2 4J8TA 1TFOA 3PGBA 2W6JH 4HM0B 1UI7A 1OF5B 1VQ43 2Y73A 3PYJA 1JKGA 4GL6A 1GD4A 2GEXA 5IG4A 4XDWA 1CQSA 2INXA 2O3OA 2HMKB 3HZPA 3JUPA 3CC23 1YJ93 4HKVB 3CME3 3DXOA 2PNCA 1OHOA 3PS8A 1E3RA 2E2TA 3CCQ3 1TUHA 3BNCA 1W6YA 3B7CA 3NM2A 2P09A 1OCVA 1SPUA 1N5PA 3PXMA 4X2OA 5BXQA 3SOYA 3T0UA 3LOYA 2GU1A 1M1K4 3SXXA 1O7WB 1Q824 4HM7B 1NO3A 3CD63 1Y4KA 3I0YA 1NB5I 2CFKA 3DGOA 1VQP3 3G4S3 1CYUA 2R4IA 3HIGA 4R9KA 3D9RA 5EVHA 3GWRA 4BTYA 1IDPA 2CWVA 1S5AA 4MMZB 2D1WA 3FSDA 4FMCA 1IVUA 2PZVA 5AIHA 3LXUX 1T5YA 4J9AA 5IG0A 3K0ZA 1OGZA 4L8OA 3N9HA 3BLZA 1L5GB 3F8XA 3FF0A 2XR8B 3FF2A 4EC6A 2CHCA 3X3ZA 1W6GA 1V74A 1ZX2A 2F86B 1K734 1U8CB 5TGNA 3NBBA 1D6UA 3KN4A 2ML6A 1Q40A 2WGOA 3S28A 3J7Yd 1JN5A 4FCJA 5CF1A 1WMPA 4HM8B 3WOFB 1US1A 5CF2A 3JVCA 3JUNA 2RGQA 4AKZA 2CK3H 1YI23 3WA2X 5KP3A 2ZL8A 3BNBA 5IG3A 2KRTA 3UB1A 3NXJA 1FUWA 2CH9A 3FH1A 3HX8A 3MG1A 1NJI4 1TU5A 1RRHA 4FR9A 3EX9A 1IU7A 3CMA3 3CCM3 3CPW2 1JNQA 2GEYA 1IVVA 4CCVA 2P05A 3NQYA 1KC84 2V1LA 1ROVA 5FW5A 1MNLA 5CXOA 3V92A 3QK9A 4PEJA 1HKXA 3LTAA 2BO9B 2W04A 5JPPA 5ELUA 5IERA 2HMJB 4WP5A 3H51A 1JN5B 1O7NB 2BNGA 4IIAA 2HMLB 1VZZA 3AMOA 4XBTA 2OWPA 5IF6A 4U13A 3NQZA 2RSXA 3S67A 3JUQA 1DVDA 1GY6A 3EQQB 2MF7A 2WOFA 3JUMA 4XBYA 1YHQ3 1IQYA 2BMRB 2ZDJA 3TDGA 1C7HA 1STFI 2OOVC 3EBTA 5A0OB 2GBWB 1LNHA 1N5HA 1W6CA 3DGNA 1PU4A 2XGNA 1FGMA 1JB2A 4HJLB 5IEOA 5LC6A 2OTJ3 3A76A 5AI1A 5CLKA 1JJ22 3DY5A 5D81A 2BHMA 7STDA 1UW1A 2W9PA 3CPOA 1YJW3 2BMQB 3UNLA 1VQO3 3MWZA 1NU3A 5FGOA 1FGOA 2Z77A 4K90B 2HMNB 3KIIA 4XDVA 3WOEB 2GBXB 1YIJ3 3SLUA 4FCMA 4O3VA 2M7OA 5HGRA 3WDGB 1IVXA 3Q1CA 3AMOB 2F98A 3ALAA 1RRLA 3EN8A 4R80A 1Q864 2RCDA 4KFEA 1A67A 2D42A 2FNQA 2CFDA 3NHXA 3EBYA 3B8LA 3IMAB 1ISKA 4EYCA 4IPBA 4O02B 3LT9A 4RNZA 3X3XA 1OUNA 3L0RA 3OX9A 4XB5A 3CCE3 4HM5B 2XF3A 1N8QA 6STDA 5KP1A 3U97A 3PCSA 1EQKA 5AEUB 4K1VA 2CW9A 3HK4A 1KD14 2F99A 3WODG 1U5OA 3PZWA 2IUJA 1YIT3 3KSED 3LTCA 4X2HA 1AVKA 4HM2B 2OCTA 3ROBA 1N9EA 5BVBA 2GU3A 2A15A 1RJOA 3CXC2 2KCDA 4WYKB 3FG4A 5IG5A 3KKGA 1PFPA 1J2BA 3OV4A 4HM3B 3K7CA 3RDEA 1NWWA 3O8YA 3V98A 3DGMA 3FG3A 2YFJB 2K54A 4AKYA 2I9WA 1FGQA 5AIFA 5LC7A 3VF1A 3MHEA 2LQVA 3GRDA 4H61A 2Z6BA 3CCJ3 4OK0A 2HMMB 3ECFA 3EHCA 1AVLA 1M1XB 2W56A 2XH9A 8CHOA 5IEPA 5CK6A 4KFDA 3VSYA 3F40A 2UX0A 3DZLA 2Y74A 4HZ9B 2Z7AA 3OWYA 4N6NB 1Q814 1VQ63 2WGQA 4MMYB 2CWTA 4HVNA 4JF8A 3FKAA 4HM4B 1MOLA 4NHFA 3WMDA 4TX4A 3WA3A 1W00A 3DUKA 3MPHA 2QGUA 1ULIB 3NUVA 4G1MB 3CCV3 3Q90A 2FGTA 4XBXA 4R4KA 3V99A 4NREA 1VQ93 1AV4A 1O7MB 3KZTA 4GB5A 4ZM8A 3IPTA 3LT8A 2BMOB 3KFQC 4H3UA 1YGEA 3B4OA 4K61A 3NBRA 2P0MA 1K9M4 3G0KA 3OXAA 4OVMA 3X40A 3K5TA 5JPUA 2E2UA 1ZO2A 4FMAA 3Q2PA 3DM8A 3DGLA 2CC3A 2W56B 1VQN3 3S5CA 4RZMA 4QWTA 1QVG2 3IJEB 4I4KA 1W4NA 1VQ73 1IVWA 5ELJA 3UJMA 4HM6B 1WTHA 3X41A 2CWUA 3MG2A 2B24B 1K8A4 1A90A 1IV7A 3RGAA 4N3VA 3S27A 1OH0A 5STDA 3BB9A 1DMNA 1EKMA 4XM4A 1GY5A 4N6TA 1JB5A 4STDA 4FCZA 2IUKA 3GZYB 1W02A 3K9MC 3S29A 4HM1B 4LGQA 5AYRB 1JV2B 5JBSA 