4HZRA

Crystal structure of ack1 kinase domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
261
Chain Sequence
LTCLIGEKDLRLLEKLGDGVVRRGEWDAPSGKTVSVAVKCLAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ack1: activation and regulation by allostery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Activated CDC42 kinase 1
total genus 85
structure length 261
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hzrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hzrA01
1PXJA 3HYHA 3TI1A 3RCDA 3MI9A 2EWAA 2H34A 3FLZA 3QRUA 4R5YA 4YJQA 3ACJA 4GT5A 3DNEA 4IJPA 5AP5A 4MWHA 3EQIA 3ANQA 1RQQA 1YDRE 3L9LA 5GZAA 3A61A 3QF9A 4O7ZA 4R1VA 1OL1A 3A99A 3JVSA 3QYZA 3PSBA 5IUHA 4JAIA 1XH9A 5L8JA 4F08A 3JS2A 3WZJA 4DC2A 4ZJVA 4Y73A 5JKGA 2R3HA 1R3CA 1VEBA 2BPMA 2I0YA 4FIEA 4TYHB 5FLFA 4ARKA 4BWPA 5E8TA 3CC6A 4D2TA 5KMNA 4PX6A 4P4CA 3RK7A 2JC6A 3QX2A 4FV7A 4F9YA 3AT2A 2BDFA 2HZ4A 4S34A 4UZDA 5IH5A 2YCSA 4R78A 3C0GA 4IZAA 1JKLA 2E9OA 3FQSA 3GCPA 3NUPA 4XV1A 3AC3A 1H01A 3D4QA 3G6HA 3OCGA 4O0VA 3D7TB 1E9HA 4ZZNA 4ZXTA 4I4EA 5CYIA 2F9GA 1EH4A 5LXMA 3FKOA 5CEKA 1ZOGA 2C6LA 3BU3A 3FMEA 2JDRA 3ZRLA 3UOJA 3O17A 4YLJA 3LW0A 1Q8ZA 3RNYA 4X2GA 5HO6A 4TKSA 5C8KA 4XP2A 5H8GA 2XM8A 4AT3A 4KIKA 1H25A 4D9TA 2PU8A 4BGGA 4C34A 3V5LA 4KKHA 3OEFX 2P3GX 3FXZA 5LMKA 3LJ2A 4L42A 3MSSA 4KBCA 4IM0A 1X8BA 1P4OA 2E9NA 5J79A 2BZHB 3QC4A 2CGUA 4KAOA 2PUNA 4L3JA 4M12A 3SXRA 2GNLA 1OI9A 3NWWA 2YAKA 5FRIA 2OF4A 1DM2A 1PXOA 4KSPA 3EYHA 4QTBA 4RC3A 3ZSHA 3KRJA 3F2AA 3R1NA 3UQGA 3U6HA 2JIUA 4ACDA 2VTQA 4W8DA 3IPHA 1HCLA 3A7FA 2C6KA 3SOAA 4QMQA 1ZY5A 2YAAA 5GIOE 4NL0A 4F99A 4KRCA 1LEWA 2Z7RA 1GZ8A 5E8WA 4DTAA 2R3KA 3NMUF 2VAGA 4DBNA 4TXCA 2JLDA 5HTIA 4I21A 4BDGA 4QTAA 5A9UA 4CQEA 3GXLA 3HV3A 2BRGA 3F5PA 5DHJA 3K2LA 3K3JA 