4HZRA

Crystal structure of ack1 kinase domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
261
Chain Sequence
LTCLIGEKDLRLLEKLGDGVVRRGEWDAPSGKTVSVAVKCLAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Activated CDC42 kinase 1
publication title Ack1: activation and regulation by allostery.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 261
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hzrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hzrA01
1Q3WA 3F5PA 3I6UA 3WIGA 4MBLA 2BPMA 3C9WA 3MPMA 3NIZA 4I6QA 3QZFA 4FKSA 3QTSA 3MB6A 3SKCA 5LVNA 3HDNA 1HCLA 2VX3A 1H0VA 5BMMA 4YMJA 3V8SA 4HZRA 1BI8A 1APME 2ZV9A 4P4CA 4LGHA 1SVEA 2YIQA 3HP5A 3PTGA 4ITJA 3NW5A 5AV1A 5HNIX 1H07A 2YM8A 4YZDA 3TIYA 5EOBA 2XIRA 4ACGA 4JDHA 5BYZA 1YOMA 3UJGA 4RMZA 1LEZA 3OCTA 4QD6A 3FMNA 5E90A 3DZOA 5LMBA 3BE9A 2CGUA 3C4ZA 3ERKA 1JKSA 3C4EA 4QYYA 3TZ9A 2QKRA 2W9FB 4JRVA 5B2MA 4KSQA 2OJFE 4HYSA 1V0BA 2V62A 3ENMA 3HV4A 2P3GX 4FC0A 4LL5A 4FSRA 5HTBA 4YLKA 4D58A 3QCSA 3ZFMA 5BVEA 3NYOA 1PXIA 4JBVA 4PL5A 4V05A 4USDA 4LG4A 4A07A 3V5LA 4EYJA 5A9UA 3NUAA 3TUCA 2PMLX 2UW5A 2QOLA 4MNEA 2JDSA 3B8RA 3HEGA 3GENA 5J8IA 3VQHA 4ANMA 3QD0A 2B52A 4KKHA 1ZARA 4Y73A 2XNNA 5HLWA 4WG3A 2C5OA 3VVHA 4O7WA 2C5NA 3NUPA 3ORTA 4C0TA 4PP9A 2BAJA 3P5KA 5E8SA 4XV2A 4I23A 1R78A 3BU5A 3C50A 5ACBC 2HZIA 5IA4A 4J97A 2VZ6A 3L8PA 5CU2A 4ZMFA 3OFMA 4CZYB 2JFMA 1WBSA 2X4FA 5IKWA 3R9NA 5IEVA 2XK3A 4LOPA 2J5EA 4U6RA 2QD9A 2Z7SA 4BWXA 4W8DA 4FZAB 5AX9A 4WKQA 4QNYA 3BELA 3N4TA 3QQJA 3QX4A 3MN3A 4ONAA 4QQCA 4D0WA 4EK5A 5CSHA 3HRBA 2PWLA 2WELA 1YDRE 2JIIA 4I5MA 4PV0A 3C4CA 3QQKA 5I0BA 4FTKA 4CGAA 3W55A 3QHRA 5LJJA 1CKIA 1K9AA 2YABA 4PY1A 4FIHA 4FV1A 3PPKA 4EHGA 3EN9A 4IMYA 5AADA 3PRFA 3I6WA 4YJPA 2CN8A 2C6MA 2ITOA 4O27B 5KX8A 3DK6A 4FNXA 4NU1A 1IAHA 3V3VA 3S0OA 5C8MA 4G5JA 2QC6A 2O64A 1XH8A 3EQIA 3SGCA 2B0QA 2VWVA 3H3CA 2WTJA 2UVXA 2EXEA 3KXMA 2VX0A 4RIXB 4MXXA 4EZ3A 2OGVA 3Q9WA 5L2SA 2ZB0A 5AM7A 2W4JA 4NW5A 4BZNA 3KXZA 3Q04A 4W4YA 3WYYA 1H1WA 4BR3A 5GZ8A 3OOMA 3AQVA 1FMKA 1OKWA 3UO5A 3R63A 2WKMA 4XH6A 3Q2JA 4ZTMA 1R3CA 4FTUA 4CSVA 2PZ5A 4BCQA 4F9YA 5EKNA 3U6HA 5M06A 4FICA 5J1WA 4GVJA 4BBFA 3FL5A 4AU8A 5H8EA 2LGCA 4CKIA 4QTAA 5HTIA 1H08A 4FL2A 2GNJA 2XP2A 4CFVA 5ITAA 5JFWA 3OWJA 5FUTA 3UOLA 3KN5A 3FLWA 3ZMMA 1W84A 2XK7A 3F6XA 4M7IA 2QLQA 1WBWA 5G1XA 3QKMA 4BCJA 4C61A 2J4ZA 3MSSA 4ENXA 3W32A 2W1CA 4FTRA 3KCFA 4JR3A 5JZJA 5KMLA 4S32A 4WD5A 5CEMA 2B9IA 3RPOA 4QMYA 4YSMA 4M14A 3BYSA 2HENA 2YIRA 1OPKA 2CGVA 3FKNA 4X6RA 4E26A 5J9LA 2X39A 2OWBA 3G6GA 3Q9XA 3G15A 1F3MC 1PXKA 4CTCA 2J50A 3H9OA 4JDKA 4IAFA 2R3GA 2ZM4A 3WZDA 4HYUA 3G90X 4HGSA 3TUBA 3MFTA 2YLEA 4RVLA 4EJNA 3BWJA 1ZOEA 4JXFA 3AC4A 4BI2A 2F2UA 3G9LX 1U54A 2YAAA 5HICA 3K54A 4FKJA 2WGJA 4I5CA 4AZVA 4O7SA 4M68A 5TO8A 3ALNA 5AP1A 1G8SA 3QYZA 2OXXA 5CF8A 4AZEA 4JX3A 3V01A 3PIXA 2OJIA 2H8HA 5CANA 5DT3A 4QTBA 5E4HA 3R8ZA 2QOQA 1ERKA 4X3FB 4W9XA 3LZBA 3CY2A 4OBQA 2BTSA 5CXHA 4DYMA 2W4OA 1XH6A 3ZFXA 4A4XA 5HD7A 3LLTA 4LQMA 5AFVA 2EB3A 3H10A 3VBWA 3FPMA 4AGWA 5FTOA 1WMKA 2H6DA 4NIFA 4XG3A 3NUSA 3SXFA 4QMNA 2BMCA 2XK9A 3Q6WA 4K77A 2XCHA 4AW0A 3ALOA 5CAOA 5IQAA 2C5XA 5A46A 4E5WA 1GZ8A 4DFUA 5HCZA 3W2PA 1OIYA 3OD6X 2LAVA 3LXNA 5H8BA 3TG1A 4AGCA 3R9RA 2WEIA 5T6KA 2J0JA 2XM8A 3L9MA 3R00A 5I9XA 4M66A 1NVRA 4B7TA 2PUIA 3GCPA 3E7OA 2IO6A 3G33A 4DC2A 4IZYA 2XIYA 1WBNA 2ZV7A 4N70A 2BDWA 5CZIA 3DB8A 5EI6A 4LM5A 4YP8A 5M4CA 4O84A 3K3IA 2XCKA 3HV7A 2WQOA 3OY3A 3GQIA 4MXAA 5KE0A 2B55A 2UW7A 4KS8A 2UZDA 3LFCA 1J1CA 2ITPA 4ANBA 1CMKE 2C1AA 3RZBA 3FMJA 4O0XA 2OLCA 2W1GA 4ACMA 2R0UA 5CI7A 4FV7A 4R8QA 2VWUA 4DGGA 4MD8E 3BIZA 3C1XA 5F95A 3H9FA 2VTAA 4H3PA 4OT5A 5CVFA 5DI1A 5CVHA 2R3PA 4FGRA 5DG5A 3VJOA 2AC5A 5K0KA 4FUXA 5AIRA 4EJ7A 4PTEA 3QQLA 3NNXA 4E6AA 4QTEA 4ZMEA 2AC3A 2GHMA 3EB0A 4U41A 3DU8A 5J5TA 3QTRA 4D0XA 2UW9A 2RGPA 1TVOA 2OH4A 1NW1A 3NPCA 1YXVA 5JQ5A 3RPSA 4OTWA 4C58A 2E9NA 4TPTA 5IEXA 2XKDA 3AMAA 3TKHA 2VTLA 1LR4A 5GJGA 4QTDA 5HOAA 2C5YA 5IZFA 4RZVA 3HGKA 4XX9A 1ATPE 4I93A 2XKFA 1YXTA 2W5AA 4HCUA 1SYKA 2WU7A 5DEWA 2GNLA 3FC1X 2XEZA 3QXOA 4BDJA 3VIDA 3QRUA 4G31A 2VWZA 3CPBA 2E2BA 3DKOA 2UW8A 3FLSA 3O17A 3W33A 5KMNA 5CS6A 2X6DA 4I22A 2R3MA 4FG9A 4M0ZA 5CI6A 4H05A 2QI8A 4YZCA 1LP4A 3KRWA 3H0ZA 3PXRA 3R7VA 1E1VA 3ZO4A 5ANIA 4AW1A 4EC9A 5ANOA 1Y8GA 4USEA 4NL0A 2R7IA 4WUNA 2EU9A 4DHFA 3VF8A 1ZY5A 4O1PA 4GIIA 3ELJA 4CVAA 3UC3A 2BAKA 4E20A 3TV6A 4CV8A 1ZAOA 2ZVAA 4C4HA 3QGWA 3GOKA 5HCYA 4R1YA 2UZOA 3TNQB 4AN9A 2WTIA 3DQWA 2Z7LA 2XJ1A 2QCSA 4FE2A 3UZRA 4RT7A 4YTHA 1SVHA 3OCBA 2C3JA 3W2OA 5HORA 3QQUA 4ZTLA 3CY3A 2C0IA 1GIIA 4YURA 4MEDA 3RZFA 1PMVA 2OK1A 2P4IA 3D5UA 3LCDA 5AIKA 5DGZA 4YU2A 2WU6A 1KE7A 5GINE 4UZDA 5EYMA 4E7WA 4FSZA 1PF8A 1DM2A 1VR2A 1UVRA 3E8CA 4CT2A 4D2RA 1Q8TA 4QP3A 2H9VA 2XIXA 2ZAZA 4Z7HA 3P7CA 4G17A 4CKRA 2FVDA 5DIAA 5ETFA 4D1SA 3LQ8A 4TW9A 2R4BA 2O2UA 2X2LA 3ZEWA 3R9HA 3IW5A 3N4UA 3WBLA 4R78A 3I5ZA 3BI6A 4QP1A 2QONA 2IZTA 3EKKA 2XS0A 3F61A 3U51A 4YTCA 2QU6A 1P4FA 3NS9A 5JFXA 4DGOA 3E63A 4OTQA 5JRSA 3BBWA 3KRRA 2WQEA 3E64A 