4HZLA

Neutralizing antibody mab#8 in complex with the epitope ii of hcv e2 envelope protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
217
Chain Sequence
EVMLVESGGDLVKPGGSLKLPCAASGFTVSTYAMSWIRQTPEKRLEWVATISSGGSYTYYPDNVKGRFTISRDIAKNTLYLQMSSLRSEDTAMYYCARHPPTVVAGDAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
publication title Structural evidence for a bifurcated mode of action in the antibody-mediated neutralization of hepatitis C virus.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 217
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzlA01
3TNMA 4LLDB 4NN6C 2D31B 3FQUB 2Q76B 3IU4L 1WBXB 3OB8A 3VFNB 3C9NA 4ORGA 3SKOA 1RMFH 1DBAH 2NY4B 4TNVK 4NN6B 3T04D 1DQDL 3HC4L 5ERWA 1KGCD 5DFVD 4JJ5B 2LTQC 5DRWB 4K3JH 5HHVH 3ULUE 3R1GH 4QTHA 4S0SD 5CFHA 1HZHH 4PY7B 1DUZA 2A6KB 3L3GA 2LTQB 1PW3A 1HILA 5GS3A 4MJIB 3IU3B 4GUPA 3QULB 1OSPL 5AZEH 2VH5H 4IOFD 1CFVL 3GBNL 3H9SD 4GSDH 4RSVA 3R0MA 4PJBA 4C56A 2L7JA 1KBGH 4OCXH 1PZ5A 1Z3GH 2FD6L 2GIYA 1SMAA 2NY3C 1ODAA 1DANT 5LBSH 4JKMA 5GRZA 3MCKA 4JAMA 3E6FB 3FB8A 3NACH 4H1LB 1JGEB 1QA9A 3U30C 4R9HA 1SM3H 4HT1L 2DLFH 2NY3B 1IGML 3QDGA 3IKCB 4YE4L 5IVOA 5IK3B 5BJTB 2R0KH 4AIZA 2GT9A 3MQIA 5EC2B 1X7QB 1EGJH 1UB6B 3T0AA 3U30B 3KLHC 1YECL 5FECA 4P9HC 5CINL 4XRCB 1A7RL 4MNHA 5L8JB 3PE9A 1EIBA 2C26A 2AJUL 2APFA 3L5XL 2VDQL 4FZEL 3NZHH 2G5RA 4LBEA 3DXAA 5LWYH 3VFSB 1KIRA 2VISB 4IBLT 5TDOA 2OTUB 3HUJF 1HWHB 1HXYA 1WZMA 1J1OH 2DM4A 3ESUF 3ZE1F 8FABA 3E6HB 1S7SA 5SWSE 1ZXQA 3T0EC 1XF2A 4GXUN 1CFNB 4YXLH 2K7QA 2D7TL 4MJ2A 5BCAA 3L3OB 2NX5B 2ZSVA 5DJ6A 1QSFD 2VDKH 4UI2A 1A6WH 1FGNH 2B1HL 3DGCR 3T0EB 1E28A 1PKQB 4KTEL 3BW9A 3EDJA 2NTFA 3JV4B 3TNMB 5F7HA 2PW1A 5HYJE 1S7XA 3TV3L 5CEZD 5GGVL 1UVQA 2FATH 1R5VA 2E27H 3C9NB 4ORGB 4YXKH 1R5WA 3HFMH 3SKOB 5C0RH 2W0PA 5ITBH 3LN5A 4HPOH 4HD9A 1WFOA 4AQ1B 3SDCA 4L4TE 5ERWB 3TBYA 2VXQH 2GYSA 2ICWA 2C9AA 4TRPH 1T7ZA 1SJEA 3V4PL 1KLGA 4PJHE 3R8BB 4J1UA 3B2VL 2VJXA 4LHUD 4QTHB 3OMZA 5KVDL 1DUZB 3VU2A 2ATKA 3B2UC 3L3GB 5HI5C 1HILB 2R15A 3W9EA 4FFYL 5D6CB 3LD8C 1YUHA 1T7XA 2VIRB 4PRHA 5JOFA 2DKSA 3EDKA 2DD8L 3EOAA 4IRZH 4PJBB 4C56B 2FBJL 1JZ4A 4RA3A 1PZ5B 4JO4L 3ZTNL 4FP8H 4NWTL 3LD8B 4PJGF 2CMRL 2H9GA 2RIKA 3V5KA 4JAMB 4WTZA 1AO7D 3FB8B 1A7OL 1RV6X 2YD7A 4XNUH 2QSVA 2ZCHL 1QA9B 3CSBA 4XHJD 3QDGB 5C6TL 2HFFA 4AIZB 2GT9B 1DLHA 4GKNA 2ZUVA 3HCVA 3QIUD 4RMQA 4M6OL 1DLFL 3OAUH 1I1YA 5FECB 1EVUA 1LO5A 4MNHB 1A22B 3CVIL 5EZOL 4OBRA 5I15H 5E8DH 3DUSA 2GJJA 3BJ91 3QCVH 4LBEB 3DXAB 1KIRB 3SJVA 5DEZA 8FABB 1HXYB 1MREH 2XOTA 2NY5H 1S7SB 1XF2B 4NZTL 2BOBA 5C86A 1HI6A 2ZSVB 5DJ6B 4BK5A 4FFVD 5I30L 3BE1H 2FIRT 4OLVH 3BW9B 2NTFB 4R2GD 3RQ3A 3SDCC 1S7XB 5ALBH 3B9VA 4POYA 1UVQB 5CILH 1R5VB 4K9EL 4U6YA 1S9WA 1MFBH 1R5WB 1XIWA 4J4PA 5KSVA 2VLKE 5E0QA 2Y72A 3LN5B 5DUBA 1PG7W 3SDCB 4U6VH 3TBYB 1LP9A 2ICWB 4KI5C 3WCYA 4X8JA 4QHMA 3SHSA 4JRYD 1SJEB 2VZSA 1KLGB 2H1PL 4PJXA 4J1UB 4YUEL 5FGBA 2ZUYA 3O6FD 2ATKB 5T1DH 4YHNA 1HIML 1KFAL 3KYKL 5E6IA 3W9EB 4HS8H 3S5LA 4QHKJ 1T80A 2CIKA 1HH6A 3X12A 1YUHB 2M2DA 2MQ3A 1G0XA 3Q6FA 4P3WA 4PRHB 4LCYA 5JOFB 5HHNA 1J10A 3EOAB 3QWOA 5GXBB 3I84A 3RX7A 3UJIH 1WQVT 3VFOA 1CWVA 2H9GB 3V5KB 4O51A 3ORJA 3CLFL 4RAVA 2I60H 4XBEL 5I1EH 1YPZF 1I8KA 4Z6AT 2NW2A 1SY6H 4XVTH 5EZLA 2DQCL 2FX8L 4M1CC 2HFFB 1DLHB 4GKNB 5KANI 3HCVB 5TDNA 3S36H 1QFOA 3QPQC 1MHPH 1I1YB 3U0WL 3RVXC 5LKNA 1LO5B 1VADB 1OTTD 4RWYH 2AJSH 3D18A 4Y88A 4MD0A 4CDHA 2FJGA 5AG9A 4M3JA 3AS1A 1Q1JH 5AZ2L 4O5LL 2GJZA 1YNLH 1SEQL 5C07E 2BNRE 4P5TA 5GS1A 3KPMA 3OQ3B 1XFPA 2J8UE 4H88H 2VDML 5GRWA 5T3ZH 2BOBB 2V9TA 4OLYL 3WD5L 2YRPA 4NQDD 3EW3B 2BHZA 4QRRE 1QD0A 3PWJA 1XGTA 1XIWC 4J4PC 2ZNXA 5GGRY 5LGJA 1MI5E 1RUQL 2EDHA 2EKSA 3HMXL 4G6KL 2W0LA 4MCZA 4U6YB 1S9WB 1XIWB 5KSVB 2O5ZH 5DUBB 4OV6F 3BKJL 2HRPL 2ZCLL 3G04A 3WFHA 1LP9B 5F8RC 1LDPH 2Z31D 4B53A 3CU1A 1FORH 1NMBH 4X8JB 4QHMB 5E6IC 4XVSL 5HI3C 1QZ1A 2VZTA 4BFIA 4PJXB 1T0PB 4I0CC 1F42A 2VXTH 4JRXE 4PJ9D 5KN5A 4HT1H 1J7VR 4Z7VA 2I9LB 4TYUA 4DQOL 3GDBA 1NMAL 1AC0A 5E6IB 3S5LB 4ZUVA 4LKXA 2CIKB 1HH6B 3X12B 5ABDE 1UWEH 5EUOA 1MUJA 4JKLA 3Q6FB 4PV9A 4LCYB 5I1CL 1C5DA 5HHNB 1DEDA 3QWOB 4DGVL 43CAA 4NNPH 2AK4B 4UIKH 5INCA 4K7PH 3H6JA 2DL9A 1XF1A 5GZNC 3LKQA 4U2ZA 3VFOB 2WP3O 3L5XH 2VDQH 4FQ1H 2RBLA 4O51B 4RAVB 4HIIA 1UEYA 3EKCA 1I8KB 5GISL 1JYNA 2NW2B 5EZLB 4HBCH 2O5YL 3DV6A 1OM3H 5MEQA 3ULUD 3HAEA 3MROA 1D5IL 1X5YA 4FNLH 1NUNB 5KTEH 5TDNB 4J3SA 2IFFH 3KGRA 4LHUA 1CL7I 4HC1H 1IAIM 2H2PC 1F6LL 1DZBA 1CD1A 2GJ6B 3D18B 1QSZA 4P5TC 3U83A 3DVGA 4MD0B 5GS1C 2FJGB 5IHBA 5F3BA 4ZFOL 3TV3H 2YD4A 5HDQH 5HYIA 5EULV 4XAKE 3TA3D 4ODSH 2GJZB 3CJJA 4P5TB 5CP3H 2NZ9D 4GKOA 5GS1B 1GC1H 2UWEE 3KPMB 1BPVA 2I9TA 5EH1A 1AO7A 4Z7OE 3V4PH 2G75A 4I48A 4Z7QE 3CPLA 4WEBL 3PWJB 1IILE 1J0ZA 4PJAA 1XGTB 2VWEE 4RGNE 1II4E 3MODH 3FQRA 3MNWA 2AAVA 5J1SC 4PRIA 5LGJB 1OLZA 3PQYA 1KEMH 1EBPA 2EKSB 4OCYL 4MCZB 1BD2E 4XP6H 3OPZL 2NR6D 4YEEA 4FMFA 1DFBH 4OM0H 4HUVA 2X89D 2XACC 3G04B 3WFHB 1IGFH 2EIDA 4LSVL 4NWTH 3G08B 5F9OL 2OR7A 4G7YH 1IAII 1MNUL 1RK0A 4HAFA 4PRPA 4ZOEA 1FYTE 4J23A 5I8KL 