4HZLB

Neutralizing antibody mab#8 in complex with the epitope ii of hcv e2 envelope protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
b'DVLMTQTPLSLPVSLGDQASISCRSSQSLVHSDGNTYLEWYLQKPGQSPNLLIYKLSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a bifurcated mode of action in the antibody-mediated neutralization of hepatitis C virus.
pubmed doi rcsb
molecule keywords Fab heavy chain
molecule tags Immune system
total genus 47
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzlB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hzlB01
5D1ZD 1J1XL 1YYLH 1P4BL 3U6RA 3S34H 5IHBA 2R56L 4TTDD 3RVXC 3CMOH 3KR3L 1I8MA 3MYJA 1Q9OB 2IH1A 3L7EB 5F6HI 3ARTA 1TFHA 5IJKC 4P2OA 5JW3H 3BE1L 1UXWB 3MV7A 4EZMA 4IJ3B 3QUZB 3MRBA 4G6FD 4OGYL 4PP1C 4WVRA 4FS0A 1A2YA 1LK2B 2B1AL 2DIBA 4L8DA 4QHNB 2P8PA 3TO4A 4G9FE 1CICC 2Y72A 4HGWA 2DAVA 3ECBB 4KRMB 4B53A 1A3RH 4L8CA 4XPGL 2R23A 1LK3H 1UCTA 1CGUA 1HHIA 5KVFH 1J1OH 4PY7B 1QLRB 4KKLD 4F58H 4B7LA 1UCBH 5ETUA 3GSQA 1BREA 2DD8H 3BMWA 4TOYL 4D94A 2UUDK 5D7LD 1C08A 4UT6L 1JV5A 3MV8A 1LE9A 1CU4H 3B5TA 2VLRE 2EC8A 4Z18A 2VZ3A 1KPVA 2R1WA 4QO1A 2ZPKL 1RZJL 1FV1A 2HA1A 3GSWB 5ILTL 3T3MF 4Z95H 2QEJA 5J89A 3QUMA 1NCWH 2Q76B 3H3BC 3VXRD 3D39A 5FB8A 1U8HB 2A83B 5MEPB 3CK0H 5FM4A 4ZUSB 3TN0D 2XPGB 5HYQA 1SJEA 1JNHB 2AS5M 1A3QA 1QFHA 1A1NA 4XPAL 4PJ5D 1TJIL 5FFLA 4O2CB 2CH8A 1S78D 1S7TA 5K9OB 4L8SC 2ED8A 5GJTH 2N56A 4RIRA 2CMRH 3MLWL 4DAGL 3T0AA 1X7QA 1KCLA 3L5IA 2AW2A 5EU4A 4JRXE 1NL0L 3H9HB 3NCFB 3QAZC 3DROB 4RFOL 4NZUH 4IRJB 1DBJL 5CIPB 5IP4A 2IG2H 5BV7C 4KKCC 1OAXL 4GW4A 3WFCH 1P9MA 4N0CD 3N1QC 2DMCA 4NQSB 5CHNA 1TZIA 4XP4L 5IGXH 5HHNA 5H2BA 1Z5LA 3LB6D 4M7JH 5F1IB 2XT1B 1TETH 5SV3A 2GIYA 4RGMC 4NJAL 1MCQA 4Z7WA 1JPTH 1P1ZB 2W60A 5D7LE 3MCG1 1I3UA 4X6CF 3B9KD 4OFDA 4MA3A 5TE6H 3NA9H 5BW7A 1TQBB 3SDXE 3VXUB 3TVMA 1D9KD 1JGEA 1MLCB 1D6VL 3O8XB 1S7RA 3VXMA 4NCC2 4O5LH 3U46B 4HWBH 4KU1A 3RGHA 3ZDXE 4BFIA 4XC3L 4UT9L 1KTKE 1PG7W 4N5UA 5ECJE 2CSPA 5GSRA 4DGYL 4QOKB 4PV9A 5HY9B 5GGUA 2A74A 1CDHA 3R0MA 2XYCA 4MJID 4ERSL 3MX0A 4KROD 3SJVD 5FGCB 3BOVA 1MHPH 3DETD 2P7TA 4X4XB 4NM8H 4WEUD 5D2NB 5I1KL 5SX4I 4KDTC 2FBOJ 3MLVH 3PWUA 4TSAH 2Q3ZA 3EYQD 5KS9E 2WWKT 5E8OA 4PUBL 1ORQB 3OKYA 5C0DA 3BPLB 4LSTH 2RFXA 5F7EL 4MD4A 4X6BA 3H42H 4FZEH 5IF0A 5T3XH 2WBWB 4XCNA 3DV6B 2BVPB 1VEMA 2HVKB 2QBWA 4NWUH 3QI9B 4HPOH 2FJFB 4FQQA 1FN4A 1JPGB 2GTWB 5I1LA 5E6YA 3HPLA 1I7RA 2AQ2A 2EIEA 1CF8L 2BNUB 4OLVH 4UUJA 4X7TB 1IGFL 1X9QA 2XTJC 2YPLB 2EC9U 4QXUH 4PJ9C 2V7HB 5IROC 2I25N 4PJ8B 4ISVB 5GS0H 5MI0C 2AKRA 1IBGH 4OTXH 5KZCD 4XC1L 2GW5A 3PQYE 5IK3A 1OSPL 1TXKA 3QXDA 3PL6A 5DMJB 4ETQA 2XWTA 1CTNA 2R2HA 2YBRA 4Y2DA 3DUHA 5EC2A 5FOBA 2IPTL 2VE6B 1WISA 2X9YA 4XTRC 4V1DB 4MJIE 4HC1A 4M6OL 2HLFC 3BPCB 2VJXA 2HVJA 4Y8AA 1CG9B 4UIKH 3CZJA 1G7PB 4ACPA 4OZFA 5I8KL 1JF6A 4MDIB 2MHAA 3V2AR 4PGCB 4TRPH 4Y1AA 1FFQA 3BUTA 4YC2B 2OSLA 5KG9A 3N85H 2EDEA 3HE6B 4PGEB 2JJWA 2JB6A 4G6KH 4RISH 3T2QA 4U0RB 1YMMA 4U1LA 1R0AH 2NY6D 5BZWA 3O3BB 5D93C 2W59A 1BQHG 1ZS8B 4UIMB 1FYHB 4YZFE 4EUPA 4Z78B 3HC0A 5EFIA 4XHJC 1JF1B 2Z35B 4FQXC 1IZJA 4HS6A 1FLTX 3OKKA 1B0RA 4TUOA 3ZYOA 4EN3C 3DX7A 4FQHA 3S35X 4DCQB 2EKSB 2B0SH 5LGHH 1CFVL 1KYOJ 4JFZL 1T1WB 2OCFD 3UMTA 2H32A 1KTLB 3MRLA 4LGSB 3TC9A 1HH9B 4ZFZB 2B8OT 3OGCA 5B8CC 1OW0C 1FSKC 5C07D 5IB4B 2OZ4H 3WSQL 1OGTA 1VGKB 3MRQB 5MEOA 1Q0XH 3KPNB 1AQDB 4YBLB 3M1BA 3F5WA 3WIHL 2EO9A 3HG1E 3O2WL 4PRHE 4OFVA 2BERA 2EH7L 4LAJH 3GSUA 3MJ6A 4I77H 1ZT4B 2EDKA 5HDBE 4WUKL 1BZQK 4F33A 1S7QB 5I1AA 1AD0B 3GHBH 5T1LA 2J6EH 1RIUL 3RAJL 1MCOL 5KSBA 4XBEH 3CFKB 5HSFA 1OD7A 3INUH 2Z4QA 3E6FB 1WC7A 3REWB 3D3VD 1FQ9C 4QHLB 1NPUA 3NPSC 5IW3A 4RNRA 4RAHA 1IEBB 2DYPB 4LL9A 2ZCHL 1BQSA 2NXYB 3H3PL 5HHOA 4HS3B 3CLEL 5T3ZH 3V4VL 5IT2H 2N7BA 4X6DF 1QSFB 1LO4H 1UENA 4M93B 5CJQL 3TJHD 2BVEA 2P5ED 1JJUA 1T2QH 1AIFA 1MI5D 3AB0B 3THML 3ZKQD 1U8NB 4JRYB 4ZOBA 1K8IA 5SWSB 2FRGP 2FB4L 1C7SA 1I1AC 3I9GL 1YEHL 3VXSD 4JY4A 3ARGA 3O11A 4MQ7B 2XOTA 3DYMA 2CRIA 2VXSL 4GJTB 4X9GA 5HBBA 4G8GA 1BJ8A 1VDGA 2WINB 2FIRT 1JI2A 4PJAA 1OAZH 4LLAA 1RZ7H 4UB0L 5C07E 2DQFB 1UXSB 1I7TB 1P7KB 5CBEB 2BNQB 3S3SA 2HKFL 2CDFA 5L88L 1Y6NR 1UKQA 4O02L 5ERWA 2NY0B 4K7FB 3B5GA 1YPZE 2XKSA 5C0RH 3H0TB 2G75B 2Q6WA 5KVDH 4HH9B 4N8VA 3G9AB 5KAQF 2W9EL 1VGEH 4K3GA 4HKJB 3P9LA 1Q9KB 3FQXA 1IC1A 3MLZL 4ODUB 3O6LH 5BVPH 3QHFL 1WVZA 3DBXB 4IOIB 1VKXB 3D3VE 4HUUA 1DQLL 2V2TA 1HIML 4XNZB 5GPRA 4ZOEA 1XF5A 2PETA 1MJJB 1CLOL 3QUYC 5E6IA 2HT3C 5FYKU 1MCRA 1MWAH 2AXJA 2SEBA 3B3IB 4PBXA 5KSUB 4QHMA 3ARDB 1JGLL 4EI6A 5C0BE 2P5EE 1BMGA 2C1PB 1JP5A 2FEEI 1ITBB 4W81A 5HTSA 1VFBA 4NHCH 1XGTA 4OLZH 1UEMA 3O0RL 3QH3B 5DJYB 1DUYB 43C9B 4DUVA 5IR1A 5HGAA 5DJXA 2MOVA 5DD1L 3RWCB 1EGJA 4JB9H 3P4NB 2FX7H 3GBML 2CK0L 4PG2A 1MAML 1FZJB 4UV7L 4HK3N 2CO6B 4NCDA 3KGRA 5A2JH 2CDEB 2X4UB 4MWFA 3GBNH 2RR3A 2Q1EA 3G6DH 3PIQB 1ULVA 5E2WH 2VRAA 5D9SA 4X98B 5EG6C 1T7ZA 5C0EA 1MH5B 3MFFB 3M17A 1INDH 4HUWB 3SDDA 3WFBL 1C5DA 3JWOL 3L95A 1BFVL 4LU5L 4HUVB 4LIQE 4PRPD 4ODSL 1GPOL 4MCYB 2V5RA 1CXHA 4PJXA 3RBSA 1I1YA 