4HZLA

Neutralizing antibody mab#8 in complex with the epitope ii of hcv e2 envelope protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
217
Chain Sequence
b'EVMLVESGGDLVKPGGSLKLPCAASGFTVSTYAMSWIRQTPEKRLEWVATISSGGSYTYYPDNVKGRFTISRDIAKNTLYLQMSSLRSEDTAMYYCARHPPTVVAGDAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
molecule tags Immune system
publication title Structural evidence for a bifurcated mode of action in the antibody-mediated neutralization of hepatitis C virus.
pubmed doi rcsb
total genus 43
structure length 217
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzlA01
5CHNA 3K2UL 2Y6SC 3W82A 4MYWB 4KI5C 4O9HL 1NBYB 3UBXB 3BEVA 1DE4A 2V5YA 1WWWX 1OTTD 1AXTH 5IVXE 1LO2H 1U8QA 3ALWA 3QIBD 1HYRC 1PZ5A 3CX5K 4H5SA 1EAJA 4D8PB 1OQXA 3MREB 4EI6B 1C12A 3MRQA 1CG9A 1AXIB 4MLIA 2R2EA 2WIMA 4I5BA 4POZC 3RL1B 3BO8A 4YH6A 5IB4B 2NPLX 3CUPA 3OKEA 3CVIH 5T3ZH 1MFAL 4K3EL 1MELA 4R90L 5F7FA 3U0WL 1G9MH 5F3HA 1YEHH 2BNQB 1INQB 2VB5A 4LF3B 2EDKA 3TZVC 1WBYA 1DBJH 4JZJC 1PX3A 1MJJB 4DOHB 4ORZC 2GJ6E 2XV6B 4IOIB 4MMXC 4WTZG 4Y16C 1NSNH 5GS0H 1G7HB 4H1LA 5FUZL 4O4YL 3VG9C 1GZQA 5FM5O 1K85A 3BPCB 5EOTB 3OKLB 4FQHA 2V7HA 3JWDH 2GJZA 2XPGB 4LNVA 4Y4FB 3P9LB 3HI5H 1QYGH 4UQ3B 4CN6A 3RKDC 2XTJB 2QEJA 2X1WL 1C5DB 2VLKD 5D7JA 4K23L 1QLEL 3HNVL 1IVLA 2OZ4A 1RUAL 5C0CA 3KS0J 4LPVA 2A6IB 1QFUH 3DTXB 3O45B 1I3RB 3DMMD 1FVEB 5DD6B 1YJDC 1VB9A 3FO9B 3M17B 3SE8H 3QUMB 3MRQB 4QHMA 4LVHB 1ZLVK 2UYLA 5JDSA 1CTNA 1VFUA 3GB7B 4GOSA 4Y19E 4OZHA 5GZOC 1OSPL 2OI9C 5HDQL 2VLJD 3EYVB 2V5RA 1DUZA 3MLSH 4M61A 4JFFD 3TBYA 4Z8FL 1JNLH 3LSOA 1S7TB 2VXVH 4XVTH 1Z9SA 2JJWA 4I8DA 1QFUL 5CP3A 5KW9L 5JHDD 5TDOA 2LAAA 5DWUH 3F6IA 1MPAH 5F9WB 2YA1A 4K23H 1U58A 4DVRL 4QOKE 2FHCA 3MROA 2LTQB 4O2EB 4NKOB 3CMOH 2XZAL 2F54B 4NZTH 1RUML 4PJ7F 2BY0A 3KPRE 5AZ2L 2PYEE 1T6VN 4MQ7A 1NBZA 5IP4A 4RAUA 4O4YH 1LO5B 4LSPH 3QAZB 4C83B 5IVXA 4YFDB 3SGDI 5BO1H 4K3GA 3LCYA 3HE7D 2ADIB 1T7YA 3HPLB 4WW1A 3HAEH 3IKCA 2G5RA 1U8LA 3MJ9L 3TNMB 2F8VA 4ODUA 2Y5EA 4HUWA 2IGFH 2H8PA 3A67H 2MMXA 3FTGB 5FYKD 4WWKA 2PKDA 4WI2A 1E4WH 1U3ZA 1HZHH 5F93C 1GH7A 4KDTA 4QRUB 4XVSH 2YD2A 4ZAKA 3DUUA 2PW2A 4I1NB 5HGHB 4XP9H 2JE8A 3DJ9A 4XX1G 3QJHA 4GMSL 1JNNL 5F88A 4B50A 1LK2B 1XF1A 5DFVD 3E6HA 3H9HB 1NMAH 4BKLB 3T04D 1M1SA 2VZOA 1BECA 4L4TB 4LBEA 2APXA 1RK0A 3RA7L 2FD6L 4OZ4A 5ECJE 2FWOB 3I85A 3MLPA 4NNPH 2AK1L 1EHXA 1NC4D 1SM3H 1JZ2A 5IW3A 3TT1L 4JKLA 4WTXA 4ZFFB 1KLGA 1OW0A 3MSPA 3FB8B 5SV4A 2R15A 1KPUB 3PABB 2R56L 3S37X 5C9KA 1T0NB 2NY6D 3BSZL 4HUXB 5EWIL 1ROWA 1AIFB 2R0KH 3CDCA 3F6LA 1F45A 5T3ZE 3VWKB 5C0AA 3UTQA 3PIQB 2EXYD 4PJCA 3L1OL 2HG5A 3SE4A 4LSVL 3WO3B 3EKCA 3T3PE 3ARBC 2IH1A 4JREB 1D5BA 1LEGA 1P2CB 3VGFA 2G5BA 5DVKA 2OK0L 4YX2L 1U8LB 4P23A 1KLFA 4YO0A 5A3IC 1JHTB 4GO6B 5KVFL 5E8PA 2X7LB 1MREL 2HT3D 3PV7A 4RX4D 5L2KD 3BISA 5IWLA 4U2YA 5F1IA 1UH4A 5AZEL 2H6PA 3OL2A 5AYUH 5D1QC 2PXYA 3P0YH 4PR5B 1FGVH 3O2DL 1N3NA 3QIBA 3RAJL 1U8IB 2VDLL 2D4DA 5GSVB 2JJTA 4HBQA 5D2LF 3A6OA 1U8OA 5F71A 4KQ4L 1E4XH 3B9KC 3NCEB 2WWKO 2R29H 1LO0L 2X1XR 1MHPH 2X70B 2F54E 5EULV 3UTSD 1QLRA 4ZTOH 3DXAD 3WHE1 4CDHA 1AE6L 1F4XL 3KPPB 4MJ2A 4YO0B 3FMGL 4AH2A 1QBLL 4U1KA 2EDHA 2DDQL 4DGVH 4MA8H 3SGJC 2KL6A 1HHKA 3MGTA 4L9LC 4YDLB 5F6IB 4ZUSA 2CXKA 2ZOLB 2GAZA 4ZQKB 3PJSA 5GISH 4NZUH 1P5VA 4U33A 4RFNB 2FX9L 5KS9E 3BP4A 3BXNA 4Q0XL 1Q9LA 4U3XA 1JV5A 4LFHG 1JYNA 1HHGB 1FFNA 1NCCH 2B5IB 2VTFA 4Z0BL 1YYMH 5DJCA 1X5LA 1NFDA 2A38A 5DMKA 3QQ9D 1YUHA 1CFQB 4HUMB 1JFQH 3VH8B 4HXAH 5AEAA 3TV3L 5K9QI 4H26A 3AFLA 2JB5H 2I5YH 4PV8A 3U46A 3MOBH 1FO0A 1UA6L 2F74B 5ICYB 3PNWA 3T0ED 6FABH 6CGTA 3BQUC 4X4ME 1XCTA 3HC0B 1CICD 4PJAB 1ADQH 5C07A 3W0WE 1CZ8H 3EO1B 4KROD 3EOTL 5C0BB 1DQMH 5EU3B 5BVPL 2FR4B 5M94B 1YMHA 4H20L 1T5WB 3WMSA 2NXZB 4G8GE 1PSKH 4P2RD 2XTLA 3QDJE 2XKSA 1BD2D 4H1LG 4J23A 4GRWH 2F15A 3S4SG 2D7NA 4GKOA 4KAQH 1T03H 1XIWB 2B0SL 4U1IB 1QHPA 1TZIA 4X98A 4N0FA 2GHWB 2IQAA 1CZ8L 3WL9B 1ERNA 1F8TL 5IUSA 1CDGA 1ZE3C 3ULVH 3B8SA 5EUOB 3DVNB 1XMWA 2DKMA 2OR9L 2YD7A 3G5VB 3VXRB 3W9DA 3O3EB 3T1FB 4AENB 3GM0A 3OG6B 2NLJA 3MZTA 5E8OA 3KAAA 3SCMB 4DVBB 1N2RA 2Z31D 2PCPA 4TUOA 2GFBA 3QWOA 2VKXA 1FYTE 2CIIA 4P3WA 1VEOA 1DEEA 2NYYC 2DWEB 3CAFA 3WUWG 1KSRA 5CHNB 2GCYB 4WUUD 4JFDB 4KI5D 3TJHC 2CIKB 4G8GD 1FV1A 3E2HC 1KPVA 4HV8B 3SPVA 4TTDD 4YK4C 5JOFB 2CLVA 4KK5D 3KLSA 2R0WL 3T8XA 3EYUH 4L8SC 3VXPA 3OGCA 4AM0A 2B1AH 1NLDL 2VRAA 4XCNB 3DETC 3ECBB 4RISH 1F13A 3MRNB 4UT9H 5GGSA 5C08A 5GGVY 1UKSA 4Y1AB 1TTGA 1EFXD 2OP4L 5HHQB 4L9LA 2VLME 1RURH 1ZA3A 4CL7A 1TETL 2VO5A 3WV0A 1Z0NA 4N1EA 5JW4N 5E2JA 2RIKA 1VKXB 2I07A 3SO3C 4ZFGH 4YUEH 4JFPA 4UILL 3RVUD 3DI2B 4JRXD 4KUZH 1KJ2H 2ATKA 4X7TA 1SBSL 3QWRA 4RWYL 4XP4H 2DQHL 1BGXL 4HKZB 1AI1L 5HHMB 4G8EA 4HJGB 1FL5B 4LSDA 1EBPA 4LARH 3LMJL 25C8L 4QEGA 3ARGB 4UT7H 1GIGL 3FRPG 3EJYD 3MYZA 5E5MB 3MRHB 3HZYA 4N0UA 4GKSA 1MREH 5HYJE 4NFDA 3P40A 3LIZH 4L8DA 5FUCC 4PS4H 5DO2C 4UT6L 1NGZA 4YAQB 1Z0MA 4Z78A 3BO8B 3WXVH 3TO4A 1XH3B 4QHKJ 4X4YA 3OXRB 3ZSTA 2YSSB 4IMLB 3JUZA 3ARFC 4L1DA 3NFSL 3QIUB 4UIKH 3HR6A 2VZUA 3IJYA 