4BFIB 1A7OH 3MLUH 4GQPH 5SWSD 4L9LA 5EU6E 5KN5B 4X9IA 4Z7VB 5C6TH 4JO3L 4X6EA 1QVOA 3V8CA 4P48A 1MFAH 3BDBA 32C2A 4LKXB 5EUOB 1A6TA 1MUJB 5J57B 4PV9B 4XPGH 4TUJA 4KY1L 1C5DB 1JNNH 5HYJD 43CAB 3MRHA 2PO6D 5INCB 1NCAH 2FIKA 4X7CC 3U36A 3LKQB 2HTKD 3RKDD 2DDQL 2ZUWA 4ZNEA 4G7VL 3SN6N 2WLZA 4KQ3H 5HPOA 4L4TD 1U6AL 4HIIB 1TNMA 3HMWH 3QEQE 1TPXC 3EYQD 1PAMA 3DV6B 1O0VA 5MEQB 1WT5A 4ONGL 3HAEB 1A0QL 3MROB 4U4BA 4JFYA 4JRYA 1V5JA 4BSJA 2O26U 1X4ZA 3FN9A 4AEIH 3DIFA 3W11D 4LHUB 2GY5A 4HLZH 3O6FA 5AAMA 5CZKA 1S78D 1CD1B 2CK0H 3DVGB 1KJ3H 1ED3A 1CGYA 5F3BB 1RK1A 1KXTB 4EI5D 1IC5L 1P4BL 4OLZL 4JZOA 5ID1A 3VFRA 2I9TB 5DWUH 5C0FA 2OZ4A 3UZVB 1FG2A 2G75B 4I48B 3T0BA 3UTQA 2MPAL 3CPLB 5HD8C 2EDKA 1IMHC 4PJAB 5GGQL 4TN9A 1AGEA 3C09C 3FQRB 1KB5L 3MNWB 4PRIB 3PQYB 4OAWA 3EYOA 3JWDH 3BD3A 2IPUG 4CU6A 3HC0A 2X1QA 3C09B 5DHVA 5I8CA 4HUVB 2WUBL 5EOQL 1RK0B 2EICA 3G6JA 3IJHA 3NIFF 4JY4A 4PRPB 4NPYA 2ZUXA 3WLWD 4LSSL 1FIEA 4NM8L 4L9LB 5D71H 3DHJA 3MFFA 4UV4L 4YR6A 2QQNL 4X6EB 4ZSOE 1KCSH 1QVOB 1YZZA 3ZE2F 3QR2A 32C2B 4KRPD 5GSVA 5IB1A 1A6TB 3IGAA 4NQDA 4TUJB 4KMTL 2VZOA 5DVOA 3UYOD 2D0GA 1ZK9A 3MRHB 5EBLA 4L4JA 5EDXA 3FTGA 2FIKB 4R2GB 3U36B 3W9DA 4FQ2H 1GPOL 5C2UB 5CJXA 2VLKD 3CMOH 1WT5C 1RU9H 3VXOB 5IVXF 2BVOB 3NMEA 5FGRA 3NCBB 4BQ8A 5IGXL 4D9LH 5HVHB 4XMLL 3TYGH 4U1NA 3O6FC 3FO9A 4XPHH 5C2BH 4JFYB 3LS5L 4QXUL 1N4XH 2VDOH 3ZDXE 3DIFB 3RY6A 3WD5H 4BM7A 4NBYB 2A1WH 4X6DF 3O6FB 1QLFA 4FTVA 4EBQL 5HHME 5I9QC 1U8PA 1XGYH 3QNYA 5TE4H 1ED3B 2D4FA 4P9ML 4EN3A 2KQMA 1RK1B 4YFEA 2DQDH 3E2HC 2JCCA 3V5HA 4XAWL 5I9QB 4YBHA 5C0DA 1CVSC 2Z35A 4KK9C 3MGAA 5JDSA 1JHKH 4M6AA 3BEVB 3NN8A 2IGFH 4JZOB 4QLRA 3VFRB 1T04A 2HFGH 3E2HB 3O9WA 5C0FB 2OS7A 5EU4A 4Y4HA 3LRSA 4OF5A 2PETA 4XVSH 3PWPE 1FG2B 4LSQH 3JWOC 1MVUA 5A43C 1AGEB 2WWKT 2P47B 3MV11 2V2XA 2ZG1A 4LLWA 5EC1A 4OFYD 5DHYA 1BQSA 4YDJA 4OAWB 2ADIA 3EYOB 4NP4L 4P23C 1OW0A 5JA8B 3HC0B 5I8CB 4OLXL 2JJTA 4D9RE 4DGVH 1MY5A 5DD0L 2YPVH 1IE5A 4F80A 1NGZA 5F7YC 3QO1B 4JY6A 3G6JB 5F7NC 3IJHB 3MA7A 4JY4B 5AYQA 2RGSA 5C07D 2XG5A 4NPYB 1TJIH 1C7TA 4PRNA 3JUZA 2ARWA 5J1TC 3CDYA 4TUKL 2NY1C 1RZJC 5DJ0A 2CLZA 4YBLB 3MFFB 4EZMA 4YR6B 1S7WA 3CFEA 1B0WA 5FYJL 4QRRD 1UM6L 3B5TA 5CJXC 4L8DA 5GSVB 4Z7NE 5IB1B 3IGAB 2F8VA 2NY1B 4HJGA 4ODVL 2XKUA 5FYKU 1LO2H 1J87A 2JB5L 4EIGB 5EBLB 4Y1AA 1MI5D 3FTGB 1EGJA 1EH9A 4J6RH 3W9DB 4PPTA 1BP3B 3QQNA 4DW2H 1NC4D 3V4VL 1NFKA 2X70A 1PFCA 1GGCH 2E9BA 4OGXL 1T03L 1RUPH 3RY6C 2P4AB 4PJEA 2IF7A 4U1NB 4JFFE 3FO9B 4LLMA 3O8XA 4KUCD 2WBJA 2AK1L 1LE5A 1GZPA 2MCPL 4CL7A 1KTRL 2WWMD 3CK0L 1LWRA 3A67H 4EN3C 2WBKA 3ARRA 3CX5K 2WLYA 1QLFB 4FTVB 5LAXA 3UO1H 2PTUA 4JFHE 1U8PB 4AEFA 3QNYB 3LVEA 4JZJA 2HJFA 4EN3B 3K3QA 4M1GL 3BKML 1YQ2A 3V5HB 2JCCB 3O9WC 3G9AB 4Y4HC 3OPZH 5HYJA 5C0DB 2N7AA 5IB2A 3ZYZA 1VFAB 1KYOJ 4XVJH 2Z35B 4MYWB 1A1OB 2VZ1A 4XI5D 5JDSB 5IHUH 1QHOA 3D0VA 3NN8B 3WE6A 4KV5F 1T04B 2J3SA 3O9WB 5EU4B 4Y4HB 3LRSB 3LRGA 3GKWL 1MNUH 4LGRB 3BEWB 1RURH 3D2UD 1JIBA 2B7DT 1QBLH 4RMUA 5CBEA 3UTSE 4HJJH 3U1SL 1OW0C 2JE8A 1B2WL 5F93C 3HRPA 2X1XR 3LH2H 1MVUB 1ACYH 4XWGH 3VI4E 1MCRA 5I1HL 2JJTC 2V2XB 4LLWB 3MJ9L 5EC1B 5DHYB 1AXSA 5DQJA 4YDJB 2ADIB 4L3AA 2YD2A 2IBZY 4Y4KD 3LQAL 3TESA 4M8QA 1WK0A 3CSGA 4XAKD 3TBVA 3DUHA 5B8CA 1OTUC 4JY6B 2EE6A 4MQXD 1U3JA 1RUKL 3C5SA 3KNBA 5DJ0B 2CLZB 3FQNA 3GHEL 3MRBA 3RWHA 1S7WB 2APTA 2Q7NA 3CFEB 4N0YH 1WWAX 3OHXB 1O7VA 5C0NC 4LAQL 4L8DB 1S9VA 4RGND 3TIEA 2HJKA 4YGAB 4HJGB 4Y1AB 2VAAA 4PBWD 5E2WH 1S9XA 1JWMA 2P5EE 2PNDA 1QPPA 3ULUL 1QTYT 3VXUB 1N3NA 3BRFA 2DMKA 3O8XC 2WBJC 2X70B 4Y0GA 1A14L 1UWXK 3SDYL 3DETC 5J11B 2I5YL 3O6ML 4PJEB 1M1SA 1MAML 4BA8A 4WFHE 1FYTD 4ZUUA 3O8XB 1Q0XL 3UJJH 2NY2D 2WBJB 5EU6D 1LE5B 2E7CA 1GZPB 1CCZA 1D6EB 4JZJC 3MV9E 4OGYH 1LO4L 5LAXB 2QJDA 3LS4L 4JZJB 3CH1A 2HJFB 4ZFFA 1KIPA 3MLXL 2AKRA 3ZKND 5FYLH 3MUGA 5IHZA 4JVUA 5I1KL 1IZKA 1QOKA 4NKQB 1FPTL 2ADGA 3D0VB 5FV2A 3WE6B 3QEQD 5EOQH 1NFIA 1GIGL 3CDFA 5CBEB 4I18A 3PHOA 2UYLA 2NY0D 4HIXL 3LEYL 4POZD 3S37L 4PRDA 4G43A 5B8CC 3MLWL 1P7KA 2VDRL 3W81A 4Y16D 4M4RA 1DEEA 4WWKA 4RA0C 3NCEB 4M8QB 3TBVB 5B8CB 4K2UH 1MIEL 3AVEA 4OSUL 5DO2D 1PY4A 3TT1L 1ZEAL 4NQCA 2VLRD 3C5SB 2Q6WA 3KNBB 3FQNB 3MRBB 3OSKA 1F4YH 2C4FT 5D2LE 2E8ZA 3VFPA 1S9VB 3TIEB 3WIHH 4N68A 1SY6A 3QDME 4BKLA 4HG4K 4Q0XL 2ID5A 2VAAB 4OZGE 1KIUA 4RMSA 1S9XB 3V2AR 4OFYA 3GMQA 3T2PA 3PV6A 5L7XL 1N3NB 3H2WA 4UDUA 5TF1H 5T1MA 3GSUA 1YEKH 3UAJD 5DVMA 5C0BE 1FO0L 2NY5C 1RIVL 4ZUUB 1AQDB 2IAMD 2ZOKA 4GBXD 3S98A 1QRNE 3C2AL 3N85H 5DS8A 3TCXA 3LB6D 3D6GA 3T0DA 4KZEL 2XZQH 4DKEL 4V2CB 4YZFF 2D0HA 3QIWD 5KVFH 4YC2C 3QRGL 1KENH 1OSZA 4X98A 1AIFA 3CH1B 4WTWA 3D9AL 4FQCL 5JXAL 4OUOA 1KIPB 15C8H 2J4WH 4Z95L 3LEVL 2AKRB 4KRMB 1R0AH 1MLBA 2OK0H 3MUGB 1G9MH 4YC2B 4QT5A 5IHZB 4I18C 1PLGL 4Z7UE 2ADGB 1NC4A 2HLFC 3P30H 4NQEE 3ZMRA 1NFIB 3HA0A 4HUNB 1QQDA 1ZT4A 4I18B 1PKOA 3PHOB 2UYLB 4TUKH 4JANA 1DUYA 5C9KA 1JVKA 4WWKC 5CMAA 4P2OD 4PRDB 4G43B 4DVRL 1P7KB 3TZVD 3ES6B 4LARL 5HHMD 5DZLA 4WHYH 5A16A 4OF3A 1DEEB 1EJOL 4WWKB 3BZEA 2O5XL 2QLVB 5IROA 5D72L 1IM9A 1JF6A 4ODXA 1G7HB 5SX4I 