5HG8A 1OL7A 5AV3A 5IMEA 2FA2A 5FM3A 3VUDA 1H24A 1SM2A 3NWWA 2QOOA 2UZEA 3A99A 4L3JA 4UWYA 3UZTA 3FZOA 3WE4A 5K3YA 2XJ0A 3I7BA 3RGFA 1M17A 3MVJA 3F3ZA 5DT4A 3E93A 4BYJA 4IE9A 3W2QA 1UWHA 4IAIA 3VUIA 2VV9A 4FR4A 3LCSA 5L8KA 3QFVA 5TOZA 4YO4A 2HW6A 3OCSA 1F5QA 4RIYB 1HCKA 2PVFA 2HWOA 4YUQA 2WO6A 1PXMA 3D5VA 4HVHA 4J53A 3OT8A 4GG7A 4CV9A 3NVKI 4JX7A 4V0GA 5CENA 5IEYA 5E91A 4ZSAA 3EKNA 2X7GA 3OXTA 4MF1A 5I9VA 4RPVA 3GGFA 4GT5A 1YHWA 1H1QA 1VZOA 4E4NA 5EHLA 3TACA 4U81A 3ZLWA 3TIZA 5HE0A 4GH2A 4BI0A 3MVMA 4BI1A 3CJFA 3V8WA 3REPA 3ZBFA 1PXPA 3RWPA 3ZRMA 2QG5A 2QOBA 2GNHA 4Y8DA 2IVSA 5F20A 4F9CA 2GTNA 4O38A 4ERKA 2V22A 2XUUA 5EK7A 5HI2A 5HGIA 3FZ1A 3QQHA 4LMUA 3VBVA 3ZSHA 5M4UA 4BDEA 5I3RA 1YXSA 1ZOGA 4BCMA 5L2WA 1PMUA 4QP9A 4O86A 3O50A 4ZJJA 4BTFA 3OBGA 1Q8ZA 4FTNA 4QP7A 4GV1A 3LFBA 2OXYA 3IS5A 4A7CA 3IPHA 3IW4A 3TV7A 5HLPA 4F6WA 4FEUA 4L52A 3NYXA 4ZTSA 5IA5A 4EUUA 4C57A 3UQCA 3VHEA 4ZLZA 3RPVA 1CKPA 2X7FA 2OH0E 4YPSA 2BUJA 5I5ZA 3W2CA 3EQCA 5H8GA 4CG9A 4L44A 4AP7A 3OW3A 5K5NA 1JNKA 2W1DA 3GU6A 3O7LD 2X2MA 4GU9A 2Y8OA 3FPQA 4TWCA 3ANQA 4EBWA 2ETMA 4IH8A 2FYSA 4V04A 2ZMCA 3B2TA 2C4GA 4RIWA 3HRCA 3BHTA 5KHWA 5CF5A 3P7AA 4MXCA 4RVKA 3FI4A 3NDMA 5B2LA 2WD1A 5J79A 5GJFA 3GC0A 4TYIA 1YXXA 3KEXA 3TCPA 3FYJX 4DG0E 2BHHA 5M4IA 4X2NA 4GFGA 4AUAA 1Q99A 5DWRA 2VTJA 2YM3A 4J8NA 2IZSA 3AGLA 3CQEA 3LJ0A 4UYNA 5CTPA 1M2QA 2RFSA 3HMMA 5C9CA 2B4SB 3QTQA 1PW2A 5FXQA 4RG0A 1PY5A 3AC8A 4X21A 4EOQA 2GFSA 4AG8A 4C4EA 3QD2B 5CASA 1KV2A 4EH6A 3QLFA 5M53A 2QVSE 5BUIA 2W17A 2FGIA 3R8MA 3F5GA 4OBPA 3WZUA 4EHEA 5C8KA 2Z02A 4HNFA 1GAGA 5HNBA 3RJCA 4F6SA 3NUYA 3HV3A 1OB3A 5HBEA 4YZNA 4CLJA 3DNDA 4KRCA 3UVRA 1W7HA 2Z7RA 2J2IB 4GUEA 2Y9QA 3OXZA 3AC5A 4X3FC 4UEUA 3E3PA 3MH0A 2GS7A 5CX9A 2F9GA 4JIAA 2FSOX 4FA2A 3GU8A 3ZM4A 4ZY6A 3VULA 5KMJA 1YW2A 4QMXA 3HZTA 4MXOA 3PVBA 1Z5MA 4FTCA 2UZBA 3SOCA 1BI7A 5KUPA 2JBPA 4O7YA 3JY9A 4W4XA 3SLSA 4BCKA 3PIZA 2EXMA 3NYVA 3LE6A 4EI4A 3DBCA 5CEPA 3ET7A 5DR6A 2ETRA 4Q5EA 2UW6A 3RBWA 3RK5A 4EOPA 4U0IA 4DGLC 3R7IA 5LCJA 3QCYA 1W8CA 4U3YA 2JBOA 5AUUA 3W1FA 4TZRA 3UODA 4EKLA 2ERKA 2VWBA 4HPUE 4XV1A 4EH4A 5BVFA 1H28A 2ACXA 3SRVB 1Y91A 4C4JA 3LHJA 2JKKA 3CR0A 4UXLA 5EW8A 4DN5A 2I0VA 4IIRA 5CT0A 1JBPE 1YKRA 2C5VA 3ORNA 4LOQA 4LGDA 3COHA 3DBEA 2X7OA 4DEGA 3VBXA 4A4LA 5GNKA 5AUVA 4UWCA 5IA1A 2XNPA 2FSTX 2CN5A 2CSNA 5LWNA 5E9EA 4IX3A 2ZMDA 2QOKA 3LM5A 5AR4A 3F3UA 2CLXA 3NSZA 4YR8A 3ZYAA 5HD4A 5JK3A 3QRKA 5CALA 3NAXA 5EFQA 5L2QA 1B38A 1H26A 4IVBA 4ACCA 1YVJA 2VTPA 3DKFA 3BWFA 4HVGA 5IQFA 4EOOA 4E6DA 3V6SA 4U7ZA 5HEZA 4O0TA 4DFBA 3I81A 2ZDTA 3GC9A 4WOVA 5CYIA 3A60A 4IWDA 5A3XA 2RL5A 4O7LA 2P2HA 4JNWA 3OMVA 4BY9E 2HAKA 3D15A 3GU4A 4YJSA 4PX6A 4KKEA 1CSNA 4TTHB 1U59A 3FEGA 3EYHA 2BDJA 3VWAA 3CSVA 3LCOA 3Q53A 3QQGA 5E8XA 5A14A 2HCKA 1FGIA 3ZHPC 5JRQA 3RPRA 5IQDA 4FKIA 3PJ8A 3LFNA 1UNLA 1MUOA 1OM1A 4IM0A 4JL9A 1URCA 3RALA 3UVQA 5C4LA 5A4LA 2PVKA 2A2AA 2X8IA 3VS0A 3TZ7A 2RFEA 4WA9A 5I3OA 4DFXE 3OG7A 4FKRA 4IJPA 3VBYA 2HIWA 5L8JA 4OAVB 5M51A 5BVWA 4IWOA 5LXMA 4MYGA 4Q2AA 3E88A 3VUHA 5JQ8A 4BCPA 4UYAA 1IASA 2H96A 3TWJA 4FKQA 3VS1A 3MS9A 3OS3A 3IGGA 2OICA 1J7LA 2PE1A 2ZDUA 2XB7A 3BU6A 1PXNA 3LQ5A 3RAWA 2PTKA 5DVRA 3PZHA 4MD9E 4BB4A 3VRZA 1Z57A 3NEWA 3OEZA 3E8DA 2EVAA 3LFFA 4M84A 5AX3A 3U6IA 4JG8A 3Q2MA 3FMKA 4QPSA 3NVMB 2XA4A 3CGFA 5H3QA 3F2NA 1M2RA 4K8AA 3EMGA 3T8OA 2PE2A 3MIAA 4XYFA 4AT3A 1UU8A 4MD7E 3OZ6A 1G3NA 3KA0A 4TY1A 3PVGA 3I60A 5FEQA 4IFGA 3R9DA 1VEBA 2OU7A 4EH9A 5EQYA 3CGOA 2XRWA 4HCTA 2G2HA 1JKKA 5HVYA 2C6KA 3IDBA 4D2PA 3OC1A 3G9NA 5BUEA 3GNIB 4MAOA 3MA3A 2G1TA 4RQKA 5IA3A 3L9LA 1JOWB 2AUHA 1TKIA 3F7ZA 4PNKA 5K4JA 3EZVA 4ERWA 3MTLA 4F0IA 4BGGA 2GMXA 2WMSA 2PZPA 4LV5A 2HK5A 3R02A 4KNBA 3VS4A 2ZYBA 3QTXA 2GPHA 3ZZWA 3ZDUA 4RFZA 5EDRA 4IVDA 4QQTA 4NH1A 4FVPA 3DPKA 3VS5A 1WVWA 4RLKA 2QOIA 1U5RA 2ZV8A 3QQFA 3JYAA 4EK4A 4GFMA 1P5EA 3FHRA 4F7LA 3LMIA 2C0TA 4J1RA 4C4FA 3TEIA 4YTIA 3L8XA 3RHXA 1W83A 2GFCA 1TQMA 3A8XA 2IW9A 4DFLA 2WTDA 2REIA 3QF9A 3VNTA 3PZEA 2R3KA 4AZFA 4TNDA 4TYHB 3PXYA 1RDQE 4FEQA 3FC2A 4U40A 4GW8A 1E9HA 2UZLA 4O83A 3CCNA 3D5XA 3VUGA 2OF2A 2VTQA 4UY9A 2O5KA 3FY0A 3U55A 2CKEA 5DN3A 3MFRA 3EHAA 4IJ9A 3KQ7A 3TXOA 2C1BA 2QKWB 3EQHA 3IW6A 3ZXZA 2ZB1A 4BCGA 2EWAA 4OTHA 3PP0A 5CU4A 4LUDA 3FXZA 3QGYA 3RVGA 2GQRA 4NUSA 3VS2A 3ORXA 3S95A 1KE8A 3K5UA 5FRIA 1BL7A 4LRMA 5A6NA 3KREA 1U5QA 4BIEA 2C6EA 1OMWA 3QLGA 3I1AA 4ZEGA 3IDCA 3SC1A 3VS7A 4EUTA 3CKXA 4FTOA 4I1ZA 4ZSLA 5EHOA 3QKLA 1REJA 3KN6A 2CCIA 2YLFA 4QYHA 2JD5A 3DT1A 4MXZA 3PP1A 3IONA 1M2PA 2P33A 4GS6A 3LJ1A 4K2RA 3ZU7A 4AQCA 5AAFA 4KSPA 3UGCA 1M7QA 3E5AA 4NT4A 5KCVA 3KRLA 4G3GA 4IAZA 4R5SA 1JSTA 1KSWA 3L9PA 3BHVA 4APCA 2F7XE 2Y7JA 4BTKA 3GU7A 5CNOA 5EI2A 1W82A 2PSQA 4Q5HA 3KK9A 1REKA 1UA2A 4WT6A 2JIVA 4M12A 5AV0A 4QO9A 1MQBA 1J7IA 4RLLA 5DH3A 4FT9A 5C1QB 4C36A 2QODA 3F66A 4BWKA 3SXRA 3QUDA 1PXLA 5CSXA 4F1OA 4FV8A 3BGPA 4X2KA 2VWXA 3GEQA 3KB7A 2VNWA 2JEDA 3GC7A 3ORMA 2BAQA 4FKOA 4JDIA 4DA5A 1O6YA 5B7VA 2HW7A 4O96A 4IWQA 4UN0C 3CP9A 3O8UA 2PHKA 4XG9A 3SVVA 5IQGA 1BKXA 3HUCA 4FVRA 