2PTUA 5FK9B 5E00B 5CZKA 2O5YL 1FLRH 5ACZA 5C0CD 3ZDZE 1JTPA 1QFWL 3V5DA 5IMOB 3ME0A 4QRRB 4NN6C 4X4XB 4Y4KB 4F15C 4L8DB 3GI9L 2ESVE 1R5WB 2K7PA 4XP6L 1IBGH 5L9DL 3PXJA 3RA7H 2R1XB 3OXSA 3V5KB 3ZSSA 5L2KE 3HI6H 3PQYD 4Y1AA 5HHQA 3FB6B 3QEUB 2ICWJ 3L3JB 3GMNA 2GFBB 1KEML 3MXWL 1F2XK 5DQJA 4DOHE 3JWDC 3KPRA 5IGXL 2XYCA 5TDNB 1FCCA 3QXDB 1W0WB 2QHLA 4NQEA 1MLBB 2YBRB 3FRUB 4WHYG 1HYSC 3H3PH 3W81A 1S7QB 3F62A 1FYTB 4XVSL 3E1F1 5GS2H 3O81A 1KTKE 4Y16A 3EDDA 4R2GC 1DANT 3PG2A 4LEOB 2N7BA 5EOQH 4HBCL 1PAMA 4X80H 3P9LA 2GQHA 3O2VL 1RZ8B 3P77B 1MLCA 4MWFA 3RWGB 4I48B 2OBGA 4HC1A 4CRPA 3PWVA 4HFWB 5INDA 1P4BL 3BPCA 3I02A 5EOTA 2NLJB 3D25A 3QQ3A 4GAYB 3IDJA 4G9DB 1U3HA 3V5HB 2C3GA 2BSRA 1FC2D 3H9SD 5HYQB 1FFOB 5DFVC 4RX4A 1U42A 5AD0B 4PJ7A 1WIUA 5DJAB 1FZOA 5J1TC 5EO1B 2CJUL 4QYOB 5H94B 1K4CA 2CUHA 1IGTA 3F58L 5BW7C 1INQA 2VDRL 4DW2H 4PRPE 2VLRE 2XZAH 2V2XB 3OKOA 4JCMA 5IBUG 4LSUH 4RAHA 4O5LL 4D0DA 4U6VL 4TVPH 2X05A 2XG4A 1MPAL 1IL1B 3QXAA 5FM8A 3GJEA 3HAEA 1I1RA 3OAYH 5C3LD 1M6OA 4XPAL 3S4SA 3LN5A 2Z35A 4YQXL 5HHME 3QHZH 2VLRA 3BZ4B 2LFGA 1WTGT 5D6DA 1FFOA 3IFPA 1YZZA 3O3BB 1OW0C 3OHXB 2AKRB 4JO2L 1QBMH 4NQDA 4YHIA 3S35X 3BPOB 3P2TA 3ZLQC 5ID0B 2DBLH 3RWDA 1CD0A 1ZGLA 2X89D 2EDNA 1CXEA 3BEVB 1N5YH 5JUEH 4OF3A 1CCZA 5DUMH 4YHNB 1MFCL 1KXTB 3VXNB 4OZIF 3WYRA 5FF6A 1HEZB 5FO7A 3TA3C 3BKYH 1A1NB 1GGIH 4JO4H 3MRRB 3JBG7 4X9BA 4DKFH 1VERA 4GUPB 3MGAA 5KN5B 3TN0D 3LN5B 4G6AD 1BQHA 3DV4B 1NBVH 1MCDA 5IW6A 2ZCHL 4CKVX 1BJMA 1LEIB 2CKNA 1UCTA 2EZ0C 4XWOD 4XBGB 3VXQA 4G6KL 3ESUF 1ZKAA 4Y4KC 3IDYB 3S7GA 4JM2B 3KYKL 1FSKC 4HPOL 1WAAF 3DX6B 5BMFL 3TVMB 2Y7QA 1DP0A 1TZHB 1SVZA 4KDTC 5HYSA 4NKMB 4W6YB 3L3IB 5IFHH 1JGLH 4RSVA 5FO7B 5IESL 5MEOB 3DNKA 1VENA 3OKMB 3M1BB 1UH2A 4HEME 5GXBB 1YEHL 3T2NH 2L7UA 3RBGA 2CKBA 3QPXH 4ZDHB 2ORBH 3R8QA 3UMTA 4JZJA 4OCNC 3ZDXE 3G5ZB 4RA3A 4HS6B 5F1KC 5IJVA 2XN9A 3O8XC 4AH2B 1P84K 3C5ZC 3EUUA 4UV7H 4KVNL 1DSFH 1OAXH 2DKUA 3IF1B 1JZ5A 5HYSB 1LILA 5TH2A 1U3HC 1S9YB 5I75C 2WBJC 3F7VA 4MXWH 5D5MA 4AG4L 3NIGF 4RAVB 5J6GB 1LO2L 1OGAA 1NFDE 4P5MA 4EDXA 2X4NB 1R0AH 4OLUL 1DBBL 2GJ6D 5HHOD 5IMKA 1CYGA 2VITA 2UYLB 2ICEB 1FRGH 3H9HA 3IU3B 3LD8C 1AD9A 1OP3H 2VDOL 4S1QH 3ARBA 4TSAH 1GAFH 4BA8A 3GSRA 4RWHA 4R4FH 3QUMH 2QKIB 3V4PL 3TPKA 2X7LA 4P4KD 1UQSB 1NKOA 4PRPB 3VFWB 1A6AB 4FQJL 1N8ZB 4Z95L 4JM2D 2V17H 4ZUWB 1YNKL 3KR3L 5ESAA 4M7KL 4N9OB 5TF1H 1JHKL 4XMLH 2XWJA 5C08D 1GOGA 1LO3L 4Z7VA 2F53E 5D1ZC 5DTFB 3ZHLA 3NAAL 4XMLL 5CBAA 1JHKH 2GY7B 1ZLUK 4NYLA 2KPNA 1J11A 2Q1EA 3WJJC 4PGCB 1FE8H 3QJHB 2DQIL 3MGOB 4AEHH 5GSRB 5FO9B 3GKWH 4JY4B 5BS0B 1R3IH 4QXWA 3QULA 4U1LA 4YDJB 1KIPB 3TA3A 1KN2H 3HUJB 3PWNA 1PG7H 5K9JH 4KDWA 3FO1A 5MEQA 3N85L 2QJDA 3B9KB 1CF8H 5DEFB 4UDUB 1DBBH 4OFIA 3MV8B 3DGGB 4NQDB 2BOBA 4RGOH 4CNIB 5CJOH 3VXRA 1VACA 4IMKC 5EZJA 1F4WL 3UC0L 4XPGH 5IT2H 3MLRL 4PLJD 1FNFA 1TCRA 5IF0A 3RL2B 1PBYA 5LGJA 4WW2A 4H8WC 1NBZB 4HCRL 4JB9L 5HI5D 2BK8A 3RPKA 4H0GA 3RY6A 1EEQA 5CEZD 3G6DL 3LKQB 2BVOB 2IWGA 2PXYC 3LDBB 3HMXL 3SCMD 3QNXA 3T2NL 4EEEA 3OG4B 5A2KH 1BIIB 3VGAC 1U91A 3QDGB 2CXGA 1S7UA 3PWLB 1LDPH 5MHSE 1GSMA 1DR9A 3VRLE 1CICC 3UJIH 2ZNXA 2D2OA 5MEND 3BD4A 1FQ9C 5AWNH 4PJBA 5BMFH 3QDJB 2X1PA 2GSGB 3CPLA 1BREA 1GGBH 1WWAX 3BYYA 3FQWB 1OP3K 15C8H 4OT1L 2DYPD 3NIFE 1NLBH 1FNSH 3NN8A 2DQGL 3CPLB 5I1CL 3MV9D 2ZUWA 2ZKHL 1HI6B 2AI0L 1A5FL 4IHOA 3MA9L 5FYJL 3GGWB 3WNLA 5F88B 1EJOH 1RV6X 4KKLD 3WJLC 4MQTB 4CU6A 4ZD3L 4GG6E 1NFDB 1EHLH 3O9WC 1B2WL 2NXYC 4OQTA 1MCNA 2P8PA 4NC2B 2NMSA 2VZTA 2FYYB 4HIJB 4XAKE 4HK0A 3O6MH 3KVQA 4O2CA 3BN9C 4HIXH 4KY1L 4N0FB 3SDXE 5C6PB 3TO4C 3DGGA 5FDWB 4M7ZC 4J2XA 2YRPA 5DUML 3BN9D 4F7EA 4OCYH 5JUEL 4OV6F 4O02L 5E2UH 2X9XA 4LHUB 3MBXL 5C09D 3PQYB 5EUOF 4G80B 3AB0C 1ORSA 3CVHA 5CSBA 5D2NC 1JBJA 2E3VA 4Y4KD 3P4NB 4MNQB 1CLCA 3N1QC 2FR4A 3EBAA 2WUCL 3QA3B 3ZTJG 4S2SA 1TZGL 2A77H 4YXKH 3K7UA 2FH6A 4RGNE 4YQXH 4JRYB 1AQKH 3CFEA 4X98B 2EYTA 1AO7A 4KWUA 4WW2F 4FQLL 3BP5B 4OZGA 3D69B 4JRXE 1RULH 4TVPL 1KJMB 1FL5A 1UJTA 3D69A 1T1ZA 3B5HA 4DGIL 4JFED 1CL7H 3F58H 1OTSD 2VXSL 5F1IB 3HUJE 2BVEA 2BY2A 3DVNA 4ENED 3WFZA 1IM9B 4P4KA 4WU7B 3ETBF 2BVUA 1JWUA 3LY6A 4N0CD 1OWWA 4LQFH 5DQJB 1CXLA 3HMWH 4OZFA 1MOEA 3TBVB 1Q9OA 5GGVL 3WNNA 3C8KB 1IGYB 3KXFE 1DVFB 2FEDD 2C3VB 3O4LD 1UVQA 1UZ6E 2F19L 2R2CA 5EIIA 5EOQL 3WLWC 5D7JD 1X4XA 1FVCA 3NPSC 4N5EC 7FABL 4YHKL 2XWBB 5GIRA 5J13C 3QH3B 3TP4A 3NA9H 3TPUB 1H3VA 3HC0A 4O00A 3S3PA 4LLVA 3L3HB 3G9AB 1OAKH 2E9JA 3QDGE 2CIIB 1I7RA 4WVRA 3IFNH 4AQ1B 4YHLL 4PLKD 4U6HB 5E6ZA 4NWTL 2M8XA 4X6CE 2EIBA 1URLA 2ICWA 4I4WA 2VQUA 2RFXB 5EU6E 1I7ZA 2HVKB 1BM3H 1JPTL 3FB7A 3I9GH 3WBDA 4XP6H 4L29B 4K7FB 3EZJB 43CAB 2BNRE 3VH8G 4XNMA 2UZXB 4UU9A 3HZYB 4N0UB 4P2QB 4TPRH 5EFIB 2VDML 1K5NB 4D3CH 1NEZB 2B2XL 2O5YH 4ODVL 1LEKB 4DZBA 2ITCB 2Z31B 4M7LL 4M7LH 2BVYA 3L5JA 3V0VA 3ARDC 2B2XH 1A1MA 3H7BB 4M6NL 1Q9KB 2PYEB 3OKKA 4NKDB 5BXFB 1IKNA 1HH6B 4Y5XC 4JN1L 5HI3C 3OB8A 3JTSA 5D7LD 5I16A 4FXKA 4CU7A 3LHPL 4QRTB 4JAMA 1E6OL 2EIZA 2ADGB 3WFCL 1KOAA 1H3PL 3MV8D 3MODL 4D0BB 3U4BH 5ENWA 1WFTA 1A64A 4GW5B 4YHLH 1WBXA 