4YU2A 5DGZA 1O6YA 2R3FA 4IWPA 5A6OA 4IX3A 2YCRA 4AE6A 3AMBA 5AA8A 5C1QB 1YWRA 3F2NA 5DI1A 2XBAA 2EUFB 4FNZA 2G2IA 2UZWE 5IQEA 2HZIA 5LVNA 3FDNA 4JS8A 5KBQA 4FSZA 2Y4IB 2PE1A 5CTPA 5ACKA 2LAVA 5HESA 4QTEA 3EWHA 3ZC6A 4DFYA 4E8AA 5LVOA 4D4SA 3MDYA 2I7QA 3VW6A 3JXWA 2FSMX 2RF9A 2XEZA 3Q6UA 1FPUA 5EW3A 4F0IA 4FIFA 4LMUA 1I09A 3NSZA 5I4NA 3MTFA 4C4JA 4QMWA 2RIOA 4ZLYA 1J7LA 2YEXA 1WAKA 3Q9XA 4M3QA 2YIYA 4YTCA 1PJKA 3A4OX 5EYMA 3PDTA 4QYGA 4L6QA 3PPKA 2V5QA 2BCJA 4C4GA 2B4SB 4X2NA 2YIQA 2J6MA 3QRTA 3RP9A 4FEVA 4E6QA 4QP4A 1VYZA 4FT5A 5ANIA 1YWNA 4ZY6A 3KGAA 3PZEA 3FXXA 3R9HA 5HLPA 2ITOA 4H05A 2Z7LA 4FKGA 3F61A 4RX7A 4BL1A 5A46A 2WTKB 2V62A 2FH9A 3K54A 4NTTA 2V55A 1R39A 5IF1A 4M66A 4D4VA 3T8OA 3LCDA 3Q6WA 2OJFE 5C8MA 4QYEA 1F3MC 3VUTA 4TWOA 3Q60A 3D2IA 5F4NA 3T3VA 4AW1A 4DHFA 4BCFA 2BKZA 2PVJA 5GINE 1Y6AA 2HAKA 3PJ3A 2OJGA 2QONA 3RNIA 5IDPA 4G3DA 2BZJA 3BQCA 3LM5A 5EDPA 2E9PA 1H0VA 1I44A 3P5KA 4PPCA 3SRVA 3W2OA 2BDWA 4B6LA 3NAXA 4FMQA 2DYLA 3VJOA 4BCGA 1A9UA 4IEBA 4S30A 4W4VA 3SC1A 4EYJA 2P2IA 2R3OA 3WF5A 4AGWA 4CLJA 4YHJA 5EYCA 3R8UA 4Y5HA 3QD4A 4A7CA 2NRYA 4IC8A 4D9UA 3NYNA 5TR6A 3ENHA 4XLVA 1PXMA 4UMQA 2WMTA 3KXGA 1JQHA 3QTRA 4GUEA 3RBWA 5DMZA 3GP0A 5EFQA 4J53A 5CNOA 4GSBA 4QMUA 2FO0A 3KN6A 2VWUA 3SW4A 3ZLWA 3GI3A 5ANGA 2R5TA 3IECA 4TYJA 3NNXA 4E1ZA 2ZYBA 2BRNA 3GQLA 4M14A 4TT7A 1J1BA 4Y5QA 3VS3A 2VTTA 4CXAA 5ETIA 1NT2A 1JKTA 2VWZA 2FSOX 4CFXA 4TN6A 4WNMA 1U54A 2BALA 1ERKA 2V0DA 4IAZA 4WBBB 4F9WA 2X0GA 4GW8A 2GMXA 3N9XA 4FSRA 3N4TA 4U8ZA 4U6RA 2UW3A 2WTJA 1TQPA 3HVCA 4FYNA 4FV5A 2ITNA 3UOLA 1T46A 4JBOA 2C3LA 2PZIA 2C0IA 2XIRA 3UOKA 4PPBA 3CCNA 4D0WA 4MXZA 2J0MB 3TACA 4LUEA 4EH8A 4PTCA 4IQ6A 4RWKA 3TTIA 5H2UA 4D2VA 2B9HA 4D55A 3W18A 2VGPA 5HG7A 1A06A 1CMKE 2I40A 4UYAA 4ZS0A 1UA2A 