4LDEB 4PJFA 4NT6B 1A7RL 1OF2B 3IB4A 2L0DA 1EEYA 1G7JB 3UP1A 4QY8B 4C58B 1JZ7A 1JHKH 4XCYA 2DF3A 4P2QB 1IQWL 2C4FT 1KC5L 4UT7L 2PTTA 5L9DH 4U1IB 1DQDH 3QDJA 3GI9L 1EFXB 3OZ9H 3SY0A 5D71L 2E8YA 2IANB 5KOMC 1RFDH 4JFXA 1A3LH 4MD5B 1G9NC 1XR9A 3MBXH 3AREB 1OSZB 3UTTE 1GRWA 1S9YA 5C09E 4XNYH 1GZPA 2VDQH 3O4OC 5ALCH 4GKNB 4PJ7E 1CGVA 4QEGA 2D7PA 4NNPH 1QFOA 2V5TA 2R2BB 2BSSA 4OGXH 3GIVB 2XN9D 1WIPA 1LGVA 1ZXQA 2R29L 2LVEA 4NBXB 3ARVA 2ZOLB 1XF2B 1LO0L 1Q0YL 4HZLB 4AEIL 5IKCB 4Y19E 4J3TA 4HIJA 5F71A 2DLGA 4LLWB 3NGBC 5FYJL 3PWLB 5FF6B 2EIZA 4OCSH 3DUSA 4IMLA 5T1DH 4HXAL 3TBYB 3NFSL 3UJTH 1N64L 5BJTA 4IRSD 4KQ4H 3EAKA 3QO1A 1TVBB 4YDIH 5EBWB 1ZHBB 3GKWH 3HC4L 3IFPA 5E8DH 3DSFH 1I9IL 3IGAB 4PRPE 3U48A 4JQXA 1INEH 2E7MA 5L2KD 4MVBD 4TULH 4Z7VE 3REVA 4KUZH 3RGVB 1T3FA 5JW5A 4YXLL 1NAMA 5FIEA 2I27N 5F72S 3HR6A 3KPSD 1QR4A 4KPHL 1SBSH 3WIFB 1S7UB 4MYWB 1R24B 3KLAB 4ODTL 3QIBA 1SVZA 3RWFB 1FNSL 3TZVD 2VXTL 3MRNB 5EU6D 2ZUSA 3WD5H 4PRBB 5JPNB 4WHTA 3E6HB 2GK0B 5LXGH 2CLZB 4NKDB 5A43C 4B50A 5GS0C 4LCCC 1PLGL 2OQJA 3KPRD 1YECH 4GG6E 3BZ4A 4JHWH 2P43B 1A7OH 2XN9E 2VLME 4Y16B 3D0LA 3L3KB 2O93L 2VXVH 5IBTH 1JNNL 4U6TA 1MCWW 1WCBB 2YD2A 4PJDF 2FX8H 4L4JA 1BFOA 2MQ3A 1JZ6A 1UZ8B 4OIIL 4ZTOH 3RWIA 5EWIH 5BVJB 4PS4L 3EFFB 2I9LB 3LEYL 3NABL 1HEZA 3IJYA 3GMMB 2WSKA 1A1MA 2QTEA 4XCFL 2Z9TA 2P44B 4P23C 1NSNL 3WIIL 5C1MB 5BXFA 4AYFA 5L2KE 1NAKH 4DVRH 1S7XB 4I9WD 2X1WL 1MHCB 3QNXA 5CMAA 2Y36H 4IDJH 5IFHL 1KCSH 5DJZB 4DZBA 5GGTA 4JZJA 2N7AA 5HYEA 5IW6B 2GTZA 5CLWA 1CGSH 5F88B 4Y4KA 2CJUL 1IE5A 3EOAB 1F97A 4UNUA 4XVTL 1FZKA 1WGOA 1BAFL 2GAZA 2ZCLH 5EU6E 2AJUH 4U1SB 4MS8D 4NQXA 1ED3B 3MRIA 1GOHA 3JV4A 1S9KC 3TPUA 4K3JH 3QJFB 5DYOA 5I1HL 3BH8B 4NRXB 1QZ1A 3PNWB 5C0FA 3NFNA 2BDNL 3UTZA 4Z7UE 3NIDF 1AHWA 3PWVA 3K7UA 4ONFL 1FNFA 3Q1SH 1RVFL 4XH2A 5DFVD 3LS4H 1GH7A 2DWDA 3QIWB 4WIQA 3RZCA 1IKFL 4LSUH 2AXFA 4HT1L 5CCKL 2Z8VC 4TNWF 4K94H 4DWHA 3QZWB 4MJ2A 2C1OA 1CDJA 2WNGA 4N0YL 3GSXA 3PGCB 3QNYB 3DVIA 4G6AD 4X99A 5CLTA 5HHPA 2ZG3A 4P5TC 2O5XL 4QXTA 3VW3L 4KJQC 3VFPA 2CIIB 5FCUH 2YD1A 4I9WE 1BJ1J 2K7QA 5IIEA 1YJDH 5BO1L 1A6VL 1XF1A 4JANA 5TDOB 3ULSA 4N0UA 5DSCB 1I75A 2FIKA 4IRJD 1F45A 2UWEB 1FORH 1OP9A 4M48L 1H3PH 4YFLF 4CU8A 5ADPL 1XGUA 5AYUL 5EIIB 3L3GA 4BSWA 2ENSA 3FQNA 3HZMA 4R4ND 2JIXB 1AGCA 1UA6H 3LN4A 4J6RH 3D2UB 3JVGC 3WDJA 4M7LH 4YDJB 5IEHA 2VL4A 5EPMB 4R9HA 1I8LA 2FO4A 3PV6A 5JIKA 1IT9L 4OGAD 3GSNB 4S0TD 4R4FL 3TO2B 1S9VA 5IFAL 3PHSA 4HF5H 3SDCC 4GRLA 4G5ZH 3LEVH 1PKQA 4GS7C 3JTSA 4WHDA 1HHHB 3GMLA 2IH3A 2MPAL 3X3GL 1ZLVK 3FO0L 4MNQA 4HQQL 3VXUD 4FQ1H 1YY8B 3O8XD 4WFED 4CN6A 4MMXC 3MJ9A 3EUUA 1RIHH 3MYJB 4QOKD 1I8MB 2IH1B 4LVEA 5HXMA 4J3OC 3NZHH 3O3UN 4P2OB 1IKNA 3QCTL 4DGVL 2UZIL 5J4MA 4PGBA 2DIAA 3MV7B 3KJ4C 3MRBB 3E0GA 1VFMA 1A2YB 3NCYP 2WIIB 2YRLA 4L8DB 5CILH 2P42B 1LQSR 5DFTA 1H5BC 3DURA 5CEZL 3I50L 4QGTA 3HRZA 4R97B 5L7XL 3DTXA 4NWTH 3TO4B 3MUGA 4HGWB 4CDGC 3BEVA 2YHGA 2OM5A 4L8CB 3VD7A 2ZUQB 2R23B 3UTSE 4NKMA 1HHIB 3QI9D 3O2DA 4X6CA 2WK2A 1MRFL 3K4ZA 2BZDA 3SKUD 5ETUB 3GSQB 4I8DA 2C5DC 1F11A 1F13A 4H88H 4XAKD 1C08B 1J7VR 2NXZC 2IAMC 4XVJH 1FDLH 3WEXA 2YPLD 3MV8B 1LE9B 3IDYC 4PJ8D 3VFGH 4HBCH 4B5EA 12E8L 1XCQA 1MCHA 1KPVB 2R1WB 3UCRA 2G2RA 4OM0L 1NCBL 1G7QA 1FV1B 3AUVA 4D0DA 3K2UH 5DMGC 2A77H 4XMLL 5TFSH 2AV7A 2AEPL 4M7ZB 1WFTA 2D31A 3VXUE 3QUMB 3C60A 3U4EA 3UBXG 3X11A 3D39B 5FB8B 3FB7A 4QRTA 2QR0B 1IGMH 4OB5H 1FO0A 4TVPL 3B2UD 1IGJA 1T5WA 3VXTA 5HYQB 2WAHA 1SJEB 4NN5B 1E27A 3VA6A 3LSOA 1YEEH 4QOKE 1FGVH 4G6JH 3FRPA 1K6QL 4V1DD 1A1NB 1KNOB 1PZUB 3KDMA 2COQA 3TBWA 2APTA 3T0DA 1S7TB 2O5YH 3FMGL 5FGCE 3H8NA 4RIRB 1NGQL 4J8RA 3QCUL 3ORJA 5D2NE 1RUQL 4W68A 1L0QA 3S7GA 4ELMF 1NMAH 4Y5XC 1FLRL 4YBQC 5F96H 5C7XL 3S5LB 4YHLH 1MELA 3C8KB 4L4VE 3IXAA 2DTSA 2NCMA 1D6EA 3RU8L 3HE6D 3L5XH 4OT1L 4PGJA 4GW4B 2EC9T 4X9IA 2Y5TA 1EBPA 3EIFA 5CHNB 5H35A 1TZIB 2K7PA 4KTYA 3JXAA 4X5WA 1GSMA 5CD5D 2VMFA 5H2BB 1Z5LB 3RVTC 2X09A 4HFUL 3KAAA 4BK5A 4Z7WB 2W60B 3KJ6L 4UTBH 1TNMA 3K4AA 2NY7L 2CXGA 2WUBH 4EOWH 2DQDL 2YPLE 4XNQB 4MA3B 3QIUC 1EMTL 3MTRA 3ZE2E 2ZUTA 3TVMB 1JGEB 1RU9L 5IVXF 1S7RB 4NRYA 2F74A 3VXMB 1CFTA 4BFIB 4I3SH 2ESVE 4U1JA 4K71C 5GSRB 1BBJA 2A1WL 4PV9B 5BS0A 5GGUB 1Q9WA 5HD8D 2A74B 3P30L 2ZSVA 3BGFC 3P9WB 4WEBH 2YRPA 5CEZD 4IIQA 1F58H 2EYTA 3JV0A 1FYTA 2P7TB 2IMNA 2QQKL 3PWUB 2QKIA 1PSKL 5E8OB 4L3EA 5E5MA 3WFDL 3LS5H 5C0DB 2EDBA 2EXYD 3N9GH 5D7IF 5DVNA 5JQHC 5HGDA 3U9UA 2RFXB 3S36X 2E8ZA 5IQ7L 1MF2H 1U93A 2ERJC 4MD4B 4X6BB 4KMQA 3JBG7 5DC0A 1GC1H 1NMCB 2CD0A 5IF0B 2R2EB 3BX7C 4ZNEE 4XCNB 1UWXH 5EA0H 4JN1H 5TE7L 1FN4B 2XQBH 5C6PB 3U36A 5I1LB 3HPLB 5KVMC 1KENH 3EJZC 1DQQA 4K3EL 4PY8I 4U1NA 1B4JH 4TSCL 4UUJB 5DO2D 2DYPD 5DJ2B 1PJ9A 2AKRB 2NXYD 3WFEL 4XP1L 1OAQL 1QSFD 5IK3B 2VC2H 2AJYH 3IFNH 1P4IL 3OF6A 3QXDB 5I1EH 3PL6B 4ETQB 1IC5H 3WNOA 2XWTB 2R2HB 2YBRB 1XFPA 4JRYD 4PJBF 5ITBH 1JRHI 5F7WC 5SWSD 4ESKA 1P6FA 2FHBA 4M6MH 4WHYG 3PGDA 2R0KH 3FTGA 5INCA 2LAAA 1CDYA 3CFDA 2YXMA 3FZUC 2ZJSL 2HVJB 5LGJA 3T4AA 4XI5D 3U4BH 1I85C 1CLYH 4WWID 4ZYKB 3CVHH 4K8RL 2BNQD 2MHAB 5HYJA 