4JHZA 3LKPA 4OF5A 3LH2H 4AM0B 4HUNB 1NC4A 3TBTB 1AI1H 2GJJA 4JRYE 1BGXH 3CFJA 1KLUB 4XP4L 4LLVB 5SWZD 1X5IA 3W0WD 1MCPH 5T1LD 4LP4A 4L8SA 5L2JA 5DMIH 4GBXA 5EBWB 3ARUA 5SWSD 5F1NA 4ZFOB 2DQFA 3S36X 2WANA 1TETH 1CQKA 5DK0A 5C2UB 5HHPA 5IMMA 4J6RH 1RURL 5FGBA 3P11L 5FYKL 4HSQA 2DICA 4RNRB 5BZDB 3OKNA 4LIQE 1WWCA 2C9AA 2ZUXA 5BRZD 4ACPA 3U0TA 3EOBA 3FFCA 1NLDH 3KDMB 5H94A 4NBYB 5F6HI 1EHAA 4LQFL 3CDGB 5IBLC 1IRAY 2R0WH 2YHGA 2M2DA 4RMWA 4V1DD 1CE6B 2XTJC 1JPGA 4QTIH 5ICXA 4H8WL 1IL1A 1NCDL 1SY6A 3HR5A 1G84A 5HHOB 4DKEH 4DQOL 1C5CH 3HZVB 4PGEA 5DHYB 4I9WD 1KBGL 2DM3A 1G0DA 3EYFB 3JV4A 3I3DA 3VGBA 1RZ7L 4ZPTA 4AEIH 3RPIA 4NKMA 3B9EA 1WEJL 1F6AA 1IZKA 4TUJA 4XTRC 5B39B 1I3GL 3I75B 3QZWA 3VXNA 3QXAB 3EO9L 3GBML 3TBTA 1T2QH 4X6CB 4TTDC 4XVJL 4HKJA 1KN4H 3C09B 1FPTH 3HZKA 5JTWA 5DHVB 3RZWA 1S9XA 3BEWB 1OWRM 5LAXA 1N8ZA 1PSKL 2R2BA 4R4NC 1WITA 4ZUTA 5H2BB 1R3HB 2BSTB 2G9HB 4QRSA 4TSBH 5BXFA 4KFZC 4NJ9H 5DLMH 4ZD3H 1KNOB 4H25B 5A1AA 2NX5E 3ZTNL 1BF2A 3MA9H 4ELMF 3WIHH 1ACYH 2W9EL 1Z3GL 2YUZA 2UVFA 1JZ8A 4U3HA 1PZ5B 4PTUA 1A7NH 1BVKA 1OP9A 4X9GA 1U6AL 3RGHA 2AJ3A 1QSFD 1R3JA 4MJ5A 3OKLA 4FQHB 4Y0GA 5SWSB 5JXEA 1QO3B 1R5WA 1AXSA 3U7WL 3GHBL 1YNLL 1IJ9A 4G6JH 3AXLB 4MDJA 4FQPA 1J5OH 4FXGB 1K9TA 3RKDD 1YEGH 1UB6B 5GS2D 4GRLC 1MHHB 1AHWA 1YEIL 4FNLL 2R2HB 1Y6NR 4NCDA 4YDKL 1YQ2A 3ZHDA 4NZUL 1FG9C 2PXYB 3CFDA 1F11A 2WWMC 3RI5F 1RHHB 3X14B 2Y07L 4MA7L 5B38G 5A40E 5EZOL 4WWKC 1G9EA 1MUJA 2LU4A 3L3IA 5DHXB 3VE0A 5CEXB 3DUUB 1F4XH 2J8UB 4CU8A 1N5AA 3D2UA 1OPGL 4HC1L 4F7TA 1A6VH 2D7OA 1M05A 4FFZL 3VFTA 4CMHC 4LAQL 5C0BE 3VXQB 4KQ4H 3CFIC 1IC7H 4Z5RA 4NT6B 2HRPH 2CQVA 3FTGA 5SWQB 1R3LB 2EC8A 1AHWB 2JB6B 5E6YA 4M5YH 4URTB 4BSWB 4U1JB 2VLKA 3P0YL 3FQNB 5T3XL 1HCVA 4ZO8A 5AZEH 4P2QD 1I3RA 4J1UA 2ZCLH 1MI5E 3GKWL 4P9MH 4AEHL 3O8XA 3LQAC 1FE8L 1S7SA 1YN7A 3KJ4B 1F90L 4BSJA 1LO5A 2WSKA 4LCCC 3O2WH 4NOBA 4PP1D 4Y16D 1NAMH 4QF1A 1AO7D 1KGCD 2AJ3B 1MRCH 4PRBB 5CCKH 4LASL 3QWRD 1PEWA 1J0YA 5T3XD 1KPRB 3KPTA 5J57B 3MMEA 1J87A 1SEQL 3MFFA 3ULVE 3GIZH 1I1AA 4EI5B 1YNKH 3KR3H 4LVOB 4ODHL 3VFRB 2Y36L 3ZHKA 5D7LB 2R0KL 1QSEE 3DX7B 5DUPL 1BX2A 3CVHH 3WFEL 3JWNC 3IS0X 3V4PH 3ZKSD 1SHMA 5HI5C 1UEMA 1SM3L 5EA0H 5KSBE 3CZFA 3BXNB 2HT3C 2IC2A 5JPMB 4HH8A 4N1CA 4YIQA 1YDPA 4QRQA 2O26U 1LP9F 1MFDL 2X1OA 3U9PL 1JZ6A 4WW2B 5LGKA 3QIBC 1NMAL 2X4SB 5EO0A 4EN3B 4I0KA 1KPVB 2MKWA 1BVZA 4KI5F 4V1DB 1UACH 4GMSH 4NJAH 3QPQC 4XBPB 3MNZA 3S36H 4BQ9A 3MLZH 1A14H 4PJIF 1X3DA 4A6YB 4N8PA 1KIQA 1TVBA 4NNYA 5HDBF 1OSZB 4XZUA 4FG6C 5CKAA 2Q87A 4NNYB 4JR9L 1CVSC 5FYKU 3HZMA 3MUY1 5LGHH 1WFOA 3UO1H 4DUVA 4PJ8A 2EDDA 5I6XB 5K59F 3GBNL 2WW8A 2I07B 2QQNH 1P7QD 4M1DL 5JPNA 1JGLL 5C70A 2I9LA 1BWMA 2VC2L 4UNUA 1ZT1A 2MWCA 4I0PC 4L3EA 2OJZH 4IHOB 2CO7B 5BO1L 5E8NA 1VEMA 3OAUH 5H8DA 1I1AB 1UWGL 3ARGD 2WIIA 1XIWA 4P5KB 2FRGP 5D1XD 3N1PC 1NGXB 1F2QA 1OGTB 1RZIB 3MXVL 4G6KH 4NT6A 2FJGA 2RHEA 5GS1B 2ZOLA 4M02A 1HKFA 1C08B 1HINH 4U1GC 3VRJB 3I6KA 2O5XH 4PUBH 4P2OD 1A1OB 5D7IA 4WI8A 1T5WA 2FH8A 1WFUA 3L7FB 3FB8A 2XIDA 3QFJE 1JYXA 1EBAA 4ORGB 2BVQB 3JXAA 3RUGE 3ZE2E 3H8NA 4YBHA 4XXCA 4JDTL 4CN4A 3C5ZB 4Z8FH 4DTGH 2DLFH 3QNZB 4KZDH 1A0QH 3IJYB 4JG0L 4EXPX 1PX4A 4FQIH 4PV8B 3WJLA 4UNTA 2YWYA 1BOYA 4FMKA 3VFTB 5DJXB 3V6ZB 2HFTA 1ZT4B 5HVFB 3QIWC 4F37K 5IOPB 4NUJB 1FO0L 5K9QG 2RAMA 4LCIL 4LGSB 2OXHA 1TQCB 3QHZL 3QDME 4WDIB 1MCLA 5MERB 2W0PA 4KJQC 1CDIA 5FGCB 1VFBA 3O6KL 3NCCB 1KYOK 3P0GB 1N7MH 2DQTH 1HOCA 4PY8I 2P24A 1T22A 2B4CC 4G5ZH 1JF1B 2WQ8A 4XCYB 4E42A 3VWKA 1R5IB 1Y18B 2H3NB 1CFQA 1X5FA 2VN7A 5DQDH 3VH8A 2YPKA 3RVWC 2X9YA 1G9MC 2OJEA 5BZWA 4B7LA 5CIPH 1SJEA 4JRWA 4R8WH 1UM5H 5F9JB 4L29A 2J8UF 4M3JA 3RY6C 1CE1L 3BIBX 1DQQA 5DR5H 2J6EH 2XNAB 1SQ2N 4HX1B 1L0QA 1DVFD 3PJSB 5T5NF 2UY7A 2EDFA 5IBLD 3ZE2F 4KUCD 3DO7B 4ZODA 1G9ML 1HDMA 1UM6H 4JDVA 3BX7C 1MFAH 4K3EH 5CD3B 1IAOA 1EUTA 3L3KB 4JN2B 4WFFD 4LMQI 3MUHL 1D7FA 4X99A 1KG0B 3CFBA 3QXDA 4O2FA 2HWZL 4XMPH 1DDHA 4APQB 3BH9A 4NQXB 3EOBB 1XGYL 1GL4B 1MCOL 4WIQA 4HIHA 4JPKH 2CDGA 3HNSH 1AQDB 4D9QE 4DZBB 5DJYB 1EGJL 1I8LA 2FLBT 4HKJB 1ZXQA 4Z77A 5FYKE 4X4ZA 1YY8B 4J3WA 2J8HA 3O3EA 4XT1C 5DUBA 4JJ5A 4GXUN 1EGJA 5HI3D 4QRPA 4PRIA 3GI9H 4LPWA 1N4XL 3IDXL 4MA3A 3O8XD 1KGCE 3WKML 2ICWB 2XI9A 3EYFA 3SQBA 2HH0H 3E3QC 1X6NA 4JGMA 4OTXH 4NOFA 1FH5L 1A9EA 2CMRH 1II4E 3GNMH 3NH7L 4R97B 1BJ1H 1IGTB 3U36A 1QSED 1LNUB 3RUGB 4HG4K 3QJFA 1QSFA 3PL6C 1TJIL 1JPST 3ARBD 4JFXA 5MEPA 4G9FE 3RWIB 2PR4H 4WCYL 1WVZA 2NY5H 1G9NL 3Q1SL 2EC9T 1RUPH 4MVBD 4JZOB 5D7IB 1PY9A 4KK9C 3W39B 3V6FB 5E5RB 4G80A 1N0LA 4ONGH 1KENH 5BZDA 1GHFL 4HWNA 5TPWL 3PGFL 2YKLH 1BBDL 1A4KB 4PJGE 2NY5C 1XGUB 4KJYA 4AIOA 4RWYH 4H25A 3P73B 4F33B 4CGTA 5HSFA 5FYLD 2E7LC 3EHBD 1W8OA 2AGJH 4JY5L 4C56B 1SJEB 3STBA 2YBRA 4JQXA 1NQBA 1DLFH 3X3GH 4K7PY 2H45A 1NCBH 3RP1A 3V6ZA 5FCUH 4ZSOE 3OGOE 3PWVB 4HFWA 5F9AC 2GJ6B 5KAQG 2ZSVB 1S9WA 4OM0H 5DC9B 1GGUA 3Q2CA 4L4TA 2XKNA 4BH7A 5EZIH 3HLAB 2D0GA 3OKYA 5C0EB 1T83C 2AV7B 1XZ0B 2J8OA 2FJHA 4HJJH 3LB6D 4XHQA 3FQRA 5EO1A 5FGSA 4ZSOA 5F7MC 5IB5B 4GBXB 1XF2B 2R1YA 4BYHA 3NFNB 1CDCA 