3MOQA 3WV0A 1H8SA 4NQCB 4K94H 2Q6WB 1T03H 2O61A 2J8HA 2CJUL 3L9RA 3PWUA 3VFPB 1NCDH 3CXHJ 3JBG7 3D2UA 4JG1L 4J3XA 2YEZA 4BKLB 4QTIL 1AGFA 3NGBB 5MI0C 1C08A 1F6FB 1IAOA 5GRUH 5IESL 1ZHLA 3GMQB 5HGGS 1BJ8A 4YHKL 4XP9L 4D9RD 4HC1A 2RHEA 3IETA 4UDUB 3IXAA 5T1MB 4Y4KA 5MI0B 4MGXA 2R0WL 3EHBD 5FAAA 4LFHD 4MA7H 3O3AB 4BH8A 1PD6A 3SQBA 3CFBB 2ZOKB 1PGRB 5EG6C 1CBVL 5DS8B 4JFXB 2YHGA 5EUKA 1URLA 3PGDA 4H20L 4HF5L 1AGDB 5CP3A 1GYAA 1Q94A 4V1DE 2EZ0D 4ALAL 4OZFA 5KSBF 3NOIA 4C4KO 4YHLL 4MAYD 1XF5A 1OSZB 1P9MA 1AIFB 1TITA 3I02A 3PUCA 4X98B 7FABL 5CZXC 2ZOLB 3TN0D 1MLBB 1C8PA 4JDVA 1HKLH 4PGCA 2Y07H 4QT5B 2VQTA 4TTGA 3QAZC 4LLAA 1NFDF 5F7UA 1G7IA 4JQIL 1NC4B 4FOMA 4JFFD 4FXGA 4GOSA 5KSAA 4JPKH 1JFQL 1QQDB 1ZT4B 5L88L 2B1AH 3C60D 3QAZB 4JANB 1DUYB 3CGTA 4KK8C 1G9NH 5CMAB 1MCWM 4LKCA 4HUXA 5IROC 1I7UA 4S1QH 1OWRM 3D3VD 4JFHD 2D3VA 5HHXH 5A16B 3UBXI 1FFPA 3BZEB 2X10A 1IM3A 1CD8A 2BDNH 4OTXL 3V6FA 1IM9B 4ODXB 4EUPG 1HSBB 2HYMA 3SE8H 2Z0BA 3I6LE 5CSGA 2HG5A 4PGJA 1WCBA 4ZXBA 3EZ8A 2O61B 4QXWA 3L9RB 3UTSD 1ACZA 3PWUB 4WUKL 4PJGA 4QHUA 4OFPA 1JGUH 5F9JA 3MBXH 3PDGA 2YEZB 4P3DB 3NIDE 4KGLA 3VRLE 5ADOL 4Y4KC 1AGFB 2FSEA 2A9NH 1C08B 1I9IH 1IAOB 2DI9A 3BZDA 2B20A 3Q3GA 1VACB 1ZHLB 2W91A 3ARWA 5KAQG 3PP3H 4HKXA 1QYGH 4M03A 2ERJC 3IETB 3IXAB 4Y16A 3AS2A 4Y4KB 3KYOA 1T66D 1HYRC 3P9WB 4ZS6C 3BQUD 3IDMA 3AMLA 1GC1C 4BH8B 3I2CH 3OGOE 2ERJB 5DA4A 2L7UA 25C8H 3MNVA 4F2MA 5C08D 2KBGA 4GRMA 4MS8C 5EUKB 3PGDB 2VLRA 5HHOE 3LN9A 1Q94B 3HUJB 4PUBL 1UKQA 2XXMB 1Y0LA 4NRXB 4P3CH 2R69L 1NCBL 1I1RA 1XF5B 4K23H 1KXVC 3I02B 1E6OL 5JDJA 3O0RH 2IBGA 1YNKL 2Z93B 3NA4A 1S3KH 1JF5A 2P5ED 1B0RA 3KXFE 1IGCH 4JDVB 4PGCB 5KSAC 5H37G 1PEWA 3BN3B 2DQFA 2Z4QA 4HIHA 1T4KA 1G7IB 1MIEH 4WGVB 4MA8H 4OSUH 4WFHD 1RIUH 4FXGB 5KSAB 4U1SA 2XQBL 5J3HD 4NGHL 1BFVL 4AEHH 5I0ZA 3D85D 1A7BA 4KDVA 2IAMA 2APXA 4LKCB 1I7UB 4YAQA 4GG6F 3A6BL 4XC1L 4G8FA 1FFPB 3ARZA 4RBPH 1JV5A 1IM3B 3V6FB 4XH2A 4ZXBC 2A6JA 2K9UA 4PD4K 1WFNA 3QPXL 2V2WA 2X4UA 1MFDH 3RWDA 2HG5B 4NUGL 3UYPA 4ZXBB 1WCBB 2DF3A 1FO0H 3O41A 1RIVH 1JGLH 4PJGB 2VN7A 4QHUB 1JCKA 1FL6A 5FKPB 1YPZA 2NY0B 4HFWA 1NBVH 2FSEB 5GJTL 4POUB 3STLA 2EDWA 3Q3GB 4P2OA 3V7AE 3U7YL 4HKXB 3TZVA 1SVZA 4KDTA 1NANH 2FECL 4KKLD 4Q9CA 5MP6H 2V9RA 4Y16B 5DO2C 3KR3L 3KYOB 2EDJA 4HZAA 3LMJH 5AAWA 3IDMB 1A7PH 2LAGB 4TTDD 3WNLA 1H3XA 4F57H 4U7SA 4RZCA 3T3MF 4YO0A 3C08L 4KJQD 2J5LC 4F37K 2VLRB 1N64L 1G0DA 2VB5A 1Y0LB 3A6CL 2APVA 5IG7A 2XZAH 3QDMD 2J5LB 4RISH 4W81A 5IHLB 1PG7L 3VI3E 3JWDC 4JY5L 4GLRH 3EGSA 1A6UH 3NFNA 5FYKE 1B0RB 2HT2D 4P2QE 1TETL 3FFDA 5IFAH 2DQFB 5DYOA 4BZ1L 2Z4QB 4HIHB 1ULVA 4LOUC 2FRGP 2UZXB 1ZE3C 3MRDA 5C0BD 4M7ZC 5JMRA 1DSFH 2X40A 3CC5A 3CFIC 1OAXH 4OJFL 1QRND 2A77L 1W72L 2R4SH 4NC0B 4MJ4A 5HDOA 4M7ZB 4YAQB 1EV2E 3ULVF 1OP5H 5ESAA 1P5VA 4G8FB 2K3TA 2WAHA 4N1CA 1IKFL 1KN4H 2UZYB 3BISA 1J88A 5B38G 1FLTX 1JV5B 1Y18A 1YEEH 4XH2B 3MR9A 2ILLA 1AKJD 2VN4A 2YPKA 4DGYH 3LKPA 2A6JB 3BYYA 1TVHA 3TN0A 2J6EL 4Z0XA 3AY4C 4KXZI 2V2WB 2X4UB 2PXYD 4OB5L 3RWDB 4NQED 2XQYK 4JHWH 3OG6B 4Z8FH 4XNZC 1ADQH 3O41B 3VXNA 3QJHA 3U79A 4KWUA 3VGFA 3S34L 3BAEH 1BBDL 2LABA 2ZG3A 4JFFA 2F9BT 4KDTC 1FL6B 5B39A 4XNZB 1YPZB 1S7QA 4I9WE 2G5BA 3AXLA 3STLB 2QR0B 4P2OB 4UILH 3RVUD 5C9JA 1RJCA 3D3VA 4EI6A 2IQAA 4TVPH 1KCLA 3P4OA 5BMFH 4JB9L 3SCMD 5IMOA 5I8OH 5E4IA 5LCVH 1MCHA 3BGMA 4RZCB 5CGMA 3O2DL 4YO0B 1DQMH 4HFUH 4U6XA 2NYYD 3M45A 4LSUL 1X5IA 1CD0A 4KMQA 5TE7L 1OP3H 5IG7B 4PP2A 2AP2A 3RWJA 5JA9A 3SGJA 3NPZB 3WFBL 1OWWA 2QEJA 3QISA 3GIZL 3EGSB 5E8PB 1MHEA 3NFNB 5EN2A 3EO0A 4IDJH 3FFDB 5DYOB 5T5NG 4XCNA 3VMPA 3MLSL 5FM4A 1K85A 4YDVA 3MRDB 5GQBA 5LGHH 2A83A 3CC5B 4KHTL 4WDIA 4RMWA 2E9IA 2FX9H 4A6YL 1FE8H 3L7EA 1K2DA 3BQUA 4WTZG 1UT9A 1R3IH 1HINL 3EFFA 5C8JB 4V1DD 4WUKH 5C08A 5CD5D 3UBXG 4WI4A 5ESAB 1BJ1J 1OGAA 1GL4B 3TN0C 5D70L 3TFKD 2Y5EA 2CQVA 5HTSA 1Y18B 3C6LD 3GM0A 4M62L 2YPKB 3LKPB 4UT7H 2YKLL 1W0WA 4TSCH 1TVHB 3TJEL 3TN0B 4Z0XB 4NJAL 5MEPA 3DYMA 4LL9A 1KNOB 5KJRH 1CFSA 2W9LA 3VXNB 4QXGL 5FCUH 4R8WH 4DJMA 4HXBH 2YD3A 5B39B 2YD5A 1KJMA 1NGQL 1S7QB 4KAQH 3V4UH 2G5BB 1PEZA 3AXLB 3D85A 4PUBH 1BFSA 4KFZC 4RFOH 1NCBH 4JREB 5C9JB 1BIIA 3VE0A 1KC5H 2G60L 3CCHA 3JZ7A 1E6OH 3D3VB 4EI6B 2NW3B 2IQAB 4KVNL 3S3SA 3QXDA 3P4OB 2EIBA 4HQQL 5IMOB 1NCWL 2YPLE 3RWIA 1X9QA 5EU7C 3BGMB 3DNKA 1UJTA 5DSCA 4K7PY 3MACL 5K9QI 3EYSL 4U6XB 3SGJC 1MH5A 2CDGA 3LDBC 4ESKA 1BFVH 1NCUA 4L3EE 4PP2B 2E7LA 2XI9A 2HVJA 3RWJB 4GXUM 4TQEH 3LDBB 5LQBL 1QBAA 1MHEB 2X9XA 2CKBH 3GI9L 4NQTA 5EN2B 3EO0B 2DQEL 4Z76B 4QRUB 4XCNB 2WQ8A 3O4LA 4XP5L 2W60A 1B4RA 4XCFL 4YDVB 3QHFL 4LASH 2A83B 1VEOA 2EDXA 4WDIB 3HNTL 2AQ3A 1WC7A 1K2DB 3L7EB 2GTZA 3BQUB 1A6AA 3RVWC 3EFFB 2GK0A 5HHOD 5C08B 2DM7A 1NPUA 3PIQA 4D94A 3S97C 1OGAB 1QLEH 1IGIH 5GS0D 2FX7H 4L4VB 1HHGA 2R56H 5GZOD 5GJTH 3KXFD 3QI9D 3WIHA 1A2YA 1FYHB 4YIQA 1IT9L 3OXSA 1LD9A 3ARGA 3PGFL 4N8VA 4IM8A 5MEPB 2VXSH 2BNQB 5JHLH 1OGTA 5B4MC 4WO4D 3QHZL 1CFSB 1VPOL 1CVRA 3QZWA 3K80A 5IVXA 1U58A 1WAAE 3QQ3A 4FQXD 4U1IA 1QRNA 1KJMB 1N64H 4HUMB 4UT6H 3A6CH 2EDRA 2ZCKL 4LNRA 1BIIB 3VXRE 3CCHB 