4IM3A 4NKAA 3CLYA 4I0TA 2OW3A 1WVXA 2PVHA 4RX5A 3A7HA 4FNWA 5HNGA 3LIJA 4JAIA 4GEOA 3OP5A 5EI8A 4C3RA 4N57A 1J91A 2DWBA 5CZHA 2JKQA 4QMZA 3ZRLA 2ITNA 3KXXA 3PA3A 5KMMA 2XK6A 1OBGA 2WMAA 2W1HA 2A4LA 2YM6A 4U43A 5BX0A 3GU5A 3KKVA 3KMMA 2QNJA 4PPBA 2XIKA 5EYCA 5EQEA 3CBLA 3HNGA 2NNWB 3I4BA 2O8YA 2YEXA 4RC4A 1PXJA 2C6TA 2XNMA 3BU3A 4CMTA 2A1AB 4PNIA 4E73A 4O2ZA 3RWQA 3BHHA 4XV3A 2YDKA 3EIDA 4BKYA 2GNIA 4FIJA 4FNYA 3RPYA 4R3RA 1OKYA 4ZLOA 3QZIA 3OWKA 2XNOA 4I21A 3NZ0A 3ZFYA 3AGMA 3R83A 1W0XC 4EH7A 3DGKA 3C4XA 1Q24A 1Q8WA 3LJ2A 3P9JA 4TRLA 3LFEA 3P1AA 3LFQA 4KIKA 3F88A 2YAKA 4DCEA 1R39A 2OZOA 3RAIA 3SAYA 3FLYA 4QYFA 1UNHA 2E9PA 2R64A 1FGKA 4FG8A 2UZVA 5EKOA 3Q5IA 1SVGA 1ZMVA 3DAJA 4EBVA 1QCFA 4YC3A 3WI6A 3C4WA 3CKWA 2OF4A 2IPXA 2PYWA 4A9UA 3D5WA 1OECA 4EH8A 4DTAA 1SNUA 3EN5A 1XH9A 1Q62A 2OG8A 3D7TA 3TV4A 4E5AX 3C7QA 4HW7A 3NYNA 4LL0A 4QMUA 4GKIA 4YPDA 4KA3A 4CZTA 1O9UA 4E3CA 1PYXA 3MPTA 2I0YA 5HO6A 2OBJA 4XG4A 3IGOA 2BCJA 2IW8A 5K4IA 5EW3A 4LRKA 3AD4A 2BFYA 3NUXA 5E8UA 4USFA 3F9NA 2QLUA 2W5BA 5AP0A 1YDTE 5DMZA 1ZYJA 4FUYA 5E8VA 4A9YA 4FTIA 3PXZA 4Q9SA 3A2CA 2J0MB 4RJ6A 2I1MA 2P55A 4DINA 2VX1A 3DXPA 4RVTA 3SDJA 1FOTA 3PJCA 4R3PA 2JKOA 3EQPA 4PDPA 4B0GA 4HZSA 4M97A 1GY3A 2RG6A 3V51A 4DEEA 5IQCA 3LXLA 4J7BA 4K1BA 1XWSA 3QZHA 2YWVA 4ZTHA 2OZAA 2A19B 2R3OA 2R3RA 3IO7A 3R73A 3WZEA 2CKPA 3PYYA 2X9FA 4F9WA 3O8PA 4NJ3A 2JKMA 3KK8A 4AZTA 5AEPA 3TDVA 1B39A 2PPQA 4AXAA 3DBQA 2PMIA 5LVLA 4HVSA 2UUEA 2VTSA 2WQNA 4FSNA 2GHGA 1RJBA 1Z9XA 4BIBA 3R04A 4RWKA 2XEYA 4BZDA 2UVYA 4XRLA 4QPMA 3POZA 4ZJVA 1OL5A 3UDBA 2A0CX 2XH5A 1GZNA 3UO6A 5DR2A 2XIZA 3BX5A 4HCVA 4F0FA 1NVSA 2UW3A 3GVUA 4HYIA 1LUFA 3CD3A 3OEFX 4K0YA 4WSYA 4FKUA 1OUKA 4K18A 5JEBA 5KKRB 3ZUVA 1JAMA 3ULZA 2PZRA 2ZM1A 1OIRA 5GIOE 4YNOA 4UWBA 3Q5ZA 4JRNA 3D83A 2F2CB 5HKMA 4JT3A 2ITUA 4MKCA 4WNMA 2BTRA 4BC6A 4NZWB 1GIHA 1WBOA 3O71A 4M69A 4W9WA 5J87A 3WF5A 3G51A 4Y83A 4BFMA 5HE1A 2BHEA 3KULB 5F9EA 1NT2A 3WOWA 4QMMA 3U9NA 3F7WA 4ARKA 5FDXA 2BROA 3BYOA 3P78A 3TNIA 1RE8A 2PVNA 2RG5A 2PY3A 3O51A 4FKPA 5IH5A 4AF3A 1A9UA 5CQUA 3VAPA 5IUGA 1Q5KA 2XK4A 2AYPA 2JDRA 2W1ZA 3F3TA 4RJ7A 4TT7A 3OTVA 5GHVA 5HE3A 3ZSIA 4RGJA 2IG7A 1RW8A 2ESMA 1MRYA 3T9TA 3EFKA 4CEGA 5L2TA 3PVWA 4ZS0A 5CF4A 5HBJA 4A06A 5FXSA 3E3BX 3UIMA 2HELA 4U79A 1YWVA 2RIOA 4M67A 4GVAA 1OBDA 1QPJA 4ZOGA 4XCUA 1PXOA 4Z55A 3EN4A 2J6MA 4ITIA 1PKDA 2UW0A 2W4KA 4DF3A 3HYHA 3WIKA 5BYLA 4EZ7A 4EOMA 4D1ZA 2XBAA 1VYZA 3C0HA 2RSVA 2PVYA 1JSVA 3H4JA 2EUFB 2YWPA 4FSYA 3IKAA 1YOJA 3PLSA 3BPRA 2NPQA 4PDOA 2HWPA 3EL7A 4FBXA 4XG7A 4XOYA 5B2KA 5T68A 4BKZA 4PPCA 3PE2A 3A7JA 2HZNA 1WAKA 1W98A 2J7TA 5EYKA 3UG1A 3RAHA 4G3EA 3UQFA 1DAYA 2XNBA 1P4OA 2UZWE 4S33A 4BCNA 2BR1A 4C4GA 3BLRA 4LV8A 4YJRA 3PLAE 2IJMA 2Q0BA 3ZH8A 2BZKB 4BDHA 2Q83A 4RJ3A 1QPDA 5IQBA 5M07A 1FBNA 1VJYA 4KWPA 5CAVA 3R28A 5B0XA 2EB2A 3MY5A 5A4QA 5L6PA 5L6OA 3IQ7A 3WILA 3NX8A 4K9YA 1BX6A 4P7EA 3UOKA 2ITQA 3F3VA 4XP2A 4ALUA 4BCHA 2G2IA 4GT3A 3ORKA 3JPVA 1IRKA 3R7YA 3ZLSA 3RNYA 2HZ4A 4GG5A 3R8UA 4BN1A 3EN6A 3FI3A 2QG7A 4FX3A 5DFPA 2WXVA 2GQSA 4PDYA 3M1SA 4ZY5A 4CG8A 3ITZA 2B1PA 3MVLA 3QHWA 4IBMA 4FV6A 2J9MA 4BHNA 1STCE 4JIKA 2PUNA 3FKOA 3I0QA 2VWWA 3FWQA 5HZNA 2OJ9A 1AQ1A 2OIDA 3VBTA 2QO9A 3QA0A 3FQEA 2WNTA 3IOPA 2YISA 4S31A 5HX8A 5IF1A 3AC3A 4DAWA 3E8NA 3CS9A 4FV5A 2J5FA 3AC2A 1ZYDA 4TYEA 5BQ0A 3LXPA 5CNNA 5CEOA 4FZ6A 4FL3A 4NM7A 4OBOA 4DFYA 3LQ3A 3UE4A 2BZIB 2WMTA 2BFXA 4L3LA 1YXUA 3BV2A 3MJ1A 1YDSE 4DBNA 3T9IA 5C27A 5IUIA 5LVOA 4FZDB 1G8AA 4RIXA 4EORA 4YHJA 3LCKA 4H1MA 1M7NA 2X8DA 4KB8A 2R3NA 3S3IA 1TQIA 3ENHA 3GC8A 4G2FA 4ASZA 1WBVA 2UZNA 3COKA 4RX9A 3LFSA 3FQSA 4BICA 4QT1A 2YA9A 3FBVA 4D5HA 2WIPA 4UMRA 3PXQA 4Z3VA 4XP0A 2HXLA 2IVVA 3EQFA 3UMWA 4DH7A 2WFYA 4I4FA 3WF6A 4C2WA 4L45A 5FP6A 5LVMA 3MDYA 1GOLA 1UWJA 2C3LA 2W5HA 3PXFA 4I3ZA 4UB7A 5CVGA 2CLQA 2W0JA 5H9BA 3KF4A 4FYNA 2W1IA 2R0IA 2JAVA 4RX7A 4GK4A 3HL7A 4O0VA 4O1OA 4OTFA 3ORIA 3DOGA 4KIQA 4YBJA 3OT3A 3FMLA 4MK0A 4O7RA 5ANJA 2OFVA 4OW8A 4ZSGA 2GNFA 4BBEA 2BVAA 2O3PA 3JR1A 3PSCA 4ANOA 3PG1A 1GZKA 1QPCA 4ZXTA 4ZZNA 4JQ7A 3S2PA 3ZEPA 1R0PA 3RMFA 3MJ2A 3R1NA 4IAYA 4RFMA 2VGPA 2VO3A 1Q41A 4WG4A 3NUNA 3OF0A 4EHZA 4IB3A 3DS6A 1AGWA 5HVKA 3O23A 3HAVA 2BKZA 2YM7A 3F5XA 1XQZA 3GCUA 1HOWA 3AD5A 3UNZA 1M52A 3UQGA 3U9CA 4F9BA 3MB7A 4EYMA 4R3CA 3MWUA 3ZCLA 4AAAA 4ASEA 4EK3A 3WF9A 3BZ3A 3KFAA 3WARA 3TTIA 4EOJA 3EN7A 5L4QA 4II5A 3SA0A 3WYXA 4HGEA 1T46A 3O0GA 3TJDA 3R8PA 3BLHA 3ROCA 5LCKA 4OR5A 1PMNA 2V0DA 3G0EA 3LPBA 4K11A 2PVRA 2YCQA 3FZTA 4D9UA 5JGBA 4HGTA 1MRVA 4FTTA 5KMIA 3NGAA 2G9XA 5DR9A 4X3FA 4O2PA 5AM6A 1K3AA 4FV0A 1UU3A 3ZRKA 4O91A 4J8MA 4QYEA 4FV4A 5JKGA 5CT7A 3W16A 5HLNA 1RQQA 2WMBA 3R7OA 3U4WA 4AOIA 3RAKA 2OIQA 2F49A 3FLQA 1JLUE 4YJOA 3QTZA 4YC6A 1CDKA 3VUMA 3NMUF 5FBOA 1Q3DA 1UKHA 3CD8A 2B7AA 2GSFA 3COMA 3DJ7A 1XKKA 2HY0A 2GCDA 4GU6A 4HOKA 3QD4A 2X9EA 4EK6A 4EOKA 2IVTA 3BCEA 3F69A 4EKKA 3QA8A 3PWDA 4NK9A 4BDAA 2WTWA 4QP4A 2YACA 1KE9A 2OI4X 4AZSA 3Q9YA 1NVQA 1LPUA 2QU5A 2ITXA 4QMLA 2JIUA 3TNHA 2WAJA 1ZWSA 2WQMA 4FIFA 4IAKA 4HJOA 