5B39G 3AY4C 4Y1AB 1EJOL 4MDJA 5D2LF 5KG9B 2NY0D 1RJLA 2OSLB 4Z0XA 3F7PC 2IPUK 2JB6B 2X05A 2KQNA 1LO3H 2PYEA 3G6AA 5I30H 4XMPL 1BZ9A 3TJEL 5HGBA 4U1LB 4QXWA 4X6DA 5BZWB 1N4XL 1I9EA 4U6VL 5FHAL 1P53A 1G84A 3TYFA 4EUPB 3W9DA 3QDME 5BOPA 5CJOL 2NYYC 3HC0B 2WQRA 5EFIB 4L9LA 2AABH 2AAVA 4P5MA 1FBIL 5GISH 1E6JL 4OIAA 4HS6B 4XWGH 3OKKB 4TUOB 1JHLH 1FPTH 1Q72H 3DX7B 4KQ3H 1LO2H 3VWJA 1DBKH 4U7MA 4WNQA 4X4ZA 1MJ8L 2H32B 3ARDD 1D3CA 5HHXL 3MRLB 3O6MH 3P9MA 3QQ3A 4R90L 3VFWA 4GW5A 4WFGD 2UV3A 5SWSE 4G8FA 4JFFE 3S35H 3T0EC 3OGCB 1H0DA 1YN6A 3MSPA 4LOUC 2B39A 7FABL 2X6MA 1OGTB 3ZSSA 2PO6A 5MEOB 5CZVH 1HI6A 3M1BB 1WBXA 3F5WB 1TTGA 2ARWA 2Y1VA 3GSUB 4IOFC 4WTWA 2BNQE 2Q7NA 3RX8A 3CVIL 5J8OA 4F33B 5I1AB 3UTPD 4Z76A 4JVUA 2GK2A 5T1LB 5KSBB 3EO9L 4NC1C 4LHJB 3ZO0A 4NO2B 4POZD 1N5YH 2Z4QB 3TA3A 3VFTA 4K94C 1WC7B 5E8EA 3H2WA 4RNRB 3WCYA 2AI0H 2WUCL 4OLXH 5HYSG 3HNTL 3VGFA 4OZFG 1DBAH 5HHOB 4GMSH 4LKCA 4JO1H 4P2QD 5EUOE 3NCJL 1C8PA 4JFEA 4AIZA 2MWCA 1AIFB 1YJDC 5DUPH 5CZXC 1A7QH 3CD4A 2B7DT 4JQIL 1K8IB 1EFXD 2E7LA 2IAND 5DMKA 2FATH 4M43L 1CZ8L 1BD2E 3WL9A 2O5ZH 4K8RD 1NANI 4JY4B 3ARGB 3ARED 3O11B 2DLEA 4XPTH 4O58L 3F65A 4WFGE 4AENA 4OCYL 1EFQA 2H8PB 4G8GB 1X4XA 1LDSA 1OL0A 2LU7A 4PJAB 3ULUH 1K2DA 4FFZH 4L9DA 2R2CA 1U92A 1ZANL 2YRZA 2CDFB 4R3SA 5ADOH 5ERWB 1DVFA 1RY7B 3RTQA 1ZLUH 3GDBA 1J12A 3B6SA 2Q6WB 3MBEA 4PJEF 4KV5E 4N8VB 4QXGL 3UTPE 2DJ4A 4LFHG 3P9LB 2V2WA 4HUMB 1JYWA 3FQXB 3QXWA 3P40A 3EOTH 4NN7B 1Z3GH 5DD5L 4JM4L 4HUUB 5EO1A 3QB7C 2V2TB 2XZCH 3MC0A 4ONGH 2IEPA 1C16A 1S3KL 1XF5B 4J3XA 4ZNCD 5CINH 5T33H 2MNUA 3QJHA 5E6IB 3RL1A 1DE4B 3RGVD 2SEBB 3LH2L 3EHBC 2P45B 2Q86A 1CCZA 4QHMB 4P2QE 4YX2H 1CD1A 4BFGA 5GGRY 5E94A 2VLKA 3P77A 4EI6B 2NY1C 4KY1L 2NY4C 2W9DH 1RURL 5MP6H 3GJEA 1ES0A 3CMGA 4KZDL 3ZE0F 4D2NA 1VFBB 3L5HA 1XGTB 2IANE 2VLJE 3MJ7A 3C6SA 4XXDA 3BD5A 3BPNC 2AGJH 3C8HA 2B2XL 3SOBH 5D70L 5IR1B 4EBQL 1QHOA 5DJXB 5HGAB 1NBZA 2DBLL 4IMKC 4JM2F 4PREB 4YDVA 2CUHA 1C7TA 1MIMH 4NQCE 4MWFB 5I9QB 3J8F7 2XACC 5T5FL 3ZYZA 4Y16D 3PABA 1FFOA 5K9QI 4C4KT 1UM6H 5C0EB 5JHDA 1UWGH 1U8LA 1YC7A 3MLRH 3SDDB 5F9WC 3L95B 1BFSA 1A1OA 4OZGE 6FABH 4FMFA 4FXKA 3E8UH 3OHXA 4TPRH 4PJXB 4E9LA 4YO0A 1I1YB 3RUGE 3GO1L 1XGRA 4OZHE 4DTGH 4PJFB 5HI4C 5F1NA 3GM0A 4JY5H 3KYKL 3MXVH 1EEYB 4RGNB 4PJCE 2A9MH 1UWEH 3GI8H 1L0XA 3JWDL 3X12A 4XCYB 1A14H 4R7NA 1P69B 4BZ2L 4G9DA 2PTTB 2ZUUA 4P9MH 3RIFK 3VWKC 4OCXL 3SY0B 5AUMA 4PLNC 2EDRA 4JFXB 4P46A 5CGYC 5BCAA 5JMRA 5AAMA 4RGOL 5KJRH 1MJ7L 2E6PA 2VDPH 4DN4L 1S9YB 1GZPB 1R3HA 3JSSA 2X2YA 5EU3A 1WAAE 2F19L 3A6CL 2R0ZH 4M1CC 5ELIA 3FN3A 1SJXA 5D8JL 4FQ2H 1TQCB 1DQJA 4PJDA 2QQNH 4PRNA 2BSSB 1X5XA 1ZA3A 4BH8B 4M3KB 1UC6A 3KJ4B 2Y25A 3MGAA 1F3RB 4HIJB 3NIFF 2NZ9C 3OB0H 4BUHA 5GGQH 4P4KA 2EIZB 3DUSB 4IMLB 2BHZA 5DI8A 3QIWD 4MB3A 3VGBA 2D7QA 1FIGL 4WCYL 5BJTB 5C9KA 2ZUXA 2Q87A 3MLPA 1NH6A 3QO1B 5JW4N 2F53E 4FQLH 3IFPB 3LCYA 4YPGA 5A3IC 1A6ZA 4ZUWA 3UC0L 4R2GC 4IDLA 4TUJA 4ZTPH 1FH5H 2VSDA 3REVB 3E2HB 3MLTB 5DK0A 3NCEB 1DDHA 1T3FB 2XY1A 2BRQA 5DWUL 5JW5B 1DBBL 2EICA 1IAII 3MMEA 2G60H 5AWNH 3V6ZA 1GIGH 2IAMB 1KJ3H 3G5XA 4KKBC 3IFLL 1HILA 2FBJL 4TQEH 3TT1L 1GC1C 4P0DA 3VGDA 4HWEL 1RI8A 3QIBB 3V4UL 5D7SL 3VJ6A 4S0SD 1NCUA 3KXFA 4HCRA 5I71C 3DNKA 3ZL4L 1G0DA 3FL7A 1TPXB 5J06A 4XPBL 1KJ2A 2JIXD 4JKPH 3D2UD 3PP3H 4WHTB 1VERA 5FO9A 1V3JA 1MRCL 2JLLA 1SM3H 2OQJB 4Y5YA 4N90D 4HJGA 3BZ4B 3D0LB 4FFVD 5B3JE 4Z9KB 4MJ6A 2C26A 5DMIH 2R69H 3RNKA 1BFOB 5D4QA 1RV6X 3RI5K 1EUUA 1LEGA 3IETA 1OAKH 4HKBA 1KB5H 4Q0XL 1HEZB 3Q0HA 4WV1C 5F7FA 4P2OD 1A1MB 1IILE 1WZKA 2A9NL 3MV7D 1M4KA 4RDQF 3RA7H 5I17A 2C3VA 3ULVD 4XAWL 3P3YA 4JO4L 5BXFB 2AJZA 3C5JA 3I2CH 1MFDH 2GSIA 3L3HB 3QNXB 5CMAB 4KZEL 1NDMA 5I1IH 4Z7QE 1S8DA 2H3NA 5IVOA 3WKML 4GKZA 2DQGH 4DZBB 4ODVL 4JZJB 3BISA 1YYLL 2GTZB 3TO4D 2EYSA 4I4WB 3KG5A 3CMOL 2UWEE 3AM8C 3FHQA 1FZKB 2HT2C 3ISWA 5ESVA 1AD9A 2GAZB 5JW3L 1QSZA 1UEYA 4HD9A 5HI3C 1AXTH 4NQXB 2H1PH 5DZLA 1Y6MR 3MRIB 2OI9B 1S5IH 3TPUB 2AK4E 4LVOB 3STLA 4GXUN 1FGNH 3MV8D 2QADB 3MRCA 1F4XH 5C0FB 1RUMH 3NFNB 3UTZB 1AHWB 3PWVB 3BJLA 4AM0A 3ZKMC 2DN7A 5EZIH 4XH2B 1T1YA 3RZCB 2DWDB 5K59E 3BP4A 3HI1B 1A3RL 2AXFB 3GFUA 1JGDA 5E99H 3EYOB 1LK3L 3D39D 5KVFL 1J1OL 4PB9H 1KN2H 2M8XA 1UCBL 1OAYL 2C1OB 2J8UF 5FYJU 4ODXA 2DD8L 4Y4HC 5I76A 4G43A 4NO5A 3GSXB 3AXLA 4X99B 3WXWL 5HHPB 1MFBL 3MV7E 4QXTB 3RWGA 1CDGA 4HLZG 4Q6IC 3ULVE 5FUCC 3VFPB 2UY7A 1GHFH 4XNXL 1WIOA 5IIEB 4JANB 3ULSB 4Z95L 4N0UB 1E4KA 2H2PC 2FIKB 4HC1L 3ZDYF 1W72H 2GITA 1NCWL 3PWNA 3HE7A 1P84K 2DKMA 1DFBH 4AJ0A 1JFQL 1BVKA 2DLFL 3L3GB 5I1GH 1VPOH 1URLA 3FQNB 4BSWB 3HZMB 4XP6H 4IRZH 2NX5A 1AGCB 3LN4B 3IDJA 3LMJH 4OQ1A 5IEHB 1SMAA 4HLZH 3UJJH 5D1XC 3PV6B 3TBSA 3VH8A 5DJAA 4YQXH 4K2UH 4JFOA 1PKQB 3JTSB 3MA9L 3GMLB 5F3BA 2IH3B 3MV8E 4NZUL 4MNQB 3V7MA 1BQLL 4OBRA 4WTZG 1L7TH 4D3CH 3TVMD 2XZAH 2IG2L 3VXMD 3QEUA 4BQBA 1Z9MA 3BSZH 4JR9H 1NFIA 1DLFH 1JHTB 4ELMA 4JVWA 5IGXL 5IW1A 4F2MA 2P5WA 4M7JL 5M95B 1TETL 4OFYA 4PGBB 4KKAD 5DHVA 1JPTL 3ULUC 1G0XA 1ZTXL 4KVNL 4QRRA 1HNGA 1X5HA 3K2MC 3TCLA 3CFBA 5ACZA 1KB9K 3NA9L 1BOGA 