2K0MA 3CC43 2OQEC 1SQWA 4N6MA 1UUWB 3H3HA 1QVF2 1M9GA 1IV9A 4RNYA 4R1KA 2BT3A 2ML5A 4LEHA 3CNMA 1IQ8A 4WWUC 1HU9A 1N9JA 4LSOA 4EV2A 1SIHA 1DYUA 5AIGA 1QALA 3NM7A 2Q07A 2OOVA 3RGRA 3JUOA 3I553 2XFSA 4FMDA 3STDA 1D6YA 1OACA 4WYKA 3CCR3 1LXEA 4ORLA 2CFLA 5I97A 1F8NA 1WMOA 4FMBA 2P0XA 4N6OB 3NX0A 3E99A 2CG1A 1WNHA 3X3YA 2XSOB 4OUQA 3D3LA 3N54B 3NV0A 3EF8A 1VQK3 1STDA 5EEOA 4WFOA 1JRQA 5G2GA 1DVCA 2XFTA 1KSIA 1QAFA 3DMCA 1DMQA 3HI7A 4HBRA 2YFLB 1EA2A 3KE7A 1SIIA 1OHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFI B;  3SOA A;  5DRV A;  1GYB A;  2IMJ A;  2STD A;  2XSH B;  1QJG A;  3MKI A;  2CKF B;  1EG9 B;  1GY7 A;  3NV0 B;  3F7S A;  3MSO A;  1OGX A;  3FZW A;  1JKG B;  1O7P B;  3F14 A;  3F7X A;  3B4P A;  2XRX B;  1E3V A;  4MJD A;  1W01 A;  1A2K A;  2RFR A;  3T8N A;  1NDO B;  1E97 A;  1GS3 A;  2Z76 A;  3ER7 A;  4LMI A;  1O7H B;  3GZB A;  4HZB B;  5DRE A;  3VGN A;  4K1U A;  3F9S A;  1ASK A;  3MG3 A;  1DMM A;  3OWU A;  3EJV A;  1UUV B;  1Q42 A;  4R9L A;  3F8H A;  4L8P A;  3LZA A;  3LYG A;  1Z1S A;  4CDL A;  1K41 A;  3M8C A;  3GZX B;  1SJW A;  3MYT A;  2HMO B;  1O7G B;  2GXF A;  3CU3 A;  1QMA A;  5IEN A;  4KVH A;  1BUQ A;  1Q40 B;  3EC9 A;  1JB4 A;  3CNX A;  3OWS A;  3G16 A;  1OF5 A;  3FGY A;  4L7K A;  3G8Z A;  1WQL B;  5AII A;  3SED A;  5D83 A;  1ULJ B;  4Q53 A;  3EN1 B;  3KSP A;  1OHS A;  5D82 A;  2B1X B;  1TP6 A;  2QIY A;  2JQ5 A;  5AEW B;  1AR0 A;  3FLJ A;  5KP4 A;  2W2C A;  1OPY A;  3T8U A;  3GZR A;  4J8T A;  4HM0 B;  1OF5 B;  1JKG A;  2GEX A;  5IG4 A;  4XDW A;  1CQS A;  2INX A;  2HMK B;  3HZP A;  3JUP A;  4HKV B;  3DXO A;  1OHO A;  1E3R A;  1TUH A;  1W6Y A;  3B7C A;  3NM2 A;  1OCV A;  4X2O A;  5BXQ A;  3SOY A;  1O7W B;  4HM7 B;  3I0Y A;  2R4I A;  4R9K A;  3D9R A;  5EVH A;  3GWR A;  1IDP A;  1S5A A;  3FSD A;  2PZV A;  5AIH A;  4J9A A;  5IG0 A;  3K0Z A;  1OGZ A;  4L8O A;  3BLZ A;  3F8X A;  3FF0 A;  2XR8 B;  3FF2 A;  2CHC A;  1ZX2 A;  2F86 B;  5TGN A;  1Q40 A;  1JN5 A;  4FCJ A;  5CF1 A;  4HM8 B;  5CF2 A;  3JUN A;  2RGQ A;  5KP3 A;  5IG3 A;  3NXJ A;  3FH1 A;  3HX8 A;  3MG1 A;  3EX9 A;  2GEY A;  5FW5 A;  5CXO A;  4PEJ A;  1HKX A;  5JPP A;  5IER A;  2HMJ B;  4WP5 A;  3H51 A;  1JN5 B;  1O7N B;  2BNG A;  4IIA A;  2HML B;  1VZZ A;  4XBT A;  2OWP A;  5IF6 A;  4U13 A;  3JUQ A;  1GY6 A;  3EQQ B;  3JUM A;  4XBY A;  2BMR B;  1C7H A;  3EBT A;  2GBW B;  1JB2 A;  4HJL B;  5IEO A;  3A76 A;  5AI1 A;  5CLK A;  5D81 A;  7STD A;  3CPO A;  2BMQ B;  3UNL A;  1NU3 A;  2Z77 A;  2HMN B;  4XDV A;  2GBX B;  4FCM A;  5HGR A;  2F98 A;  3EN8 A;  2RCD A;  3NHX A;  3EBY A;  3B8L A;  1ISK A;  1OUN A;  3OX9 A;  4XB5 A;  4HM5 B;  6STD A;  5KP1 A;  5AEU B;  4K1V A;  3HK4 A;  2F99 A;  1U5O A;  4X2H A;  4HM2 B;  3ROB A;  5BVB A;  2A15 A;  4WYK B;  5IG5 A;  3KKG A;  3OV4 A;  4HM3 B;  3K7C A;  1NWW A;  2YFJ B;  2K54 A;  2I9W A;  5AIF A;  3MHE A;  3GRD A;  2HMM B;  3ECF A;  3EHC A;  5IEP A;  8CHO A;  5CK6 A;  3VSY