3V8TA 4XUFA 3BE2A 4HNIA 5DPVA 5K0XA 4FIEA 2BRMA 1PKGA 1Y6BA 2SRCA 3AG9A 3Q6UA 1OVEA 3QRTA 4S34A 2CDZA 3F82A 4EH3A 2BALA 4J96A 1ZLTA 4QP2A 4CFNA 4JR7A 5FEDA 4FOBA 3OY1A 5T3QA 4APPA 4UXQA 4BDKA 3F3WA 3HP2A 4QQJA 5HE2A 3RP9A 3RTPA 2BKKA 3QAME 4G9CA 4I4EA 4DEIA 4F7NA 2XKEA 4FZFB 3RI1A 3UIUA 4D2SA 1OKVA 2W1EA 4AWIA 5CAPA 4EL9A 4Z9LA 3O7LB 2C3KA 4L01A 3R01A 2IN6A 5E8YA 5HTCA 4B99A 4IC8A 5M4FA 5J9YA 1PJKA 4J98A 2ONLC 2UW4A 4R6VA 2YZLA 3SXSA 3QWJA 4GFOA 4RA4A 5CF6A 3GOPA 3PY0A 4ZLYA 3QYWA 3V5QA 4AW2A 3TT0A 2VUWA 4OT6A 3FY2A 4QPAA 1WVYA 2J90A 4F7SA 5KKRC 1OIQA 4IX5A 4L8MA 4JAJA 4CLIA 1JKLA 4B8MA 4IWPA 4XMOA 1XJDA 3RCJA 4JBPA 4MNEB 3IW7A 4MH7A 1GNGA 3D4QA 3CC6A 2VTTA 4XRJA 5FLFA 4FTAA 3UOHA 5ETIA 3DBDA 4G3FA 4TYJA 4XP3A 3RK7A 2JITA 3VBQA 2XRUA 5EM6A 3V5TA 2R3QA 3DKGA 3G0FA 4QOXA 4YJNA 4E4MA 3GFEA 4A4OA 4AS0A 2CNVA 3LAUA 3LM0A 4XOZA 1OPLA 2HOGA 3BHYA 3VW6A 1PMEA 4ZAUA 3LLAA 4NTSA 3UYSA 3D94A 2QOFA 4YSJA 4RZWA 1CKJA 3NIEA 2HY81 3IOKA 3D2KA 2V7AA 4YTFA 4XHKB 2NRUA 5F1ZA 3COIA 3ZUTA 3GP0A 3E8EA 4YZMA 2JAMA 2CHLA 1XBAA 5K9IA 2G01A 3OROA 4TYGA 4RBLA 5DBXA 5DYJA 3CTJA 4O7ZA 1MQ4A 2YIYA 3Q4UA 1A48A 4FEXA 2YN8A 2QR7A 4FTJA 5HG7A 5AV4A 2VWYA 4DE4A 5IQEA 2WQBA 4L42A 3KRJA 3R1SA 2PVLA 4FSWA 3VS3A 4CCUA 4WBOA 4ALWA 4QRCA 3NNVA 5K5XA 2WMVA 2I0EA 4C62A 4ANSA 5KMOA 4NKSA 3H30A 3AT4A 1Q61A 2XBJA 3BYMA 4FV9A 4I41A 1WBTA 3MFUA 4G1WA 3TTJA 3RKBA 5EOLA 4ORKA 3DBFA 4CRSA 1CM8A 4KD1A 4FF8A 4MQ2A 4RA5A 5DE2A 4B8LA 4XG2A 3F2RA 1MRUA 3H9RA 4XNEA 4AFEA 3HAMA 3ID6C 4XS2A 2C30A 3ZO1A 3GBZA 2A27A 4R1VA 3ZBXA 3C51A 4D4RA 1XH4A 2C6LA 4L53A 2GS6A 3Q96A 1BMKA 3A7GA 3R9OA 3THBA 3ODYX 5IA0A 5AP3A 4HVIA 3DV3A 2KTYA 5L6WL 3PJ2A 1H27A 3LMGA 3ORPA 4KIOA 3JVSA 4A9SA 4BVUA 5AJQA 2FSLX 2VTNA 3C5UA 3JXWA 3UMXA 1SMHA 1YWRA 3EH9A 4XG6A 3G2FA 4RIYA 4FIIA 1GIJA 1JVPP 3BV3A 2O0UA 4BKJA 3P7BA 2X4ZA 4FTMA 2BZJA 4F65A 5LWMA 5GZ9A 3UG2A 3CIKA 3FLNC 3AXWA 4FNZA 3L1SA 5F94A 5CWZA 4AX8A 3EQGA 4I0SA 2CNUA 4BGQA 1YRPA 4J71A 4R7HA 5I9UA 5JH6A 3BEGA 4C02A 4C59A 3R21A 3Q32A 3Q4TA 2B54A 5LMKC 5D41A 3W2RA 4NFMA 5IDNA 3FXXA 1UU7A 2IWIA 2VTRA 3DDQA 1XH7A 4X7QA 4EC8A 3EFWA 1Q8YA 3B8QA 4U9AA 3GI3A 3F5UA 1U46A 4FSUA 2F7ZE 3DK3A 3FDNA 4FV3A 3OBJA 4JBOA 2E9UA 2XK8A 2ZM3A 3KVWA 3PSBA 3Q4ZA 4JQEA 4AZWA 3FZPA 4CFXA 5E8TA 3OUKA 3C0IA 3IECA 2FUMA 4KBCA 1V0OA 4X2JA 4DH8A 2XNGA 3LW0A 4FSMA 1U54B 1UU9A 5I9WA 3QU0A 2OJGA 2X1NA 4DT9A 3PG3A 4E6CA 4TNBA 3AT3A 3FQHA 3ZOSA 4EONA 4I20A 5CEKA 4FG7A 5EQPA 4QNAA 1MP8A 4DTBA 2QOCA 3HV5A 4CZUA 4FKLA 3MY1A 4F09A 3GB2A 4XG8A 3W18A 2YDIA 5IISA 3QD3A 4GIHA 4UMTA 3BRBA 3DA6A 3ODZX 2XF0A 5FDPA 5I9YA 5CSVA 3VUKA 4BDFA 2WB8A 4GRBA 3A4PA 3W10A 3EJ1A 1KE5A 3ACJA 4BRXA 4CMUA 4I6BA 5I9ZA 3TM0A 3M11A 4IX6A 4EHVA 2B9HA 4NIFB 2J0LA 4ZJIA 2PVMA 3R7GA 3DZQA 2BRHA 3MYGA 4D4SA 1E1XA 3Q60A 3ORLA 1H00A 3KY2A 4MNFA 4FKGA 3SOAA 1KV1A 3VW8A 3DCVA 1U4DA 2F4JA 5AUTA 2F57A 3N4VA 3P23A 5L2IA 5FQDC 4UMPA 4IHPA 4KRDA 3PXKA 4FT5A 4XV9A 2X2KA 4DLJA 2ZV2A 4NCTC 3UPZA 2H34A 1EH4A 3RK9A 4M3QA 1ND4A 4PMPA 4G6NA 3PPJA 4PUZA 4R7IA 4RJ8A 4IFCA 2J0KA 4LFIA 4QQ5A 5AV2A 1P2AA 2QURA 3LFDA 5HVJA 3S4QA 4CFMA 3NR9A 1ZMUA 4ID7A 5ANKA 2ITTA 3C13A 4MWHA 3OXIA 4GUBA 2YIXA 4FTLA 4C3PA 3CEKA 4K33A 2C0OA 3C5IA 1XH5A 5F4NA 4HGLA 5M56A 1Y57A 4EEVA 4CQGA 4RSSA 3CTHA 4WO5A 4RC2A 5ACKA 1K2PA 5BMSA 5ICPA 4EH5A 4DITA 4RWIA 3CQUA 3ZM9A 4F1MA 3VQUA 4CD0A 1KOAA 3PUPA 1H1SA 5EHYA 3HRFA 1J3HA 4QMVA 4L68A 4JQ8A 1XO2B 3GCVA 4KS7A 3VJNA 2O63A 3BYVA 5IH4A 2C6DA 1TQPA 3A7FA 3IW8A 4C3FA 3PY3A 4BDIA 5BVNA 1WFCA 3II5A 3DDPA 3SRVA 5IA2A 3QX2A 4H3QA 4LRJA 4BCIA 1J1BA 2PZYA 3FXWA 5AUZA 4DEDA 3OVVA 4TL0A 4FKWA 3QCQA 1V1KA 2E9OA 5AUXA 3FV8A 4L3PA 4CNHA 5JN2A 2W9ZB 2CMWA 3MH3A 3HX4A 4RJ5A 3KF7A 2Z2WA 3I79A 5AWMA 4GYIA 4RVMA 2YDJA 3GT8A 3QC4A 4YBKA 3NNWA 4F63A 5BNJA 1R1WA 5HO7A 2WMXA 2XNEA 3HMOA 4PDSA 4IW0A 4QMOA 4ANQA 2IZRA 2PK9A 3AT2A 3PJ3A 4R77A 3FZRA 4TWPA 3PY1A 2Z8CA 3R7UA 3JVRA 4C38A 3KCKA 4UMUA 3K3JA 4DEAA 5CAQA 4QP6A 3B2WA 3QALE 5IU2A 5FD2A 5FP5A 3JY0A 1UKIA 3SHEA 2YZAA 5D11A 4DT8A 5CQWA 4ACHA 3A7IA 1H4LA 5DOSA 3DLSA 4Z7GA 4F7JA 3F2AA 2WZJA 2FB8A 2RKUA 3KMWA 4H58A 4F9AA 4KABA 3A62A 4EWQA 4O82A 4C2VA 2J0IA 3BQRA 3MBLA 3N51A 4FOCA 4LYNA 3UIBA 4O0SA 1OL2A 2ITVA 4Y95A 3ZC6A 5EDQA 2FO0A 3P08A 4D4YA 3N9XA 3DLZA 5DT0A 3WE8A 1PHKA 3GXLA 3EOCA 4PF4A 4QMPA 3SW7A 4EZ5A 2W96B 2W7XA 4XBRA 5KO1A 2ETKA 3U4UA 5JMSA 5M44A 1X8BA 3FUPA 3ZO3A 4L46A 4WRGA 3EYGA 4ZSJA 3MV5A 5LVPA 4C33A 4AGDA 4B6LA 2BDFA 5KNJA 4NM3A 4A9TA 4K6ZA 4TWNA 4YJVA 4CT1A 3QTIA 4I92A 1ZMWA 2DQ7X 4OTIA 3O2MA 3EWHA 2PL0A 3QWKA 4KUJA 3EFJA 3MY0A 4OUCA 1QPEA 4W4VA 3PRIA 4F6UA 5AA8A 4M15A 4OTRA 5IQHA 1QL6A 2PUPA 4XEYA 4UV0A 2FSMX 3UBDA 3V5PA 4PMTA 4V0GB 3HECA 4X6QC 1L8TA 3DFAA 2YM4A 4KBKA 5HIEA 1XHAA 2JDVA 2WTKB 3BQCA 4AA5A 4FIGA 4YZ9A 4EOLA 3M42A 4G3DA 3ZLXA 2ITYA 2JFLA 4FGBA 5CU0A 2VRXA 4RC3A 4D2VA 3SV0A 2QHNA 3FYKX 4O0UA 1NY3A 4N6ZA 4DGMA 1SNXA 3UTOA 5ANDA 3D9VA 4ANLA 1BUHA 4CFUA 1H01A 2XVDA 1PRYA 3HA8A 3TNPC 2Y4IC 1YHSA 5M55A 5CAUA 4LGGA 5IMXA 1VYWA 2VTOA 4Y72A 3R7EA 2C68A 2W1FA 4DEHA 