1PG7H 3GO1L 5F88A 5SWZE 3QXDB 2ZPKL 2C3XA 4X6DA 2VLLA 4OKVA 4NHCL 1N0XH 1KT2A 3RWIB 4DKFL 4DKAA 1AKJA 4OLEA 3P0YH 3FKUS 3MV7A 2DMCA 5FUCC 3RIAF 5I18L 2E7LC 3ZTJH 5D1QD 3LIZL 2P5WA 5I1JH 1MH5B 2CDGB 3AAZB 5HJ3A 4BUGA 2A77H 4MSWA 4P59L 2HVJB 7CGTA 3MXVL 1MF2L 1DCLA 1IGTA 1J12A 1MCLA 1AJ7H 4HWBH 2VLJD 3OZ9L 4RDQF 1BBJA 4Z7WE 3O4LB 4M1DL 1H5BA 2FO1A 4TTDC 5KVGH 2H2SD 5GJSL 1N6QL 1EO8H 2ZSWA 3B9KD 1WC7B 2GTZB 1A6AB 4OB5H 3GMPA 4JQXC 3CUPA 2VLME 4JHAH 3SE3A 2GK0B 1FNAA 4JFEE 3WHE0 1ZMYA 2OMBA 1SJXA 3PIQB 2WANA 3HAEG 2P8LA 3S3JA 4OZIF 2BOCA 2CLRA 1AXTL 5DR5L 3ULVH 4ZS7L 4F9LA 1HHGB 3ARGC 1JTTA 4LHUG 3LOWA 5FYKD 4I5BA 1TVBA 5ALCL 4P2QD 1A2YB 3MBED 3FRUB 5FGCE 4YIQB 1OOAA 2EKJA 4DN4H 4NOBA 5D7IE 1LD9B 3ARGB 4N8VB 4UIMA 4DOHE 3N1PC 2ZG2A 1KCRH 4OD3H 3H9ZA 5I1GH 3QZWB 5EA0L 5C7XL 4CKVX 3PP3K 4S0TD 5IVXB 1U58B 3QQ3B 5F7FA 1QFUL 2PW2A 5F97E 4LVOC 4U1IB 5MHSE 1QRNB 3L1OL 4Y2DD 5CKGA 2I24N 1N8ZA 4LNRB 4HJ0D 5DF0A 2D2OA 4LVOB 3DYOA 1Z9SA 5F88B 4HWEH 2EH7L 3STZA 1G9MC 4X6DB 2VLLB 4OKVB 1KT2B 4KVCH 3SDXE 3OAZH 1AKJB 1DQTA 3MV7B 3IFNH 3FHAA 4OIIH 2P5WB 4P49A 5CUSL 4A6YH 3U9PL 5D96C 1CZ8L 5HJ3B 1MHHA 2YA2A 3V52L 5K59E 1BM3L 4MSWB 3FQXA 4N0FB 4HGKC 4HX1B 5IIEA 2HFEA 4I9WD 1U92A 1H5BC 2OQJA 1IGTB 5A2IH 1DBJL 1N5AA 1O5DT 4AYFA 1UADC 1BBJB 3JVGC 3MSPA 5JXEC 1GRWA 5T5FH 1IEBB 1A02N 1H5BB 4M62H 4BZ2H 4TVPD 4YHML 1BQLH 2YKLH 4IOSD 2ZSWB 1ZGLM 4K94C 4JVPA 4PGBA 5T3XH 3FB7A 2WINA 1TJGL 3CUPB 1D6VH 4M7JL 5HGHA 4F9LC 4R7DA 4RBPK 3QJFB 4L3CA 5DQ9A 2CRZA 2P8LB 5ISZE 2Y7QA 2BOCB 3WO4C 2CLRB 1K9TA 5FOBA 4NKIH 4ONOA 4D9QE 1YEGL 4F58H 1NGQH 2PYEE 2EXWD 2QSCH 3MGTA 2DQIL 4I5BB 1RY7B 2HKFH 1TVBB 2EE2A 3WO4B 5AEAA 5JW3H 1F4WL 2OJZL 3ZDYE 3SE4A 4UIMB 2Y36L 1ZHNA 3HNVH 3WHE1 5JUEH 1CTNA 2F5AH 3V0WH 4X6FA 1XMWA 1YNTA 1CLZL 1OY3B 4Q97A 1JHTA 1FIGH 4OFDA 3RGVD 3L3IA 3MOAL 4X4YA 1V8HA 3MACH 5CD5C 2DQGH 2YMXH 4LMQE 4PB0L 1EHXA 2PW2B 5CJOL 1NAMH 4XBPA 4PRAA 4ENED 5DA0B 3SDAD 4D0DA 4KKNA 4U05A 1N8ZB 2BXZA 4X7SH 1MWAA 2R0ZH 4JFDB 5LQBH 3STZB 1JWSA 4JPVL 2DQEH 4KPHH 1BF2A 1H8OA 5EIVA 3SE9H 3S37X 3ZL4H 3GMLA 4S2SB 1CDUA 1Q9KA 2BVEA 1KJ2L 1MHHB 4WO4A 2D7MA 1SBSH 1GVIA 3RHWF 3FQXB 3UPCA 1YMMD 1G9NC 1MQKL 2F5BH 3SQOL 1FZOA 4FXKB 5IIEB 3QXVA 1U92B 4PJ7E 3FOMA 1N5AB 2BRRH 2IQ9L 1UH4A 1MRFH 3FHQA 2NTSP 3TCLA 5T1LD 2R0LL 1N7ML 2B0SL 1QKZH 2BVYA 2MQCA 4OCLC 2YPLD 1FFOA 3TVMD 2ED7A 1TNNA 1A64A 4PGBB 4PLKD 4UT9H 1JMXA 5HDLA 3QIBD 5F7DA 4IRJD 4FG6D 1BIHA 5HGHB 4R7DB 3ABZA 4L3CB 5DQ9B 2XN9A 2C1OA 2QSQA 3GNMH 5D1QA 2J8OA 3QUYC 1Q72H 4L3ED 2Y7QB 3GM8A 2ZUUA 3NIGE 3SE4C 2AQ1A 3MGTB 2HT4D 1ONQA 2X4TA 3MX0A 4E41E 2VLJA 1UYWL 1MCOL 3GIVA 1ZHNB 5IBTH 3S6CA 2Z8VC 5T33H 4X6FB 1YNTB 1JZ3A 1JHTB 5E9DE 2V5MA 4WCYL 4DKFH 4DUWA 5F70A 3V8OA 2AEQH 4OLWL 5CGTA 4X4YB 3QDJD 1MCPL 3VGGA 3QHTC 3RVVC 3WSQH 3B9KA 1M4KA 4PJDF 3DSFL 4LGSB 1K6QH 4XBPB 4PRAB 4HCRH 4M43H 4D0DB 5AYUH 3PP4L 4P59H 1I8MA 2R2BA 5E99H 1CR9H 4QWWD 1AI1L 3OJ2C 1XH3A 1MWAB 2XIDA 2R1XA 4WNQA 5D2NE 2WIMA 5I19L 1JWSB 1HHJA 4PYHA 6FABH 3ZKMD 4WO4C 5C71A 3MBEA 5GSRA 4H8WL 1CGVA 5BXFA 1XR9A 3GMLB 3E3QE 1Q9KB 1X5LA 5EO9A 1EEQA 3ZYIA 1FJ1A 2LU3A 2E9JA 4WO4B 1NLBH 2W9DH 1FZOB 2EXYC 2YUVA 2P24A 3FOMB 4OF7A 5D8JL 4R4FL 2OR8A 1R3JA 1A6VH 4Y2DA 3QEUA 4ZS7H 2Y23A 4PG9A 3TCLB 3ZHLA 5SWZD 1VGEH 4P46C 1CQKA 4U0QB 1FFOB 4TULL 1FNFA 1IC4H 4P99A 3MV01 3S35H 2RJMA 5F7DB 3FZUC 5GS0L 3HLAA 1RZKL 4P46B 1NAKL 4LVEA 3RUGF 2XN9B 2C1OB 5IJVA 2FEDD 2VZVA 4Q9RH 1R3LB 1MCSA 1FO0B 1ADQA 3DMMC 3FN0L 1JN6A 4PGDA 5DC4B 3M8OL 3GB7A 1ONQB 1I1AD 1QFHA 3RU8L 2X4TB 3QUMH 2WW8A 5ESQA 4LEXH 3PGCA 2VLJB 1CXKA 3G5YA 4I2XE 3GIVB 4Q58C 1AQKH 5TFSL 4OD1L 5CBAA 4NCDA 4KHXH 3WXVL 4Q9BA 2IADA 3VWKD 2ZP0T 1QSEE 3B9KB 1YEFL 5GIRA 1P1ZA 2VXUH 2N4IA 3U7WL 1J86A 4J3TA 3VXSA 2LVCA 3M07A 3NA9H 2VO5A 3U9PH 1YMHA 4PLJC 2X1WL 3QG6A 5FUOH 4JGUA 5D7JD 4E5XA 2R2BB 1I8MB 1B4JH 3RAJH 4UQ3A 1P4LA 5JHDE 1XH3B 5ILTL 2R1XB 4WNQB 4G6AC 5KSBA 1HHJB 3B6SA 4KZDH 3I50L 4X5LA 4I3GA 3AGVA 4AK1A 3MBEB 5GSRB 1HXMA 4OCWL 2YBRA 5BXFB 3IDUA 4R6UA 4Q6IA 5F7KC 3RY4A 3L3JA 5EO9B 3RX5A 3U2SA 3RFZC 1FJ1B 1FGVH 4F33A 4Y2DC 3IDGA 4M7JH 3DX6A 5MHSD 1NFDA 4JPIB 2P24B 1Q0YH 3VG9C 3VCLA 1R3JB 2VSDA 3JTSA 4Y2DB 4LRNH 5D1ZA 3QEUB 4BFEA 4PG9B 2DIAA 1XEDA 3GSNH 1IQWH 3TLRA 3VG9B 3BPNC 1MCCA 1A7NH 1EBAA 2XV6B 4GT7A 1F4WH 1MAJA 2APBA 4MJIE 3U6RA 2J12B 1HHHA 2Y36H 1GHFL 3HLAB 4K8RH 3BPNB 2DBLH 5FYKL 4IMKA 1SVCP 4JKWA 5IJVB 3O2WH 4LQ1A 3GKZA 4GG8A 4X4ME 5CJOH 1D5XA 1U8JA 1MJJA 4X6CF 1JN6B 1YMMA 3HNSL 2DRUA 3GB7B 3T65A 3QG7L 2XG4A 6CGTA 5I74C 3BH9A 3HI5H 4YQXH 2WWKO 5ESQB 3PGCB 3G5YB 1RUAL 3BIAX 4MA3A 1U36A 1MCWW 2Y5TA 4ONFH 5J89A 1KCUL 5I74B 5E8EA 5CBAB 2EECA 1MELA 4OCSL 2IADB 5HVWA 5T3XD 2YWZA 3BDYH 1P1ZB 5GIRB 1A9BA 3VXSB 4NZRL 4XMKH 1YMHB 2Y06H 5IBLC 5D7LA 3QG6B 2VDLL 3TH2T 1G1CA 4DN3H 3LZFH 4D9QD 4N1EA 5DI8A 4E5XB 2PYED 1GGIL 4UQ3B 1P4LB 1V3MA 3E0GA 1X5XA 3BMWA 4Q6IC 2DICA 4HS6A 5KSBB 3KVQA 3B6SB 4JPWH 4QEGA 2NX5E 5BV7L 1EFXD 1E0OB 2EC9U 3MCG1 5DVLA 5A40E 4J3WA 4LQFH 1HXMB 2YBRB 3T0EE 1PKQE 4Q6IB 2CKBA 1KCVL 3L3JB 3MLYH 3U2SB 2XA8L 1BWMA 