3MZGB 3VG0H 3DURB 5IB5A 4OM1H 2LU4A 3HRZB 3DTXB 4O5LL 3MUGB 4HWBL 2JCCF 3BEVB 2YC1A 4GSDH 2HWZL 3CSYA 4X6CB 3FT3A 3HB3C 3SE9H 1QRKA 2ENYA 1MHPL 2G9HA 4NM8L 3OPZL 1U8PA 5IVXA 4QRQA 4RQQA 4TSAL 5GGVH 4MXQC 1M7IA 4YNYB 5ITFA 3GJFH 3VFSA 3WEXB 4XNUH 1MHEA 3ZT5A 4OV5B 1IGTA 2EIBA 4LSTL 1XCQB 4MB5A 4Z7WE 1CFNA 2G2RB 5F9JB 1G7QB 3H42L 4D0DB 1XT5A 5T3XL 2AV7B 4RSVA 1D5XA 2EH8H 2D31B 3OTTA 3PL6D 4NWUL 3CFJA 3C60B 3U4EB 3V0VB 3VXME 4DN3H 4Y2DD 5J13C 3FB7B 4QRTB 2WBKA 3R4DA 5D7IA 5JQ6H 3VI3E 1MVUA 1IGJB 1T5WB 2FSEB 3VXTB 3IU3B 3LSOB 4APQC 4K3HA 1RUPH 3KDMB 3HAEA 2LVCA 5K33A 4LCIH 4QXUL 3QISA 3TBWB 1T20B 5GS0L 4QGYA 1U8IA 1X5FA 3QA3A 3S4SG 1NKOA 4U2YA 4J8RB 4NQEA 5C08A 1N2RA 3ARBC 3BXNA 4AG4H 4ZS6C 1MPAH 3WYRA 3KS0J 5JORA 3EO0A 3P0GB 3ESUF 4Y1AD 3IXAB 1RSFA 3MRMA 3T4YA 1D6EB 5K9JH 4NFDA 1WEJH 3O3DA 4LSPH 4FNLH 3SKOA 2YUVA 1ZVSA 1G7LA 2WM0A 2Y5TB 5H35B 3Q3GA 1AC0A 4MSWA 3MUHL 2OS7A 4QF1A 4PB0H 4BFEA 5TE4H 1U3YA 1UQSA 1KELL 4JGMA 4UIKL 1CE6B 1HSBB 2PN5A 2PR4H 2Q20A 3P0VH 4PJBA 4MA1C 3VXSA 3PXJA 1QBBA 4WFHD 1LE5A 1BOYA 5GZOC 3N85L 4MQSB 4NRYB 2F74B 3QDAA 5F7LB 1T4KA 4IEFB 4GBXC 4U1JB 2FHCA 2UY6A 1BBJB 3W11C 2EZ0C 4CDHA 5FYLH 5BS0B 5IWLC 1Q9WB 3PV7A 1RZKH 2ZSVB 4LSSL 1EAPB 4ZO7A 4L4TA 4NOFA 3PDOA 4IIQB 5JTWA 4LFHD 2BX5A 1EO8L 3CX2A 4DKDC 4YWGH 1G9MH 4PD4J 4XVUD 2QKIB 3ZLQC 1YEDA 3GB7A 4L3EB 3MPCA 4QTIH 5E5MB 1WFOA 4HKZA 4FG6C 3SKJH 2VITB 5HGDB 2IFFH 3U9UB 1HOCA 1CD9B 2B0SL 4HIXL 5I75C 5LGHL 3QQ9C 1KN4H 1U93B 5FECA 1SJHA 1HDMA 5EBLA 4TN9A 4Y1AE 3F7RA 1YNLH 3DMMC 3KPPB 5T1LD 3ULUE 4UI2A 2CQVA 3L3DA 5DR5H 3FRPG 3U36B 3S36H 5F9OL 1DQQB 1YMME 4X5XA 5T3XD 4U1NB 4ODWA 3SGKC 5CJ8A 1Q0XL 1UACL 1OAUL 4GRWH 4ONOA 4NBZB 2F5AL 3BPNB 3WIHA 1IM9B 5HHOD 1MOEA 3GIZH 5DHXB 4ZODA 1TIUA 2WBJC 4WFHE 3U0TA 4P4RA 3FB8B 4BH7A 2MFNA 3DX6A 3GJFA 3GHBL 5IJVA 2OTWA 2J6EL 5FA4A 1TCRA 4XBEL 4U7KA 4X7FC 3O6FC 3INUL 3UPRB 1UB5A 3T0BA 1IRAY 4S10A 3FO9A 4LCWA 1UKSA 4I3RH 3UEZA 3PGDB 5KS9F 1J0ZA 3FTGB 3IDXH 4PV8A 2FEDC 5INCB 1VSCA 3ARGD 4J4PA 3CFDB 4OUUA 1JZ2A 4Q9QH 4G8GD 4MNGA 5LGJB 4LMQI 3T4AB 4OQTH 5T3ZL 5IT2L 2OLDA 3B9AA 2LFGA 1LO5B 4ZAKA 5DRXA 1KLUA 2B20A 4Y89A 5HYJB 1T2QL 3EBAA 4MDJB 2YMXH 1RJLB 4BUGA 1FNAA 4Z0XB 4E0RA 1ZLWK 4R8WH 2HKHH 1KACB 4LPXA 2PYEB 3G6AB 1CYGA 2B4CH 1BZ9B 5HGBB 5KSBE 4X6DB 3IVKA 1OTUC 3TYFB 4D9LH 2J4WL 3W9DB 4X0KA 4YK4C 1OAZL 1KTDA 2MCPH 2HFGL 4L9LB 4P5MB 1QKZL 3MLXL 2AJXH 3BFOA 3O9WA 3R8BB 5E6ID 2WP3T 1I4FA 1XF3A 1MQKH 3CFCH 5C0RL 1OTSC 4WNQB 5KVDL 4KXZI 1QRNA 2NR6C 5BRZA 3WHE0 4M1DH 1VGEL 3P9MB 3QQ3B 3VFWB 1Y18A 4GW5B 3T0WA 4G8FB 3BMVA 3VFMA 1H0DB 1YN6B 5EO9A 1VFUA 3W2DH 2BJMH 5ACLA 4PJEA 2PO6B 4LLDB 3FAXA 1T7VA 3Q5TA 4CVXA 5IMMA 4X7CC 1HI6B 5CBAA 4PJAE 1MWAL 1WBXB 3D69A 2VZTA 3MUZ1 3SEPA 3ZKNC 2VDKH 1BFTA 4XXCA 5C0CA 2AK1H 1AQKL 1J8HB 3UDWA 1JYNA 5I74C 1X5IA 1FE8L 4Z76B 5J9PA 2FECL 2Q3AA 3WKNA 1NCAH 5ISZA 3TA3B 2OJZH 4OLZL 3SDDD 5C92A 4NZRH 1FC1A 5CZKA 3WS6C 4AT6A 5E8EB 3KPSA 1PQZA 2V9QA 1NGXA 1N8ZA 2FX7L 3SBWC 2M2DA 4UAOB 3FOLA 4RGND 1EJ6A 4ZFOA 3LPGA 2BVOA 3GBNL 4LKCB 5IMOA 1R5VA 3G6DL 4IOSD 4JFEB 1REIA 5E2WL 4AIZB 5E6ZA 1W0WA 2IGFL 1L6XA 2R0WL 3FO2A 3SCMA 4KMTH 4JM2A 1INDL 3K3QA 3GSVA 5DMKB 1FFPA 3WL9B 1F90H 1WV7T 1XCTA 1V05A 1BQUA 3LKNA 4PLJD 4LVHC 4AENB 3WO4B 2P8MA 4JPIA 2HMID 4K07A 3VGAB 4AEEA 3MUY1 5GGTL 3IU4H 1K2DB 1QBML 3H9ZA 2APVA 5TH2A 3IRPX 5HDBF 1U6AH 1WZ1H 5L9DL 4Y2OA 3V95A 4R3SB 1CT8A 2R1YB 1NJ9A 2HTLD 1DVFB 4OQTA 1EEZA 3RTQB 3SE4A 2BRRL 2A73A 3MBEB 3QUZA 1RFDL 3BGAA 5L8JB 1A3LL 3RZWA 3MBXL 2P4AB 3GKZA 4M9OA 2IADA 4XNYL 2VDQL 3NH7H 1ZT7A 3RVUD 2HH0H 1EHNA 1KXQE 1KCRH 3SO3C 4LSVH 4EXPX 5D7JA 5EO1B 5JIHA 4F15C 7CGTA 3F7VA 3WJJC 1C16B 4OGXL 15C8L 1AKJA 3QJHB 4YHOL 3RL1B 4YFEA 2Q86B 3M07A 4OCSL 2VUYA 1FNEA 5T1DL 2IAMD 5E94B 1RUAH 2VLKB 3P77B 4LCUA 1LDPH 3FT4B 3GJEB 4KQ4L 5GGSA 1ES0B 2C7UA 3QDJE 1QFWH 3QIBD 5E08H 4HUXA 3VD5A 3O3AA 3MV11 2Q8BH 3MJ7B 3C6SB 5IBLC 1AFVH 3N1PC 4K3DH 1INEL 2ZUYA 4NO3A 3RVVC 3EGSA 1NBZB 4TULL 4KUZL 1UFUA 3L3IA 2BC4A 2Q76A 4YDVB 3TBTA 1V7MH 1YPZF 2A83A 4U1HA 4MA8H 5KVEH 2DIJA 2XPGA 1JNHA 4ZS7H 1FFOB 4F80A 5JHDB 3S37L 5EDXA 4UQ3A 4F9LC 1NBQA 1HINH 2X41A 1A1OB 1F4WH 4OF7A 4Z8FH 2FD6L 3H9HA 1GAFH 4FXKB 3P2TA 4NBYB 5JA8B 4YO0B 1F4YH 1UM4H 1XGRB 3LOWA 3RDTA 1RK0A 2F58L 5F1NB 4QWWD 3IDUA 4KK8C 1JIBA 3CPLB 5GRVK 3M8OH 5AZ2H 5LWYH 1Z9SA 4R6UA 4QNPE 1YECL 3X12B 4JHWL 3HMWH 1A7OL 3ME0A 2EXWC 2QV2A 4G9DB 2VXVL 5LCVL 2JTDA 5IBTL 1B0WA 1UZ6E 2AEQH 1HK6A 3LHPH 3TWCH 1P1ZA 4LHQB 3S96A 1OPGH 5AUMB 4P46B 5I1DB 5EWIL 1BF2A 5GHWH 2NTSP 4KRLB 3MACH 1YEIH 5A2KH 4LEOA 1R3HB 4GRLC 5EU3B 3EDDA 5ID1A 5KSAC 3BWAA 3UJIH 1B2WL 2DJUA 2VDOH 1DQJB 4PJDB 5KN5A 1NAKL 5DZNA 1ZA3B 4DVRL 2HT4D 2BFVH 1DQMH 3GSOA 2Y36L 4IDJL 3X14A 5IBUG 1KCSL 2QADD 5FKPA 1AR1C 5JZ7D 4MAYA 1M7XA 4P4KB 1A6UH 4HS8H 3X17A 3RZCD 3G5YA 5DI8B 3DARA 4XCEA 4KI1A 2Q8AH 3IDGA 1MFNA 3KPLA 1HQ4A 1RZKC 5E9DE 3SDAC 2DKSA 2ZCLL 3GGWA 1KYOK 4WWKA 1TVDA 4YPGB 1A6ZB 1PAMA 4LRNH 4O9HH 1Z2KA 1G9MC 4ZUWB 3V6OC 4K3JL 5JW4M 2ICWJ 1AP2A 3CX5J 1DL7H 1X5JA 4JAMA 3X3FH 5DK0B 4AY0A 1DDHB 