1I09A 4D2WA 4E1ZA 1JWHA 3WZKA 2X6EA 3UO4A 1Q4LA 3TUDA 4YJTA 5J5SA 4QYGA 4MQ1A 4IZAA 2P2IA 3QTWA 3SW4A 4EWHA 1QMZA 1PYEA 4U5JA 2VD5A 2GNGA 4YO6A 5EYDA 1OKZA 2R3IA 5FG8A 5FGKA 4IX4A 3ULIA 4FSQA 3R8VA 4D28A 3I7CA 4HYHA 3NUUA 3UYTA 3ZONA 5JFVA 2JDOA 3DTWA 4LOOA 3W8LA 4QMQA 4U42A 4IXPA 5J7BA 4O7VA 5DEYA 2VU3A 2YFXA 4KAOA 2OXDA 2B9FA 2YCSA 3DTCA 4PPAA 5HQ0A 4WBBB 3AD6A 3NRMA 5A54A 1YI4A 5IH6A 4TYHA 4AE6A 3QRJA 2R3HA 4RIWB 3DB6A 4BTMA 4BGHA 2WMRA 3ROYA 2XKCA 2W99B 3KU2A 2Q0NA 2HZ0A 4LMNA 1H1PA 5C8NA 2VTIA 4MBJA 4LI5A 5D9HA 3TZMA 4FT3A 3A4OX 3KXGA 4P90A 3S00A 3UNKA 3AMYA 3BLQA 3RINA 4C37A 3K5VA 4CYJA 5TT7A 3BHUA 3DFCB 5CU3A 4I94A 2V5QA 4FK6A 4FTQA 4JDJA 4JLCA 4FEWA 2I6LA 4Y5HA 3HLLA 1GZOA 4I6HA 3HV6A 5E8WA 4QMWA 4YLJA 2IZUA 1B6CB 4RX8A 3T3UA 3VUTA 2V7OA 4FV2A 1Q97A 4AN3A 5ANEA 3KL8A 2YIWA 4L7SA 3OW4A 3G5DA 3DK7A 4QMTA 3TJCA 4KINA 4J99A 3UVPA 4F64A 4YJQA 4GK2A 1IAJA 3FLZA 4UMQA 1S9JA 4O81A 3VF9A 4G9RA 5EG3A 4FK3A 2R3LA 4FSTA 3RCDA 4QMSA 4Y5QA 1ZZLA 3OCGA 5JGAA 3ZC5A 4MVFA 3D14A 5KZ0A 3W2SA 3WZJA 4R5YA 3Q4CA 1YHVA 2PVJA 2QR8A 4L43A 4P5ZA 2VWIA 4W4WA 4YGAA 5TF9A 5KHXA 4RFYA 4D9TA 4DEBA 4CFWA 1H1RA 2PMOX 5J7HA 3CPCA 5M57A 3NCZA 3ZDIA 5D7AA 2YITA 4ZZOA 1FVRA 3QXPA 3MW1A 5E8ZA 4DTKA 3PPZA 1YI3A 4GJ2A 5IPJA 2FH9A 5A4EA 3EQBA 4KIPA 2ITWA 2WMUA 4C7TA 4D1XA 3MH1A 1UNGA 3RM6A 2WEVA 4WHZA 4YC8A 3UPXA 3MH2A 5J95A 1WCCA 2PE0A 3NW7A 5M09A 3OWPA 2ITZA 4MX9A 4BIDA 4TN6A 5IQIA 3QBNA 4H3BA 3BEAA 4MTAA 4F99A 1FVTA 5TR6A 3NW6A 5DLSA 3PVUA 4BWPA 5KBQA 5KMKA 2VO0A 4Z16A 4CQEA 4GT4A 3ZZEA 4IDTA 4BZOA 4DH5A 4O6EA 3R0TA 5HHWA 3PDTA 1YQJA 5JGDA 2PU8A 4GKHA 1H25A 4BDDA 3RM7A 1OUYA 4IANA 3KGAA 4A9RA 5CSWA 5GZAA 5AP2A 4ZS4A 2R5TA 3ZUUA 4DGNA 4AOTA 1O6KA 3GFWA 2UV2A 5H2UA 2CGWA 3TKIA 3MVHA 4WG5A 5FXRA 3SG8A 3I0OA 3W8QA 3MTFA 3K2LA 4I24A 4I5PA 4OTDA 2GDOA 4RQVA 5IDPA 4C34A 3DY7A 4DFNA 5AAEA 4H1JA 1XBCA 3HMNA 2QO7A 4FYOA 4FZ7A 4L00A 3MIYA 4U8ZA 3HDMA 4FT0A 4X2GA 2YERA 4Y46A 2QOHA 4AOJA 4BDGA 5J9ZA 4RWLA 5AP6A 1KE6A 4BCOA 3WF8A 1KOBA 2B53A 4P2KA 1S9IA 4AN2A 2JLDA 5FWKK 1JQHA 2UZUE 4IDVA 3CXWA 2BRNA 4BBMA 5CSPA 3HMPA 1ZZ2A 2O65A 5C26A 4RRVA 1FVVA 5HCXA 3TNWA 1T45A 1Y8YA 3DAKA 5D1JA 2OJJA 2ZJWA 4I0RA 5AP4A 3DQXA 4L67A 4U97A 3WF7A 3FMHA 4BHZA 2NRYA 2OKRA 2WMWA 4YZBA 4EH2A 2DYLA 2G15A 3OWLA 2JGZA 4JBQA 4N6YA 2WMQA 3HKOA 4IAAA 1IA9A 4GJ3A 2BZHB 5AR5A 3FKLA 5FTQA 1P14A 5TE0A 3R2BA 4OTPA 4WRSA 3UC4A 1GJOA 4U45A 3QUEA 4EQMA 4EK8A 1L3RE 3IG7A 3S1HA 3P0MA 2J51A 2VO6A 3QC9A 4TKSA 2X0GA 3KC3A 3POOA 1Y6AA 4UBAA 5HIDA 3HVCA 4CRLA 2RFNA 2DUVA 4JG6A 4OGRA 4ACDA 4DBXA 4QTCA 4ZIMA 4PTGA 3UIXA 2YJSA 1DAWA 2P0CA 2VTHA 2XZSA 1OITA 4S2ZA 4G34A 3GCSA 2VGOA 3TL8A 4E4XA 3KVXA 5HX6A 3EL8A 1OIUA 5ANGA 1ZRZA 3ZTXA 4EOIA 5HESA 4D4VA 5AA9A 2C3IB 4D55A 2R3JA 3TI1A 3TDWA 3AOXA 4O22A 2ERZE 5D7VA 2XYNA 3FAAA 4J95A 2CKQA 4X0MA 2Z7QA 3SX9A 3R22A 1OPJA 4O21A 4XBUA 3UP7A 3ZXTA 3R71A 2ZOQA 5AUWA 1BYGA 1OL6A 3LOKA 3M2WA 5BYYA 3H0YA 4FT7A 3C4FA 3O96A 3G6HA 1O6LA 3E62A 4IQ6A 4WNKA 5IUHA 3PJ1A 4MXYA 4BF2A 3BYUA 3FL4A 3KMUA 3TZ8A 3LCTA 3CTQA 4W8EA 3MFSA 4G6LA 4C35A 3R8LA 3OUNB 3ZO2A 4XLVA 3UOJA 2F7EE 3HA6A 4G5PA 3AC1A 4AFJA 3BBTB 2ONLA 3VHKA 2WPAA 4IACA 3FMMA 4YLLA 3D2IA 3QTUA 3I5NA 1KWPA 3P79A 4CCBA 2CKOA 3Q52A 5I4NA 3P86A 1ZYLA 5ETAA 2BRGA 4WNPA 5AR8A 3T3VA 4IM2A 3V04A 1YWNA 2NO3A 2B9JA 2R9SA 4GCJA 5HU3A 1KUTA 2CNQA 3NNUA 3QZGA 4I5HA 2W06A 2XJ2A 5BVKA 4BL1A 3QUPA 4EOSA 5CY3A 4O7TA 1WZYA 2QQ7A 3D0EA 4MF0A 4UZHA 4FEVA 4X3JA 3AMBA 2C6OA 4M0YA 5GJDA 4DCAA 4ZTQA 3C0GA 1OL1A 1OGUA 2IVUA 2WTKC 1FMOE 5AMNA 3DNEA 1IR3A 3E87A 5IG1A 3KULA 5EM8A 4DFZE 4H36A 4NSTA 4ZZMA 2C6IA 5AAGA 2VN9A 5EM5A 5HG5A 4QP8A 1NA7A 2GQGA 2OFUA 5AP7A 4IZ5A 5EW9A 4B9DA 3FI8A 3A8WA 4D2TA 4ALVA 5HBHA 4JOAA 4O0WA 4L9IA 3LVPA 3E92A 4PQNA 2CGXA 4N0SA 4NM0A 4XLIA 4RIOA 1V0PA 5HO8A 4V01A 2OSCA 5CXZA 5FM2A 4L7FA 3R30A 2BIKB 2Y6OA 4PL3A 5HU9A 2PZIA 3HMIA 3EQRA 4FKVA 1ZXEA 2I0HA 4NYEA 2IW6A 3PA4A 4G6OA 4AE9A 2I7QA 4BYIA 4GMYA 3NLBA 4F70A 4CFFA 3LKMA 1AD5A 4CKJA 5FTGA 3OTUA 3OHTA 3KXHA 4G16A 4PTCA 4RWJA 2XMYA 3U54A 4JI9A 2GU8A 2BIYA 5CU6A 2WOTA 4B4LA 4MCVA 4FKTA 5G6VA 4U44A 3SQQA 3BKBA 3ANRA 3U8WA 3ATSA 3MESA 3EFLA 1CTPE 2R3FA 3PSDA 4LUEA 4E8AA 2HYYA 4IB1A 3NAYA 4WIHA 3MPAA 4NEUA 4WSQA 3FMEA 4PP7A 4YNEA 3BGQA 3Q9ZA 4JVGA 2WHBA 3KRXA 4OTGA 4ASXA 5AR7A 4F1TA 4JJRA 1UV5A 4ZP5A 2WTCA 4IADA 4IZ7A 1H8FA 3EQDA 3GQLA 2VNYA 3L9NA 4AGUA 4MBIA 1M14A 4PL4A 3FJQE 3FE3A 2UZTA 5EH0A 5D12A 2Y0AA 3A61A 4M13A 2C47A 4PMMA 2XYUA 3UZPA 3V5WA 5DRDA 3RNIA 4E6QA 3ATTA 3CJGA 5JSMA 3IK3A 4JG7A 3VO3A 4BTJA 4U80A 3JS2A 1LEWA 5E1EA 1JPAA 2E9VA 3FSKA 3ZS5A 4CXAA 2WIHA 3MI9A 3P4KA 2PMNX 5AP5A 4CMOA 4FI1A 5ETCA 4YHTA 4ZY4A 4Q9ZA 3IDPA 5E1SA 2CJMA 4GL9A 5DRBA 3QCXA 4F4PA 5EDPA 1DI8A 1JKTA 5DA3A 4C8BA 5M08A 5D10A 1FINA 2OO8X 2RFDA 5DHJA 3OOGA 4Y85A 4L6QA 5E7RA 3FHIA 4DH3A 5C01A 4IB0A 3PFQA 1NXKA 3D7ZA 3LFAA 4TXCA 3JUHA 3MGYA 5LMKA 3RHKA 3ACKA 5HG9A 3PE1A 5DNRA 4ZTRA 4ZK5A 4NWMA 1ZYCA 4KKGA 2Y4IB 2RF9A 1YI6A 4U3ZA 5A6OA 2VAGA 5AUYA 4CTBA 2Z60A 2GS2A 2DS1A 3DKCA 3PWYA 3R1YA 3Q3BA 