A;  3F40 A;  2UX0 A;  3DZL A;  4HZ9 B;  2Z7A A;  3OWY A;  4HVN A;  3FKA A;  4HM4 B;  3WMD A;  1W00 A;  3DUK A;  2QGU A;  1ULI B;  3NUV A;  3Q90 A;  4XBX A;  1O7M B;  4GB5 A;  3KZT A;  3IPT A;  2BMO B;  4H3U A;  3B4O A;  3NBR A;  3G0K A;  3OXA A;  4OVM A;  5JPU A;  1ZO2 A;  3DM8 A;  3S5C A;  4RZM A;  4I4K A;  3UJM A;  4HM6 B;  3MG2 A;  2B24 B;  3RGA A;  4N3V A;  1OH0 A;  5STD A;  3BB9 A;  1DMN A;  4XM4 A;  1GY5 A;  1JB5 A;  4STD A;  3GZY B;  1W02 A;  4HM1 B;  4LGQ A;  1UUW B;  3H3H A;  4R1K A;  4LEH A;  3CNM A;  4WWU C;  5AIG A;  3RGR A;  3JUO A;  3STD A;  4WYK A;  4ORL A;  3E99 A;  2XSO B;  4OUQ A;  3NV0 A;  3EF8 A;  1STD A;  5G2G A;  3DMC A;  1DMQ A;  2YFL B;  1EA2 A;  3KE7 A;  1OHP A; 
#chains in the Genus database with same CATH topology
 1ROA A;  3HII A;  2YFI B;  1N8R 4;  4BL3 A;  3SOA A;  3D4A A;  5DRV A;  1M90 4;  3LTD A;  1GYB A;  4DKI A;  1VQ5 3;  4BTW A;  1VQ8 3;  3BND A;  1T2I A;  2IMJ A;  3UL6 A;  2W03 A;  2STD A;  4HOH A;  5GSP A;  3OW2 2;  1X1Y A;  2XSH B;  3BNE A;  3ZFZ A;  1R4C A;  1QJG A;  1W7C A;  2CIU A;  3MKI A;  3SYU A;  3GAX A;  2W9Q A;  2CKF B;  1EG9 B;  4KFF A;  1BRN L;  1GY7 A;  1RN7 A;  1W5Z A;  3LTB A;  3NV0 B;  3G71 3;  1BNI A;  4J5G A;  3F7S A;  3MSO A;  1BNF A;  3CCL 3;  1FGT A;  1OGX A;  3CCS 3;  1IT8 A;  3FZW A;  3AGN A;  2E2V A;  4O2H A;  4EBG A;  9RNT A;  3G6E 3;  2O9U X;  1JKG B;  2K3D A;  1TIJ A;  5AYS C;  4LZI A;  1IK3 A;  2IA7 A;  2W0Q A;  5RNT A;  1O7P B;  3F14 A;  3F7X A;  2OTL 3;  1FGR A;  3B4P A;  2XRX B;  4CPK A;  1IQX A;  2F5M A;  1E3V A;  1I2G A;  4MJD A;  1QAK A;  4AEQ A;  1W01 A;  2IY2 A;  2LYX A;  1TFK A;  1VQM 3;  1A2K A;  1BRK A;  2RFR A;  3T8N A;  4EXR A;  4O8S A;  2QA4 3;  1IT7 A;  1NDO B;  1E97 A;  1GS3 A;  1LOW A;  4JRF A;  1GOY A;  6GSP A;  1D6Z A;  2UGI A;  2Z76 A;  3ER7 A;  1A2P A;  1FUS A;  3NBJ A;  4LMI A;  2KXG A;  1G96 A;  2ZA4 A;  3PCR A;  1RGF A;  1O7H B;  4N6V 0;  3GZB A;  4HZB B;  2L4V A;  3QRD A;  5DRE A;  1RGL A;  3VGN A;  4NPB A;  3FCS B;  2SBL A;  4K1U A;  3F9S A;  1K28 A;  1ASK A;  1RTU A;  4BTX A;  2XEP A;  3LH4 A;  3MG3 A;  1DMM A;  3OWU A;  3EJV A;  5G1L A;  1R4Y A;  1UUV B;  2CFW A;  1ZS7 A;  4MEI A;  1LOX A;  1Q42 A;  2KAA A;  4R9L A;  4N6U A;  3F8H A;  4L8P A;  5IW9 A;  3LZA A;  4GHO A;  1BIR A;  1S72 3;  3LYG A;  1Z1S A;  4CDL A;  1K41 A;  1T3B A;  3M8C A;  1BSC A;  3GZX B;  1B3S A;  2H0H A;  3EB8 A;  1NNV A;  1SJW A;  1RKY A;  1TRP A;  1FUT A;  3MYT A;  3SVA A;  1UI8 A;  1JBT A;  3GSP A;  3CCU 3;  2HMO B;  3WHO A;  1JBR A;  1O7G B;  2GXF A;  3SX1 A;  1NB3 I;  1Q7Y 4;  1RGC A;  8RNT A;  3K63 A;  4IT7 A;  3EE1 A;  1TTO A;  3CU3 A;  4HYZ A;  2CX1 A;  1QMA A;  3AHW A;  2QEX 3;  1W2Z A;  2C10 A;  4KZ1 A;  1KWI A;  5IEN A;  3X42 A;  4KVH A;  1BUQ A;  1Q40 B;  3KCH A;  3EC9 A;  5EQL A;  2CFG A;  1JB4 A;  1B2Z A;  1RMS A;  1DET A;  3CNX A;  3OWS A;  3G16 A;  2CG0 A;  3LML A;  1WMN A;  4MMX B;  1OF5 A;  2MC8 