4ZG1A 1L9NA 2Y06H 3TIEA 3MMEB 3V6ZB 2RB8A 3VD3A 3G5XB 5C0NC 1HILB 1QNZL 5TGBA 4NGHL 5HPOA 2D9QB 2X89A 4UMGA 1YEKH 2RQ8A 3VJ6B 1VHPA 3KXFB 4PJ7F 3S8WA 3D18A 4ZSOA 4KHXH 2HJFA 2Z31C 3TNNA 2IPKA 3QUXA 4Y4FC 3G04A 5FO9B 4F57H 5CP3A 4NP4L 4H25A 2W91A 4G8EA 4JLRA 4Y5YB 4HJGB 2MSPA 4RMVA 3T04D 5FCUL 2IC2A 4KHTH 2J8UA 1C12B 3QEQE 4V1DA 1YJDL 3UROR 4DKFH 4MJ6B 4MNQD 2AJSH 3I85A 43CAA 1FORL 1MRDH 3WDIA 4EDXA 3RNKB 3T09A 4GFTB 1CFSA 4WW2C 1LEGB 3IETB 1ZAGA 1G9EA 1N6QH 4HKBB 4GXVL 5D1QC 4GAJH 4M7LL 4Z7VF 4DFIA 2PXYA 2P47B 4ORZC 1RK1A 4K9EL 5I17B 3KLDA 5FUZH 4HF5L 4DW2H 1CK0H 4WUUA 2AJZB 4LP4A 1IAKA 3LEVL 1IZKA 2LQRA 3C5JB 1NDMB 4GAFB 3MCKA 1S8DB 2H3NB 4NM4H 4GKZB 4FQ1L 4LCYB 1K3IA 2DQCH 1WFNA 1ORSA 3A6BH 3V8OA 2VKWA 1EEQA 1UWXK 2C3WA 3K74B 4YIQA 2EYSB 4GLRI 5H37G 4I2XE 4N0UE 2WIMA 2B4CC 1PEWA 4YPJA 1RAMA 3QO0A 2RHEA 5JXEA 5ESVB 1YNKH 1C1EH 1KJMA 4I0CC 4HDIA 1RJYB 4GG6F 4HUNB 3EOYG 2OTPA 1P6AB 1YNTA 3IDMA 3U7WH 4LNVA 1I9RH 2ZUVA 3STLB 1GGBL 5GRVL 3MRCB 3X13A 3HPJA 1YQ2A 4NWTL 4RX4A 4AM0B 1Q9LA 1T1YB 1WITA 4FFYL 1ZOXA 3BP4B 4MA7L 4G3YH 4GXUM 4WW1A 1JGDB 5F8QC 3TCXA 2G5RA 2DOCA 3NFPA 4DKAA 2HAZA 4Z0BL 3C60D 5DXWA 1AQDA 4XCCL 4H20H 5FM8A 1WTGT 2X4SB 4ONHB 5EU5A 4NQDA 4ODXB 3O41A 3OKDA 4G43B 4NO5B 2XICA 4H88L 1QUNA 4XVJL 3AXLB 5J12C 1FDLL 3ZE1E 3UAJC 3VFGL 4HBCL 4JFQA 1EEUA 3RWGB 3MJ8A 1NLDH 3PUCA 4W4OC 1ADQH 1IAIH 2V5YA 2A77L 5DVOA 3ZKSD 4QHLA 5TFSL 1QBAA 5SWQA 4BQCA 2NY2B 1BJMA 2GITB 4EKXA 3PWNB 3HE7B 4ZXBC 3V6OE 3IJHA 1IGML 4HS3A 4OB5L 1BVKB 1WSST 2FJHB 3BQUA 3BH9A 4FXGA 1HYSD 4JKLA 4JHAH 1YEEL 2NX5B 1FGVL 3DWTA 3IDJB 4G6JL 3L3OA 3O4LE 2R4SL 3UO1L 4WO4A 4X6CE 5MENA 3TBSB 3VH8B 2DQTH 5DJAB 2CUIA 3BDYL 4A6YA 1BIHA 4Z7UF 1VEOA 3OXRA 1OP5H 3B83A 5DURB 1NMAL 1UM5H 3UYPA 3SGJC 4JFOB 1QBLL 2VXUL 1X3DA 5F3BB 1WT5C 4Q6YA 3W0WE 3MV9E 4YHLL 1XMWA 4JGJA 3S6CA 2W0FA 3VMNA 1T89A 2DQJH 3QEUB 5JMOC 3L5XL 3S88H 5BQ7A 4MX7A 3WNMA 4GRWE 1I7TA 1P7KA 4G9FA 4ELMB 5CBEA 5BS0D 3I6KA 4KKNA 5IW1B 4F2MB 1AE6H 5FYKD 2P5WB 4P3CH 2EE6A 2DDQH 5DHVB 4OZ4A 1RMFL 3RY5A 4QRRB 2DQIH 1DN0B 2WUBL 4L3ED 3TCLB 4EOWL 2I07A 4I18A 3CFBB 3RNQA 4JE4B 3KR3H 1BOGB 1XAUA 2VR4A 5IB5B 4N8CL 3DBXA 2VLRA 4I3SL 1JWUA 4LBEA 2D03L 2YC1B 4OGYH 1GOFA 5EULV 2DLTA 1HHJA 3CSYB 4WEBL 4CJ0A 3FT3B 1F58L 5C2BH 2X4PA 3OWEA 4JFDA 2G9HB 4LLQB 4POYA 1U8PB 5IVXB 3WLWC 3CAFA 4QRQB 3NMEA 4RQQB 4KGJA 2QHRH 1WTLA 3HMXH 5HVGB 1M7IB 5ITFB 3VFSB 3VWJC 1IGCH 1KIRB 2BK8A 5FGBC 1MHEB 3N9GL 2XZQH 1K4DA 1IGTB 5I8OL 4C59B 5CKAA 1IM9D 1CFNB 3VD4A 4LPWA 1MF2L 2BSRA 1PGRB 1EDQA 1U8MA 2VXQH 1WWWX 1EVUA 3BN9D 5LKNA 3OF6D 3RWCA 2L7UA 1D5XB 4JRXA 1OD9A 3CFJB 5E2UH 2WWMD 2A0LD 4WHCA 4JN1L 2XQBL 2IBZY 5D7IB 2WZPD 3AMLA 1MVUB 5KVGH 1B6DA 1RZJH 2CR6A 5BS0E 3CSPA 1B4JL 2W0PA 4F37K 3HAEB 5T1KA 4KI5D 1YY9D 5FYKE 1X5GA 1JUFA 1L6ZA 4S1DD 5HHMB 5BV7H 1FYTE 1EUTA 5SWZE 3EJYC 4NQEB 1U3HC 5C08B 1N2RB 3JUZA 3RY4A 3BXNB 4J3WA 5AG9A 1I3GH 4L3EE 4I0PA 4R7DA 1LP9E 3IFNL 4JJ5A 4UBDC 4YDLB 5HYJD 5I1EL 1DEEB 3EO0B 3MRMB 4KJWC 1CFBA 3HRPA 4JN2A 4V2CB 3BRFA 3O3DB 4QY8A 2MMXA 3MLWH 4DAGH 5C6WH 4Q9CA 3FN9A 1ZVSB 4PJIF 3BKYH 1G7LB 4M6ML 3LPFA 5C3LD 2PYED 2CKBH 1JTTA 3Q3GB 3TT3H 1NL0H 4QF1B 4NHUA 4RFOH 1UQSB 3QG6B 5MEQA 3U4BL 2BOCA 4PJBB 4XP9H 3RKPA 4MD5A 4PBWD 1OGAA 3ARFA 1TCMA 1EIBA 5KS9A 3T77A 4N5ED 3AS1A 1K85A 3DI3B 5FV2A 3B4NA 4NJAH 1LO3L 5HVHC 2W1NA 1LEIA 3AAZB 3RPKA 5IJKA 5J6GA 3MROA 4TNWK 2ZOLA 3CXHK 3I3DA 4L4TB 3PDOB 3MOAH 1F3JA 1A47A 1QLFA 3CLFH 1D6VH 2AABL 5D2LB 5GISL 4Z7OE 5DUMH 1YEDB 4XWGL 4KI5E 5EORL 4UT9H 1JHLL 3P11H 3DYPA 1K9TA 3DGCR 4HKZB 5J0BA 1O5DT 3BIKB 1Q94A 2PO6D 4GG8A 3C6LC 1ITCA 1CICA 4ERSH 2VH5H 3OXSA 1HOCB 4TYUA 2DTMH 4KQ3L 1LO2L 4JG1L 1SJHB 1OM3H 3BJ91 3R1GL 4CBPA 1J8HD 1JPSL 5K9KA 5EBLB 1FP5A 3PQYA 1TENA 2GKIA 3O6ML 4PUBH 3L3DB 4KDWA 5IMKA 2OMBA 3TA3D 3LDBC 3S35L 4KKBD 4EI5C 3KYAA 3TFKD 5F7EH 4X5XB 4X6DE 5DGQA 4ODWB 5B4MD 3TM6A 1JMXA 1F2XK 2PW2A 5CGTA 1BVZA 1J0HA 4K23L 1FNGA 2PCPB 1MCPL 4I3GA 2DMKA 1H3WM 3U0TB 3VG9C 3EZ8A 1F02I 3DSNA 4P4RB 4BH7B 4JFED 1DZBA 3DX6B 3GJFB 1CF8H 2OTWB 1AXSA 5FA4B 1TCRB 3MODL 3CDGA 5DJ6A 5GS2D 4X6EA 1N5YL 1UB5B 3NOIA 3L3JA 3FO9B 4LCWB 3NIGF 3PWJA 1TTUA 1XF4A 4PV8B 2AI0L 1OSPH 4L8SA 1JWSA 3F6LA 3LD8B 4OLXL 4OUUB 4NN6C 4MNGB 1ZK9A 2JJTC 4ELKA 5F93C 4GMSL 5E8NA 4KMLB 3MXWH 2IPTH 3GSRB 4ZAKB 3OB0K 5DRXB 3EDFA 2FJGA 5DGRA 4R26H 1A7QL 1DVFD 3WV0A 2VDLH 3VI4E 4E0RB 3PHOA 2E6QA 3RTQD 4F7EA 2FATL 3MBED 2O5ZL 5JUEH 4XPTL 4H1LH 4MQXC 3OJDA 3IVKB 2NZIA 3MR9A 4X0KB 1A7PH 3C2AH 1NBYA 1YUHB 2WWKO 1OT2A 5KBNC 4LDLB 3L6FA 4MLSA 4P3DA 2CLRA 5JPMA 3O9WB 5F88A 3SGEI 1BHGA 5ADOL 3GMOA 1I4FB 5ICZA 1XF3B 3OMZA 3HA0A 1R3JA 1PG7X 1QRNB 5BRZB 3HG1A 2VLKD 3N0PB 5D1ZC 4PRHA 3OKMA 2BMKA 4DEPB 4LIQH 1KEML 1N0LA 5F7YC 1Y18B 3PP3K 4TTDC 4KDTA 4U1MA 4HFWA 3VFMB 3EOTL 5EO9B 4PR5A 3T65A 2XZCL 1CFVH 4ONGL 4JFZH 5I73C 2GT9A 4NZJA 4P57A 4PJEB 3GUTA 4PRIA 5T33L 5D7KE 4NKOB 4CVXB 3CZFA 5IMMB 5CBAB 4FABL 3D69B 4KWUA 4HCRL 4YX2L 5C0CB 3PGCA 3FN0H 1CDCA 1HWGB 5MP6L 5JHDD 1JYVA 5ISZB 4KK9D 1QYGH 5T1MA 1YEGL 3LRSA 4M5ZL 4AT6B 5FDWA 2AGJL 1KEGL 