4IB5A 1H0WA 4F0GA 5J1VA 1BL6A 4KIKB 4O7NA 3TN8A 4GSBA 4PRJA 2YCRA 1ZYSA 4WNOA 2CPKE 4X2FA 4J52A 1F0QA 1I44A 4I6FA 5L8LA 3PIYA 1URWA 5LMAA 2R7BA 4XJ0A 1OI9A 3KXNA 3U87A 4OAUC 1YOLA 2W05A 2OIBA 4MHAA 4OLIA 3DAEA 3ZSGA 1R0EA 3QL8A 2GTMA 4M8TA 5HIBA 3V6RA 4DLIA 3FMDA 3SD0A 3VN9A 2VTMA 2BRBA 3D7TB 1WBPA 2X81A 1Q8UA 4IC7A 1OZ1A 4HVDA 4ZSEA 4G3CA 3LMHA 3QRIA 4CYIA 5E92A 2BILB 5JT2A 2EXCX 3L8SA 1ZOHA 1J7UA 3VC4A 2I40A 4UALA 4BDBA 3DJ5A 2JDTA 5GIPE 4E4LA 1SZMA 5C03A 1BLXA 2PULA 2Y4PA 4IVAA 4AA4A 4C4IA 5LQFA 5FBNC 3R1QA 3ZLYA 5CLPA 2V55A 4RJ4A 2GHLA 4AA0A 4ZTNA 4ANNA 4EQUA 3VRYA 4UX9A 5C4KA 3VS6A 3FSFA 3GCQA 3L8VA 4O0RA 5EM7A 5BVDA 4PMSA 1JSUA 4IEBA 2VO7A 4YHFA 1G5SA 4EQCA 2XM9A 4NFNA 4O0YA 3ORZA 3QKKA 2WOUA 2Y6MA 3GUBA 4NCTA 4O6LA 5L3AA 1XBBA 2YM5A 1XR1A 2OZAB 5KZIA 4ASDA 1IG1A 4S30A 5LARA 3BGZA 1A06A 3UP2A 4BDCA 3O8TA 4DG2E 4F08A 5A4CA 4YJUA 3ETAA 4E93A 5BPYA 1IEPA 3LXKA 3U6JA 5AR2A 2YHVA 4FMQA 5TKDA 5BVOA 4TWOA 3FI2A 4NJDA 4DG3E 4NTTA 1DS5A 3CQWA 4H39A 5CEIA 1FQ1B 5AR3A 4KBAA 4FODA 4GYGA 5JZNA 4AW5A 4NW6A 2X8EA 3DJ6A 5JFSA 3EZRA 4MWIA 4E5BA 5FEEA 2G2FA 4FL1A 2UVZA 1DI9A 4NM5A 4P5QA 2QHMA 4PWNA 4AACA 2KULA 3DXNA 2C69A 3CE3A 2PUUA 3DXQA 2NP8A 4WUAA 4BCFA 4D5KA 2HXQA 4AT4A 4ENYA 5KBRA 5LOHA 3PA5A 4HPTE 3V5JA 3HUBA 1IA8A 3R2YA 4IVCA 1ZY4A 4R7BA 2JC6A 2YCFA 2YJRA 3TKUA 3UNJA 3MA6A 3FZSA 3NCGA 4N4SA 2CCHA 5BUJA 4JS8A 2WTVA 2QO2A 3R6XA 3E7VA 4FVQA 1FPUA 4M69B 5CEQA 4AT5A 3SG9A 4GK3A 4ITHA 5A4TA 2R2PA 4DH1A
chains in the Genus database with same CATH superfamily
1Q3WA 3F5PA 3I6UA 3WIGA 4MBLA 2BPMA 3C9WA 3MPMA 3NIZA 4I6QA 3QZFA 4FKSA 3QTSA 3MB6A 3SKCA 5LVNA 3HDNA 1HCLA 2VX3A 1H0VA 5BMMA 4YMJA 3V8SA 4HZRA 1BI8A 1APME 2ZV9A 4P4CA 4LGHA 1SVEA 2YIQA 3HP5A 3PTGA 4ITJA 3TMOA 3NW5A 5AV1A 5HNIX 1H07A 2YM8A 4YZDA 3TIYA 5EOBA 2XIRA 4ACGA 4JDHA 5BYZA 1YOMA 3UJGA 4RMZA 1LEZA 3OCTA 4QD6A 3FMNA 5E90A 3DZOA 1ST4A 5LMBA 3BE9A 2CGUA 3C4ZA 3ERKA 1JKSA 3C4EA 4QYYA 3TZ9A 2QKRA 2W9FB 4JRVA 5B2MA 4KSQA 2OJFE 4HYSA 1V0BA 2V62A 3ENMA 3HV4A 2P3GX 4FC0A 4LL5A 4FSRA 5HTBA 4YLKA 4D58A 3QCSA 3ZFMA 5BVEA 3NYOA 1PXIA 4JBVA 4PL5A 4V05A 4USDA 4LG4A 4A07A 3V5LA 4EYJA 5A9UA 3NUAA 3TUCA 2PMLX 2UW5A 2QOLA 4MNEA 2JDSA 3B8RA 3HEGA 3GENA 5J8IA 3VQHA 4ANMA 3QD0A 2B52A 4KKHA 1ZARA 4Y73A 2XNNA 5HLWA 4WG3A 2C5OA 3VVHA 4O7WA 2C5NA 3NUPA 3ORTA 4C0TA 4PP9A 2BAJA 3P5KA 5E8SA 4XV2A 4I23A 1R78A 3BU5A 3C50A 5ACBC 2HZIA 5IA4A 4J97A 2VZ6A 3L8PA 5CU2A 4ZMFA 3OFMA 4CZYB 2JFMA 1WBSA 2X4FA 5IKWA 3R9NA 5IEVA 2XK3A 4QDEA 4LOPA 2J5EA 4U6RA 3BL9A 2QD9A 2Z7SA 4BWXA 4W8DA 4FZAB 5AX9A 4WKQA 4QNYA 3BELA 3N4TA 3QQJA 3QX4A 3MN3A 4ONAA 4QQCA 4D0WA 4EK5A 5CSHA 3HRBA 2PWLA 2WELA 1YDRE 2JIIA 4I5MA 4PV0A 3C4CA 3QQKA 5I0BA 4FTKA 4CGAA 3W55A 3QHRA 5LJJA 1CKIA 1K9AA 2YABA 4PY1A 4FIHA 4FV1A 3PPKA 4EHGA 3EN9A 4IMYA 5AADA 3PRFA 3I6WA 4YJPA 2CN8A 2C6MA 2ITOA 4O27B 5KX8A 3DK6A 4FNXA 4NU1A 1IAHA 3V3VA 3S0OA 5C8MA 4G5JA 2QC6A 2XANA 2O64A 1XH8A 3EQIA 3SGCA 2B0QA 2VWVA 3H3CA 2WTJA 2UVXA 2EXEA 3KXMA 2VX0A 4RIXB 4MXXA 4EZ3A 2OGVA 2XAMA 3Q9WA 5L2SA 2ZB0A 5AM7A 3UDZA 2W4JA 4NW5A 4BZNA 3KXZA 3Q04A 4W4YA 3WYYA 1H1WA 4BR3A 5GZ8A 3OOMA 3AQVA 1FMKA 1OKWA 3UO5A 3R63A 2WKMA 4XH6A 3Q2JA 4ZTMA 1R3CA 4FTUA 4CSVA 2PZ5A 4BCQA 4F9YA 5EKNA 3U6HA 5M06A 4FICA 5J1WA 4GVJA 4BBFA 3FL5A 4AU8A 5H8EA 2LGCA 4CKIA 4QTAA 5HTIA 1H08A 4FL2A 2GNJA 2XP2A 4CFVA 5ITAA 5JFWA 3OWJA 5FUTA 3UOLA 3KN5A 4DDGA 3FLWA 3ML1A 3ZMMA 1W84A 2XK7A 3F6XA 4M7IA 5BV3A 2QLQA 1WBWA 5G1XA 3QKMA 4BCJA 4C61A 2J4ZA 3MSSA 4ENXA 3W32A 2W1CA 4FTRA 3KCFA 4JR3A 5JZJA 5KMLA 2A98A 4S32A 4WD5A 5CEMA 2B9IA 3RPOA 4QMYA 4YSMA 4M14A 3BYSA 2HENA 2YIRA 1OPKA 2CGVA 3FKNA 4X6RA 4FRFA 4E26A 2X39A 2OWBA 3G6GA 3Q9XA 3G15A 1F3MC 1PXKA 4CTCA 1VLRA 2J50A 3H9OA 4JDKA 4IAFA 2R3GA 2ZM4A 3WZDA 4HYUA 3G90X 4HGSA 3TUBA 3MFTA 2YLEA 4RVLA 4EJNA 3BWJA 1ZOEA 4JXFA 3AC4A 4BI2A 2F2UA 3G9LX 1U54A 4MUQA 2YAAA 5HICA 3K54A 4FKJA 2WGJA 4I5CA 4AZVA 4O7SA 4M68A 5TO8A 3ALNA 5AP1A 1G8SA 3QYZA 2OXXA 5CF8A 4AZEA 4JX3A 3V01A 3PIXA 2OJIA 2H8HA 5CANA 5DT3A 4QTBA 5E4HA 3R8ZA 2QOQA 1ERKA 4X3FB 4W9XA 3LZBA 3NFGB 3CY2A 4OBQA 2BTSA 5CXHA 4DYMA 2W4OA 1XH6A 3ZFXA 4A4XA 4AQKA 5HD7A 2XARA 3LLTA 4LQMA 5AFVA 2X0OA 2EB3A 3H10A 3VBWA 3FPMA 4AGWA 5FTOA 1WMKA 2H6DA 4NIFA 4XG3A 3NUSA 3SXFA 4QMNA 2BMCA 2XK9A 3Q6WA 4K77A 2XCHA 4AW0A 3ALOA 5CAOA 5IQAA 2C5XA 5A46A 4E5WA 1GZ8A 4DFUA 5HCZA 3W2PA 1OIYA 3OD6X 2LAVA 3LXNA 5H8BA 3TG1A 4AGCA 3R9RA 2WEIA 5T6KA 3W0NA 2J0JA 2XM8A 3L9MA 3R00A 5I9XA 4M66A 1NVRA 4B7TA 2PUIA 3GCPA 3E7OA 2IO6A 3G33A 4DC2A 4IZYA 2XIYA 1WBNA 2ZV7A 4N70A 2BDWA 5CZIA 3DB8A 5EI6A 4LM5A 4YP8A 5M4CA 4O84A 3K3IA 2XCKA 3HV7A 2WQOA 3OY3A 3GQIA 4MXAA 5KE0A 2B55A 2UW7A 4KS8A 2UZDA 3LFCA 1J1CA 2ITPA 4ANBA 1CMKE 2C1AA 3RZBA 3FMJA 4O0XA 2OLCA 2W1GA 4ACMA 2R0UA 5CI7A 4FV7A 4R8QA 2VWUA 4DGGA 4MD8E 3PUFC 3BIZA 3C1XA 5F95A 3H9FA 2VTAA 4H3PA 4OT5A 5CVFA 5DI1A 5CVHA 2R3PA 4FGRA 5DG5A 3VJOA 2AC5A 5K0KA 4FUXA 3W0RA 5AIRA 4EJ7A 4DDIA 4PTEA 3QQLA 3NNXA 4E6AA 4QTEA 4ZMEA 2AC3A 2GHMA 3EB0A 4U41A 3DU8A 5J5TA 3QTRA 4D0XA 2UW9A 2RGPA 1TVOA 2OH4A 