A;  1B21 A;  1GOU A;  3FGY A;  4L7K A;  3UL5 A;  3G8Z A;  1WQL B;  5AII A;  1LQM B;  2P38 A;  1RSN A;  1LRA A;  2BU4 A;  2WOH A;  2FXT A;  3SED A;  5D83 A;  4WHA A;  1ULJ B;  1FA3 A;  2C11 A;  1YNV X;  4Q53 A;  3U1W A;  4EV5 A;  1CEW I;  3EN1 B;  1GD3 A;  3KSP A;  2XGL A;  1MGR A;  1KQS 2;  1OHS A;  1YJN 3;  5D82 A;  1CYV A;  3I56 3;  1YVB I;  2B1X B;  1UCJ A;  1TP6 A;  4N6L A;  1LVN A;  1MWU A;  2QIY A;  2JQ5 A;  2OQE A;  5AEW B;  1AR0 A;  5G1K A;  3FLJ A;  5KP4 A;  1A2V A;  2JDI H;  2W2C A;  3N8B A;  2WO0 A;  1OPY A;  1UGH I;  3FG1 A;  4RBN A;  2YX9 A;  3A5E A;  3T8U A;  1V57 A;  3GZR A;  3CC7 3;  1RN1 A;  5BIR A;  1W2B 2;  2KF6 A;  4J8T A;  1TFO A;  3PGB A;  2W6J H;  4HM0 B;  1UI7 A;  1OF5 B;  1VQ4 3;  2Y73 A;  3BIR A;  3PYJ A;  1JKG A;  4GL6 A;  1GD4 A;  2GEX A;  1IYY A;  5IG4 A;  4XDW A;  1CQS A;  2INX A;  1BGS A;  1YVS A;  2HMK B;  2O3O A;  3HZP A;  3JUP A;  1LNI A;  4HKV B;  3CC2 3;  1YJ9 3;  3CME 3;  3DXO A;  2PNC A;  1OHO A;  3PS8 A;  1E3R A;  2E2T A;  3CCQ 3;  1TUH A;  3BNC A;  1W6Y A;  1I2E A;  3B7C A;  3NM2 A;  2P09 A;  1OCV A;  1SPU A;  1BRI A;  1N5P A;  3PXM A;  4HAA A;  4X2O A;  5BXQ A;  3SOY A;  3T0U A;  3LOY A;  2GU1 A;  1M1K 4;  2F5W A;  3SXX A;  1O7W B;  1TRQ A;  1Q9E A;  1Q82 4;  4HM7 B;  1NO3 A;  3CD6 3;  1RNB A;  1Y4K A;  3I0Y A;  1NB5 I;  2CFK A;  1I70 A;  3DGO A;  1VQP 3;  3G4S 3;  1CYU A;  2R4I A;  4CJN A;  3HIG A;  4R9K A;  3D9R A;  5EVH A;  3GWR A;  4BTY A;  2KF5 A;  4BL2 A;  1IDP A;  2CWV A;  5BU4 A;  1S5A A;  1RGE A;  4MMZ B;  5M19 A;  1RLS A;  2D1W A;  3FSD A;  4FMC A;  1IVU A;  2PZV A;  5AIH A;  1FYS A;  3LXU X;  1BSB A;  1BOX A;  7RNT A;  1T5Y A;  4J9A A;  5IG0 A;  3K0Z A;  1OGZ A;  4L8O A;  3N9H A;  3BLZ A;  1AY7 A;  2R41 A;  1L5G B;  3F8X A;  3FF0 A;  2XR8 B;  3FF2 A;  4EC6 A;  2CHC A;  3X3Z A;  1W6G A;  1V74 A;  1ZX2 A;  2F86 B;  1K73 4;  1U8C B;  5TGN A;  3NBB A;  1D6U A;  3KN4 A;  1BRJ A;  1HYF A;  1Q40 A;  2ML6 A;  2WGO A;  3S28 A;  1JZO A;  1JN5 A;  3J7Y d;  4FCJ A;  5CF1 A;  1WMP A;  4HM8 B;  3WOF B;  1RHL A;  1US1 A;  5CF2 A;  1B2U A;  3JVC A;  3JUN A;  2RGQ A;  4AKZ A;  2CK3 H;  1YI2 3;  3WA2 X;  5KP3 A;  1Q7H A;  2ZL8 A;  3BNB A;  2SAR A;  2BIR A;  5IG3 A;  1BVI A;  2KRT A;  3D5I A;  3Q3F A;  3UB1 A;  1I0X A;  1GMR A;  3NXJ A;  1FUW A;  2CH9 A;  3FH1 A;  3HX8 A;  3MG1 A;  1NJI 4;  1TU5 A;  1RRH A;  1VQL 3;  4FR9 A;  3EX9 A;  1IU7 A;  3CMA 3;  3CCM 3;  3CPW 2;  1JNQ A;  2GEY A;  1IVV A;  4CCV A;  2P05 A;  3NQY A;  1KC8 4;  2F56 A;  2V1L A;  1ROV A;  5FW5 A;  1MNL A;  5CXO A;  3V92 A;  5HOH A;  3QK9 A;  4PEJ A;  1HKX A;  1EEJ A;  3LTA A;  2BO9 B;  2W04 A;  1BU4 A;  5JPP A;  1RGA A;  5ELU A;  5IER A;  2HMJ B;  1RDS A;  4WP5 A;  3H51 A;  1JN5 B;  1O7N B;  2BNG A;  4IIA A;  2HML B;  1VZZ A;  3AMO A;  4XBT A;  1DE3 A;  2OWP A;  5IF6 A;  4U13 A;  1RN4 A;  3NQZ A;  2RSX A;  3S67 A;  3JUQ A;  1DVD A;  1GY6 A;  2CX0 A;  3EQQ B;  1I3F A;  2MF7 