3O2WH 3SOBL 4PJ9A 1PQZB 4KKLC 2AQ1A 2EH7H 5IROA 1NGXB 3V0WL 2X1XR 1N8ZB 4XX1G 5DD0H 3RAJH 1RIUH 3LKQA 3P73A 4JQVC 5ESAA 5F1SA 3FOLB 1MIML 3CUPA 1L0YA 4ZFOB 4QHKI 2BVOB 1WWCA 3CJJA 3K46A 4YHYC 5IMOB 1R5VB 1WBYA 1NEZG 1W0WB 3RY6C 3U7YL 4F8QA 1T0PB 2KPNA 4KRPB 3FO2B 4OKVA 3SCMB 4JM2B 3TO2A 4M5YH 3VE0A 3H3PH 3GSVB 3LQAC 3MZTA 1FFPB 5IFJB 3MYZA 2E3VA 4P46D 3V4VH 1YPZA 3DXAA 6FABL 2X4TA 1NGWA 4TPRL 5IB1A 3LKNB 3F7YA 1T0MA 5GZND 5HDQH 3TN0C 4DTGL 2I9TA 4P2RA 2P8MB 4JPIB 5LBSH 2AP2A 4JY5L 3MXVL 5F89A 4U1GB 1RULL 1DJSA 1BWWA 1I8IB 2A9ML 1UWEL 1S78C 3GI8L 1KBGL 2VAJA 1A14L 5TH2B 4YE4H 4NNYA 3DGGA 2CUMA 4ORGA 1MNUH 3RHWF 1T21A 4LRIC 4P9ML 1CT8B 1NJ9B 1T7WA 4M8VA 3W81A 1EEZB 5E2VH 3TGXA 4P4KD 4DK6A 2A73B 1Z0MA 4KUCF 3T1WA 5KJRL 3L5JA 4JFPA 2YN5A 5JHDE 2WIIA 3ARSA 4HH8A 2IADB 5C0BA 1ZT7B 4N0CC 4BZ1L 2FZ3A 5JHLH 5L88H 4O02H 1NGYA 4FQ2L 2F8VA 5D7JB 2QQNL 3LB6C 3F7VB 3Q5OA 4HWZA 3PHQA 5EUOF 4EN3A 4J7RA 2W9EH 1AKJB 1I8KA 4KRNA 4LEXL 2ZNWA 5DD3L 3B9KC 2X4NA 3MGTA 3QHFH 3RRQA 2D7NA 3C09C 1WICA 4MCZA 1FNEB 2NY5L 1D9KC 5GS1C 4LCUB 1XIWC 4KXZH 3NPZB 4L8BA 3BO8A 1HIMH 3H9SB 4IBLT 5GGSB 2C7UB 4HUXB 4FA8A 3O3AB 5C0AA 5B8CA 4FQLL 3KXFD 1OW0A 1EH9A 1FAKT 4HWUA 3EW3B 2CKNA 4KROC 4WRLA 4CU6A 5JNYA 1AXIB 3DETC 4NO3B 3EGSB 2Y6SD 3O45A 1FH5L 2E9WA 3PJSA 3NCCB 3L3IB 2BC4B 3EYQC 3TBTB 2X10A 1HKFA 5J3HD 3UZVB 2MQCA 2QR0A 2IQ9L 4PJDE 4U1HB 3O0RH 5AWNL 2G60L 5JDSA 1GIGL 4KV5F 4EVNA 2JKXA 1IARB 1KJ3L 1J05A 1KNOA 4UQ3B 3FONA 4OGZA 3RWHA 1BP3B 3GBMH 1MAMH 1KXVC 2H2SD 2F5BL 4U6HB 1UB6A 4OF5A 3F6IA 4JKPL 3A67L 1RZJC 4FP8L 4S2SA 3S5LA 3C8KA 1C5CL 1ZA6A 1NCCH 3RDTB 1RK0B 1J18A 3UTTA 2XA8L 4IHOA 5I2IA 2EDQA 5C09A 5CAYB 1SM3L 1G9NH 1PY4A 4PJ7A 4E41B 4TUKL 2OL3A 1PVHA 2VWEE 4HX1A 3JWNC 1OVZA 4ODSH 1GPOH 1HHKA 3QWQB 5L0QB 1H8OA 1G7MA 5DMIL 1I7ZA 1CBVH 2R69L 4TNVF 1I1AA 2CO7B 4Y19A 3S96B 3VFUA 1MJUL 1EBAA 3NACH 3WN5B 5E4EC 1IQWH 4L1DA 4XNQA 4LEOB 5ID1B 5C0IB 4G80A 3KXFE 2ICWA 3BWAB 3GJFK 3T2NH 2CPCA 1JNLL 5D96B 3W11D 3NIDE 1H3TA 4OV6F 5E5RB 3JV5A 3W82A 5D71H 3UTOA 5DD6A 5KN5B 1N7MH 1QP1A 3GSOB 4KK5C 5BZDA 3VXRE 3X14B 5I1IL 5JOPD 5FKPB 2DQGL 4Z7VA 3VA2C 4ZFFA 1KCUL 1X4YA 4MAYB 3RWDA 3FB6A 4OZGF 3G5YB 4PJ5E 2G5BB 4XCEB 4ZUUA 1CL7I 3RUGF 3IDGB 4OZHF 2W92A 3KPLB 5IB3A 2R29H 1HQ4B 1VADA 1HH6A 2XNAA 1LO0H 3GGWB 2NY6C 1QFUL 4WWKB 2DL2A 4PJCF 2H1PL 4WFFD 3QUYA 1S5IL 4FQJL 4XZUA 2R2EA 1AP2B 3NFSH 2H26A 3V0AC 1IC4H 1FGNL 4JAMB 1F4XL 1RUML 4EJ1C 3TIEB 2IALA 4YEFA 3HN3A 5TGBB 4GG6A 3Q6GH 5DJ2A 2NY2D 4F3FA 3HE7D 1AO7A 4RAVA 4KK6D 2GQHA 2X9WA 4S1SL 3QBTB 3D18B 4ZSOB 2HJFB 3TNNB 4KAQH 4YXLH 2IPKB 3QUXB 4RMSA 2NX5D 3MREA 3LN9A 3G04B 3QQNA 5EOCH 4HAGA 3DPBA 4ODTH 2BNRA 4N68A 1BM3H 4H25B 5FAAA 4G8EB 4JLRB 3HI6H 4XPFH 5DURD 1GHFL 2K1MA 4XGZA 2J8UB 5E7FA 1RHFA 2WMPA 3HI5L 3SJVE 4N9OB 43CAB 4EDXB 1QA9A 4KTEH 5CIPH 1DFBL 1CFSB 5I1GL 1VPOL 1NMBL 3WUZA 4XP6L 2BSTA 3AS3A 2C3HA 4X8JB 1RJZA 4ZYKA 2ICCA 2GJJA 4M4PA 1PZ5A 3UJJL 3ZKXC 2DWEA 2PXYB 1NBVL 2P5WD 1A6WH 1RK1B 4OFYD 4R0LC 5A2LH 4WFFE 4YQXL 2JJSC 4CUCA 1NC2A 4XWOD 5HHQA 4K2UL 1U91A 2DM7A 4WUUB 1IAKB 4QRRD 1IEHA 1R3LA 4FOMA 4PS4H 3I02A 3MCKB 4QTHA 5SV4A 1VCAA 4XBGA 1X5LA 4RDQG 3SE3C 1ORSB 3TJHC 2EDXA 2NY3B 3MO1A 3BSZL 4YIQB 1H3VA 4JR9L 4XCFH 3CCHA 1DLFL 4Z7UA 4LASL 1NSNH 3QO0B 2GFBB 2Y5EA 1KIPA 3GMNA 3R06A 1KJMB 2ITDA 4HDIB 2NX5E 4C54A 5J7CC 1PYWA 1YNTB 1K4CA 3IDMB 1NGZA 2CJUH 3SN6N 1XZ0A 3X13B 4HG4J 1FVEB 4OM1L 2A6KA 3HPJB 4U6XA 1BAFH 4Y5VC 3K1KC 4HWBA 1Q9LB 3OGOE 3FKUS 5EN2A 4M1GH 4LQFL 1WBZA 3HS0A 1DCLA 4WW1B 5T5NG 3NFPB 4N1HB 3K8MA 1ZV5A 1ZKAA 4C57C 3RVWD 5EU5B 4NQDB 3O41B 3OKDB 2JELH 3N1GC 5GGVL 1QHPA 2JCCB 2P5WE 4HT1H 4XNUL 5F9AC 5HHMD 4KVCL 5FOJA 1E4XL 4JFQB 4NO2A 4O2FA 3MJ8B 4NQED 5I6XC 5C08D 3HZYA 4LLVA 1CFQA 4QRRE 3BZDA 4N0YH 3SKNA 4FFWD 5SWQB 2LTQC 1V3LA 2EH8L 4PJGE 4DN3L 3IJHB 4NC0B 3HZVA 2O5XH 5DRWB 2YD4A 4FXGB 3BQUB 3BH9B 4NUGH 5JQ6L 3VW3H 32C2A 4RA0C 4L3CA 5F6HJ 2J5LC 3L3OB 3CSBA 5CUSL 4LCIL 3OJ2C 4C55A 4WO4B 4XPHH 5BO1H 1OWRM 5MENB 4LCCA 4A6YB 2BY3A 4PGZA 5IVXE 3C5ZC 3OXRB 5AYUH 4AG4L 5HGHA 2UVEA 3V4PH 1MPAL 1PW3A 1PKOA 4NN6B 3BRDA 3AFLA 3WXVH 4OCRH 4NNXA 2W0FB 2EIDA 1ACYH 3QRFM 2H8PA 5HI5D 5K9JL 2D9CA 5E70A 1WEJL 1IT9H 5F6IC 5BQ7B 4MX7B 4S1QH 3EDKA 5IFAH 2E7HA 4G9FB 4K7PX 4BQ9A 2NQCA 3I6KB 3ARYA 1NGPH 2JE8A 2DRUA 5TE4L 4L4TD 3OKEA 5HJ3A 2YPKA 5D7IE 4ZDHA 4P23A 3UTSA 2PR4L 4OZ4B 3ARWA 1QLEH 2I07B 4I18B 1GJIA 3RNQB 4PJIA 5F70A 5HHME 5AAWA 5DVMA 4G7VH 1CD8A 35C8H 1QSEA 1DQTA 4NQEE 2OK0L 3GHEH 5GRUH 2P24A 5C08E 4OJFH 1UJ3C 2UZIH 2M1KA 1Z6JT 2JJVA 5E4IA 2VLRB 2QSTA 4FZ8H 1JWUB 4LBEB 5FYLL 4GLRH 4H5SA 1RZKL 3PXHA 1G6RH 1HHJB 1DE4A 4BYHA 2X4PB 1YEFH 4RFNB 4JFDB 3HNVL 4OF8A 4YWGL 5L7XH 5LAXB 2CR3A 4HXBH 1SY6H 4QTIL 1MVFA 4PLKC 1MI5E 2DM3A 4JREC 3SKJL 1K4DB 5IBLD 2C3XA 4PJBE 3CDYA 2BSRB 1MRFH 3SPVA 3VXSE 1BQHA 1U8MB 5F9DC 4N9GA 4F7CA 3L1OH 4RFEA 1PBYA 1YNLL 4JRXB 1AY1H 3FOMA 3SDYH 4PREA 1RZFH 1ND0A 4L4VA 4JZOB 4LVNB 2JB5L 3ZTNL 4IRSC 4HIEA 4LCWD 3S36L 4ZFOL 4RWHA 4AZ8A 2OZ4A 1F8TH 3U30C 4P5TA 5T1KB 4J4PD 4L4TE 2AEPH 4HAFA 1JUFB 4CMHB 2DI7A 