4GQ9H 2XTJE 1N6VA 2AK4D 2NY4C 4OLZL 3WEXB 2ATPB 3BRDA 4N0RA 1ZOXA 3TJHD 1GGCH 2EC9U 4J3VA 5T3XE 4W6WB 4NQDD 4JQVA 1UVQB 4LSQL 1ZTXL 2X4UB 4NNXA 5JW4M 5LBSL 1AGCA 3FFDB 3L95A 5FGBC 5ID1B 5GS3A 3QRFM 1T3FA 4HLZG 3IFPB 3QCVH 4P5TD 4MXVF 1E28B 2OR9H 3AY4C 4CMHB 3QISA 1JHTA 3BT2L 4N0CC 3DX7A 5HPMB 4JZNA 4HMEA 5JIIA 3HC4H 1F8TH 1QRND 4YHPA 1DBAH 4J3TA 4OUUA 3QO1A 1WBYB 4EQ2A 4W68A 4PPTA 4LKCA 4WWKB 5T1DL 3QNYB 5T3ZD 3GMMA 2V2WB 1RUKL 3GJFH 4XP5H 5A43C 1MFBH 4FN0A 1FFPA 2X4QA 1T0NA 1YY9D 4YBQC 5C0IB 1KTDB 2AXJA 1YN7B 4BQ8A 3REWB 4WW1B 5L2KA 3MV8E 4K8RD 3V8CA 1WCBA 4AYFA 3EOTH 4NQDE 1RUQL 4JG1H 4ESKA 5DJ6A 4TOYH 3TYGL 3KG5A 2VQ1A 3P4MB 4NGHL 5ETUA 2W65B 2AV7A 2QLVB 4FA8A 5CP7B 3MCLH 3RNKB 1K8IB 2X89A 4UUJA 3NGBB 4WUKH 1WZ1H 1AHWC 5KSBA 4NKOA 5HHMD 2I5YL 3FN9A 5D1XC 3MV7E 4JFFA 4AQOA 3ULUC 5JQ6H 4NZRL 5FCSH 5I1AA 4HUUA 3CXHK 1KEGH 1DQDL 4NZDA 4F7PB 3VGEA 5CEXA 3LDBC 1EO8L 2FBJL 1NCCL 2YPLA 4GLRH 5JDJA 4M3KB 4JPIA 4Q0XH 4PP2A 4WENB 5IROC 3QUKA 4PJXA 3RTQB 1T80A 1J1PH 1K8IA 4N0YH 3FN0L 4HUWB 5MP6L 2OR8A 4MQSB 1B3JA 3V6FA 3C09C 1QBLH 1I3UA 2P7TA 3RIAF 2GIYA 4L4TE 1OCWH 2F58L 3HCVB 3S9DB 4M93B 4TRPH 5IB3A 1KB5H 5IQ9A 1AE6H 5DXWA 4K3DL 2A6IA 1CDUA 3C9NA 3NIGE 3EGSA 2B7DT 1S8DB 3K1DA 2VLKB 5DJZB 4OFKA 4BH8B 4JFEB 1LP9A 1DJSA 1SMOA 5C0CE 2XRAL 5ERWA 1I9RL 1U8IA 1KCRH 2VDLH 4NNXB 2NY6C 1M71B 3GSOA 3QEGH 2X4RB 1JTTA 4ONHB 2R39A 4S11A 4LNRB 5T1LA 4MDJB 3T0EC 5IQ7H 4OKVA 5EZLA 3PDDA 4GFTB 1OAZL 4JANB 4S1SL 4I77H 5DGRA 4U1JA 2EDLA 3VFRA 2A74B 1VGKA 4CW1B 3VRJA 4JFFB 2ARJQ 1XF5B 5JORB 1ZAGA 2H1PL 3QR2A 3S88L 3IVKB 4IRSD 1HHHA 2A9MH 2A9ML 2H1PH 3S88H 3MOAH 4J3UA 5IHZB 3AGVA 4JRXB 3FFCD 5I71C 1T1YA 3BKCH 5F6IC 4A2LA 3KPLA 3CCHA 4J8RB 3WS6C 2XXCB 1CFVH 4TUJB 4GRMB 2IFGA 1INEL 2EE2A 3INUL 1WCBB 3MGOA 3TT1H 5D2LB 2Y06H 1JGUL 3O6FD 5LJYH 1P84J 1T7VA 4NNPL 3BGMB 2AXGB 4GS7C 2BC4A 1RZJL 4X6CF 2FD6H 4AEFA 2P47B 5C09B 4WTZA 4PJXF 3DIFA 1IAII 3N06B 5D71H 1X5XA 4OD3L 2XWJB 5MEQB 4ZOCA 3QEQD 1P4IL 3UTZA 4M1GH 4OIBA 4A6YA 3EDJA 5D5MB 5IB1B 1ZVSA 3HE7C 1GGYA 1HKLH 1LK3H 1KNOA 2E6JA 4K3DH 4PD4K 5J1SC 3L9RA 3WHXA 5DJCB 4IDJH 3Q3GA 1AD0B 4B53A 2EXWC 3PHSA 2PW2B 3V6OA 1OAQL 1RJLB 2J88H 3QDGD 3X13B 1OLZA 4JM4L 1KTLB 3EFDL 2DWEA 1I75A 5MP6H 4N0YL 5BRZE 1BQLL 4WEBH 4U4BA 1E4WL 3BOVA 3WDJA 3KPSD 4IDLA 1OY3B 4OBRA 1OF2B 1TMCB 2CLRB 2O93L 4PJAE 3ZMRA 4LLYB 4HIJA 3X11B 5I17B 3O4LE 2Z8SA 5EU3A 5E1AB 3IF1A 5GZND 2P5EB 2AEIT 2Q7YA 4MLSA 5KVDL 3L9RB 3GSWB 2P8MA 2BVPA 3D48R 2DMKA 2QSCL 2Y7QB 1G6RB 5I1AB 3T09A 1RZGB 1TTFA 2GT9B 2DIJA 4L3EE 4KROC 2ICES 1NGQH 4U6HA 4PJ8C 4XNZC 4LPXA 4P2RB 3QCTH 4Y89A 4LLMA 4PJ5D 1BZ7B 1UZ8B 1WAAA 3OMZA 2VR4A 4FS0A 3C5ZA 4UNVA 1LHZA 3ORJA 4JG1L 4JFEE 1QLFB 4I0PA 4QRRD 4ZFZA 5KW9H 3B2UD 4EXKA 1I7TA 1D5XA 1JNHA 4L5FL 1V7ML 2JB6A 1YEJL 3PNWB 2PTTA 2R23A 2HJLA 5EUOE 3L5WA 2VE6B 4XPHL 4YBQD 3MV9A 2PTTB 5HGDB 1P69B 4Z0XB 4EZMA 3HC4L 5IBTH 1VFBB 2R9HD 4MGXA 3U9UA 2R8SL 3HI1B 3RWEA 2XY2A 3LV3A 4PRNA 1QEWB 4KRMB 4OJFH 4WTWA 4KMTL 4NP4L 1ZT4A 4MJIE 1QLEH 2IH1B 3AM8C 2PXYD 4LAJH 4YE4H 1P1ZA 5D7KE 4C4KO 1Z5LA 4PJCF 5EU4B 3CDYA 3B9KD 1P1ZB 1OSZA 3LEYL 1H5BB 4FQXD 4NQSB 5IV2B 2ERJC 3EFFB 3JWDL 1DQQB 4ISVB 2H6PB 1AGDA 5DVNA 5EH1A 4QY8B 5EBWA 2MQ3A 3KPQA 1HCFX 3T0EE 4P0DA 3K4ZA 2E5EA 2OL3H 4OZGE 3WKNA 3RWEB 2E7LA 3BE1L 2HLAA 4G6MH 1Q0XL 1DBJL 4BZ1H 3GK8L 5CAYB 2HTLC 3WO4C 1AQDA 1KCKA 4R2GB 2LV4A 3SKOB 1R6VA 4YHOL 5ESVA 4EUPG 2EICA 1D5ZB 3X3GL 5L8LB 1DLFL 3RGVC 4XWGH 1MRDH 3MCKB 2DN7A 5E1AA 3LKSA 2ZSWB 1ZLVH 4GXVL 5E5UB 5HTSA 4K94L 4F3FB 1U8KB 1YEDB 4PJHB 4NKQB 4OKDA 4KJWD 4X4MA 1BBDH 4Z9KB 1WTLA 1CGTA 3HZMB 2E7MA 2YUVA 4KPHH 3WDHA 4YHML 3VWJD 1IC5H 2J6EA 1HXYB 3WNPA 1FBIH 4Z7NE 3H3KA 2Q8AH 3UJTL 3B43A 3NCJL 1QPPA 4G7VH 2P48B 3OKDA 5I76B 4QRTA 2IPUK 1MJUL 4PJAF 3HFML 4LSSH 3VMOA 1A6TB 3EYSL 3REWA 2XZQH 1B4JH 1MHEB 2D7PA 3SBWC 3ARQA 1QNZH 1GCFA 3PGCB 3VFUA 1L7IH 3SBWA 2C26A 3DX8B 5I2IB 3EIFA 1RZ8A 4E9LA 2DYPB 1R24A 2GJZB 4JHAL 5ITFA 2N7AA 1CGVA 4IRSB 3GSNA 5C0FA 4QOKA 5FB8B 3FB6A 3ZDYE 4YDVA 1QFWI 2DIAA 5DYOA 3OHXA 4YHIB 3O11A 5AG9A 3OKEB 1ZK9A 2DIBA 1N4XH 1MQKH 2XQYG 5AD0A 1MJUH 2HT4C 1HILA 2DD8H 3FB7B 4GJTB 3C5SA 1PDKA 1BQUA 4QXUL 4MAYA 4WHCA 1F3JA 3WSQL 1FBIL 4XNUH 1I1FB 1MCKA 4M6ML 5MI0B 1NANI 3P77A 5E94B 1U8QB 2AJYL 1XGYH 3WNKA 1LE9A 1Q38A 3KYMB 3LRGA 2HWZH 4XMPL 2OMBA 4I9WE 1I85C 4F37F 4R26L 4GBXC 3CUPB 3FL7A 1XH3A 1Z9OA 4RZCB 1JF6A 3QQ4A 4NZJA 5CSZB 5F44A 4XP1H 5EBLB 3MV7A 3NFNA 5IMLB 3H9SB 1UB5B 5CD3A 3FT3B 3C60A 4G9DA 3P4NA 4MNQA 4H0HB 5GGQH 4PJEE 3SQOH 2Y5TA 4E5XA 3ILQC 4OCSH 4YLQT 3WIFA 3MJ6A 3JV6B 1HSAB 5D70H 5IVXF 4OZGB 3QUXD 1FJ1A 3LEXA 4P3DA 2BCKB 3FO9A 4PRPD 2DF3A 2I27N 2DKSA 4MJ6A 3OJDA 2VLRB 1CD1B 3QUZC 4M4RA 1GPOL 3UPRA 5DD0L 1I3VA 5T1LB 1MJ7H 2WLZA 2RB8A 4P3CH 3W11D 4OZGF 1C5DA 3ISWA 2ADFL 2XT1B 4GG6F 2UWEF 4XI5C 5SWZE 2BNQA 2VLJE 3QNYA 4YE4L 4KU1A 2O5ZL 4UUJB 1J88A 43C9A 4E5XB 2P5WA 3V52H 1UB6A 3G5YB 4NP4H 4NRZB 1RIVL 3SDXF 1ZANL 4Y19D 3ULSB 4ZFOL 5E0QA 4MAYB 5C0AE 2EDEA 3MTRA 5B39A 2ARJB 1YMMA 3S37L 3DSNA 3WFDH 5FHBL 1MCJA 5ICZB 2DQUL 3F8UB 1U8HB 1ORQB 