3CSYA 5D6DA 4G3YL 5D1ZC 1IKNA 3VXPA 3DX6B 5CHNA 4AT6A 4U7MA 1NFDB 4BQCA 1D5MA 1YEIL 3QDJA 1S7VA 4ELKA 4P5KA 4N8PA 3VCLB 2EO1A 3JTSB 5D1ZB 4HDIA 3VWJD 2EEDA 4GG6A 1BX2A 3L5WB 4OFKA 1FNSL 2DLIA 4IMKC 1NGXA 4OI9A 3U6RB 3WFEH 1EERB 1YJDL 1B6UA 1HHHB 5FB8A 4LVHC 4C56E 3K2UL 5I73C 1WWCA 1UJ3C 3N1FC 1CFQA 2UY7A 5IFHH 1IBGL 4GG8B 1ZHBA 1D5XB 1U8JB 4LVHB 4RMRA 5GGTH 4B7IA 5B3JE 4IHOA 1YC7A 1YMMB 4UTBH 3WBDA 4EDWH 1BGXH 5I73B 4HGWA 3T65B 1JYXA 1S5IL 3QDGE 3KPRA 4NNXA 3BH9B 3CFDA 4NJ9H 4ERSH 1W0YT 4Y2OA 4MA3B 4ZFGH 2Y5TB 4GFTB 3PWNA 1KXQE 1MPAL 5SWZA 4NC1C 1M7XA 5E8EB 4FG6C 4DGIL 4DTGH 5FHAL 5JZ7C 3DBXA 3C2SA 3KYNA 3H8NA 1PG7X 1VFBB 2QHRH 3U0TA 1A9BB 2ADFL 3AREA 2X4SA 5D7LB 4QOKA 1DN2A 1KUMA 5DI8B 3X3GH 1OTSD 3OAZK 4YDLB 2HH0L 2BSRA 1LO0L 1Z9OA 5FUZH 3R06A 5JW4Q 4HS6B 1ZVHA 2VSCA 1INEL 2RAMA 5E2UH 4MHHG 5D6DC 2H8PA 3BWAA 4G8GE 4HWBA 4Z7WA 1IKNC 5KVMC 4U0RB 2CKBB 4I3RL 3IFLL 1F58H 4HKZA 3JWNC 4TULH 5C6PB 5E9DD 3LPWA 4G9FA 3N06B 3CSYB 2ZKHH 5DMYA 3VXPB 2AXFA 5CHNB 4XCYA 4AT6B 4AL8L 1D5MB 3QDJB 4XPAH 1S7VB 4ELKB 4P5KB 5F1KC 3DHMA 1CG9A 1NH6A 4ACPA 2CK2A 4J3VA 1OAUL 4A2MA 1UA6H 4KKBD 4HEME 4KDWA 3ZKMC 4HDIB 3MXWL 3LKSA 4KI5E 3L3DA 3T1WA 4GG6B 1BX2B 3CX5J 4O9HH 1OAZL 2GSIA 4IEFB 1NGXB 4G6MH 3VGHA 4MQSB 3T8XB 5FB8B 4ZODA 3QDHA 4PRHE 1OLLA 2FGWH 4X80H 3KLSA 1CFQB 2BJMH 1DDHA 4M5YL 3C87A 1ZHBB 4LSPH 5IOPB 4KJYA 5KOMC 3QEGH 4HGWB 5A1AA 1IARB 4OZFG 1JNLL 1HWGB 3KPRB 4NNXB 4XVUC 3CFDB 1CXEA 5ILTH 5EO1B 2R1WB 4MNQA 3PWNB 4WW2F 4U1KA 12E8L 4YXHH 4FQLL 4TPRH 4L5FH 3AREC 3B3IA 3DBXB 1J1PH 3KYNB 1CIDA 2Z8RA 1QR1A 3SDXA 4CVUA 4XMPL 1V7NH 4MVBD 3U0TB 4DEPB 5CZVL 3AREB 2X4SB 4QOKB 1FVDB 3V5DA 2R29L 4JFZL 4ZTPH 1TJHH 3R06B 2AW2A 1HYSC 4WFED 2VR4A 1EZVX 4G6FD 1DL7L 4OZHF 3MFGB 2H8PB 3OB0H 3BWAB 3GBMH 4DK3A 4Z7WB 1TVDA 2YA1A 4D3CH 2G2RA 3VDBA 1J5OL 3ALXA 1UH2A 3RBGA 2NZIA 1E6JL 3G6DH 4G9FB 4ORZC 5JW5A 3I6KA 1T1WA 2A9ML 1OQXA 3NAAL 1QSED 2C3WA 5AWNH 2X1OA 3JSSA 1NSNL 1LP9E 3QUZD 1NC2D 4F7MA 1CG9B 4OF8A 3ULVC 5I76A 3WIIL 1BEYH 1EEUA 1F90L 3DLQR 5JHDD 3K2MC 4PJXE 3LPFA 4HK0A 2PYEA 4QRSA 3QG7H 3LKSB 4JM4L 2X5PA 5H35A 2GSIB 4F15C 2CGRH 2DQJL 1KTLA 2AERT 2AEPH 1Z2KA 3IS0X 1C16A 1QG3A 3SY0A 4KQ4L 2AK4E 1DQJA 2VITA 2F8XC 2WUCH 4F15B 1DDHB 1NLDL 1VCAA 3ZE0F 2NY4D 3F8UB 4U3XA 5HI4C 1T7VA 1U95A 4KJYB 4M48H 1NMCC 4NWUL 1NAMA 1KGCE 3T3PF 5JQ6H 1MRDL 4EJ1C 4M6ML 1NBYA 4JR9L 4LSDA 4MNQB 3ZSSA 2OL3H 5E00A 1ES0A 5EZIL 2EDBA 3VWJA 4FZ8L 3B3IB 1F97A 3O6LH 4LIQE 1G9EA 1QR1B 1BQHA 3SDXB 2GJ6E 1HK6A 4YHOH 4HV8A 5DK0A 2GHWB 1MQ8A 3QBTB 4JO1L 2OP4L 4MB4A 5JIPA 1MJUL 4P0DA 5HHPA 3V5DB 4QNPE 2G9HA 1BECA 4A6YB 2QQLH 1G1YA 2BFVL 3QCTL 2NY3D 4PJ7A 1L6ZA 1I7TA 1LE9A 4YHZL 1JZ8A 5L9DL 3HN3A 1OP9A 2G2RB 2OMNA 2GFBA 4HG4J 3OKDA 3VXMA 2ICES 5JW5B 4LCIL 3I6KB 1T1WB 2R39A 1J0YA 3T2QA 3WEXB 5CLWA 1UACL 5IT2L 4ELMF 3KYMA 4TNWK 3KLHD 1A5FH 3K2UH 8CGTA 2DLHA 1W0VA 4XC3H 1DQQA 4F7MB 4YPGA 4Y5XA 5I76B 2FHBA 1K3IA 3WYRA 3CD4A 4GH7B 4NKDA 2BHUA 4HK0B 4QRSB 3DUUA 3QWRD 4Z7VE 1BJMA 2AGJL 4NM4L 1BMGA 2NX5D 2AJ3A 2CPCA 5H35B 3P4MA 4HXAL 3SKUD 3H9HA 5EUOE 3OF6A 5JR1L 1MPAH 1RULL 5GRJL 3SY0B 1DQJB 2VITB 4HAGA 5K9KA 5E9DA 1DVFC 5DURD 1YYMH 1FNEA 4RFNC 4AG4L 1U95B 2ADFH 1T20B 5E8NA 4TOYH 4FRWA 1QNZH 2OSLB 4NCC1 2YOCA 2OXHA 4F7TB 1NAMB 4M6NL 5DLMH 3VWJC 2F19H 1ZANL 4HCRA 4NYLA 3ZDZE 4W6WB 3O6KH 1NBYB 2COQA 3EZJB 5CJ8A 5D5MF 5JLZA 1WBZB 5E00B 1ES0B 4FQJL 4OV5A 1ZSDA 4XWOD 4ZD3L 1DQLH 3MRKA 4KKAC 3VWJB 2B4CH 3QFDA 2IH3A 3EOBB 1WJ3A 3BIBX 2V17H 3B2UD 4G6JH 5HI5D 4HV8B 5DK0B 4C56D 4V2BA 5E2VL 4XNQA 5CIPH 1I3GL 1ZLUK 1RUMH 4LFHG 4NIKB 3SOBL 3QCUH 5DD3L 5IM7A 5HHPB 2CIIA 2G9HB 3PNWA 3HI6L 3VW3H 1OPGH 2FEEL 1EK3A 1LK3L 1F3DJ 4W4NA 4PJ7B 3OR7A 3EYUH 1I7TB 1LE9B 4YHYC 4J3UA 5DZNA 1CE1L 4PJAE 4Z0BL 2GFBB 3MJ6A 3MYZA 4O2EA 3OKDB 2FR4A 2Z91A 4PRIE 3VXMB 3PQYE 2LVEA 4YHYB 3FB6A 2J88L 3KYMB 3BZ4A 3MLVH 1W0VB 5LXGL 1DQQB 4YPGB 1HDMA 3K4AA 3GI8H 4PRPE 2DYPD 2A6IA 1ZT1A 4N5EC 4HIJA 5B39G 4NKDB 5KW9L 3DUUB 4LSRL 4K3EH 2AJ3B 4X9FA 4OZIA 1D9KA 3P4MB 2CH8A 4KTYA 4FABL 5CGYC 3IT8D 4G8GD 3H9HB 4M61A 3V79C 1JPTL 1LVEA 1CLYH 3GSQA 3QUMA 4FQLH 3THML 3QEHA 3SPVA 5K9KB 5E9DB 4KI1A 4ZNEE 1FNEB 1KELL 5IMLA 1OAKL 3SDCD 5E8NB 2Q87A 4I3SH 2EH8L 3BP5B 1IRAY 3SGDH 4MMZC 3MRIA 3DGGA 1JWUA 1NC2A 3NTCL 4IMLA 2MJWA 4MAUH 4NYLB 1Z9LA 3EO9L 4X9GA 4LPXA 4NCC2 2XWJA 4KI5D 1G7LA 4OV5B 2JB6A 1ZSDB 4P2RA 1CF8H 3MRKB 3QFDB 2IH3B 1C7SA 2BERA 1S7RA 4JO2L 4ODWA 3U4BH 4BQBA 1T0NA 2YS4A 1L0XA 4RMVA 3EJYC 4XNQB 2E3VA 5EORL 4KK5C 4YBQC 5IM7B 1UCBL 2CIIB 2GI7A 3PNWB 1MFEH 2FLBT 4BSWA 4K07A 3GEWB 4RAUA 2A74A 2DWDB 3OR7B 2Y4SA 2C4XA 1YQVH 2A0LC 3TT3L 4YWGL 2VDPL 1P84J 1TMCB 4O2EB 3RHWK 1CDBA 2FR4B 2Z91B 4YFLI 4PY7A 2XQYG 1FNHA 3GSNA 3ROLB 4MVBC 1ZTXL 2VXVH 4LK4A 1C5BH 1HSAA 1UH3A 3IU3A 4M7LL 3VDCA 3LSOA 3FB6B 2BHYA 3QPQD 1WZ1H 4KQ4H 4MD4A 3RVXD 3BZ4B 3BD4A 1ZV5A 3LPGA 4XPTL 2X4NA 5IVNA 1HDMB 1WITA 5KS9F 3G6JE 1Q8MA 2A6IB 1D9KC 1T6WA 1ZT1B 3RRQA 3RZCA 3GJEA 4X4MA 2ED8A 5FO7A 1UGNA 2K7PA 4P2CG 1OT1A 1NKRA 4OZIB 1D9KB 1WEJH 5TGBA 4MD5A 1CDGA 1FL5A 4M61B 4AY0A 5EZIH 3GSQB 