A;  3HOH A;  2WOF A;  3JUM A;  4XBY A;  1YHQ 3;  1IQY A;  2BMR B;  2ZDJ A;  3TDG A;  1C7H A;  1STF I;  1CH0 A;  2OOV C;  3EBT A;  5A0O B;  2GBW B;  1BRH A;  1GMP A;  1LNH A;  1N5H A;  1W6C A;  3DGN A;  1PU4 A;  2XGN A;  1FGM A;  6RNT A;  1JB2 A;  4HJL B;  2H0I A;  5IEO A;  5LC6 A;  2OTJ 3;  3A76 A;  5AI1 A;  5CLK A;  1JJ2 2;  3DY5 A;  5D81 A;  2BHM A;  7STD A;  1UW1 A;  1GSP A;  1BUJ A;  3DH2 A;  2HOH A;  2W9P A;  3CPO A;  2BMQ B;  1UGI A;  1YJW 3;  3UNL A;  1VQO 3;  3MWZ A;  1B20 A;  1NU3 A;  5FGO A;  2KF4 A;  1FGO A;  1T2H A;  2GSP A;  2Z77 A;  4K90 B;  2HMN B;  1BNE A;  1I3I A;  2H0G A;  1BAO A;  2GBX B;  3KII A;  4XDV A;  3WOE B;  1BSE A;  5M18 A;  3SLU A;  4FCM A;  4O3V A;  2M7O A;  5HGR A;  1GMQ A;  3WDG B;  1IVX A;  3Q1C A;  3AMO B;  2F98 A;  3ALA A;  1RRL A;  1RGK A;  1I2F A;  3EN8 A;  4R80 A;  1Q86 4;  2RCD A;  4KFE A;  1A67 A;  2D42 A;  2FNQ A;  2CFD A;  1B2S A;  3NHX A;  1SAR A;  3EBY A;  3B8L A;  3IMA B;  1ISK A;  4EYC A;  4EW5 A;  4IPB A;  4O02 B;  3LT9 A;  4RNZ A;  3X3X A;  1OUN A;  3L0R A;  3OX9 A;  4XB5 A;  3CCE 3;  4HM5 B;  2J8X B;  2XF3 A;  1N8Q A;  6STD A;  5KP1 A;  1BSD A;  3U97 A;  3PCS A;  1EQK A;  5AEU B;  4K1V A;  1X1U A;  2CW9 A;  3HK4 A;  7GSP A;  1KD1 4;  2F99 A;  3WOD G;  1U5O A;  3PZW A;  2IUJ A;  3ZG5 A;  1YIT 3;  3KSE D;  3AHS A;  3LTC A;  4X2H A;  1AVK A;  1RGG A;  1G0T A;  4HM2 B;  4ILF A;  2OCT A;  3ROB A;  1N9E A;  5BVB A;  2GU3 A;  2A15 A;  1RJO A;  3WR2 A;  1JZD A;  1G02 A;  3CXC 2;  1B27 A;  2KCD A;  4WYK B;  3FG4 A;  1RNT A;  5IG5 A;  3URP A;  3KKG A;  1PFP A;  1J2B A;  5M1A A;  3OV4 A;  4HM3 B;  3K7C A;  3RDE A;  1TJD A;  1NWW A;  4GSP A;  3O8Y A;  1YIJ 3;  4RNT A;  3V98 A;  3DGM A;  3FG3 A;  2C4B A;  2YFJ B;  2K54 A;  1PY3 A;  4AKY A;  1YGW A;  2I9W A;  2RBI A;  1FGQ A;  5AIF A;  5LC7 A;  3VF1 A;  3D5G A;  3MHE A;  2LQV A;  3GRD A;  4H61 A;  2Z6B A;  3CCJ 3;  3DGY A;  4OK0 A;  2HMM B;  3ECF A;  1LOY A;  3EHC A;  1ZGX A;  1AVL A;  1M1X B;  2W56 A;  2XH9 A;  4I5Q A;  8CHO A;  5IEP A;  1RCL A;  5CK6 A;  4KFD A;  3VSY A;  3F40 A;  2UX0 A;  3DZL A;  2Y74 A;  4HZ9 B;  2Z7A A;  3OWY A;  4N6N B;  3ZG0 A;  1RCK A;  1Q81 4;  1VQ6 3;  2WGQ A;  1HZ1 A;  4MMY B;  2AAE A;  2CWT A;  4HVN A;  4JF8 A;  3FKA A;  4HM4 B;  1MOL A;  4NHF A;  3WMD A;  4TX4 A;  3WA3 A;  1W00 A;  1I0V A;  3DUK A;  3MPH A;  2QGU A;  1ULI B;  3NUV A;  3D79 A;  4G1M B;  3CCV 3;  3Q90 A;  2FGT A;  4XBX A;  4R4K A;  3V99 A;  4NRE A;  1BNG A;  1AV4 A;  1O7M B;  3KZT A;  4GB5 A;  1VQ9 3;  4ZM8 A;  3IPT A;  3LT8 A;  2BMO B;  1UCL A;  3KFQ C;  4H3U A;  1YGE A;  1JBS A;  3B4O A;  4K61 A;  3NBR A;  2P0M A;  1K9M 4;  3G0K A;  2RNT A;  3OXA A;  4OVM A;  1X1W A;  4BIR A;  3X40 A;  3K5T A;  5JPU A;  2E2U A;  3BU4 A;  1ZO2 A;  4FMA A;  3Q2P A;  3DM8 A;  3DGL A;  1RGH A;  2CC3 A;  2W56 B;  1B2M A;  1VQN 3;  3S5C A;  4RZM A;  1UDI I;  4QWT A;  1QVG 2;  3IJE B;  4I4K A;  1W4N A;  1VQ7 3;  