3I6LD 1KLFA 1VACA 4RRPA 4KJPD 4MVBC 3GIZL 3JTTA 1KJVA 4I0PB 4R7DB 3AROA 4ZAKD 1FVCA 3TYGL 4JJ5B 1X4ZA 2J6EA 3B8SA 1IGYA 4L29A 4JN2B 3FMGH 1GGCL 1J5OH 1NGQH 3QCUH 3JVGA 1EA9C 4I3RL 3IDXL 4JO2H 3TZVC 2ESVA 4P2CG 4NHUB 5ICYA 4Q9QL 2XI9A 3LIZL 1RHHA 3IS0X 4N1CA 4Z7WF 3N1MC 4OQTL 3FB5A 3SDCA 3IDNB 5MEQB 2BOCB 5EC1A 3ZZ1A 4D0BA 4OT1H 1FCCA 1MCSA 3UXFA 3O9WD 1OGAB 1I7UA 3ARFB 5KS9B 2E9BA 3T77B 5C0GA 2XQYK 1I9JH 2YMXL 1UJTA 5DJ0A 1SJVA 5JW4R 1N0XH 2V5MA 2YR3A 4R8WL 1CXIA 1U41A 2HKHL 4MAUH 1QRND 3DUUB 5CJXC 5EOQH 1X6NA 1E0OB 2B4CL 5BRZD 1VA9A 3UZQA 1LEIB 1OCWH 1G1CA 2NY7H 5J6GB 3MROB 4BH8A 2DQDH 3MLUL 1F3JB 1B90A 3BKJH 1EMTH 1QLFB 4LCWE 5DRNB 1LNUA 2MCPL 4CKVX 1UKTA 4LPUA 4OI9A 2A2QT 1WIUA 4U1KA 1H5BA 4ZO6A 5DLMH 1Q94B 3BPOC 4MNGE 4GG8B 5AEAA 1Z0NA 1CICB 3OXSB 4XX1E 1MQKL 1JGUH 2MKWA 2FLBT 1E4WL 5C0CD 5IESH 5K9KB 4UDUA 4QCIA 3PQYB 3KYOA 4G8IA 4LMQE 3MLTA 5ISZD 5HYIA 5IMKB 2DLHA 4QKXB 2I26N 2X1QA 5EZOL 1XIWB 3EOBA 5F97E 4OD1H 2IAMA 3W2DL 4GAYA 1ZLVH 1BLNA 2BJML 1G6RA 2FECI 2YK1H 2OXHA 4MS8C 3HUJF 2PW2B 3T0XA 1MWAA 1G7HA 1KUMA 3V79C 1FNGB 4A2MA 2VDKL 4OF6A 1MCKA 1SVCP 1VENA 5TE7H 4NUJA 1V8HA 2VKXA 3UYRH 4K3EH 4OAWA 1T1XA 1AXSB 1J88A 1KPRB 4TSCH 4DVBA 5DFVC 3C08H 3CDGB 1NCAL 3FFCA 5DJ6B 3TEUA 4KRPD 4X6EB 3LVEA 5F7MC 4CNIB 3SCMD 8FABA 2HRLA 3L3JB 4JM2D 4WTXA 3HR5A 4LARH 3PWJB 4NZRL 3KPOA 4EQ3A 1O7SA 1XF4B 3WFHA 3CXDL 3RKDD 4L8SB 4M9PA 2H9GA 1JWSB 5I18H 4XB7A 4OZIF 4IS6A 1UH3A 3EJJX 1AGEA 2EKJA 4G6AC 3E1F1 2HN7A 3FQTA 4Y5XA 4ELKB 3BWUC 5E8NB 3QAZB 3QDMA 3JUYA 3T1FA 4PJEE 2YPVH 2FJGB 3ULUF 1YN7A 4QRSB 2X42A 4F37F 5BV7B 2VQ1A 3VFRA 1B88A 4KMTL 5D6CA 3PHOB 5GJSL 5C0CE 4IRJC 5D5MF 5TQ0H 1T2JA 4F7EB 4HJ0D 3QUZD 1W0VA 2BVTA 1F90L 4R96A 4B0MM 4JO3L 3MRRA 4K8RH 4G6MH 4OD2A 3OJDB 3L3HA 5ISZE 4RGMB 1O7VA 3MFGB 1DSFL 4R4NC 4QRPA 3FQUB 4WI3A 3MR9B 3CXHJ 1EJOH 2AJ3A 4JDZA 1NBYB 3IU4L 4JPVH 2APXA 5J1AB 2CRZA 5D7JD 3L6FB 3KPSE 4WY7H 2VLLA 1QD0A 2CKBB 4I4WA 4OGAC 4P3DB 4JFFA 2CLRB 3QIUA 5DJCA 1WZ1L 3LPWA 4AMKL 3WDHA 5JPMB 3DVNA 4PJHF 3TJEH 2YD7A 1AKJD 4U6VH 3GMOB 4G7YL 5ICZB 5FYJD 2ED7A 1BGXH 1TQBC 1R3JB 4AL8L 4X9FA 3BAEH 3HG1B 3O8XC 1QFWM 4PRHB 3OKMB 2BMKB 2IMMA 3H9SD 3W5NA 3NH7L 2HH0L 4U1MB 4HFWB 1RPQA 3KHOA 1KCRL 3KPRE 4LSVL 5I15H 4LSDA 1GVIA 4RMUA 4PR5B 3T65B 3LZFH 3HI1A 1MFAH 1ZT1A 1PG7H 2GT9B 4P57B 5DFWH 5D2NC 3GUTB 4PRIB 3EYOA 5HHXH 3CZFB 4D9RD 4Q74A 1KIQA 1ZHNA 2PW1A 3NA4A 2HJKA 1HXMA 3BPLC 4OCWH 2FNBA 5E7BA 7FABH 4YHZH 3O6KH 5EUOA 1Q38A 1QFWL 2R4RL 5T1MB 1ODAA 2Q8BL 3PWPA 3UYOD 1BF8A 5J1SC 4ZOAA 3LRSB 1AFVL 5FDWB 3QI9C 3OR7A 2XTJB 4K3DL 3O2VH 2FR4B 4PJ9B 3ZHKA 2EEDA 5MI0B 1XGQA 1BD2A 3V5HA 3LKQB 3RDTD 3P73B 1FRGH 1A21A 5ESAB 3CUPB 4MA8L 1M1SA 4PJ8C 1JTOA 2XFXA 1WBYB 4HULB 4ZS7L 3GBLA 2WQ8A 2EDFA 2WUCH 5I1CL 3H3KA 4OKVB 5FYJE 5DQ9B 3IKKA 1HINL 3VE0B 1F4WL 3D9AH 4Z8FL 4MLIA 1A7BA 1YPZB 3DXAB 1GAFL 1NGWB 2X4TB 5IB1B 3F7YB 1T0MB 1UM4L 3B2UC 4I5BA 3DO7A 2I9TB 4P2RB 5F89B 3GK8H 1I85A 5DF0A 1JL8A 5C6TH 5AZ2L 3NIFE 5HVWA 3AY4A 1KT2A 3VFVA 1T83C 4NNYB 1JHTA 1I3RA 3QCVH 4M43H 3DGGB 4YHKH 4ORGB 1T21B 3V6FA 4OCYH 2Z93A 3WMSA 3LHPL 2OR9H 4MAYD 4PYHA 3ZDZE 1OPGL 1A5FH 2GJZA 2VZUA 5D93B 3BD3A 4YC2C 5GHWL 5IV2A 4JFPB 5IHUL 3BIAX 3HE6C 1FL6A 3MACL 5MHSD 1YEIL 1SQ2N 1U8JA 5C0BB 1BX2A 2YKLL 2FZ3B 4U0RC 5HHVL 3UJIL 4FQXB 2VDOL 4WWKD 3KPTA 5CD5C 1NGYB 2DKUA 5HDOA 1JMZA 2FH8A 2VLJA 4HWZB 3PHQB 4HMCA 4QXGH 2RGSA 2BFVL 1HHGA 4H1LB 4EN3B 3QZWG 5C9JA 1I8KB 1XGYH 3SGEH 2B5IC 1FIEA 5DT1H 3K1DA 2X4NB 4PD4K 1KLGA 3MGTB 2Z91A 1A6UL 3CH1A 2IPUG 2DQUL 4MCZB 4OLYH 2BY0A 4L8BB 4LPTA 3BO8B 4NQCA 2Q8AL 4YNYA 4S1RH 4K7PY 2X89D 3T0EA 2HFEA 5E8PB 4OV5A 3GMRA 2KKQA 5C0AB 5B8CB 5HD8C 3RQ3A 1FSKB 5F9JA 3EFDH 4LRNL 1OOAA 4O9HL 3IS1X 1IQDA 5J11C 4M61A 3NN8A 3QUXD 5JNYB 2VTFA 3O45B 3MUJA 1MLBA 1OP5K 4KY1H 4OZGA 3MLSH 3QULA 1DL7L 3PJSB 3V0VA 4KZDH 2MTPA 4OZHA 4I48A 1DTUA 4WFEE 2Y06L 2EXYC 2AEWA 2FSEA 2R9HD 3IU3A 1AI1L 5JDSB 4EVNB 4YBLC 4LAQL 5AD0A 4PJCA 3GMQA 3RPIA 1J05B 2B2XH 1X6LA 1DP0A 4EBQH 5GXBB 3S37X 4JG0L 1T20A 5CWSA 1YEKL 3FONB 3RWHB 4A6YL 3O3EA 3NPSB 3OBAA 4Q9RH 1UH2A 5MHSE 1UB6B 1SHMA 1T66D 3NZ8A 3B9DA 4S2SB 5T5FH 4CJ1A 1ZA6B 2OYPA 2PXYD 3UTTB 4F57L 2ATPA 5DO2C 2C4FU 4IHOB 5C09B 5I2IB 3GSNH 4FHBD 3DO3A 1T6WA 4PJ7B 2NXYC 4WUUD 2X4OA 2OL3B 5E1AA 4HX1B 4P59H 1HHKB 1G7MB 1MRDL 1I7ZB 3C5ZB 4F7PA 1I1AB 4JDVA 4M93C 2D4FA 4UILL 1CE6A 1AH1A 1HSBA 2NY3D 3AB0C 4Y19B 3VFUB 3WJLC 1ZE3C 1N6QL 1YQVH 4XAKE 1K3ZA 2X1OA 2HTKD 4GAJL 1BEYH 4MQTB 5KANG 2KDGA 5JXED 3HHRB 4G80B 2ICWB 1SYSA 4ENED 1N6UA 3QG7H 5FUZL 4DKEH 5DD6B 1CK0L 4DW2L 1QEWA 4S11A 3ULVH 5FGSA 4XI5C 4RGOH 5BZDB 2A6IA 1EAPA 3DVGA 4Q7DA 1MFCH 1EXUA 4NM4L 4DN4H 1TZGH 4Z7VB 2DQCL 4ZPVA 4ZFFB 2F19H 3A6BL 4RX4D 2C3GA 4BSVA 3DHMA 5IHZA 3RWDB 1LILA 5D8JH 4V1DE 3FB6B 2NY0C 4ZUUB 3BT2H 5IB3B 1VADB 1HH6B 1YNKL 2VITA 2XNAB 4UDTA 5ESQA 1M05B 3KYMA 4U3HA 4NQDD 4Z7NF 3QUYB 2VN7A 4XZUB 1RZ8A 4GKSB 4OLUH 5KSVA 1OTTD 3U7WL 1I9RL 2H26B 3KPPA 5DK2A 3T08A 4HUKB 4WCYH 1QR1A 4YXKH 3ZDYE 2OMNA 3ARUA 1UZ6F 1IAIM 1VFOA 1ZVHA 1W8NA 1MY5A 1MIEL 5IM7B 5KTEH 2IALB 