4RX4D 3QUMB 3FT4A 5E2TL 3QEHB 3D87B 3GMOA 4QYOA 2AJYL 3SPVB 1XIWD 1FLRL 4J4PD 1SBBA 4HBQA 1G7PB 3MLZH 1EDQA 1N6UA 5DJYB 2GEEA 3BN9C 4JO1H 4YX2L 5IMLB 3AUVA 5EWIL 3MRIB 4RGOL 4YJZL 4BFGA 4AH2A 3DGGB 1JWUB 1NC2B 4IMLB 1C5CH 4GMSL 3FMGL 1MEXH 2XWJB 3FQWA 5HI3D 1G7LB 2R2EA 5E6ID 2JB6B 5GHWH 3E8UL 4P2RB 3ZKQD 3DRQA 3QWRA 4FTVE 4XCCH 4NFBA 2RCSH 1VERA 3L3OA 5LGKA 3MLRL 1S7RB 4ODWB 3HC3L 1T0NB 4GXVL 1NJ9A 5F7EH 3CVHL 2AK4D 2PR4H 5E5MA 2JCCE 5J12B 1V7ML 2ZJSL 1NUFA 3N1QC 4HUKB 2XRAL 1GH7A 4UU9A 4BSWB 4RAUB 3BESR 3GRWH 1H3WM 2A74B 5GZND 3PHQA 3OR6A 1H15A 4OM1L 4NFDA 3RZWA 2ATPA 4U2YA 1YYLH 1P4IL 5GRVK 3NH7H 1EAJA 2Q8BL 2AEWA 1GOGA 4CVZA 2AGJH 4XNYH 3GSNB 2UVFA 1J0HA 1HHKA 4N8VG 4K8RC 2GJ6D 2UUDH 5D6CA 1F4HA 1HSAB 5JR1H 2VTFA 3LSOB 3RZCC 1WSST 4MD4B 2VIRA 2RQ8A 4WI5A 3KJ6L 1HOCA 5M7QA 4Q7DA 5HGBA 4MNGA 3REWA 2H2PD 1JPSL 2EDDA 2X4NB 4KUZL 2D7QA 4P5TD 1DBKL 3RZCB 3GJEB 1A3RH 5FO7B 5HY9A 3PXJA 1X4XA 5HSFA 1MJ8L 2YK1H 5GGTA 5DUPH 5TGBB 2YSSA 3MRFA 4MD5B 3AC0A 4GRLA 1FL5B 1IC7H 5FM5O 4XX1G 2V5TA 3FT4B 3ELAT 3VGAC 4ZD3H 4Y1AE 5KVEH 3GMOB 4QYOB 1DE4A 3WFDL 2AJZA 1LQSR 4OQTH 5K9JH 3SGEI 3VXUE 1H3PL 5JO5A 1TXKA 1MJ7L 3T4YA 3C8HA 5EBGA 3VGAB 2ORBH 5I1LA 3T2OA 3BHBB 4R26H 4JKPH 1MCIA 4PJEE 4AH2B 1LHZA 2NY6C 5GGUA 3V6OC 5DD5L 4N0UE 3OKNA 2DYPA 3P77A 3TJHC 4OF6A 3FQWB 3EUUA 1KEGL 2R2EB 4RMTA 1EFQA 4OGAC 2ZUTA 3BDXA 1DR9A 5DK3A 3DRQB 4KJWC 1ZKAA 4Z0BH 1L4IA 4HWUA 5DUMH 4PS4L 1ITCA 2C5DC 1NJ9B 4G8GA 4XNMA 1FRGL 5E5MB 2CKNA 1EMTL 5HVGB 3KPSE 3BGAA 3LKNA 1RVFL 3H42L 1X3DA 4X6BB 1PJ9A 4M7KL 4GMTH 4UU9B 3VD4A 3MRQA 4DWHA 3F58H 5DURB 3J8F7 2IBBA 4CNIA 4X7TA 3PHQB 3OR6B 1H15B 3CDGA 3HZMA 4W68A 5INDA 5E08L 2BSTA 2ATPB 4XWOC 3MV8A 5DEGA 5BVJA 5D4QA 4OCMC 2FB4L 3ILPA 4P9HL 4G5ZH 4CVZB 4HUUA 3IKKA 5BZDA 1U3ZA 2BY2A 1HHKB 4YNYA 3I6GA 4KMLB 4GAJL 4NQUA 1KACB 4S1RH 5FA4A 4JLRB 4WIQA 1E27A 2XYCA 1JHLL 1HOCB 5HGBB 5C3LD 3HE7C 4MNGB 3REWB 4JN2A 3EJJX 1OAKH 2BVQA 4GRLC 3UDWC 1AY1L 3HE7B 5HY9B 3RUGA 1ZLVH 4G80A 3FOLA 1G6RH 4PJBF 4XPBL 2YSSB 3MRFB 3EO9H 2E7BA 4GRLB 1IAKA 4HGMA 3BRGC 1TZHA 4WEUD 1S8DA 4PRID 1XCTA 3PQYD 4UUJA 3VMNA 5HD8D 1CK0H 1DE4B 2KQNA 2AJZB 1VADA 3F7VA 3UZQA 2AI0H 5JO5B 4X4ZA 3T4YB 4FMKA 5F7WC 3RKPA 4YDKH 5I1LB 3T0VA 4O2CA 4LP5A 1A7QH 3H7BA 1IQDA 1DN0A 1TIUA 3H3PL 3V0VA 3CFCH 4PRPD 5GGUB 2E8YA 2OR9L 4K55A 1X5ZA 1L7IL 3OKNB 5FA3A 4PJDB 4MZ3A 2DYPB 3C8KA 3P77B 1GAFH 5FHBH 5TPWH 1UC6A 2BRQA 4JM2C 4I0PC 3TT3H 2AJVL 2JELH 3JUYA 1EXUA 4IDLA 2VDPH 1GXEA 1DBBL 4XPFH 5ACZA 1NGYA 4G8GB 4X83A 4JKKA 4XNMB 2ENSA 2R8SL 3PG2A 3UTTA 4QRPB 4RX4A 1VFMA 3LKNB 4IIQA 1KJVA 4F7EA 2Y6SC 5C0GA 3UJTL 3MRQB 1H3TA 4PJCF 5CLTA 4CNIB 4X7TB 3CDGB 2AJXL 4RIRB 3HZMB 3VG0L 4WW1A 5INDB 2F53B 2BSTB 3NABH 3OJMB 2D7OA 1P6FA 4AM0A 3MV8B 5D1XD 5DEGB 5BVJB 2F15A 3LHPH 5BRZA 3ILPB 4WI9A 3GSRA 1MCBA 4HUUB 5IQ7L 3UEZA 5BZDB 4FS0A 4IOIA 2I9LA 5I8EA 4YNYB 5EOCL 3I6GB 2X05A 4MXWH 5FA4B 5IMMA 4UINH 1E27B 2FJFA 2ADJA 4GKSA 4N9OB 4JN2B 4I77L 2AK4A 3WKML 4YX2H 3UP1A 2BVQB 5ICXA 5ACMA 4NQCE 5L2JA 4UQ2A 3BI9X 2DQTH 5EWIH 3L3KA 4BQ6A 3RUGB 5T5NF 4G80B 2QADD 3MREB 1F4XL 1X5GA 3FOLB 3UYRL 1TZGH 4HLJA 5GGSA 4KK9D 3FMGH 2GK2A 1IAKB 1YEHH 3I9GH 3VFGL 1TZHB 5LVEA 5DQDH 3MRMA 4X6CA 1HQ4A 4MDJA 1S8DB 1XCTB 5FIEA 1F2XK 3F7QA 4UUJB 2B2XH 3ZT6A 1K4DB 4NKMA 3CXDL 2OL3A 4Z5RA 5JORA 3F7VB 2X1PA 4R90L 1I1FA 1JGVL 1A1MA 2GJ6A 5C92A 2MQ0A 5EPMA 4O2CB 2A6DA 3H7BB 4P23D 1IQDB 1DN0B 2ZJSH 2OCFD 3V0VB 1GGYA 2WSKA 1LEKB 3IU4H 1RZFL 4B50A 5A3IC 5E7FA 5FA3B 5T1KD 3C8KB 1DQDH 3HC4H 3B9EA 2FH6A 5HVFB 4OM1H 1GZQA 3MRLA 5TJWK 1GGTA 1C1EL 4EUPH 4M9OA 1EXUB 1RQ5A 3EOTL 3HB3D 3MCLL 1INDL 2NY1D 4IIQC 1PSKL 4U3HA 2Q8BH 5T3ZE 1F6AA 5ACZB 1NGYB 4OIAA 3UTTB 5L6YL 3W82A 3CAFA 4IIQB 1KJVB 4F7EB 5JTWA 1OSPH 5C0GB 1T21A 1CFVH 2NPLX 3GBNH 4B7LA 3SGDI 4MXVF 1G7QA 1NGPL 4KUZH 4BH7A 2FD6H 3BP6A 5HHQB 3G08A 4WW1B 5B22A 1DBKH 1MFCL 1WGOA 4AM0B 2ENYA 4MMXC 1K3ZA 5BRZB 1T2JA 5DJDB 3GSRB 4DZ8A 4FTVD 1IGMH 4YE4H 4IOIB 1PVHA 3FQTA 5I8EB 3V7AG 2O93L 4N9GA 4NBXB 4LF3A 4EN3D 5IMMB 4HMEA 5HDBF 2FJFB 2ADJB 1VFOA 4GKSB 1YECH 5CINH 1A7RH 3OKLA 3KPLA 3W2DL 3B9DA 4PJIF 4WY7L 4X9HA 5ICXB 3CLEL 1J05A 5L2JB 1B0GB 2AJUH 4UQ2B 1F3RB 3O9WD 4Y4HD 3L3KB 4FZEH 5ELIA 3MGOB 3AU1A 3P11L 5H37H 1KCKA 5GGSB 1SYSA 1ZLWK 1TQCC 1FNGA 1VB9A 3HTLX 3MRMB 4X6CB 1HQ4B 4MDJB 1N5YL 2VC2L 3L5IA 4AEEA 5FYJU 3BT2L 2D7TH 4NKMB 2OL3B 3V6BR 4Z5RB 2B1HH 5JORB 3DI3B 1QFWL 1KN2L 5E1HB 1VHPA 1KPUA 1I1FB 4KTEH 1A1MB 3C6SA 4F8TA 5EPMB 1N6VA 2A6DB 5CS7A 3T09A 3CIQA 3H42H 5GPRA 5GGVH 1QBML 3A6OA 3FFCA 4DFHA 5CIPA 1U8IA 1RJZA 3ARBA 4LHQB 3LKRA 2PCPA 1BAFL 1OTUD 3LEXA 1GZQB 3MRLB 5E08H 2E6JA 3HUJE 3ZE1E 1A9EA 1BJ1H 1UZ6F 3B2VH 1F6AB 1YDPA 2BP3A 4ZUSA 5KVDH 4Y1AD 1KSRA 5JIKA 3Q6GL 5C0ND 4ZNCD 4FFYH 4UB0L 3VXUD 2DJ4A 3K8LA 4ZAKA 5E56A 1T21B 5DMGD 1G7QB 2DD8H 2FBJH 4JO4H 3ISWA 1AH1A 3ZTNH 1FSKC 2LQRA 4BH7B 3BP6B 4ZOAA 3O8XD 2X44D 4LIQL 2WBJD 2CMRH 1L7TL 3DETD 1CGSL 2IPTL 4DZ8B 2LE9A 2ZCHH 3DYPA 5GS2H 1FSKB 1FBIL 2JJSA 3NCCB 3FQTB 5IF0A 2BVPA 1RZ7L 4R4NC 4N9GB 4LF3B 3S4SA 4PJ5D 4GRWF 4O58L 1RFDL 4JG0L 4F3FA 