1IVW A;  2AAD A;  5ELJ A;  3UJM A;  4HM6 B;  1WTH A;  4LYL B;  2CWU A;  3MG2 A;  2B24 B;  3X41 A;  1K8A 4;  1A90 A;  1IV7 A;  1EUI C;  3RGA A;  4N3V A;  3S27 A;  1OH0 A;  2KF3 A;  1GOV A;  3BB9 A;  1DMN A;  5STD A;  1BAN A;  1EKM A;  4XM4 A;  1GY5 A;  4N6T A;  1JB5 A;  1BNJ A;  4STD A;  4FCZ A;  2IYJ A;  1AQZ A;  2IUK A;  3GZY B;  1W02 A;  3K9M C;  3S29 A;  4HM1 B;  4LGQ A;  5AYR B;  1JV2 B;  1VQQ A;  5JBS A;  1BNR A;  2K0M A;  3CC4 3;  1MWS A;  2OQE C;  2F4Y A;  1SQW A;  1MGW A;  4N6M A;  1UUW B;  3H3H A;  1QVF 2;  1BSA A;  1M9G A;  1C54 A;  1IV9 A;  4RNY A;  4R1K A;  2BT3 A;  2ML5 A;  4LEH A;  3CNM A;  1IQ8 A;  4WWU C;  1HU9 A;  1N9J A;  4LSO A;  4EV2 A;  1SIH A;  1DYU A;  5AIG A;  1MWT A;  1BNS A;  3RNT A;  1QAL A;  1X1X A;  3NM7 A;  2Q07 A;  1V58 A;  2OOV A;  3RGR A;  3JUO A;  3I55 3;  2XFS A;  4FMD A;  3STD A;  1OAC A;  1BRS A;  1D6Y A;  4WYK A;  1LOV A;  1LXE A;  4ORL A;  3CCR 3;  2CFL A;  2ZHX B;  5I97 A;  1I8V A;  1F8N A;  1WMO A;  2UUG C;  4FMB A;  2P0X A;  4BU4 A;  4N6O B;  1UCI A;  1UUG B;  1FW7 A;  3NX0 A;  3E99 A;  2CG1 A;  1WNH A;  1BRG A;  3X3Y A;  2XSO B;  4KT3 B;  1UCK A;  4OUQ A;  3D3L A;  3N54 B;  3NV0 A;  3EF8 A;  1VQK 3;  1STD A;  1PYL A;  5EEO A;  4WFO A;  1JRQ A;  5G2G A;  1LQG C;  1DVC A;  2XFT A;  1KSI A;  1B2X A;  1QAF A;  1DMQ A;  3DMC A;  3HI7 A;  2YFL B;  4HBR A;  1EA2 A;  3AGO A;  3KE7 A;  1FZU A;  1SII A;  4J5K A;  1OHP A;  1MWR A;  2L1S A; 
#chains in the Genus database with same CATH homology
 1ROA A;  3HII A;  2YFI B;  1N8R 4;  3SOA A;  5DRV A;  1M90 4;  3LTD A;  1GYB A;  1VQ5 3;  4BTW A;  1VQ8 3;  3BND A;  2IMJ A;  3UL6 A;  2W03 A;  2STD A;  3OW2 2;  2XSH B;  3BNE A;  1R4C A;  1QJG A;  1W7C A;  2CIU A;  3MKI A;  3GAX A;  2W9Q A;  2CKF B;  1EG9 B;  4KFF A;  1GY7 A;  1RN7 A;  1W5Z A;  3LTB A;  3NV0 B;  3G71 3;  3F7S A;  3MSO A;  3CCL 3;  1FGT A;  1OGX A;  3CCS 3;  1IT8 A;  3FZW A;  2E2V A;  4O2H A;  4EBG A;  3G6E 3;  2O9U X;  1JKG B;  1TIJ A;  5AYS C;  4LZI A;  1IK3 A;  2IA7 A;  2W0Q A;  1O7P B;  3F14 A;  3F7X A;  2OTL 3;  1FGR A;  3B4P A;  2XRX B;  1IQX A;  1E3V A;  4MJD A;  1QAK A;  4AEQ A;  1W01 A;  2LYX A;  1VQM 3;  1TFK A;  1A2K A;  2RFR A;  3T8N A;  4EXR A;  4O8S A;  2QA4 3;  1IT7 A;  1NDO B;  1E97 A;  1GS3 A;  4JRF A;  1D6Z A;  2Z76 A;  3NBJ A;  3ER7 A;  4LMI A;  2KXG A;  1G96 A;  3PCR A;  1O7H B;  4N6V 0;  3GZB A;  4HZB B;  2L4V A;  3QRD A;  5DRE A;  3VGN A;  3FCS B;  2SBL A;  4K1U A;  3F9S A;  1K28 A;  1ASK A;  4BTX A;  2XEP A;  3LH4 A;  3MG3 A;  1DMM A;  3OWU A;  3EJV A;  1UUV B;  2CFW A;  4MEI A;  1VQL 3;  1LOX A;  1Q42 A;  4R9L A;  4N6U A;  3F8H A;  4L8P A;  5IW9 A;  3LZA A;  1S72 3;  3LYG A;  1Z1S A;  4CDL A;  1K41 A;  3M8C A;  3GZX B;  3EB8 A;  1SJW A;  1RKY A;  3SVA A;  3MYT A;  1UI8 A;  3CCU 3;  2HMO B;  1O7G B;  2GXF A;  3SX1 A;  1NB3 I;  1Q7Y 4;  3K63 A;  4IT7 A;  3EE1 A;  3CU3 A;  4HYZ A;  1QMA A;  2QEX 3;  1W2Z A;  2C10 A;  