1M2PA 2QHMA 2JBOA 3Q2JA 3PA3A 1KE5A 4AWIA 3D9VA 1Q8WA 4DH3A 5KMKA 1IR3A 2VX3A 5BVOA 3W32A 3OG7A 4LRMA 5AJQA 3AC4A 1KOBA 3HA8A 3VBXA 3MY1A 2XK8A 5AIKA 5EQPA 4BCNA 3L9NA 4MTAA 4BHZA 3ZS5A 5FDPA 3QTXA 4LGHA 5CU2A 3LLAA 4YZMA 1JOWB 3RPOA 3PXFA 1WBSA 2BAKA 1BMKA 2OWBA 2JKKA 4MXYA 3BCEA 5DT0A 1FQ1B 4ANQA 5J5SA 2HIWA 5D1JA 4C58A 3CGFA 3CQUA 3PRFA 4CZTA 4QMZA 3L9PA 4ZY5A 4FTRA 4WD5A 4O7SA 3KN5A 4W9WA 5K3YA 4H1JA 3UVPA 5GIPE 4CYIA 4EK3A 4EWHA 2XJ0A 5CAPA 5JZJA 1W98A 3FSKA 2G01A 5I0BA 2J5FA 3C5UA 4FNYA 2GQSA 4KB8A 3QTWA 4FG8A 4KRDA 5L2SA 2PVMA 2SRCA 3TCPA 5AX9A 2VGOA 4FTCA 4KBAA 4PWNA 4TYIA 5J1VA 1KE8A 4DLJA 2FSLX 4AZTA 3NVKI 2QKWB 2XRUA 4O22A 3E7OA 2B9FA 1DS5A 2UW8A 4NIFB 2ESMA 5EM6A 3ACKA 1W7HA 4IVAA 5IH6A 2BHHA 1IASA 4IM2A 4AA4A 2UZEA 2WMBA 1UU9A 4O7VA 3QRKA 5B2MA 2WOUA 2PE0A 4FGRA 4YTIA 1H26A 5GJFA 1S9IA 4WKQA 3ZMMA 4DEGA 2HY81 2GS7A 4BBEA 3KRXA 4CKJA 5JGBA 3OCBA 3U9CA 4CMTA 5KMJA 2XNBA 5FTOA 4EKLA 5AV3A 3EFJA 5IPJA 1SZMA 4R7IA 3W55A 5IKWA 2X6DA 3EFLA 3VO3A 3C0HA 4ANOA 1VR2A 2PK9A 3ZZWA 2XKEA 4RX9A 3ULIA 1SVGA 3KULB 4FTLA 4IAFA 4PMTA 4GL9A 3V6RA 3PY3A 4JVGA 4YSMA 4RPVA 3OT3A 4DBXA 4YHTA 5HBHA 4AGDA 4AFEA 1W82A 1LR4A 4YJUA 4EH7A 2F7EE 3TNQB 4YJPA 1WVYA 4LGDA 4XRJA 4X0MA 4BDFA 1URCA 3GC0A 2WFYA 1PHKA 4XG3A 4DAWA 3PE2A 3I7BA 1Y57A 3KK9A 3WIKA 4JL9A 4KD1A 3FZ1A 3UC3A 4RFZA 4CCBA 4RZWA 3M11A 1ZMUA 3OXTA 3O23A 2Y6MA 3I7CA 3H30A 3QWJA 3OOGA 2JGZA 3ZEPA 4C3PA 4I5PA 1V0OA 3UG1A 4BI2A 4O0WA 5EG3A 3CLYA 4RWLA 2ZB1A 4OW8A 5GJDA 4TZRA 3SX9A 2J2IB 3RZFA 2WB8A 3VVHA 4HZRA 4E4NA 2OKRA 4FSUA 3RVGA 5EKNA 3C5IA 3AC8A 2C69A 2EXMA 1WBTA 1TQIA 2OGVA 3OCTA 3OROA 2BHEA 1XQZA 2UZTA 2OFVA 4OTFA 4OTHA 4BYJA 3MPTA 4MNEA 3RAKA 3TDWA 4IAKA 2ITYA 2YJSA 3OWLA 4NM7A 5GJGA 3ROCA 4JOAA 5HVJA 4AGUA 2CSNA 4QMLA 1OKVA 