1NW1A 3NPCA 1YXVA 5JQ5A 3RPSA 4OTWA 4C58A 2E9NA 4TPTA 5IEXA 2XKDA 3AMAA 3TKHA 2VTLA 1LR4A 5GJGA 4QTDA 5HOAA 2C5YA 5IZFA 4RZVA 3HGKA 4XX9A 1ATPE 4I93A 2XKFA 1YXTA 2W5AA 4HCUA 1SYKA 2WU7A 5DEWA 2GNLA 3FC1X 2XEZA 3QXOA 4BDJA 3VIDA 3QRUA 4G31A 2VWZA 3CPBA 2E2BA 3DKOA 2UW8A 3FLSA 3O17A 3W33A 5KMNA 5CS6A 2X6DA 4I22A 2R3MA 4FG9A 4M0ZA 5CI6A 4H05A 2QI8A 4YZCA 1LP4A 3KRWA 3H0ZA 3PXRA 3R7VA 1E1VA 3ZO4A 5ANIA 4AW1A 4EC9A 2IEWA 5ANOA 1Y8GA 4USEA 4NL0A 2R7IA 4WUNA 2EU9A 4DHFA 3VF8A 1ZY5A 4O1PA 4GIIA 3ELJA 4CVAA 3UC3A 2BAKA 4E20A 3TV6A 4CV8A 1ZAOA 2ZVAA 4C4HA 3QGWA 3GOKA 5HCYA 4R1YA 2UZOA 3TNQB 4AN9A 2WTIA 3DQWA 2Z7LA 2XJ1A 2QCSA 4FE2A 3UZRA 4RT7A 4YTHA 1SVHA 3OCBA 2C3JA 3W2OA 5HORA 3QQUA 4ZTLA 3CY3A 2C0IA 1GIIA 4YURA 4MEDA 3RZFA 1PMVA 2OK1A 2P4IA 3D5UA 3LCDA 5AIKA 5DGZA 4YU2A 2WU6A 1KE7A 5GINE 4UZDA 5EYMA 4E7WA 4FSZA 1PF8A 1DM2A 1VR2A 1UVRA 3E8CA 4CT2A 4D2RA 1Q8TA 4QP3A 2H9VA 2XIXA 2ZAZA 4Z7HA 3P7CA 4G17A 4CKRA 2FVDA 5DIAA 5ETFA 4D1SA 3LQ8A 4TW9A 2R4BA 2O2UA 2X2LA 3ZEWA 3R9HA 3IW5A 3N4UA 3WBLA 4R78A 3I5ZA 3BI6A 4QP1A 2QONA 2IZTA 3EKKA 2XS0A 3F61A 3U51A 4YTCA 2QU6A 1P4FA 3NS9A 5JFXA 4DGOA 3E63A 4OTQA 5JRSA 3BBWA 3KRRA 2WQEA 3E64A 5HG8A 1OL7A 5AV3A 5IMEA 2FA2A 5FM3A 3VUDA 1H24A 1SM2A 3NWWA 2QOOA 2UZEA 3A99A 4L3JA 4UWYA 3UZTA 3FZOA 3WE4A 5K3YA 2XJ0A 3I7BA 3RGFA 1M17A 3MVJA 3F3ZA 5DT4A 3E93A 4BYJA 2XAOA 4IE9A 3W2QA 1UWHA 4IAIA 3VUIA 2VV9A 4FR4A 3LCSA 5L8KA 3QFVA 5TOZA 4YO4A 2HW6A 3OCSA 1F5QA 4RIYB 1HCKA 2PVFA 2HWOA 4YUQA 2WO6A 1PXMA 3D5VA 4HVHA 4J53A 3OT8A 4GG7A 4CV9A 3NVKI 4JX7A 4V0GA 5CENA 5IEYA 5E91A 4ZSAA 3EKNA 2X7GA 3OXTA 4MF1A 5I9VA 4RPVA 3GGFA 4GT5A 1YHWA 1H1QA 1VZOA 4E4NA 5EHLA 3TACA 4U81A 3ZLWA 3TIZA 5HE0A 4GH2A 4BI0A 3MVMA 4BI1A 3CJFA 3V8WA 3REPA 3ZBFA 1PXPA 3RWPA 3ZRMA 2QG5A 2QOBA 2GNHA 4Y8DA 2IVSA 5F20A 4F9CA 2GTNA 4O38A 4ERKA 2V22A 2XUUA 5EK7A 5HI2A 5HGIA 3FZ1A 3QQHA 4LMUA 3VBVA 3ZSHA 5M4UA 4BDEA 5I3RA 1YXSA 1ZOGA 4BCMA 5L2WA 1PMUA 4QP9A 4O86A 3O50A 4ZJJA 4BTFA 3OBGA 1Q8ZA 4FTNA 4QP7A 4GV1A 3LFBA 2OXYA 3IS5A 4A7CA 3IPHA 3IW4A 3TV7A 5HLPA 4F6WA 4FEUA 4L52A 3NYXA 4ZTSA 5IA5A 4EUUA 4C57A 3UQCA 3VHEA 4ZLZA 3RPVA 1CKPA 2X7FA 2OH0E 4YPSA 2BUJA 5I5ZA 3W2CA 3EQCA 5H8GA 4CG9A 4L44A 4AP7A 3OW3A 5K5NA 1JNKA 2W1DA 3GU6A 3O7LD 2X2MA 4GU9A 2Y8OA 3FPQA 4TWCA 3ANQA 4EBWA 2ETMA 4IH8A 2FYSA 4V04A 2ZMCA 3B2TA 2C4GA 4RIWA 3HRCA 3BHTA 5KHWA 5CF5A 3P7AA 4MXCA 4RVKA 3FI4A 3NDMA 5B2LA 2WD1A 5J79A 1G8JA 5GJFA 3GC0A 4TYIA 1YXXA 3KEXA 3TCPA 3FYJX 4DG0E 2BHHA 5M4IA 4X2NA 4GFGA 4AUAA 1Q99A 5DWRA 2VTJA 2YM3A 4J8NA 2IZSA 3AGLA 3CQEA 3LJ0A 4UYNA 5CTPA 1M2QA 2RFSA 3HMMA 5C9CA 2B4SB 3QTQA 1PW2A 5FXQA 4RG0A 1PY5A 3AC8A 4X21A 4EOQA 2XALA 2GFSA 4AG8A 4C4EA 3QD2B 5CASA 1KV2A 4EH6A 3QLFA 5M53A 2QVSE 5BUIA 2W17A 2FGIA 3R8MA 3F5GA 4OBPA 3WZUA 4EHEA 5C8KA 2Z02A 4HNFA 1GAGA 5HNBA 3RJCA 4F6SA 3NUYA 3HV3A 3O5AA 1OB3A 5HBEA 4YZNA 4CLJA 3DNDA 4KRCA 3UVRA 1W7HA 2Z7RA 2J2IB 4GUEA 2Y9QA 3OXZA 3AC5A 4X3FC 4UEUA 3E3PA 3MH0A 2GS7A 5CX9A 2F9GA 4JIAA 2FSOX 4FA2A 3GU8A 3ZM4A 4ZY6A 4O4CA 3VULA 5KMJA 1YW2A 4QMXA 3HZTA 4MXOA 3PVBA 1Z5MA 4FTCA 2UZBA 3SOCA 1BI7A 5KUPA 2JBPA 4O7YA 3JY9A 4W4XA 3SLSA 4BCKA 3PIZA 2EXMA 3NYVA 3LE6A 4EI4A 3DBCA 5CEPA 3ET7A 5DR6A 2ETRA 4Q5EA 2UW6A 3RBWA 3RK5A 4EOPA 4U0IA 4DGLC 3R7IA 5LCJA 3QCYA 1W8CA 4U3YA 2JBOA 5AUUA 3W1FA 4TZRA 3UODA 4EKLA 2ERKA 2VWBA 4HPUE 4XV1A 4EH4A 5BVFA 1H28A 2ACXA 3SRVB 1Y91A 4C4JA 3LHJA 2JKKA 3CR0A 4UXLA 5EW8A 4DN5A 2I0VA 4IIRA 5CT0A 1JBPE 1YKRA 2C5VA 3ORNA 4LOQA 4LGDA 3COHA 3DBEA 2X7OA 4DEGA 3VBXA 4A4LA 5GNKA 5AUVA 4UWCA 5IA1A 2XNPA 2FSTX 2CN5A 2CSNA 5LWNA 5E9EA 4IX3A 2ZMDA 2QOKA 3LM5A 5AR4A 3F3UA 2CLXA 3NSZA 4YR8A 3ZYAA 5HD4A 5JK3A 3QRKA 5CALA 3NAXA 5EFQA 5L2QA 1B38A 1H26A 4IVBA 4ACCA 1YVJA 2VTPA 3DKFA 3BWFA 4HVGA 5IQFA 4EOOA 4E6DA 3V6SA 4U7ZA 5HEZA 4O0TA 3W0QA 4DFBA 3I81A 2ZDTA 3GC9A 4WOVA 5CYIA 3A60A 4IWDA 5A3XA 2RL5A 4O7LA 2P2HA 4JNWA 3OMVA 4DHIB 2HAKA 4BY9E 3D15A 3GU4A 4YJSA 4PX6A 4KKEA 1CSNA 4TTHB 1U59A 3FEGA 3EYHA 2BDJA 3VWAA 3AKLA 3LCOA 3Q53A 3QQGA 5E8XA 5A14A 2HCKA 3CSVA 1FGIA 3ZHPC 5JRQA 3RPRA 5IQDA 4FKIA 3PJ8A 3LFNA 1UNLA 1MUOA 1OM1A 4IM0A 4JL9A 1URCA 3RALA 3UVQA 5C4LA 5A4LA 2PVKA 2A2AA 2X8IA 3VS0A 3TZ7A 2RFEA 4WA9A 5I3OA 4DFXE 3OG7A 4FKRA 4IJPA 3VBYA 2HIWA 5L8JA 4OAVB 5M51A 5BVWA 4IWOA 5LXMA 4MYGA 4Q2AA 3E88A 3VUHA 5JQ8A 4BCPA 4UYAA 1IASA 2H96A 3TWJA 4FKQA 3VS1A 3MS9A 3OS3A 3IGGA 2OICA 1J7LA 2PE1A 2ZDUA 2XB7A 3BU6A 1PXNA 3LQ5A 3RAWA 2PTKA 5DVRA 3PZHA 4MD9E 4BB4A 3VRZA 1Z57A 3NEWA 3OEZA 3E8DA 2EVAA 3LFFA 4M84A 5AX3A 3U6IA 4JG8A 3Q2MA 3FMKA 4QPSA 3NVMB 2XA4A 3CGFA 5H3QA 3F2NA 1M2RA 4K8AA 3EMGA 3T8OA 2PE2A 3MIAA 3TYKA 4XYFA 4AT3A 1UU8A 4MD7E 3OZ6A 1G3NA 3KA0A 4TY1A 3PVGA 3I60A 5FEQA 4IFGA 3R9DA 1VEBA 2OU7A 4EH9A 5EQYA 3CGOA 2XRWA 4HCTA 2G2HA 1JKKA 5HVYA 2C6KA 3IDBA 4D2PA 3OC1A 1W2CA 3G9NA 5BUEA 3GNIB 4MAOA 3MA3A 2G1TA 4RQKA 5IA3A 3L9LA 1JOWB 2AUHA 1TKIA 3F7ZA 4PNKA 5K4JA 3EZVA 4ERWA 3MTLA 4F0IA 4BGGA 2GMXA 2WMSA 2PZPA 4LV5A 2HK5A 3R02A 4KNBA 3VS4A 2ZYBA 3QTXA 2GPHA 3ZZWA 3ZDUA 4RFZA 5EDRA 4IVDA 4DHZA 4QQTA 4NH1A 4FVPA 