4KZ1 A;  1KWI A;  5IEN A;  3X42 A;  4KVH A;  1BUQ A;  1Q40 B;  3EC9 A;  5EQL A;  2CFG A;  1JB4 A;  3CNX A;  3OWS A;  3G16 A;  2CG0 A;  3LML A;  1WMN A;  4MMX B;  1OF5 A;  2MC8 A;  3FGY A;  4L7K A;  3UL5 A;  3G8Z A;  1WQL B;  5AII A;  2P38 A;  2WOH A;  2FXT A;  3SED A;  5D83 A;  4WHA A;  1ULJ B;  1FA3 A;  2C11 A;  4Q53 A;  3U1W A;  4EV5 A;  1CEW I;  3EN1 B;  1GD3 A;  3KSP A;  2XGL A;  1KQS 2;  1OHS A;  1YJN 3;  5D82 A;  1CYV A;  3I56 3;  1YVB I;  2B1X B;  1TP6 A;  4N6L A;  1LVN A;  2QIY A;  2JQ5 A;  2OQE A;  5AEW B;  1AR0 A;  3FLJ A;  5KP4 A;  1A2V A;  2JDI H;  2W2C A;  3N8B A;  2WO0 A;  1OPY A;  3FG1 A;  4RBN A;  2YX9 A;  3T8U A;  3GZR A;  3CC7 3;  1W2B 2;  4J8T A;  1TFO A;  3PGB A;  2W6J H;  4HM0 B;  1UI7 A;  1OF5 B;  1VQ4 3;  2Y73 A;  3PYJ A;  1JKG A;  4GL6 A;  1GD4 A;  2GEX A;  5IG4 A;  4XDW A;  1CQS A;  2INX A;  2O3O A;  2HMK B;  3HZP A;  3JUP A;  3CC2 3;  1YJ9 3;  4HKV B;  3CME 3;  3DXO A;  2PNC A;  1OHO A;  3PS8 A;  1E3R A;  2E2T A;  3CCQ 3;  1TUH A;  3BNC A;  1W6Y A;  3B7C A;  3NM2 A;  2P09 A;  1OCV A;  1SPU A;  1N5P A;  3PXM A;  4X2O A;  5BXQ A;  3SOY A;  3T0U A;  3LOY A;  2GU1 A;  1M1K 4;  3SXX A;  1O7W B;  1Q82 4;  4HM7 B;  1NO3 A;  3CD6 3;  1Y4K A;  3I0Y A;  1NB5 I;  2CFK A;  3DGO A;  1VQP 3;  3G4S 3;  1CYU A;  2R4I A;  3HIG A;  4R9K A;  3D9R A;  5EVH A;  3GWR A;  4BTY A;  1IDP A;  2CWV A;  1S5A A;  4MMZ B;  2D1W A;  3FSD A;  4FMC A;  1IVU A;  2PZV A;  5AIH A;  3LXU X;  1T5Y A;  4J9A A;  5IG0 A;  3K0Z A;  1OGZ A;  4L8O A;  3N9H A;  3BLZ A;  1L5G B;  3F8X A;  3FF0 A;  2XR8 B;  3FF2 A;  4EC6 A;  2CHC A;  3X3Z A;  1W6G A;  1V74 A;  1ZX2 A;  2F86 B;  1K73 4;  1U8C B;  5TGN A;  3NBB A;  1D6U A;  3KN4 A;  2ML6 A;  1Q40 A;  2WGO A;  3S28 A;  3J7Y d;  1JN5 A;  4FCJ A;  5CF1 A;  1WMP A;  4HM8 B;  3WOF B;  1US1 A;  5CF2 A;  3JVC A;  3JUN A;  2RGQ A;  4AKZ A;  2CK3 H;  1YI2 3;  3WA2 X;  5KP3 A;  2ZL8 A;  3BNB A;  5IG3 A;  2KRT A;  3UB1 A;  3NXJ A;  1FUW A;  2CH9 A;  3FH1 A;  3HX8 A;  3MG1 A;  1NJI 4;  1TU5 A;  1RRH A;  4FR9 A;  3EX9 A;  1IU7 A;  3CMA 3;  3CCM 3;  3CPW 2;  1JNQ A;  2GEY A;  1IVV A;  4CCV A;  2P05 A;  3NQY A;  1KC8 4;  2V1L A;  1ROV A;  5FW5 A;  1MNL A;  5CXO A;  3V92 A;  3QK9 A;  4PEJ A;  1HKX A;  3LTA A;  2BO9 B;  2W04 A;  5JPP A;  5ELU A;  5IER A;  2HMJ B;  4WP5 A;  3H51 A;  1JN5 B;  1O7N B;  2BNG A;  4IIA A;  2HML B;  1VZZ A;  3AMO A;  4XBT A;  2OWP A;  5IF6 A;  4U13 A;  3NQZ A;  2RSX A;  3S67 A;  3JUQ A;  1DVD A;  1GY6 A;  3EQQ B;  2MF7 A;  2WOF A;  3JUM A;  4XBY A;  1YHQ 3;  1IQY A;  2BMR B;  2ZDJ A;  3TDG A;  1C7H A;  1STF I;  2OOV C;  3EBT A;  5A0O B;  2GBW B;  1LNH A;  1N5H A;  1W6C A;  3DGN A;  1PU4 A;  2XGN A;  1FGM A;  1JB2 A;  4HJL B;  5IEO A;  5LC6 A;  2OTJ 3;  3A76 A;  5AI1 A;  5CLK A;  1JJ2 2;  3DY5 A;  5D81 A;  2BHM A;  7STD A;  1UW1 A;  2W9P A;  3CPO A;  1YJW 3;  2BMQ B;  3UNL A;  1VQO 3;  3MWZ A;  1NU3 A;  5FGO A;  1FGO A;  2Z77 A;  4K90 