5CS6A 1OPJA 2YACA 3LIJA 3QA8A 4ANBA 3V5PA 4J98A 4IHPA 4FL3A 4FR4A 3LQ5A 3TZ8A 1OZ1A 2R3PA 2Z02A 3V5JA 3DTWA 5JQ5A 3LMIA 4K9YA 3DBDA 5H9BA 1SVEA 3W2RA 4EOIA 3OBJA 4DGNA 2B9IA 2XS0A 4RSSA 4BBMA 2PZYA 2W06A 4QP8A 5D10A 4N70A 3DXNA 1R0PA 1Q3DA 4ASDA 2X2MA 1J91A 4WOVA 4AN9A 5AX3A 5CEQA 3EN5A 3REPA 3UMXA 5K4IA 4M8TA 2OJJA 5JSMA 3TM0A 4XUFA 4DFXE 3VULA 1IA9A 4MH7A 1MRUA 3MH2A 2AC5A 2I1MA 1G8AA 4QD6A 3LM0A 1URWA 1LEZA 2REIA 4C36A 2OIDA 3FUPA 4N6YA 4PP7A 2BRHA 5HBEA 4C2WA 3RKBA 3ZM9A 3FMHA 2QI8A 4Q9SA 4X2FA 2WTCA 4I0TA 3EZRA 3FMLA 3TL8A 2UZLA 2W1FA 2IVTA 2WU7A 5HE1A 3WOWA 2H6DA 1ZZLA 3F5UA 1KE6A 3MPMA 1WMKA 1YHWA 1J7IA 4EEVA 2BR1A 4LRKA 3P7AA 4J95A 4NT4A 5DEYA 5G6VA 3TT0A 2Y9QA 2OH4A 3F9NA 4P7EA 5JRQA 4BWXA 3R28A 4G17A 3NZ0A 2VWVA 4EH2A 1KV1A 3L8SA 4FTQA 3MFTA 5IA5A 4ZSAA 3V01A 4DT8A 4D1ZA 3Q4UA 3QA0A 4R3PA 4X3JA 4O6LA 3G6GA 5TOZA 1Y6BA 3LLTA 2F49A 2Q0NA 3KA0A 3WZKA 3CQEA 5K5NA 3FLSA 3CSVA 4B99A 1GZNA 4QP1A 4TWPA 4NFMA 5IH4A 4KA3A 3IW8A 1FVRA 1M7QA 1YOJA 4GJ3A 4O38A 3PLAE 4FKLA 3BX5A 4FV9A 1ZYJA 5EDRA 3E87A 3NS9A 3O71A 4J71A 5EI6A 3C7QA 3A2CA 1U59A 5T6KA 3VS0A 3ORMA 1Y8YA 5EYDA 5I3OA 3ZHPC 4ZSEA 2RFSA 5E4HA 4PL3A 2EU9A 4XOYA 4F0GA 5EQEA 5C4LA 4JX3A 4AOIA 4IB1A 5AM7A 4BCQA 3QQHA 5TO8A 1E1XA 3AG9A 2OZAB 5EM7A 4DEAA 2BRMA 3QXPA 5IEYA 5E92A 3UMWA 5LWNA 2QOOA 3OS3A 3W8QA 2UVXA 4WG3A 4DFLA 2ETMA 1AQ1A 3ZLXA 3E62A 5JH6A 3PRIA 3V8WA 4EYMA 4HVHA 1PF8A 1W8CA 2XK6A 5E7RA 4MXCA 3GB2A 4XG4A 3FPQA 3SHEA 3COHA 1P5EA 2KTYA 2GNFA 2XK7A 5LJJA 3AC1A 5TE0A 5CT0A 3PPZA 5D41A 3RGFA 4G5JA 3CTHA 3Q04A 3S0OA 2OZAA 5EM5A 4XX9A 4ITHA 5DPVA 4C4FA 3DDPA 2F7ZE 1OKWA 2IVVA 4AQCA 4I4FA 4IJ9A 1V1KA 2Z60A 3COMA 2W1GA 3C1XA 3R2YA 5FP5A 4BCHA 3ITZA 3LJ1A 2QLQA 4FC0A 5KMIA 4I41A 2E9VA 2Y0AA 3L1SA 5I9WA 3ZOSA 4JR7A 3TN8A 1Q8TA 