1NCTA 3OJDB 4LRIC 5I1EH 4CVXA 4OLVH 3U48A 4GRLD 4L3AA 3ZE0F 4XPHH 1CK0H 3UTPD 4OV5B 4XAWL 4BH7B 1ZLUH 5JA8B 1YEJH 1ZMYA 3T0DA 2A83A 4CVZA 4OUUB 3GSVA 2OQJB 5IHBA 4FOMA 4TYUA 4OQTL 2FSEA 5E4IA 3O4OB 1MCSA 5H2BA 1YMMB 3LQZA 2ZUSA 3ARSA 5C0IA 1QG3A 1IKNC 4F57H 1MFEL 4NO0B 4V1DE 3VD4A 3UTTD 3HPJA 1EPFA 3CLFH 3MACH 1CIDA 3MRPB 2ZOKA 3UX9B 1T7ZA 3FOMB 3QFDB 5ETUB 5KVDH 5TQ2L 1WT5A 1T20A 3ZKND 4FXGA 4HQQL 1X4YA 3SDCB 3B2VL 3CMGA 5EBLA 2ZCKH 1QHOA 2XWTA 1OTUC 3UO1L 5FKPB 4CNIA 5J1AB 3ROOA 4FZ8L 3CZJA 2X6MA 3C6LD 2EECA 3UZVB 2JK5A 5AG8A 3EFDH 4PJXE 5DURB 4RAVA 5DJZA 4HWBH 1FZKA 3JWOC 3E6HB 1AJ7H 1UJ3A 3PDOA 3SE3A 3QXWA 4LEXL 4U1HA 2X4OA 4ZS7L 5MEOA 1FFRA 2DTML 4NO3A 4PRPA 1RZFL 5DRZA 1G1YA 2OZ4H 5EUKB 2PYED 4KK6D 4M43H 5DT1H 2C7UA 3A6BH 3FO2B 1ZGLP 5CWSA 1MFDH 4GXUM 3FOLB 1D5BB 1P2CA 4NSKA 2BERA 4Y19B 4DEPC 3MA7A 1NCAH 2VLMD 3TNNB 4UMGA 2R2HA 4NRYA 4JJHA 4ZUSB 2R23B 2Q8BH 1M7IB 2EEBA 4C59B 3W9EA 5J6GA 2DQJH 3DI3B 4EUPB 3NCYS 4P57A 4QYOA 4JO3L 1YMHB 1INEH 2A6DA 3CVHL 3D87B 4R9HA 5BQ7B 1NANH 5DUPH 5BS0A 3VXMD 4EI5C 2HFFA 1CFVL 5SWZB 3ARFA 5D2LE 4HWUA 3DRTA 4P4RB 4YDIH 4Z7VE 5DMYA 1YEFL 2CPCA 4P3DB 5D9SA 1MWAH 1GZPB 1SEQH 2QADB 3MOAL 4RGMC 1EFXB 4KRPC 5BVJB 5D7JC 2GW5A 5BS0E 1A6WH 3ARRA 4PP1C 4WV1C 4PV9B 5HGBA 3HR5B 4GT7A 1U3JA 5DC4B 5D93B 4G7YH 4YHZL 3OPZH 1H8OA 2CKBL 1KLGB 3S3JA 1AR1C 1CDBA 4QY8A 1YC8A 5T3XH 1KB9K 3K81A 2KUTA 4HWEH 5T5FH 4K8RH 4M5YL 3BKMH 1Q9LB 1E27B 1JCKA 4YEEA 5D5MF 5ALCH 2VITB 5KSAC 1KFAL 4PLJC 2CH8A 4MDIA 5C0RH 1ES0A 2NW2B 4MZ3A 1IILE 4BKLA 4OZIA 1OPGH 4JPWL 4R6UA 3MUGA 2H9GA 3DMMA 3H9ZA 2F58H 2EEDA 2P5EA 2Q7YB 4S1RL 2G2RA 5DJ2B 5CIPA 4IBLT 2X1QA 1ZGLM 4R0LB 5IV2A 3VMNA 4YDKH 4F7CA 5KBNC 1Q72L 1YEGL 2VXQL 4P5MB 4Q6YA 1ZVYA 4Z7VF 4M62L 4NC0B 2R1WA 4YGAB 3EW3B 3N50A 1IAMA 1HWGB 2COQA 1E4JA 1FYTD 1I9JH 1J0JA 3FCTA 3QUYA 4S2SB 4ALAH 1YNLH 2R0LL 5A2JH 4OLYH 2P49B 1EAPB 4M9PA 1WGOA 2F8OA 2YPVL 4M5ZL 5IJVB 4KJQD 1A7NL 3VFNB 4MJID 4OCXH 3RKPA 1HN1A 3U46B 2HRLA 2VE6A 3PV6B 4OIIL 1XR8B 1IEHA 3DVIA 4R7NB 1ACYL 3ZTJH 1MCIA 1SEBB 1WC7B 2H32H 1U8MA 2X2YA 1PYWA 5DRXB 4C4KT 2ZPKL 3DARA 4LKXA 4TSBL 2JIXD 4P4KB 1FL3A 4ZAKB 4F15B 3UXFA 3ZT7A 4CN1A 4OCLC 5I74C 1UYWH 1GJIA 3TGXA 2NR6C 3KHQA 3NABL 1AGFB 1OQOA 4WI7A 1JUFB 4XVJH 3GBMH 2FNBA 1B0RB 2SEBB 5C2BL 4QT5A 3WLBB 1JNHB 1J1OL 3DBXB 2CK0H 5CWSB 1VADA 4JLRA 3C5JB 2QR0B 1AO7E 4NHUA 4ZFZB 1IM9A 4U3CA 3VFMA 4R4BA 4L8SB 5L2JB 1RZ7H 4PRDA 3QQ4B 5B39G 1DBML 5GJSH 5HYJD 5F7DB 3U4EA 4YFLF 1Y0LB 4MNQD 1DQJB 3BIKA 1MRFH 4E42B 2N4IA 3SGDH 1YJDL 4FZEH 3B5TA 5LG1A 4ZXBC 2P24B 1UFUA 2ERJB 1EUUA 4OCXL 4H8WH 2ADGA 5E8NB 3ZKMC 1FYTA 2HKFL 3EJZC 1KACB 4K7FA 3QO0A 2AQ1A 5JXAH 1W8NA 2NY1D 3SO3B 3KPSE 4ALAL 5IFJB 1O7VA 2VWEE 3MJ8A 1ETZB 1UENA 3DMMC 5DJ8B 3I2CL 5DD1H 3PWUA 3BD5A 3T3ME 4I48A 2VDPH 1ZSDB 4U6YA 5FA4A 1G7QA 3T0AA 4U7KA 5DVLA 3CIQA 4AL8L 4OCWL 4R96B 3O6LL 1Q72H 4F58L 4J6RL 1G7MB 4PJEA 5C0GA 3L3HA 2MTPA 5JIPA 4B5EA 4MQXC 3SE9H 3X13A 3VFSB 5DMIL 4QRPD 3W11C 2AGJL 2VISA 2BRRL 5GRXG 2CIKA 4UTBH 1CQYA 2NXZC 3UTSA 1MLBA 1WZLA 4JKKA 5L7XL 5M95B 1FVCB 2X4TA 1G9NC 3D3VE 1RIHL 1GHFH 1T1ZB 1G7LB 2I26N 3QUXC 5GS1A 3ECBA 4KJPC 4HGMA 4OZHB 3MODH 2BNRB 3B5GA 3UTSE 5GS1C 3C2AL 2Z93A 5CEZL 1NAKH 1EZVX 4DVBA 1X6LA 5HYFA 5IFAH 2PR4L 5IVZB 2P8MB 3JUYA 4G3YH 1CN4A 3SE4C 5T5FL 5FIEA 2ZSWA 4GRWE 4KROB 4M6NH 1FL3B 2BSTA 1G6RH 2G9HA 2JIXA 2MOVA 4BQBA 4CJ0A 5HYJA 3GMQB 3WO4B 4P23C 1AR1D 35C8H 3GDBA 3ULUH 3G5YA 3L5IA 4OFVA 4BUGA 4KJYB 3VFVB 1FH5H 5C8JB 3GMOB 5TFSL 3VFVA 4OZFG 5DRNB 3RWCB 4D3CL 1NEZA 4QRPE 2ATKB 1VFOA 4PRIE 5C0NC 3GJFA 4QTHB 1M7DA 5D1ZA 1PVHA 4BFBD 4DZ8B 4TULL 4O51A 1A6TA 2ADIA 1CD1A 3MV7B 3DXAA 4QXGH 4DFIA 2RR3A 2UWEA 1RPQA 3QQNA 4I3GA 3N0PB 3PL6D 1P7QB 4GKSB 4UTAH 3ULVF 5C0EA 3FQXB 1N64H 5IJKA 2ED7A 1V3MA 4LLDB 2Q76A 1U3YA 4PGEB 3E6FA 4HLZH 4M8QA 4KMLB 1QSFE 3FQXA 2DOCA 4Y1AE 3RIAK 3DV6A 3U2SA 4LSRH 4HF5L 5GS0D 4HS8L 2VWEC 3IAQA 4KVCL 3QO0B 2XWBA 4WHTB 1BFSA 1MJJA 4I5BB 3HRZB 4JQIL 4LL9A 4NRXB 5HHOE 1VFAB 3NIDE 3AVEA 3SGEI 5HDOA 2OM5A 3L3DA 5FYLE 4FTVA 1AJ7L 3MREA 4QWWC 5GRZA 5ID1A 5CGYD 2VLJB 3H42L 1YECH 5ITFB 3GMNB 3KPSA 5TE6H 1OD7A 3ZKNC 4PY7A 2ZSVA 3KWWB 2AJUL 3MLYH 4P9HH 4X7FC 4LCUB 5L0QC 3HNTL 2JKXA 1KJ3H 4ZAKC 3GMQA 3L6FA 4KTYA 2X40A 1H3TA 1UM5L 5J4MA 5F1NB 4Z7UF 2J4WH 4YK4B 4WY7L 1XF2A 5IEKA 5A2IH 5DQDL 2XA8H 4TN9A 1EHNA 2CO6B 3ARFD 5DHVH 2BCKA 4U7MA 4G5ZL 3X14A 3DVFA 4CAGA 1IM3A 2XOTA 5EU6A 4I3SL 3LKOB 5HBBA 2YWZA 3CNKA 2CKBB 2PETA 4HT1L 4ONOA 4HX1A 4MJ4A 5DJ8A 4JZOA 3IRZA 2NY6B 2IFFL 2YS4A 1G7HA 3GSQA 4D0CB 2WUCH 4LCIH 5JHDA 2EE9A 2FIKA 1O7SA 2W92A 3SJVE 3TVMD 1E28A 2FBOJ 2P7TB 4OF0A 3AREB 4JFOB 1VA9A 4ZUVA 4JHBA 4NDMB 4BSWA 5I8KL 4ZXBD 2E7CA 3GKZA 1RJZB 3FT2A 1A0QL 1VPOL 2OR7A 4OCYL 4OGXH 4OGXL 2KBGA 3LN4A 4CDGC 2PUQT 2NTFB 2XZCH 3BP6A 2FIRT 4GRLB 1KC5H 4ELKB 1I1YA 3IKCB 3AXLA 3JV0A 4XX1E 3RWIA 3NPZB 3PHOB 5AAWA 3WNMA 3AREC 5FHBH 3S37H 1RJYA 4L8CB 1RZKH 1T83A 4P99A 5DHVA 1AGBA 2KZ1B 4PJ9B 32C2B 2JF1A 2GAZB 1Y6KR 5F7NC 5ADOH 2I24N 5F7KC 4F7CB 3VA6A 1F58L 4K3HA 3HN3A 4ZMAT 1JZ7A 3M1BA 2EIZB 2XG5A 