3BP4A 4M6OH 5GRXG 2VQ1A 1DLFH 3KPSD 3WL9A 3BVNA 3OKLB 3KPLB 5M95B 3CVIH 3ZKSD 5EZOH 2HKHL 3UMTA 5D93C 5DDHA 1J05B 4MQ7A 1MCDA 3VXOA 3AB0C 5CEXA 2BVOA 3GMNA 4U49A 2IJ0C 5F9AC 3TBTA 1I9JL 3AU1B 4PJGE 1L9MA 4UDTA 1SYSB 5D93B 1FNGB 1R3HA 3AB0B 2L4OA 2FBOJ 4XXDA 2B4CC 4NZTH 5D1XA 2CRYA 4L1DA 1TPXB 2AJVH 4NN5C 5I30H 1F4AA 1KPUB 3ARBC 2R8SH 3C6SB 4OF0A 5FK9A 4C58B 4WUUD 4B41A 4NN5B 3FFCB 4K9EH 2D9CA 2QBWA 5CIPB 1MSPA 1U8IB 1RJZB 3ARBB 3MZGB 3LKRB 2PCPB 5D7SL 1JPFA 3LEXB 2AJXH 3BEVA 5SX4H 2VLRE 4EOWL 1QLRA 4JRWA 4JGMA 4QGTA 1A9EB 5CEZL 5JW4R 2H1PH 4U1JA 4ZAKC 4YUEH 3WNNA 4NQVA 1YDPB 4ZUSB 5IQ7H 3I3EA 1JL8A 3GZKA 1GSMA 2XICA 1HIMH 1KFAH 3KYKH 3PXHA 4OZHA 2QQKL 4GKZA 3BKCL 4ZAKB 1F2QA 2WIIA 3TM6A 5IJKC 4TSBL 4ZUWA 35C8L 2ICCA 2AABL 3UTZA 2FEEI 2IALA 2JJSC 4P23A 3KDMA 3QO1A 2UUDK 4M8VA 3VH8A 4W70A 2VR5A 2FWOA 3CLFH 1FFNA 2BY0A 4XBEH 4LMQI 4XNXL 5T1KA 5C0EB 1UM5L 1MIML 2DQCH 2FX8H 1K8DB 4U31A 5IF0B 2BVPB 4CBPA 2YR3A 4JCMA 3IDYC 3S4SB 1WISA 4F3FB 3BP4B 1GGBL 2VQ1B 5I6XC 2BVUA 3WL9B 3U0WH 5L8LB 2VABA 3BVNB 3OKEB 1J1XL 5BVPL 3HE6A 3L7FA 4JN1L 3IDYB 4LSTL 1I8LC 5DDHB 5DJCA 4MQ7B 4QO1A 5CEXB 3TO4D 1X44A 5I6XB 5C70A 3GMNB 2Q1EA 5F71A 5AZ2H 2AXGA 4X5XA 1A8JH 5D1XC 3TBTB 4O5LH 3TWCL 1RIHL 4UDTB 4ODTL 5C0JA 1IAMA 1R3HB 1SEQH 2HLFD 5FOJA 4HK3N 4XXDB 1YPZE 2VDMH 2KZWA 2XTLA 4WW2C 5D1XB 5EBMA 4OLYH 2H41A 1L0YA 1F5WA 4WVRA 1Z9MA 5DT1L 3TO2A 1CXIA 4WWKD 3RWFA 2ITDB 3K0WA 2Q8AL 4WW2B 5M94B 3KPPA 2HFTA 5FK9B 3D1MC 1RUQH 3HMXH 3PABA 4G6KH 4YK4C 3VGBA 3F7RA 2X9WA 1AE6L 3T2NL 4NQCD 2QADC 1VFAA 3VD5A 4XCEA 3BKJH 2HRPH 1A1OA 1JPFB 2ZCLH 4HEPG 1R6VA 1UM4L 2OI9C 4YK4B 3WJLA 1QLRB 3SEPA 2FL5A 3BEWA 2QADB 2BMKA 3GRWA 4PGZA 4N8CL 4U1JB 1CYGA 1A47A 2W1NA 4NQVB 2DLTA 1OHQA 2Z92A 2OI9B 1OB1A 4DQOH 1NMAH 3NFSL 4OZHB 1JF1A 4GKZB 4M5ZL 1M6OA 2WIIB 3T0XA 4ZUWB 5I1CH 4Y5YA 4UTAL 3UTZB 5IWLA 2UZIL 4TVSa 2IMNA 3N9GL 2IALB 3CLEH 4P23B 1UXSA 3KDMB 4ELMA 3VH8B 3INUL 5J0BA 4LPYA 2FWOB 1T6VN 1FFNB 2H32H 2VDNL 3QA3B 2F8OA 4GQ9L 3HB3C 5GISH 5T1KB 2IANA 3P11H 4BSVB 2O5YH 4PJ8C 3OHXA 5T3ZD 3HE6C 4MXQC 4YDIL 1MCKA 1D5IH 4JDTL 3TGXA 3D39A 3ARDD 2JJWA 1ZLVK 1AFVL 2OZ4L 4HSQA 3KWWA 1PYWA 2VABB 1J8KA 4PJ8B 3HE6B 2FGZA 5L2KA 3L7FB 3LV3A 5CKAA 3RIFF 5DJCB 5CZXD 3VJ6B 2BX5A 3VXUA 2NY7L 3FN3A 1EHLL 4OQTA 3WFCL 4LEOA 3ZTJG 4OT1L 2AXGB 4X5XB 3X11B 1CI5A 4C4KT 4AMKL 1ND0A 5C0JB 2XTJD 1FP5A 5ANMA 4N0UA 5HYQA 1CL7L 5EBMB 2XZCL 4ZDHA 2JK5A 4FN0A 1D6EA 1P7QA 3TO2B 4NO2A 2H3NA 3BPOC 4WEBH 4KK8D 1HEZA 3RWFB 3TH3T 3P0GB 3D3VE 5HBBA 4PV8A 5D5MA 3KPPB 4PJ5A 1VGKA 1CLOL 3N50A 5EBWA 4UB0H 1IM9D 3PABB 4OCYH 3BPOB 1ZLSL 3WJLC 3KPSA 3VA2C 3M1BA 4C54A 4PY8I 1RZJL 1EUTA 1U42A 4UNTA 4XCEB 4PJFF 2PKDA 4LU5L 5EU3B 1VEPA 4L29B 4LSVH 5F9OH 2QSTA 3G5VA 1LEGA 2FL5B 5IR1A 2CRIA 5EU7E 5GGSY 2BMKB 1ORSB 5I8KH 2W9EL 3CNKA 1OL0A 1WWWX 2Z92B 3HRZA 1ZGLP 4Y5YC 3SDDA 1OB1B 4JO3H 4OFIA 2F54A 4UV7L 1RZ7H 5DD1L 1CTOA 5IWLC 3IJSA 1JF1B 4PR5A 1I3VA 1M6OB 2ED9A 1OAYL 3PV7A 4NO0A 4KY1H 1V05A 5HYSA 4Y5YB 4QGYA 4RRPG 1PDKA 3ULUF 1F02I 4OGZA 2C3VA 4GAGL 4WUUA 3GK8L 2DDQH 1UXSB 1FAIL 4ELMB 4G7VH 2EDQA 5TE6L 5J56B 1U6AH 4ZS6D 2HWZL 4MWFA 4JDZA 2IANB 5C08E 4OLUL 4D2NA 5J4MA 4ONGH 1OGAE 1A0QH 4GAYA 4MS8D 3RWEA 3D39B 3DURA 4L4VE 1G6RA 3RA7L 1RMFL 3OJDA 4AZ8A 1DBAL 3KWWB 1PYWB 4GRWH 5DMGC 1L9NA 2ZWLT 5L2KB 1FHGA 2DIJA 3LV3B 1OAQL 3MRPA 1W8NA 4MDIA 4K3JL 2BNQE 3R1GL 4LEOB 5KSAD 4UOJA 3UPRA 1HZHL 1IEAA 3FRPA 1ND0B 1KULA 5J7CC 5FKAB 2X7LA 1AQDA 1IC5H 1P4BH 4OLZH 4N0UB 5ANMB 5HYQB 3Q5YA 4EOWH 1BFOA 5AZEL 1SEBA 2VH5L 4YFDB 4ZDHB 2JK5B 3DX7A 4GSDL 1P7QB 5CEZH 3KAAA 2MPAH 4NO2B 2H3NB 4OCXL 1Z3GL 1HEZB 2N1KA 5GGQH 3EJZC 4PV8B 4W6XB 5D5MB 5LBSL 1SHMA 1KB5H 3DJ9A 1K4CA 4CADA 4PJ5B 1VGKB 5EBWB 3NACL 3LN4A 3KPSB 3M1BB 1SM3L 5JIHA 3PDOA 2W0FA 1J9CT 4ZPTA 2WUBH 4ZXBD 2R0KL 5FYLE 1YC8A 4LPWA 1EGJL 3G5VB 4KXZH 1LEGB 3TO4A 3SDDC 5IR1B 4NHUA 1D7FA 5FUCE 4LSSH 4NM8H 1N59A 1V3JA 3HRZB 3SGKA 4CRPA 4UV4H 3SDDB 2QQNH 9CGTA 2F54B 3IJSB 4PR5B 3ES6A 3NZHL 3VA6A 4NO0B 3CZFB 5LWYL 3O4LE 4KMTH 5KZCB 5HYSB 1YY9C 3MUY1 3S7GA 4PJHF 5BVPH 4LCWD 3KLAA 1GPOH 2C3VB 2A73A 4CJ1A 4WUUB 3W5NA 4YXLL 1G7HA 2AEIT 2VDKL 3T1FA 1A6WL 1Z6JT 1FGNL 4ZTOL 4MWFB 4JDZB 5IGXH 1PZUB 3EO1A 5KS9A 1NL0L 3NIFE 4XMLH 4LCCA 1VA9A 4GAYB 3RWEB 3LS5H 3DURB 1G6RB 4QXUH 4OCRL 2E27L 4YXKL 5E70A 3OJDB 2Q20A 5C0RL 5ITBL 4HPOL 4EBQH 3ZE2E 4B0MM 1BQHG 2VXQL 1DANU 2Q8AH 3MRPB 4ISVA 4TRPL 4MDIB 1NEZA 4P9MH 3MRJA 4XAWH 3UPRB 4X0KA 3F65A 4LNVA 1IEAB 1ZA3A 1U8QA 4U6HA 2Y1VA 3O3AA 4LOUD 5IVXE 4CUCA 2X7LB 4F7PB 1YY8A 4BZYA 3CFBA 5CJQL 4JFXA 1BFOB 1JPGA 1SEBB 1AGCA 1AGDA 3DX7B 4IRZL 5IQ9A 3BXNA 1WCQA 4EUPA 4HUWA 4WEMB 4NNYA 1K4CB 3SKMA 4CADB 4XX1E 1MOEA 4X6DE 4Z77A 5IB4A 3ARDA 2XFXA 4XNUL 3LN4B 3TO4C 4NP4H 2ZOLA 3HZKB 4OIBA 5ETUA 2P8MA 1KLFA 3PDOB 1R5IA 3MV7E 3QH3A 2W0FB 4OLXH 4ZPTB 5DD0H 2P5WE 1LK2A 5I0DA 3SGKC 3N9GH 3ZKXC 3TO4B 2IMMA 4NHUB 2FJHA 3OAUL 1KLUA 4QRTA 3I3DA 3TEUA 1N59B 4Y19A 3RNKA 3ZKXB 4Y4FA 5I15L 5H94A 4HKJA 5FYJH 4OZ4A 1UM6H 1F8TL 4U1LA 2BZDA 4ODVH 2JB5H 1MCJA 1MREL 4QRQA 2NY5L 4KRLB 3U0PA 3KLAB 2A73B 