3MRKA 1CGXA 5EUKA 4OLEA 4GG6B 4PG9A 1XH3A 3UC0H 4F3FB 4E42A 1NCTA 3ARDC 4CVUA 1AO7B 2CRMA 4H20L 4RAVB 1IM9A 4FTVA 3WNPA 3QUMH 4TVPD 3BQUD 3LN5A 3S5LG 1P7QA 2EO1A 5TJWK 1JPFA 4IMKA 3U4AA 3MREB 5EU7E 3FB8A 3QFJA 4EXKA 1A22B 4WO4D 3RL2A 5MEND 4IRSB 3F58L 4Q2ZA 5A2IH 1F4HA 3UPRA 2BNRB 1NLDL 1TTFA 3T8XA 1ADQL 3IXTA 4XGZB 1IEAA 1JN6A 5CEZE 2W65A 5TQ2H 4NCC1 1QA9B 1RIVH 3KLHD 4MNHA 1HZHL 3A0OA 4GQ9L 1MRCH 4JHAL 2BSTB 1LO5A 1RJZB 4POZC 4G9FD 3GNML 4AK1A 2BVQA 4UZGA 4HKXA 1PZ5B 4QYOA 4O4YH 1BPVA 4UINH 5IEKA 2DWEB 4YR6A 2DQTL 1R5IA 4WHYH 1RUKL 4OCNC 1HNFA 1I3VA 2X70A 3CDCA 4BSJA 1NC2B 2J12B 5HHQB 1UM5L 4ZPTA 4ZQKB 1U91B 2Z92A 3MQIA 3UBXA 1R3LB 1LVEA 3VWKA 3I02B 3QEGH 4JY6A 3V52H 4QTHB 1UYWH 2YUZA 5TF0A 2AK4A 3LQMA 1ZLSH 4XBGB 5J56B 1ZGLM 3T3PF 3MO1B 2QSCH 3S88L 2A9NH 1EPFA 2VLRD 3CCHB 5E24E 4Z7UB 25C8L 3QWRA 4XAWH 3O4OB 5TDPA 4DZ8A 3K8KA 4K8RC 1FL5A 3ZT7A 2ADIA 4NOBA 1KIPB 4TVPE 3AREC 3GMNB 3R06B 4CVWA 2DDQL 3WKMH 4JFDD 2ITDB 1QSFE 3CFIC 5DVLA 5DJDB 1G1YA 3OAZK 2DQIL 2RBLA 1PYWB 1K4CB 5MENE 1NGZB 1IGIL 2MQ0A 4JRYE 1XZ0B 4JGUA 3NGBB 3RWJA 2LE9A 3EYFA 2A6KB 4U6XB 5JXAH 1IVLA 1MREH 3QPQD 4NC2B 4KTDH 5I8CB 4Z77A 3HNSH 5EN2B 5SX4H 3BPOB 1WBZB 3HS0B 3ILQD 1A9BA 1CL7H 4JRXD 1L4IA 2Y7QA 4LLDA 4ALAL 2J88H 5C2BL 3U0PB 2AJVL 2EDHA 2D7MA 1CQKA 4M7LT 1HSAA 4Y88A 5DJ8A 1J8HA 4BQ8A 2QHRL 3MLYL 3HMXL 1IAOA 1MCCA 2AEIT 5T1KD 1IGCL 1R6VA 5JOFA 2XZQL 3ET9F 4O2FB 1R3IH 1FG9C 5HYFA 3HZYB 4LLVB 1CFQB 2Z8WC 1G0YR 1OAYH 2VXQL 3RGVC 4I0PD 3EDJA 4LHUA 3NTCH 1R5WA 2VSCA 5IG7A 1DBMH 3SKNB 3NCMA 1Y0LB 2Y07H 5E2UL 4NDMA 3WXWH 1MFBH 3HZVB 2RJMA 5KVGL 32C2B 1CVRA 4L3CB 4OBSA 2X1PA 5F21B 4XNXH 1KCVH 4M4RA 1EHAA 3WFZA 4LCCB 4HC1H 5BV7L 4JFDE 1NFDF 2R39A 3OAUH 5GSVA 3ZMRA 3FRUB 3PP4L 5HGHB 1JFQH 1I3GL 2DLFH 3SQOH 2VDNL 4EUPG 4GMTH 2K3TA 4OZFH 1OGAD 3ARFD 4NNXB 2D7TH 4Y16C 1PD6A 3RVXD 3BKYL 3OX8A 1KOAA 2CKBL 3TT3L 4WV1A 3QHZH 5DA0B 3EDEA 3MA9H 2O61A 3ZE1F 2R1YA 2V17H 3OKEB 2XXCB 1Q1JL 2YPKB 4ZDHB 1BQLH 1T22A 4ODHL 4P23B 5HJ3B 3UTSB 4PP1D 4EUPH 3PF2A 4XP9L 3C5SA 4ODBD 3CVHA 3BP6A 3ROOA 5L6YH 2BHYA 2M26A 4PJIB 4B41A 1T04B 4K7PH 2XRAH 3WO3B 1QSEB 1CICD 2P24B 2BCKA 3B9EA 1A9EA 3EYVA 3AM8A 1ZTXH 4H5SB 4KVNH 4XP5L 2H32H 3PQYD 4KFZC 2VZ1A 1AGBA 3MOAL 2VDMH 4LLYB 3CLFL 1YEJH 1JNJA 1ZHKA 4X80H 3CSGA 4PRAA 5SX5H 3F7QA 1XIWD 5B39A 5F3HA 5DUML 4GH7B 4LSQH 2V9TA 4YDKL 3FT4A 3P11L 4QHUA 4CN1A 4WI8A 3VU2A 1HYRC 3W9EA 2HWZH 2VH5L 2DTML 1NKRA 2HRPH 3VXNA 3SPVB 1OM3L 1BQHB 2FL5A 4N9GB 5DQDH 3OPZH 4F7CB 5D6DA 3CX5K 4GRWF 1OGAE 4RFEB 5KOVC 3STZA 1F6AA 2OR8A 3FOMB 4AEFA 1ND0B 2ZUWA 5EOTA 3QIWC 4CGTA 3EO1A 4L4VB 4Y4HA 5E2TL 4HIEB 1NQBA 3K81A 4P5TB 4WW2F 3H7LA 2DQHH 4LKXA 4Q6IA 5DEZA 1LMKA 1VACB 4L5FL 3JTTB 2FWOA 1OP3H 1KJVB 2DJSA 1FVCB 4J1UA 2Q7YA 1IGYB 2WLYA 4L29B 1HQRA 4YHPB 3HUJA 4KKCD 4HJJH 3CPLA 2UYLA 4LPYA 4O51A 4NQVA 1IM3A 4DQOL 3GRWH 3JV6A 5D1XA 1P2CA 2ESVB 5FK9A 5ICYB 3U1SH 4AEHL 2VDRL 1RHHB 4N8VG 5IOPA 4UTAH 2J8HA 3FB5B 3SDCB 4O2EB 5EC1B 4GS7B 1F3DJ 4D0BB 3MXWL 5I1DA 3BGMA 1KCKA 4Z5RB 2YA0A 1I7UB 2E5EA 4M02A 1GCFA 3I75A 1FL3A 4JPWH 4NKIL 1MHHB 5C0GB 5DJ0B 2FCBA 4R26L 1KELH 5FUOH 2VDLL 4OZIA 1D5BA 4FFVC 4QRUA 3VGEA 3TLRA 4KK5D 4MHHI 5HYSA 3HG1D 4ZD3L 4PRHD 5JUEL 3AVEA 3JWDC 3DVFA 1I1CA 3P4LA 3B43A 4OD3H 3AS0A 1A7PL 3C2AL 3IYLW 1LNUB 4L1HA 4PY8J 1FG2A 2CLVA 1ZEAH 4P2OC 1LP9F 4U1KB 4P5KA 5D5MA 1H5BB 4PRID 3G5VA 3ULVC 4JKWA 4LSSH 2R1XA 4HPYH 1N3NA 1EO8H 1TITA 4UDUB 5INDA 4QCIB 2ADFH 4R97C 2B5IB 4YUEL 2L4OA 3TO4C 3KYOB 4G8IB 4LIQL 3C8DA 1CLZH 5I1JL 1YMHA 2XY2A 4PJHA 4CU7A 1TLKA 3QWOB 2ZUQC 4HIXH 3EOBB 2YEZA 2NXZB 2XTJD 4GAYB 2F15A 2ORBH 4PJ9D 1MSPA 1HKLH 3IDYB 1BLNB 2VIRA 1G6RB 3N1FC 4RRPG 3MNWA 1W2KT 1LWRA 3M45A 1MWAB 4U6YA 1G7HB 1EGJH 2GJ6A 4KDVA 5J11B 1J9CT 4NUJB 3MOBH 2ED9A 2DQEH 5DC9B 3N50A 4X7SL 5F9OH 3ILPA 3FN0L 3EYSH 1F2QA 5DA4A 4OAWB 1T1XB 4DVBB 3FFCB 3HLAA 3Q6FA 1UACH 1OAUH 1QYGL 8FABB 4OLWH 4M7ZC 2F5AH 4APQA 3HR5B 4XTRD 3KPOB 1YYMH 4Z7OF 1K8DA 3U7AA 3DXAD 2HLFD 3LKOA 1C12A 4KI5F 2OL3L 3WFHB 2H9GB 5DD0L 4IS6B 4NN5C 4P2RD 4M6NH 5A16A 3ARBA 1AGEB 2VL5A 3HTLX 1ACZA 2HN7B 3FQTB 4Y5XB 2KUTA 1AR2A 1PFCA 1TJGL 3QDMB 4YFLI 2ZWLT 3T1FB 2BY1A 4PRIE 2H45A 1YN7B 3QNZA 1U8QA 1U58B 2VQ1B 3VFRB 3DLQR 1A6AA 1JPST 5D6CB 3SGDI 1AJ7H 2P49B 4M5YL 4X5LA 4H0HB 1TDQA 3R8QA 3G6JF 1W0VB 4R96B 3MRRB 4OD2B 5HDQL 3L5WA 5GRYA 3ROLB 1P9MC 5C0BD 3OJMB 5LBSL 4QRPB 3CFEA 4XHJD 3BP7A 4XVSH 2AJ3B 4JDZB 4LCYA 4FQXD 3HZKA 2XTJE 3S34L 2VLLB 5JOEA 3GRWA 4JFFB 4YE4L 5F7KC 3QIUB 5DJCB 5EIVA 3DVNB 4EN3D 5DDHA 1MNUL 1V3KA 1JGVH 4ZUTA 4GBXA 2J4WH 4K71B 5E2VL 4ZO9A 5BW7C 5IWLA 1RJYA 2HFGH 3TVMC 3BGFB 1QKZH 3MLXH 3ZT6A 2ZG1A 2APWA 5JHLL 5C0AD 4N90E 1RZIA 1FNHA 3G5ZA 2ZCKH 3DXAE 4HWNA 1NCDH 3TV3H 2E27H 1ZT1B 4KKAC 1ETZA 2QSQA 4P2RE 1D5MA 2GYSA 2ERJB 2K9UA 3VI4F 2X4SA 4F58L 1KIQB 1ZHNB 2PW1B 4ONHA 5EB9A 2HJKB 1HXMB 1L7IH 4U49A 5IVZA 1FNLA 3DMMA 3MCLH 1NAMH 1MUJA 4N8PA 5EUOB 1S5HA 2UZYB 1CU4L 1NMCC 2E7BA 3PWPB 2UVFA 1IFHH 1RD6A 5KW9H 3OR7B 3SGKA 4MMZC 1AQKH 3DRQA 1XGQB 1FE8H 1BD2B 5CP7A 1CQYA 1IC7H 3V5HB 2JJUA 1MAJA 3UTTD 5C3TA