4G43B 1T66D 3T4YA 3U0PB 1VFMA 4KTDH 3L5XL 3MRRA 4X7EC 2IF7A 4K55A 2HFFB 4FQ1L 3ARXA 5KSAD 2X10A 2J4WL 3F65A 1QSFB 1KB9J 2CSPA 4ZPVA 1OOAA 2OSLA 5HGAB 3O4LB 4JR9H 3IU3A 4WJ5A 3TZVA 1EA9C 3KYMA 3QUZA 4JKWA 2E6PA 3MRPA 1FO0B 2WV3A 5BVJA 2APFA 2QSQA 1RZIA 4HCRH 1ZEAL 4WI6A 2LE9A 1A14L 4Z76B 4OBSA 3SDAD 1E4KA 5CJXC 3S36L 2GITA 4NJAL 1IM9D 2C5DC 4ZUVB 2A6KA 4I13B 4MD0A 5BCAA 1BVLA 1TVHA 5C0JA 5CGYC 2AJVL 2IAMB 3I3BA 5CJOL 4F33A 2EIEA 3U9PH 1U95A 3DX6A 1HEZA 5EC2A 1UJ3B 3MYJB 4HZAA 3UZQA 4Q9RH 4PGJA 2V2XA 3OKOB 4MCZA 3N85H 2X4NA 2HYMA 3C6SB 5F7UA 4D94A 1IKFL 1NFIB 4MNHA 5CJQH 3U7YH 5I66B 5A3ID 2HLFD 3LRSB 3P9MB 4OLWH 4HAFA 1GZPA 3WFEH 4F2MB 3F5WB 1DL7L 2WUBL 3D0VB 3MV11 1ZT7B 4KH2A 2FIKB 4J3SA 5IB3B 2Y36H 3EOYG 3MRDB 4NHUB 4ODHH 1RMFL 1T04B 3P9WB 4OZFH 1KTRL 3GIZL 3TVMA 1BFVL 5E03A 5CJ8A 3L7EA 5TFSH 2J5LC 5CCKL 2VZ1A 5CZXC 1JGEB 4YFLI 1NAML 4DGYL 4KKAD 2V17L 4I2XB 4A2MA 3CZFB 2YK1H 3F7QA 4RGNC 2WBWB 4P9ML 1ODAA 5HGAA 3VWJC 4XCEB 5CEYB 3X12A 1KIUA 1GAFL 4P23B 1VDGA 4TSAL 5D2NE 3MJ9A 3WS6A 4Z7QE 4Z7NF 5DJXA 1S9XB 3BEWA 4B0MM 5IFAL 2WMPA 3WXWL 2HKHL 3UAJD 4Y5XA 4L3CB 3HC3H 3AAZB 3BYTA 5I8OL 3RGVD 1SJHA 1HHHB 3NVQA 3ULUF 2P5WD 4PJIB 1IGJA 2ADJA 4KUCF 4JVUA 5ISZA 4BH8A 2PO6D 1MIMH 3PGDA 3PHQB 3MRFA 4R3SB 5D6CB 1T4KB 4XRCB 2W0FA 4U1HB 1J7VR 3WUWA 4Q9QL 4GRLA 4X6DA 4XWGL 4LHQB 2UVEA 5GSVA 2V2TB 3FOMA 1MCWW 2C3VA 3HE6A 1YEIH 2DLGA 1FG2A 3QPXL 4PRAA 1Q8MA 4Q7DA 5JOPD 3CSYA 3WLWD 1K8DA 3G6JA 4ERSL 2FX7H 4R0LA 1RJYB 4P2OA 4ODUB 1T5XA 2GTZB 5DD1L 3I2CH 3GK8H 4BK4A 1OHQA 5IESH 4V2CB 5I0DA 1WJ3A 4G6ML 2G2RB 3BE1H 4W4OC 5DQ9A 4ZOBA 5JXAL 2XQBL 1T2XA 1TZHA 4Q6IC 1NMBH 3LKNB 2P46B 4NWUL 3G5XB 1NPUA 1JGVH 1QFHA 3LOWA 1S7WB 2MHAB 1Z3GH 3LEYH 4NIKB 5KG9A 4OZFB 3SDDA 3W2DL 5INCB 1NBVL 4M7JL 3QFJA 4FZEL 1NDMA 3SDDC 4O2CB 4IRZL 5HHNB 1AO7B 1F3DJ 3UYOD 1B0GA 4LRIA 1DBMH 2JCCE 3BKYL 5GJSL 4DKFL 1J0IA 1QD0A 4KMTH 4Y4HB 3VDBA 4R4BB 4N8CH 2BY1A 1DN0A 1S3KH 4NM4L 3Q6GL 3BPOC 3BHBB 3GMPA 5C08B 1V3KA 2NY7H 1ZWIA 5C2BH 2JCCA 4LSTL 3QDMB 2KKQA 3EO9H 2MHAA 4LVNC 5EO9A 1WEJH 2BOCB 2EYTB 2YEZA 3BJLA 1S7SB 3MLVH 1V7MH 4P4RA 5LWYL 2BVQA 4I0PD 1U92B 3CD4A 4QHKI 2HFEA 4OAWB 3GJFK 3C5SB 1RIUL 4JO1L 1D5IH 4RGMB 1G1CA 2GUOA 1QUNA 3AROA 1KBGH 1FC1A 1MQ8A 5TF0A 5C1MB 1C12B 4OGZA 2AJSH 5ESVB 5F9OH 1AY1H 1ZHLB 2DS4A 2APBA 2GK2A 1IC1A 3IAGC 2MPAL 1G7QB 4IIQA 1EMTL 1ETZA 2CJUH 4QTIL 1NGQL 4KMQA 2ZP0T 1GC1L 4WDIA 3UBXI 2YPVH 4M5ZH 5IMLA 1UWEH 4X0KA 3QA3A 5IG7A 2OTUA 2D7QA 1U92A 2VR9A 2YD4A 3IRPX 1H15A 1H0DA 4NFCA 3DV6B 4F9LA 1DEEB 3MJGX 3OWEA 2Q6WB 3MLTA 3JV6A 4K2UL 4GSDH 4IOFD 5I1KL 2WINB 5E4EB 4M62H 3WUZA 4LLWA 3BZFB 2X4UA 1Q1JL 5GRUL 1LO4L 1UM4L 1JMXA 3LS4H 1JYVA 3G5VA 4M7ZB 5J6HB 3TO4B 2CD0A 4GG6B 4HMCA 4JM4H 3FONA 1MCPL 3GMRB 5E2VL 3RWJB 2EDTA 3ARGC 3BKJH 1CLOH 3O9WB 2R4RH 3QRGH 5ISZB 3U9UB 3JTTB 3OF6D 3T4AB 4ETQB 4JPWH 5ELIA 2F5BL 1WK0A 3GSNB 5C0FB 1X5JA 4E41E 1V3LA 3ES6B 1H3PH 2PN5A 4RNRA 4ZNEA 4NN6B 3VW3L 4NKIL 1FVDA 3VXRD 1BJ1J 1F5WA 4OGYL 1CICA 1I1AD 2CLVB 3BAEH 5ITBL 1X44A 4RMTA 2IANB 4K8RL 4DN4L 4LCCA 1I7UB 4GG6A 4XHJD 4PREB 1S7UB 2CKBH 3OTTA 4FQQB 1FLRL 2GTZA 2R2EB 5LCVL 4IRSA 4WI4A 1SEBA 1WC7A 3T77A 3SDXA 1J8HE 2BNRA 4NQCD 4PJGB 3H6JA 2P8LB 2JCCB 4Y4FA 1EEYB 3Q48A 3STZB 1X9QA 32C2A 4XCFH 1NGYB 1ZLSL 3BDXA 3ZYOA 3FT3A 2BSED 3ARZA 4YR6A 3WNOA 1YEFH 3NACH 5IB2A 2BFVH 1QEWA 3CJJA 3WFHA 4F7MA 1CGSH 3DVGB 1HH6A 1Q9WA 4ZPTB 3VXMA 1BZ9A 5J0BA 2BMKA 1CXKA 3GJFB 5IQ7L 4JO3H 2D9CA 2FB4H 25C8H 3BP6B 1B0RA 4R7DA 5DZLA 2A9NH 4ZUUB 1TNNA 4BSVB 1ZHBB 4JY6A 4JFYB 4MAUH 4X5XA 3FB5A 4TVPD 4HPYL 3UYPA 3PWUB 3QHFH 4AENA 5KSAB 3A6BL 3KJ6H 1NC2A 5DJAA 5IB4A 4YHKH 3VGGA 1JPSH 2AABL 2H2PD 4OCRL 5T5NG 3CFCL 4FXLA 4CUCA 3Q0HA 4WFEE 4YGVB 4ZUTB 2A6KB 1HH9A 3CK0H 4JFQB 5HYQA 4S1DD 5FYJE 4LEXH 3FFCB 1A47A 3B6SA 5D93C 1A4KA 3U36B 4PLKC 5F72S 4GW5A 3FN0H 4JDZA 4X6BA 1KXVC 4CVWA 4MCZB 3DUHA 1JN6A 3BGFB 2YD3A 1QQDB 3I75A 4ONFL 1XEDA 4CJ1A 3T1WA 5E08H 2XN9E 1AP2B 3VXUA 4PJ7E 1EO8H 2WBJA 3DWTA 1BLNB 2JJSC 1DQDH 1M6OB 3FQRB 3S4SB 1KLUA 2VXTH 4OSUH 1IGIL 5TQ2H 4L4VE 1MCEA 2AS5M 2XKUA 4Z7VB 3HZVA 3P0VH 1NH6A 1WZ1L 3CLFL 3L7EB 4WUKL 3NOIA 3VJ6B 3QUMA 3VFGL 5FUOL 1CGYA 1CFSA 3ULVL 3ARED 1F42A 1RUQH 3PL6A 2B20A 4ZS6C 5FYLH 3BRGC 1IT9L 3QIUC 1ONQA 3ARVA 5INDB 4UQ3A 3K4DA 1MFBL 2P8LA 1AGEB 2L4OA 1LEIA 4HIXL 3NIFF 3CSGA 1C16B 5IHLB 3FJTA 4QGYA 3TNMA 4L8CA 2YSSA 4IMLA 1T1XA 4ZO6A 3WEXA 5D8JH 1MCFA 5IEKB 3WFHB 1QOKA 4LOUD 4NO5A 2AI0H 5FYJH 3FQUB 4GG8A 4JFZH 3SDCC 1LNUA 2H41A 3QCVL 3QFDA 4ZXBA 1ES0B 2NW2A 3MOBL 5HPOA 3VMPA 3TWCL 4JFYA 2W07A 4X5XB 2AEPH 4RDQG 2ADFH 4NO0D 5CP3H 5FYJD 5GGUB 5GGRA 4Z0BH 4P3CL 1LDPL 1CR9H 4QRSB 1BVLB 1A02N 1BAFL 2VERN 4RFNC 5GGRB 2D7TH 1OM3H 5HYSG 5C0CB 3QP3A 3IYLW 1YC7A 1A7BA 2UZYB 1Z2KA 5I30H 1K6QL 2FWOA 5IK3B 2EXWD 5ANME 3BP4B 3ROLA 3EDKA 1M71A 3DRQB 4JB9H 1X4ZA 1FP5A 5D70L 1S9KC 5JW4Q 4MA8L 5I1HL 4UAOB 2F54A 2NY3B 3FMGH 4XPGL 5IT2L 3PP4H 4HJ0C 3FFCE 1NCBL 1NUFA 1ACZA 5C0ND 4ZTOL 2BNUA 4OFYD 1QLRB 3RFZC 2G60H 1LO0H 1CFTA 4YBLB 4Z7UE 1B0GB 4D0CA 1S7TA 5C6TL 3D25B 3C08L 2K3TA 2OQJA 4XPBH 5JHLH 