B;  2HMN B;  3KII A;  4XDV A;  3WOE B;  2GBX B;  1YIJ 3;  3SLU A;  4FCM A;  4O3V A;  2M7O A;  5HGR A;  3WDG B;  1IVX A;  3Q1C A;  3AMO B;  2F98 A;  3ALA A;  1RRL A;  3EN8 A;  4R80 A;  1Q86 4;  2RCD A;  4KFE A;  1A67 A;  2D42 A;  2FNQ A;  2CFD A;  3NHX A;  3EBY A;  3B8L A;  3IMA B;  1ISK A;  4EYC A;  4IPB A;  4O02 B;  3LT9 A;  4RNZ A;  3X3X A;  1OUN A;  3L0R A;  3OX9 A;  4XB5 A;  3CCE 3;  4HM5 B;  2XF3 A;  1N8Q A;  6STD A;  5KP1 A;  3U97 A;  3PCS A;  1EQK A;  5AEU B;  4K1V A;  2CW9 A;  3HK4 A;  1KD1 4;  2F99 A;  3WOD G;  1U5O A;  3PZW A;  2IUJ A;  1YIT 3;  3KSE D;  3LTC A;  4X2H A;  1AVK A;  4HM2 B;  2OCT A;  3ROB A;  1N9E A;  5BVB A;  2GU3 A;  2A15 A;  1RJO A;  3CXC 2;  2KCD A;  4WYK B;  3FG4 A;  5IG5 A;  3KKG A;  1PFP A;  1J2B A;  3OV4 A;  4HM3 B;  3K7C A;  3RDE A;  1NWW A;  3O8Y A;  3V98 A;  3DGM A;  3FG3 A;  2YFJ B;  2K54 A;  4AKY A;  2I9W A;  1FGQ A;  5AIF A;  5LC7 A;  3VF1 A;  3MHE A;  2LQV A;  3GRD A;  4H61 A;  2Z6B A;  3CCJ 3;  4OK0 A;  2HMM B;  3ECF A;  3EHC A;  1AVL A;  1M1X B;  2W56 A;  2XH9 A;  8CHO A;  5IEP A;  5CK6 A;  4KFD A;  3VSY A;  3F40 A;  2UX0 A;  3DZL A;  2Y74 A;  4HZ9 B;  2Z7A A;  3OWY A;  4N6N B;  1Q81 4;  1VQ6 3;  2WGQ A;  4MMY B;  2CWT A;  4HVN A;  4JF8 A;  3FKA A;  4HM4 B;  1MOL A;  4NHF A;  3WMD A;  4TX4 A;  3WA3 A;  1W00 A;  3DUK A;  3MPH A;  2QGU A;  1ULI B;  3NUV A;  4G1M B;  3CCV 3;  3Q90 A;  2FGT A;  4XBX A;  4R4K A;  3V99 A;  4NRE A;  1VQ9 3;  1AV4 A;  1O7M B;  3KZT A;  4GB5 A;  4ZM8 A;  3IPT A;  3LT8 A;  2BMO B;  3KFQ C;  4H3U A;  1YGE A;  3B4O A;  4K61 A;  3NBR A;  2P0M A;  1K9M 4;  3G0K A;  3OXA A;  4OVM A;  3X40 A;  3K5T A;  5JPU A;  2E2U A;  1ZO2 A;  4FMA A;  3Q2P A;  3DM8 A;  3DGL A;  2CC3 A;  2W56 B;  1VQN 3;  3S5C A;  4RZM A;  4QWT A;  1QVG 2;  3IJE B;  4I4K A;  1W4N A;  1VQ7 3;  1IVW A;  5ELJ A;  3UJM A;  4HM6 B;  1WTH A;  3X41 A;  2CWU A;  3MG2 A;  2B24 B;  1K8A 4;  1A90 A;  1IV7 A;  3RGA A;  4N3V A;  3S27 A;  1OH0 A;  5STD A;  3BB9 A;  1DMN A;  1EKM A;  4XM4 A;  1GY5 A;  4N6T A;  1JB5 A;  4STD A;  4FCZ A;  2IUK A;  3GZY B;  1W02 A;  3K9M C;  3S29 A;  4HM1 B;  4LGQ A;  5AYR B;  1JV2 B;  5JBS A;  2K0M A;  3CC4 3;  2OQE C;  1SQW A;  4N6M A;  1UUW B;  3H3H A;  1QVF 2;  1M9G A;  1IV9 A;  4RNY A;  4R1K A;  2BT3 A;  2ML5 A;  4LEH A;  3CNM A;  1IQ8 A;  4WWU C;  1HU9 A;  1N9J A;  4LSO A;  4EV2 A;  1SIH A;  1DYU A;  5AIG A;  1QAL A;  3NM7 A;  2Q07 A;  2OOV A;  3RGR A;  3JUO A;  3I55 3;  2XFS A;  4FMD A;  3STD A;  1D6Y A;  1OAC A;  4WYK A;  3CCR 3;  1LXE A;  4ORL A;  2CFL A;  5I97 A;  1F8N A;  1WMO A;  4FMB A;  2P0X A;  4N6O B;  3NX0 A;  3E99 A;  2CG1 A;  1WNH A;  3X3Y A;  2XSO B;  4OUQ A;  3D3L A;  3N54 B;  3NV0 A;  3EF8 A;  1VQK 3;  1STD A;  5EEO A;  4WFO A;  1JRQ A;  5G2G A;  1DVC A;  2XFT A;  1KSI A;  1QAF A;  3DMC A;  1DMQ A;  3HI7 A;  4HBR A;  2YFL B;  1EA2 A;  3KE7 A;  1SII A;  1OHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...