2WM0A 4LCCC 4S1SL 3EIFA 3FJTA 1HSBA 3V4VH 3T1FB 2VNCA 3L5HA 4L8BA 4KH2A 3BE1L 4OLVL 4OGXH 1ZA6A 1EX0A 3EO1B 3F12A 5KS9B 4LCCB 3O2VL 5DHVH 3GSVA 4BYHA 2AK1H 5IFJA 4R96A 3G9VA 3WUZA 5CILL 2MCPH 1MFBL 3CK0H 1BOGA 4P3DA 1KPRA 4U6VL 5EIIA 5AG8A 1LO3L 1VACA 1U8NA 4ISVB 4BFBD 1NEZB 4M1GH 3BKMH 3MRJB 4NZJA 4X0KB 2YA0A 1KB9J 3HG1A 1WLHA 4JCLA 1ZA3B 1U8QB 3DARA 2HTLC 3BYTA 4U6HB 5T1DL 1YY8B 4LU5H 4HS8L 3U9UA 3VFUB 2C7UA 3DOSA 1F13A 3GMRA 1JPGB 3GKWH 1AGCB 2X41A 1M71A 3P4NA 3ARDC 3U1SH 5E95B 2ICWI 4P2YA 3HUJA 5IQ9B 3T77A 3BXNB 2LU7A 4X8XA 1B2WH 4NRXA 3UJIL 2ZNWA 4EUPB 5I1HH 1IC1A 4HUWB 4JFDE 4NNYB 3IRPX 3SKMB 3MJ9H 1CT8A 2VR9A 1SYVA 4RDQG 4Z77B 5IB4B 2MNUA 3ARDB 2Z93A 2XFXB 2I60L 2J8UF 1OAYH 5I1EL 3RPIA 2AXJA 1CXHA 5ETUB 2P8MB 3Q2CA 1SY6L 1R5IB 4XVTL 3QH3B 4U6TA 3LQAH 3IDIA 1LK2B 2XTJC 4NKOA 2X4RA 3MO1A 4Y4FC 2GSGA 3S36L 2FJHB 1MHPL 1KLUB 4PG2C 4QRTB 1RUKH 4Y19B 4KV5E 2XTJB 4RWYL 3RNKB 4CDGC 3GHEH 2R9HC 4MB5A 1JE6A 4Y4FB 5H94B 4HKJB 5F21B 4OZ4B 3GFUA 2WQRA 4LAQH 4FHBD 4KROC 3PDDA 4U1LB 1Q1JL 3RA7H 2HP4A 1BLNA 1YNLL 4QRQB 3K4ZA 4KUCF 3U0PB 1NQBA 1X5HA 4KROB 1OAQH 4H88L 3ULUH 5T3ZL 2DI7A 1QFWM 1A14H 4L8BB 3SDYH 2I5YH 3X3FL 1ZA6B 3F12B 2ESVA 1VESA 3O6MH 2Y9RT 5F89A 1MAMH 1RAMA 3W0WD 4NZUL 1Q0XH 3D25A 3GSVB 4HH8A 5BO1L 5IFJB 4R96B 3NCFB 1BOGB 4H0HB 5FKPA 2O5ZL 2XWTA 1LO4H 1KPRB 5EIIB 2ITCA 1LDPL 3RVTC 1A6PA 3LS4H 1FORL 1NMBL 1U8NB 4ZFZA 3MLXH 2VXTL 3HG1B 1KG0A 1TZIA 5EIQA 3BD5A 4LCWA 4XP1L 5I1KH 3CFJA 3U9UB 1FPTH 2C7UB 2VKWA 3GMRB 4HULB 1UWEL 3WXWL 1AR1C 2JIXA 1B3JA 1M71B 1OGAD 5B38A 3P4NB 1GIGH 5SWQA 2HMID 3RVWD 4WTXA 4NNPL 4UIKL 4L4VD 3T77B 4HIXH 3LEYH 4K7PL 4UAOC 5E24E 3A0OA 5MENB 4R3SB 1M05A 1QFWI 3S37H 1L6XA 1CT8B 2UWEF 2VE6A 1E4KA 3MLWH 1SYVB 4FQ1L 5F1NA 2VDRH 4JQVC 3RPIB 4LDLB 2NXZC 3KHOA 4Z7OF 4UAOB 3ALWA 4OI7A 4HBCL 2BNQD 1OM3L 5C09A 3IDIB 4Z7QF 1J8HE 1U91B 4NKOB 2DLGA 4FNLL 2X4RB 3MO1B 5KTEL 2GSGB 3O11B 2HAZA 2NXZB 2IFFL 1IL1A 4HC1L 3TT1H 1ZEAH 5B4MD 2DI8A 4ZTOH 4PJCA 4H1LG 4WV1A 1NL0H 1JK8A 1MRCL 2VERN 5HDQL 4OCRH 1J18A 1BLNB 4ODSL 2KUTA 3ZLQC 2DWEA 4Q0XH 1GC1L 3QNXA 1F11A 4UOW0 3K46A 5L7XH 3IJYA 1HNGA 5DC0A 4C83A 4QF1A 5FYLD 4KKCC 1ZS8A 2XN9E 2ESVB 2EIEA 3MODL 3DWTA 5F89B 4P4KA 1XR8A 2E9WA 3D25B 3W39A 3DX9A 3RPKA 1KEML 3AY4A 3C2AH 4GUPB 5CJQH 4XP6L 5C0CA 5TDPA 1DFBL 4OM0L 4KZEH 2XWTB 4RGMC 4DKEH 2YZ1A 4WFFD 5I1IL 2ITCB 1IGFL 2QR0A 1X5AA 2XA3A 1M7DA 3O4LD 4B5EA 2VLJE 3QRGH 4G7YL 5JXAH 3MCKB 4ZFZB 3D9AH 4FQCH 4RGMB 3MLUL 4Z95H 4K9EC 3LEVH 1OF2A 1KG0B 1TZIB 1VENA 4LCWB 3ARFA 3UBXA 1PLGH 3CFJB 3HMXA 2VL4A 1HN1A 1MFAL 2IEPA 2EDYA 4PY8J 2JIXB 4XPGL 5B38B 1E4KC 1JNNL 5SWQB 1FFQA 1CIUA 1NCAL 1B90A 3BRDA 3DROA 1M05B 4KQ3L 1F8TH 2VE6B 4DVRH 4YZFE 4LARH 5F1NB 2P42B 2V5YA 5E8PA 3ARGD 4H25A 3HMWL 5TDOB 1EJOH 5C09B 2O5XH 4FFWC 2OM5A 4QHLA 4WI6A 2W92A 1PY9A 4WV1C 2XNAA 4S1SH 5D72H 4AEIL 1D3CA 1IZJA 1FZJA 1IL1B 1WVZA 1T7YA 4PJCB 2JTDA 1E28B 3FO0L 4WV1B 5C0AD 2CK0L 1JK8B 4ZPVA 5A2LH 5C8JA 1JZ2A 3SKJL 2CJUH 3DVIA 3O2VH 1KJ3L 2PW1B 2H32A 1WZKA 2ARJQ 5DEFA 4JG1H 2DWEB 4QTIH 3F62A 4P57A 3QNXB 1M7IA 1F11B 5DTFA 4HPYL 5IESH 1LO3H 2PYFA 3EDDA 1JRHL 5DWUL 4P4KC 3IJYB 3MV7D 2EC8A 4XP9H 4MJ6A 4YHKH 4C83B 4NQSA 4QF1B 5BS0A 2P5WD 2FO4A 2R0WH 5CSBA 1ZS8B 1KNOA 4GW4A 3CSPA 4P4KB 4JHBA 4PJIA 1XR8B 3F6LA 4ZFOA 5I17A 5EZJA 3W39B 3DX9B 1CBVH 3JWDL 5C0CB 4H20H 4HF5H 4XGZA 5TDPB 1FDLL 3QXTA 5CP7A 4UOW1 3C5ZA 4ALAH 3QFJA 1BWWA 1A4JA 3B8YA 5FYJD 1M7DB 4YHLH 2RR3A 3ARFC 3MOBL 3MC0A 7FABH 2NW3A 5K93A 2LAAA 1VFUA 4D8PA 5JXED 1OF2B 5D71L 4TVPE 3ZDXF 4JZNA 3ARFB 5IW3A 3UBXB 3QO0A 1KCSL 4JE4B 5K33A 3CMGA 4JQIH 1JUFA 3VXSE 5ESVA 3O81A 1UWXH 1CXFA 3ARXA 1JFQH 5L88H 3DO3A 3W0WA 4FQ2L 1U3YA 4EKXA 3DROB 3CMOL 1RU9L 3DUSB 2CUHA 2IBZX 5JNYA 1I4FA 5KSBE 3H9SA 4JJHA 4H25B 2IC2A 5HPMA 3SJVB 3H9YA 4D9LL 3BPCA 5CEYA 4Z76A 3TYGL 4QRUA 4XPHL 5C2BL 4QHLB 1BHGA 4OTXH 2XNAB 5BQ7A 1N4XL 1HI6B 2VDOL 2A1WL 1FZJB 1JMZA 1NFDE 2FNBA 3L3HA 2PUQT 3X3FH 4LPUA 1XGYL 2NLJA 5F44A 5CSZA 4ZPVB 3RDTD 1I85A 2DLEA 3B9AA 5TE4L 5F6HJ 4NZUH 3BSZL 2H32B 5BO1H 5FFLA 5DEFB 2DQDL 4JFDD 3T0WA 4L4VA 2VZUA 5ADOH 3ET9F 4LVNC 3QT2A 3JV6A 3WHXA 4P57B 1M7IB 5FGBC 5DTFB 2P48B 1JHKL 2QQQA 2IGFL 2PYFB 2HFGL 3JV5A 3B83A 4CW1A 2BK8A 4MJ6B 2X4QA 4LSQL 4NQSB 5BS0B 3ARYA 4LVNB 2FO4B 1E4XL 4Z7NF 4KJPC 2BNQA 1R3KA 3ZT7A 4GW4B 4XTRC 4XP1H 3C5ZC 4PJIB 2C3GA 4YHNB 4ZFOB 5I17B 3QXAA 3V7MA 5EZJB 1UB5A 3OGCA 3WXWH 1QSFA 1YMME 4X7DC 4XGZB 5CP7B 1AGBA 3C5ZB 4LDOB 5FXCH 3S3PA 3QFJB 2YPVL 1A4JB 1XGRA 2R69H 1RJLA 3K8MA 2ARJA 5DFVC 4BUHA 1OD9A 4A2LA 1TJIL 1JZ5A 1TQBC 1DBML 1YNKH 5DJ2A 4D8PB 3SO5A 1KB5A 3TIDA 4JZNB 1NKOA 3QO0B 1P7HL 3TPKA 1TQBB 3EAKA 1JUFB 4NC1E 5ESVB 1UEMA 1LO2L 5D7LE 4IOFC 4P5MA 2XQBH 3AAZA 2H6PA 2I26N 4NT6A 4NGHH 4F37F 3W0WB 4L8SA 4J6RL 4Y89A 3Q0HA 4DW2L 3QUYD 2X6MA 1T2QL 1MRCH 5JNYB 1I4FB 1KTDA 1ORQA 3H9SB 3A6BH 3S5LG 4XC1H 4HHAA 1GGCL 4WU5A 5HPMB 1RUPL 4DUVA 5DC9B 1FVEA 3BPCB 5CEYB 1FNLA 2D03L 2YD6A 1TFHA 4OZFH 1BREA 2DOCA 5BQ7B 3VI4F 1I85C 4QY8A 4DZBA 2LFGA 3A67L 3FO2A 5IV2A 1I7RA 3QPXH 3UO1L 2CLVA 3L3HB 3QDJE 1CE6A 5GGVY