3IDUA 1PGRB 3GUTA 3VI4F 5CD5D 5I73B 3O2DH 1PG7L 4LHUA 2AJYH 1KN2L 2YKLL 4TNWK 5F3HB 4FMFA 3M8OH 5DA4A 5H35A 3AY4A 3BN3B 4ODWB 3WSQH 2RCSL 4M93C 5K9OA 1BMGA 1P9MC 1TCRB 5LQBL 1T0MA 2HN7A 4JREC 3T3MF 1SYSB 1OLLA 1I4FB 4YX2H 2HFEB 4OAWA 4ELKA 2OK0H 1MQKL 3ZT6A 4K7PH 5EU7E 5KS9F 3ZZ1A 5ADPL 1TJIH 4EI5A 3MRMB 5DMJB 1SY6L 3IXTB 4DCQB 3MV8A 1GC1C 1KJMA 2ZJSL 4PRHA 1A6PA 3K46A 2W38A 4PJIE 1U8NA 4TVPE 1WCQA 4P46A 4Z95H 1L7IL 3RX5A 4LIQH 1LMKA 1IGCH 3AREA 3NCFB 2VDQH 2V5SA 5I1JH 1AD0A 3GRWH 4PRDB 2Q86A 3FZUC 4LSSL 1JE6A 1MAKA 3L7FA 3V2AR 3HFMH 4FRWA 4HJ0D 1FRGL 1WFNA 2Z91A 2D31A 3B3IB 1QPXA 3KPNA 2XZZA 1REIA 2EXYC 4G7VL 4OLUH 1R0AL 1A8JH 3NN8B 4D9QD 1KPRA 4XPTH 4C57C 1T66C 3QBTB 4YIQB 3WFBH 3KPOB 3MLTB 1EGJH 4AG4H 4MXWL 4U6TA 1M7XA 2VUOA 1J8HD 1MCOH 4OM1L 1S9VA 5C0DB 2E6QA 4OD1L 4KVNH 4JANA 2W91A 4CMMA 4K94H 4H0IA 4GXVH 1MNUH 4U1MA 2EH8L 1IAIM 2GSIB 3V9FA 2XXMB 3AS1A 1EK3A 4RFEA 3E8UH 5B38A 3FQNA 1FFQA 5EN2B 4DFHA 2ORBL 4P2CG 4HGWA 3VWJB 1RK1A 9CGTA 1V5JA 1WT5C 3O41B 2KZWA 4YXHH 3BWAB 4MXQC 1INDH 4L3EB 2HLAB 3PP3H 5BS0D 5IF0B 5IFHL 4NO2B 5DR5L 5DK2A 5C7XH 2J8UA 3UTSB 3E0GA 3U6RB 1LE5A 3VDAA 4P2RE 5JPNB 2OL3L 5E6IB 4PJFE 1D9KA 4LSPL 3BJ91 3PWLA 2AXFB 5F9DC 3D0VA 5KS9A 2DQEL 3QI9B 5HHNA 1E4XI 5E2TH 1I8KA 3O6FA 2B8OT 3IB4A 2BVOA 4D9LH 4QT5B 2RBLA 1WAAE 1R3LA 3CSYB 1G7PB 5KVEH 4IIQB 2ZCHH 2FEEL 4NZTL 3SDXB 1FCGA 1DBKL 3BIAX 1XT5A 5E9DD 3MNWA 4NPYB 3HG1E 5GRYA 3WD5H 3QHTC 3RJDA 3WIIH 1A6UL 2JIXB 1CDYA 4OJFL 4U6XA 2X4PA 4K9EL 3H0TB 3RDTB 1FL6A 1FFNB 2R8SH 4N90E 1FO0H 1P9MA 1K2DA 2J2ZA 2EKSB 4AIZB 3EO0B 3GMOA 4KQ3H 2F74A 5ICYA 1K8DB 1KJ2A 4RGNB 4UQ2B 4KQ3L 5I74B 3BQUD 4MJIB 4OGAC 1NEUA 4JG0H 4ZUWA 1J8HA 4KZDL 5GZOD 4L5FH 1EO7A 1IFHH 5CUSH 4JDTH 5DEGA 3EYOA 2DI9A 4Q97A 3VFPB 5F7EL 4UOW1 1JK8B 3TIDB 2B4CL 1RUAH 4WRLA 2CDFA 5C0BD 3RNQA 3HNVH 4ZFFA 1NUDA 3BPNB 1ZHKB 2EYSA 2YEZB 2IMMA 5JMOC 5D4QA 2F53A 5C0GB 2VDRH 5D1XA 4DW2L 5KVEL 3SDDB 1HINL 2Y25A 3QCTL 3N9GH 3S96B 5E8EB 3T0XA 4D9LL 3T0BA 4H26B 4KKBD 5MENB 4PJ5A 1UWGH 1VESA 4JRYA 2OJZL 2DQDH 4Y4HD 4U05A 5FEBA 3VFMB 3ARDB 1YEEL 1EDQA 4KV5F 1AGDB 1P4BH 3K74B 3LEVH 4GAGL 3MRLA 5HYEA 4JFDD 4TNVK 4W81A 1KCUH 2DL2A 1PYWB 5HDBE 3TN0C 1YY8A 3UBXG 4LRNL 5GGSY 3BP7B 5HGDA 5LGHL 3VXSA 8FABB 3RIFF 1PQZB 1ZSDA 4U6YB 1E4KC 3VCLA 5CJXA 3ZDXF 1DCLA 3JWOL 5EOCL 3BDYH 5LGJB 3O2DA 3O3DB 3UCRA 1DDHB 2D0FA 1UZ6F 3S34L 3H3PL 2ED8A 3TM6A 1N59A 1HILB 5FAAA 3MLZL 2IPUG 5IGXH 1FYHB 2E8ZA 1UACL 1QSVA 4OM1H 4X7DC 2VDNH 1QTYT 5IOPA 5DI8A 2NXYB 5IVNA 3QG6A 4K7PX 3MXWH 4PJFA 1AXTL 3PV6A 4WEMB 1P4IH 3HZKB 5KJRL 1EEYA 4P2QE 4OD3H 4PJDE 3UAJC 4PJFB 3MRIB 4L4VA 3VG0L 3C5ZD 5ISZD 3MX0A 4X8JB 3B8YA 4MB4A 4TUKL 3MBEB 5EU7C 1WIOA 2DTSA 4NFBA 3INUH 1JI1A 3FO0H 2GCYA 5JO5B 4JDVB 5CLWA 1CICB 1FIGH 4EI5D 3ULVD 3RUGA 4BQCA 1A9BA 1OTTC 1BZ7A 1UZ8A 4G9FA 4XMKL 3VJ6A 1SVCP 1KELH 3LKPB 3QEQB 5KTEL 3FAWA 1I9EA 2E7BA 3AM8A 1A2YB 2W59A 3Q5TA 1HE7A 3ZYZA 4RQQB 2NQCA 3S5LG 1NCUA 4UU9B 2BP3A 2AJZB 4ELMB 2YRLA 5DEZA 1F90H 3DURA 4M48L 2V5MA 3CXDH 3LIZL 3KLAA 5LQBH 2VN4A 1I8IB 4BZ2L 3KPQB 3H7BA 4ELMA 4QHLA 5DMGC 4IIQC 5LAXB 4JJ5B 2J3SA 4UT7L 5F1SA 4Y4FC 3QQ3B 1F4HA 2ZG2A 4LARL 4HKBB 4N90D 2M26A 1HXMA 3BUTA 4LLUB 1J10A 5GRWA 1KCRL 2Q76B 5JHLL 4Z7OE 4XPBL 2Q6WA 1UKTA 3SO5A 4NQXA 4EDWL 5C6TH 5CINH 5KSUB 2CGRL 1QFWM 3I3EA 4GG8B 4XNMB 1ZA6A 4JFXB 1ORQA 1MY5A 1Q94B 4ODSH 5D1QA 4ZTPH 3DURB 3C5JA 1TFHA 4JGJA 2HT2C 5EBMA 4X7SL 2Z0BA 5SWSA 1QQDA 2B1HH 1FZJA 4IS6B 4L4VB 4UT9L 4M7LT 5ACLA 4RFOH 3MJ7A 1OGAD 5KSBF 1J1PL 3T65A 3EYQC 3WIHA 3BVNA 1K6QH 3C6LC 5I30L 1UC6A 2X5PA 4NN7C 5GJTH 4G8IA 1WQVT 2X42A 4JAMB 2D7TL 1OM3L 3NFPB 1BAFH 4FFVC 3BMVA 1KG0A 4YFEA 3VXMB 1CR9L 5I1IL 2L7JA 3C60D 3GI8H 3DTXA 1EVTC 1KEGL 3FAXA 5TDNA 4MJ6B 2VR5A 4B7IA 2YPLD 2IPKA 4G9FD 2ZUVA 2YZ8A 5DZOA 3U0TB 2HG5B 4LQ1A 1OAUL 1MLCB 4MWFB 4XXCC 3MJ7B 1HIMH 3QFJD 4ODXB 5C9JB 3D39D 1MVUA 4HUVB 3MCLL 3W39A 1EFQA 1PY4A 2MCG1 2W9EH 3RBSA 2ZUQC 1U58B 4PIRF 3QG7H 5DD3H 4PLNC 1BQSA 2HFGH 2ESVB 3BZ4A 2D0HA 5JHDB 4YC2B 1JTOA 3V5HA 3VFSA 4K71B 2ZUTA 3DO3A 3TT3L 5GHWL 5CLTA 5DF0A 5FK9A 4N8VA 5LXGH 4FG6D 4ODBD 4X6BB 2X09A 3I84A 2JK5B 2UUDK 4HKXB 5HY9B 1ND0B 5F8RC 3GMMB 2DLTA 4TQEH 3FT2B 1S78C 2XQYK 5T1DH 1IT9H 3LKRA 3GO1H 5DI8B 4H20H 1GZQB 3SKNB 1KB5B 5FYLL 3TN0B 4C56E 1S5IL 3D2UB 1I85A 3BUYA 4V1DA 5DD3L 3ABZA 4MAYC 3MRKB 3DMMB 4WW2C 5FUOH 3RVXC 2BSRB 2NX5A 4Y1AD 1FNEB 3NZHL 4KHTH 5CZVL 4JKMA 4J12A 4Z7QF 5DYOB 2P5WB 1HHIB 1L0XA 1W0VA 4QXTB 3CFDB 1OAUH 2JJVA 4ELME 3SGKA 2JB5L 1F3DH 4PJGF 1V3JA 4P2YA 1N26A 5T1KB 1IGIH 2DM4A 2W9DL 3FZUD 1NBYA 3UBXA 4KK8C 3M17A 2YPLB 3UTTE 1DTUA 5TE7H 5EU5B 1S8DA 3B3IA 4P48A 2CUIA 4HH9B 1MCWM 2VUYA 3F12A 4HS3B 4GBXD 4XRCA 4OLZH 5DDHB 3DX9A 1I9IH 4Z7UB 5FO9A 5GSRA 4N1HB 4YWGL 1EX0A 4J3XA 3N1GC 4Y5YA 1M7DB 5D1ZB 4LCWD 3SY0B 2FX9H 4OD2B 3UTTA 5F96L 1H3XA 2OL3A 3D39B 2DLIA 3MMEB 4N68A 2C1PB 3QUKB 3BW9A 3OBAA 4QOKD 5GQBA 4L3CA 3KHOA 3CX2A 3NCYP 4XB8A 4ZTPL 4JFQA 4RMRA 5HVHB 8CGTA 3IKKA 2AABH 5SWZA 2Q86B 2RGSA 4RRPA 4NQEB 3LQMA 5CINL 5FHAL 4P57B 1KTDA 2M1KA 3QHFL 4U31A 2LVEA 4L1HA 3D9AH 