3DPKA 3VS5A 1WVWA 4RLKA 2QOIA 1U5RA 2ZV8A 3QQFA 3JYAA 4EK4A 4GFMA 1P5EA 3FHRA 4F7LA 3LMIA 2C0TA 4J1RA 4C4FA 3TEIA 4YTIA 3L8XA 3RHXA 1W83A 2GFCA 1TQMA 3A8XA 2IW9A 4DFLA 2WTDA 2REIA 3QF9A 3VNTA 3PZEA 2R3KA 4AZFA 4TNDA 4TYHB 3PXYA 1RDQE 4FEQA 3FC2A 4U40A 4GW8A 1E9HA 2UZLA 4O83A 3CCNA 3D5XA 3VUGA 2OF2A 2VTQA 4UY9A 2O5KA 3FY0A 3U55A 2CKEA 5DN3A 3MFRA 3EHAA 4IJ9A 3KQ7A 3TXOA 2C1BA 2QKWB 3EQHA 3IW6A 3ZXZA 2ZB1A 4BCGA 2EWAA 4OTHA 3PP0A 5CU4A 4LUDA 3FXZA 3QGYA 3RVGA 2GQRA 4NUSA 3VS2A 3ORXA 3S95A 1KE8A 3K5UA 5FRIA 2ZFYA 1BL7A 4LRMA 5A6NA 3KREA 1U5QA 4BIEA 2C6EA 1OMWA 3QLGA 3I1AA 4ZEGA 3IDCA 3SC1A 3VS7A 4EUTA 3CKXA 4FTOA 4I1ZA 4ZSLA 5EHOA 3QKLA 1REJA 3KN6A 2CCIA 2YLFA 4QYHA 2JD5A 3DT1A 4MXZA 3PP1A 3IONA 1M2PA 2P33A 4GS6A 3LJ1A 4K2RA 3ZU7A 4AQCA 5AAFA 4KSPA 3UGCA 1M7QA 3E5AA 4NT4A 5KCVA 3KRLA 4G3GA 4IAZA 4R5SA 1JSTA 1KSWA 3L9PA 3BHVA 4APCA 2F7XE 2Y7JA 4BTKA 3GU7A 5CNOA 5EI2A 1W82A 2PSQA 4Q5HA 3KK9A 1REKA 1UA2A 4WT6A 2JIVA 4M12A 5AV0A 4QO9A 1MQBA 1J7IA 4RLLA 5DH3A 4FT9A 5C1QB 4C36A 2QODA 3F66A 4BWKA 3SXRA 3QUDA 1PXLA 5CSXA 4F1OA 4FV8A 3BGPA 4X2KA 2VWXA 3GEQA 3KB7A 2VNWA 2JEDA 3GC7A 3ORMA 2BAQA 4FKOA 4JDIA 4DA5A 1O6YA 5B7VA 2HW7A 4O96A 4IWQA 4UN0C 3CP9A 3O8UA 2PHKA 4XG9A 3SVVA 5IQGA 1BKXA 3HUCA 4FVRA 4IM3A 4NKAA 3CLYA 4I0TA 1XMMA 2OW3A 1WVXA 2PVHA 4RX5A 3A7HA 4FNWA 5HNGA 3LIJA 4JAIA 4GEOA 3OP5A 5EI8A 4C3RA 4N57A 1J91A 2DWBA 5CZHA 2JKQA 4QMZA 3ZRLA 2ITNA 3KXXA 3PA3A 5KMMA 2XK6A 1OBGA 2WMAA 2W1HA 2A4LA 2YM6A 4U43A 5BX0A 3GU5A 3KKVA 3KMMA 2QNJA 4PPBA 2XIKA 5EYCA 5EQEA 3CBLA 3HNGA 2NNWB 3I4BA 2O8YA 2YEXA 4RC4A 1PXJA 2C6TA 2XNMA 3BU3A 4CMTA 2A1AB 4PNIA 4E73A 4O2ZA 3RWQA 3BHHA 4XV3A 2YDKA 3EIDA 4BKYA 2GNIA 4FIJA 4FNYA 3RPYA 4R3RA 1OKYA 4ZLOA 3QZIA 3OWKA 2XNOA 4I21A 3NZ0A 3ZFYA 3AGMA 3R83A 1W0XC 4EH7A 3DGKA 3C4XA 1Q24A 1Q8WA 3LJ2A 3P9JA 4TRLA 3LFEA 3P1AA 3LFQA 4KIKA 3F88A 2YAKA 4DCEA 4QDVA 1R39A 2OZOA 3RAIA 3SAYA 3FLYA 4QYFA 1UNHA 2E9PA 2R64A 1FGKA 4FG8A 2UZVA 5EKOA 3Q5IA 1SVGA 1ZMVA 3DAJA 4EBVA 1QCFA 4YC3A 3WI6A 3C4WA 3CKWA 2OF4A 2IPXA 2PYWA 4A9UA 3D5WA 1OECA 4EH8A 4DTAA 1SNUA 3EN5A 1XH9A 1Q62A 2OG8A 3D7TA 3TV4A 4E5AX 3C7QA 4HW7A 3NYNA 4LL0A 4QMUA 4GKIA 4YPDA 4KA3A 4CZTA 1O9UA 4E3CA 1PYXA 3MPTA 2I0YA 5HO6A 2OBJA 4XG4A 3IGOA 2BCJA 2IW8A 5K4IA 5EW3A 4LRKA 3AD4A 2BFYA 3NUXA 5E8UA 4USFA 3F9NA 2QLUA 2W5BA 5AP0A 1YDTE 5DMZA 1ZYJA 4FUYA 5E8VA 4A9YA 4FTIA 3PXZA 4Q9SA 3A2CA 2J0MB 4RJ6A 2I1MA 2P55A 4DINA 2VX1A 3DXPA 4RVTA 3SDJA 1FOTA 3PJCA 4R3PA 2JKOA 3EQPA 4PDPA 4B0GA 4HZSA 4M97A 1GY3A 2RG6A 3V51A 4DEEA 5IQCA 3LXLA 4J7BA 4K1BA 1XWSA 3QZHA 2YWVA 4ZTHA 2OZAA 2A19B 2R3OA 2R3RA 3IO7A 3R73A 3WZEA 2CKPA 3PYYA 2X9FA 4F9WA 3O8PA 4NJ3A 2JKMA 3KK8A 4AZTA 5AEPA 3TDVA 1B39A 2PPQA 4AXAA 3DBQA 2PMIA 2X0PA 5LVLA 4HVSA 2UUEA 2VTSA 2WQNA 4FSNA 2GHGA 1RJBA 1Z9XA 4BIBA 3R04A 3W0MA 4RWKA 2XEYA 4BZDA 2UVYA 4XRLA 4QPMA 3POZA 3W0PA 4ZJVA 1OL5A 3UDBA 2A0CX 2XH5A 1GZNA 3UO6A 5DR2A 2XIZA 3BX5A 4HCVA 4F0FA 1NVSA 2UW3A 3GVUA 4HYIA 1LUFA 3CD3A 3OEFX 4K0YA 4WSYA 4FKUA 1OUKA 4K18A 5JEBA 5KKRB 3ZUVA 1JAMA 3ULZA 2PZRA 2ZM1A 1OIRA 5GIOE 4YNOA 4UWBA 3Q5ZA 4JRNA 3D83A 2F2CB 5HKMA 4JT3A 2ITUA 4MKCA 4WNMA 2BTRA 4BC6A 4NZWB 1GIHA 1WBOA 3O71A 4M69A 4W9WA 5J87A 3WF5A 3G51A 4JMQA 4Y83A 4BFMA 5HE1A 4AXCA 2BHEA 3KULB 5F9EA 1NT2A 3WOWA 4QMMA 3U9NA 3F7WA 4ARKA 5FDXA 2BROA 3BYOA 3P78A 3TNIA 1RE8A 2PVNA 2RG5A 2PY3A 3O51A 4FKPA 5IH5A 4AF3A 1A9UA 5CQUA 3VAPA 5IUGA 1Q5KA 2XK4A 2AYPA 2JDRA 2W1ZA 3F3TA 4RJ7A 4TT7A 3OTVA 5GHVA 5HE3A 3ZSIA 4RGJA 2IG7A 1RW8A 2ESMA 1MRYA 3T9TA 3EFKA 4CEGA 5L2TA 3PVWA 4ZS0A 5CF4A 5HBJA 4A06A 5FXSA 3E3BX 3UIMA 2HELA 4U79A 1YWVA 2RIOA 4M67A 4GVAA 1OBDA 1QPJA 4ZOGA 4XCUA 1PXOA 4Z55A 3EN4A 2J6MA 4ITIA 1PKDA 2UW0A 2W4KA 4DF3A 3HYHA 3WIKA 5BYLA 2X0QA 4EZ7A 4EOMA 4D1ZA 3UDSA 2XBAA 1VYZA 3C0HA 2RSVA 2PVYA 1JSVA 3H4JA 2EUFB 2YWPA 4FSYA 3IKAA 1YOJA 3PLSA 4LV7A 3BPRA 2NPQA 4PDOA 2HWPA 3EL7A 4FBXA 4XG7A 4XOYA 5B2KA 5T68A 4BKZA 4PPCA 3PE2A 3A7JA 2HZNA 1WAKA 1W98A 2J7TA 5EYKA 3UG1A 3RAHA 4G3EA 3UQFA 1DAYA 2XNBA 1P4OA 2UZWE 4S33A 4BCNA 2BR1A 4C4GA 3BLRA 4LV8A 4YJRA 3PLAE 2IJMA 2Q0BA 3ZH8A 2BZKB 4BDHA 2Q83A 4RJ3A 1QPDA 5IQBA 5M07A 1FBNA 1VJYA 4KWPA 5CAVA 3R28A 5B0XA 2EB2A 3MY5A 5A4QA 5L6PA 5L6OA 3IQ7A 3WILA 3NX8A 4K9YA 1BX6A 4P7EA 3UOKA 2ITQA 3F3VA 4XP2A 4ALUA 4BCHA 2G2IA 1W2FA 4GT3A 4BJJB 3ORKA 3JPVA 1IRKA 3R7YA 3ZLSA 3RNYA 2HZ4A 4GG5A 3R8UA 4BN1A 3EN6A 3FI3A 2QG7A 4FX3A 5DFPA 2WXVA 2GQSA 4PDYA 3M1SA 4ZY5A 4CG8A 3ITZA 2B1PA 3MVLA 3QHWA 4IBMA 4FV6A 2J9MA 4BHNA 1STCE 4JIKA 2PUNA 3FKOA 3I0QA 2VWWA 3FWQA 5HZNA 2OJ9A 1AQ1A 2OIDA 3VBTA 2QO9A 3QA0A 3FQEA 3AKKA 2WNTA 3IOPA 2YISA 4S31A 5HX8A 5IF1A 3AC3A 4DAWA 3E8NA 3CS9A 4FV5A 2J5FA 3AC2A 1ZYDA 4TYEA 5BQ0A 3LXPA 5CNNA 5CEOA 4FZ6A 4FL3A 4NM7A 4OBOA 4DFYA 3LQ3A 3UE4A 2BZIB 2WMTA 2BFXA 4L3LA 1YXUA 3BV2A 3MJ1A 1YDSE 4DBNA 3T9IA 5C27A 5IUIA 5LVOA 4FZDB 1G8AA 4RIXA 4EORA 4YHJA 3LCKA 3NFFB 3W0SA 4H1MA 1M7NA 2X8DA 4KB8A 2R3NA 3S3IA 1TQIA 3ENHA 3GC8A 4G2FA 4ASZA 1WBVA 2UZNA 3COKA 4RX9A 3LFSA 3FQSA 4BICA 4QT1A 2YA9A 3FBVA 4D5HA 2WIPA 4UMRA 3PXQA 4Z3VA