1D9KC 1IQWH 1IGMH 2ZOKB 4I2XA 3MFFB 5KG9B 4GW4A 1NCNA 4OI8A 3LH2L 4C55A 5TPWH 4E41D 2PO6C 1KENL 1CVRA 2IBGA 4UBDC 4FTVB 1BD2B 1QA9A 3GIVA 1A3LL 1PZUB 4IS6A 5KS9B 4MB5A 5SX4I 3ZKXB 2QSTA 3IDNA 1CGSL 3MNZB 4NM8L 5EUOA 5TGBB 3MRJB 4WCYH 4MA1C 4U1MB 3OV6A 1UT9A 4KC3B 1W72H 1J0KA 5IB5A 4IRSC 1XCTB 1QSEB 5H35B 3BESR 1K4DB 2WP3O 2CDEB 4Y4FD 4KXZH 5HY9A 3VWJA 4XMKH 4GH7B 3LN9A 5EWIH 3BSZH 5A2FA 4OTXL 2XN9D 2R56H 5D1ZD 4Z7WE 2EZ0D 4Y5YB 2WWMD 3CFEB 3FT4B 4G8FB 4F7TB 1RFDH 2OTPA 2VDMH 4XBPA 2DWDA 3B9AA 5F70A 3VXUD 1CFTB 1FV1B 4JY4A 2GKIA 5I9QB 3VFWA 4JM2C 3U6RA 1LE5B 2NY1B 3I6LE 1J0HA 4DN4H 5BV7B 5CEYA 3BAEL 1MSPA 2X4SA 4NN5B 1A22B 5EO0B 4EN3A 3DOSA 5AUMB 4M61B 1X5ZA 3MUGB 4YPJA 4NKIH 3MRCA 4YEFA 3J8F7 3V6OE 1F02I 4OZIE 1NMCC 3V7MA 5GGSB 2Q3ZA 3RIFK 1XR8A 2P44B 4M1CD 1XGPB 4GMTL 3AAZA 3LPGA 2F5BH 1TIUA 2HJLB 4I0CC 2AP2A 3VXTA 2EH7H 2VDNL 1CLOL 5JZ7C 3DROB 1KJVA 5DRWB 4XP9L 5E2VH 3BGFC 4JQVC 5DDHA 3NA9L 2DWDB 3GEWB 5CS7A 3RVTC 5T33H 1HI6A 1BIIA 3JWOH 5DA0B 5EOCH 3UJJH 3HHRB 7FABH 5GRUH 1UM6L 2YPLE 4HS6A 1DUYB 1CLZL 3VI3E 3VXRE 4UDUA 3KPOA 4FP8H 1G7PA 2IGFL 4K2UH 5I6XC 3KPMA 3L3GA 2AEQH 1PD6A 2Y6SD 3HE6B 5ISZE 5CP7A 3N1FC 1KCUL 3HUJA 3PWNB 2DJSA 4WFGD 3LEVL 1ITCA 1RZGA 3K80A 1CE1H 2DQDL 1UWEL 4EUPH 1RY7B 3ZE0E 3MRFB 4PJAA 2E9BA 5DQ9B 2VABA 4R8WL 4NQCE 1VACB 1ORSB 4WFGE 1WZKA 2WM0A 4X6EB 3QFJB 3N9GL 1JZ3A 2ICEA 4LLQA 3JZ7A 1NFIA 4MNHB 4M00A 4M03A 4X5WA 4BJLA 1FG2B 1TLKA 2AJSL 5I8CB 3QEQA 4DVRH 4Q6IB 3QUZB 4HZLB 3S5LB 3QI9D 5DWUL 1D5XB 1S78D 3ZL4L 3MV9E 4P2QA 1XF3B 3RVUC 5F7EH 1PLGL 5MERA 2PO6A 2VXVL 5CUSL 3MCKA 4QNPE 2GITB 4QCIA 5IW1B 1BD2E 1HYSD 4LLAA 1DANU 1P7KA 4MS8C 2CR3A 5C09E 1K3ZA 2NY3C 3IGAB 3IAPA 4KKBC 1OTUD 5C6WH 5FGCE 1RHFA 3S96A 4E0RA 4FQIL 1NGWB 5J9PA 1DQJA 3BIKB 1ADQA 2H2PC 1WF5A 5D9SB 3RHWF 1R5VA 2DBJA 4G6AC 1JPFB 3PWJB 1U91B 1DBKH 2EE6A 4NUGL 1GOFA 3EFFA 1C7TA 2VAJA 4PUBL 3HI5L 1C1EH 1SJHB 4Y88A 2XICA 2PCPB 1LEKA 3KPSB 3MXVH 3U7AA 4POZD 4MZ2A 1QACA 4Q74A 1JGVL 4MCYA 3ZO0A 2DQEH 5BV7H 2GT9A 5JW5A 5JR1H 3U1SH 1U8KA 3R4DA 2BVTA 3EAKA 3FRPA 3V95A 4AMKL 4YGVA 4HK3N 2UY6A 1D6VH 3KYNB 3LV3B 4PRNB 4R4ND 4WU7A 3SCMC 2IADA 2OJEB 1J18A 4OI7A 3O3DA 1TZIB 4ERSH 4XI5D 3IU4L 5SX4H 1MCQA 3HMXH 2JELH 1JWSB 3BFOA 4R90H 4YPGA 3VFNA 2WINA 5T3ZL 3BI9X 5FM5M 3CVIL 2UV3A 3QG6B 2A6JB 4GRWB 4QCIB 3RVVD 1FORL 4XAKD 4K3JL 3DXAB 4OD1H 1I1CA 1F00I 2NX5D 2V9TA 3MLRH 2ID5A 3UC0H 3SEPA 3KYOB 4LGRB 5C07E 1CL7I 1R5IA 1FVDB 1YPZE 4GRWF 5E8EA 1UH3A 1CT8A 1HXMB 4O9HH 2HKHH 4DN3H 2FO1A 3OB0K 3V4VH 4AIZA 3QDJD 3ESVF 3V7AG 1EV2E 4J3OC 1K5NA 1A9BB 4HK0B 3MO1B 2PW1A 4HLJA 2YRZA 1CBVL 2VSCA 4YZFE 4OFPA 2EDJA 1IGCL 4WGWB 3QXTA 5IMOA 4QRPB 1QVOB 1AP2A 1U8JA 1A1OA 3EYVA 4KGJA 2ZJSH 4S1DC 3MV9B 4XBGA 2Z31A 1SY6H 4HWBA 2BDNL 3FHQA 1MWAA 2R4SL 5D7IE 1L6XA 4P46D 1TJGL 2BDNH 4IJ3C 1O5DT 3C6LB 3RY5A 4L9DA 4YXLH 4LASH 5DK0B 1MRCL 2BMKB 3O2WL 4HAGA 5KVGL 3LQZB 2QADC 3HB3D 2RCSH 1OT2A 5JOPE 3V5DB 4LCCB 3F12B 4I4WB 3UPCA 4R4FL 3CFJB 3M8OL 3RZCD 3K0WA 5E5MA 1QKZH 2VZ3A 2D9QB 4MJIA 3KXFB 3M45A 2BY3A 3QDMD 4QHNB 2V5TA 4PJGA 4Q9RL 2IAMC 3D85B 5B3JF 1IC7L 2HVJA 1XCQB 2HT4D 5FV2A 1NGPH 4X4YB 4FFZH 2G60L 5BJTA 1A7QL 3QT2A 3L5HA 4HC1H 1WV7T 1QR1A 3FRUA 2R9HC 1DSFL 1TPXC 5CILH 5ABDE 1DEDA 4MX7B 3TEUA 4UV7L 4LCYA 4HWZA 3RTQC 5ACZB 1FJ1B 3LEXB 2MKLC 5DRNA 1A2YA 3OKNB 1FIEA 5K9KA 3S98A 5J89A 4MQXD 4O58L 5EU6B 1PKQB 4WNQA 2Y1VA 1XF4A 3SY0A 1NC2D 3SJVB 1W72A 3L5XH 3VWKC 3ET9F 3HE7B 4N0UE 4X83A 1W0YT 1W72B 1P4LA 1QFOA 1YA5A 1WZMA 5SX5K 1NEZG 4Y7MA 4K94C 4X6FB 3U1SL 3TWCH 2MFNA 3KYKH 4HFUH 4WI9A 3D0LA 5E7FA 5IEHB 2EDXA 3VI4E 3ROOB 2CDEA 1JMZA 3TCLA 4EIZC 3BZEA 4JFZL 3ROLB 4K8RC 3VXUE 2GK0B 1CU4H 3WIHL 3NTCL 3HRZA 2W60B 4NUGH 1VGEL 5EOCJ 1GGIL 4JO4L 3GSRB 2A1WH 2QQQA 1T21A 1KB5A 1L9NA 3GSVB 1N0XH 3V0VB 5EORL 1MAML 4BM7A 1D6EB 3RGVB 1WSST 2EYRA 4Z5RB 2C1PA 1GVIA 2UWEE 4Y19A 5DVOA 1KN4L 1YYLH 5I8KH 5E2WL 4YNYB 4PG2A 1T2QL 4HCRA 4JKPH 1FDLH 1I3GH 4JO2H 3RZCB 3DVGA 4FABH 5D1QD 1U8HA 4J1UB 3VFGH 2IFFH 4HT1H 4EI6A 1PKQA 3BMWA 4XTRD 3ZL4H 4XC3H 1B6UA 3CGTA 4ODXA 1S7XB 4G42B 2V6HA 4LSUL 4IOSD 5I1DB 1DUYA 1MAJA 5ILTL 4OSUL 5DS8B 3IXTA 5HHOA 2HJKB 5DJDB 3SKMB 5GS0C 4P59L 4Z7OF 1FHGA 3TFKD 2XA8L 2P43B 4P5TA 3C9NB 3SOBH 2MSPA 5DJ2A 1BBJB 1DFBH 4ETYA 2R1YB 5E08L 3RZCA 4I3RH 1S5HB 2C4FU 3KPRB 3AMLA 3HNTH 4U49A 4MAYD 2AJUH 4P9HL 3VRIB 1BVKB 3OJVC 5BRZA 1VEPA 4POYA 4RIRB 5K9KB 5K93A 3PWPD 2APTA 4GW1B 3V79C 4NO0A 4HBCH 1M05B 1PEZA 3LVEA 5FYKH 2VXUL 4JQIH 2R0ZL 3DV4A 3RVTD 4OCRH 3UJJL 5T33L 2X9WA 3KJ6L 3T2QA 3DHMA 4Y4HA 3N1MC 5CGMA 3T2OA 2PF6A 1TVDA 5C0DA 4HMDA 3QCUL 4PJBF 4P2OB 4HPYH 5CBAB 3QUXB 2MCPL 1RK0B 2EH7L 1JGEA 4NQVB 3CU7A 2IJ0C 4I2XE 3D0LB 5IIEA 4EDXB 2FB4L 1QR4A 1JYWA 4N8VB 3QDJA 5B3NA 5FKAB 4LCWB 3U4BL 3HB3C 3WFCH 1UXWA 1BEYH 1EZVY 2VSDA 3QULB 3RJQB 4Y2DD 1ZS8B 2BFVL 3NACL 3OJMB 3PL6B 3OJ2C 4TULH 1YMME 3NCMA 2YZ1A 4NO2A 1ZLSH 1AXSB 3D18B 2C4FT 2E7HA 1QFWH 3IFLL 4R97C 2VAAA 3MCG1 4P46B 4OZIB 4BK5A 1MVUB 4HUVA 5I66A 3NBNA 3ULUE 5HHVL 3MRBA 4Q9BA 3T0VA 3ULUL 3NIDF 35C8L 2ZG1A 4UIKL 3SKUD 3FOLA 3W9DB 3EYQD 4WV1A