3PXKA 2R3RA 2W4OA 2WTIA 5CQUA 1BI7A 3G33A 4V0GA 3SAYA 1M2QA 2X4ZA 1FINA 2A0CX 2CPKE 3NIEA 4CNHA 5L2TA 2X81A 4EK5A 5FXQA 4XV9A 2W4JA 4AGCA 4ASEA 4PMPA 4I93A 3F3WA 4F9AA 2ITUA 3BHTA 3COKA 2JDTA 4OTDA 5CT7A 3ZO1A 5KNJA 4HNIA 4ID7A 4F1TA 5BUIA 4MYGA 2XK4A 2GNHA 4Y83A 3ORPA 5AR2A 3GQIA 3GFWA 4FTJA 5HD7A 4D2PA 3ZO3A 4F6UA 4CG8A 5C4KA 5KE0A 2YCQA 5CANA 3OFMA 2EXEA 3I5ZA 3KQ7A 4L52A 3ZRMA 5JFVA 4C37A 3OOMA 3NPCA 2VTIA 4FTUA 3BI6A 3HMOA 4BYIA 3I60A 3P4KA 4RA5A 4ZTLA 5I9VA 1BL6A 3F82A 2W5HA 4ENYA 2PHKA 5FWKK 5AM6A 4PF4A 3NYXA 4C59A 2A1AB 5FXSA 2ERZE 3UVRA 3K5VA 3DGKA 4PNIA 3CBLA 5DEWA 4XEYA 4BWKA 2XYNA 2B7AA 2JITA 2OK1A 3QQKA 4GK4A 2ZV2A 3BE9A 4XV3A 3ATSA 3Q2MA 1G5SA 2GS6A 3DDQA 4O0SA 4FKIA 4USFA 5AP3A 4C4EA 5HZNA 1DI9A 4NU1A 3RPRA 1R0EA 3P78A 4HGLA 4NKSA 3UNZA 2RFNA 3EFWA 4BI1A 3C51A 4EBWA 1BLXA 4PP9A 3SKCA 2C0TA 3CD8A 1KSWA 1Z57A 4OTIA 4YZNA 3EN9A 1PMVA 5FEEA 3VBQA 2IVUA 3VUHA 1S9JA 3B2TA 4MD8E 1XO2B 4JAJA 5HE2A 3KEXA 3WF6A 4DG3E 5KKRB 4OAUC 4P90A 1Q97A 4JIAA 4AA0A 2JDVA 4A9UA 4NUSA 4RA4A 3Q9YA 5HE0A 5A4LA 4FIJA 4I0SA 2J0IA 4W4YA 4YC6A 2IJMA 4LI5A 1FBNA 2GPHA 4TYGA 1K3AA 3OXZA 4IVDA 4L53A 4CG9A 3R8PA 5E1EA 3ZLSA 3Q96A 5A4EA 1E1VA 2XNOA 5I5ZA 1OUKA 4KIOA 4RFYA 3KF4A 3FZPA 4F9BA 5AAGA 1UKIA 3TUDA 1UWHA 1UKHA 4AW2A 5HNGA 3GCSA 3OY1A 1VJYA 4X21A 1IEPA 2DWBA 4BI0A 4EH5A 4PUZA 3MFSA 2C4GA 4LMNA 2CCHA 3NUSA 1UNLA 5TF9A 4FV3A 3DV3A 3ZRKA 3UE4A 4B7TA 3FL5A 5L8LA 3DNDA 3KMMA 4X3FB 3VHEA 2CKQA 2WQEA 5DT4A 2JBPA 2G1TA 2B1PA 4HCVA 4HGTA 2QNJA 1XR1A 2CGXA 4ASZA 4IX4A 4OBPA 1NY3A 2VU3A 5ITAA 3FEGA 4YJVA 3KF7A 3G0FA 4C61A 4U5JA 4APPA 1KUTA 4ZS4A 3KRWA 5BVKA 2W9FB 3GU8A 2GSFA 4EOMA 5A4QA 4C8BA 5KHWA 3B2WA 1MRYA 4L7FA 5TT7A 4EQMA 4ZP5A 4J8MA 5DR2A 4QMMA 3TXOA 3E92A 4AX8A 2UVZA 1YVJA 3BLRA 3D5WA 1YDSE 3PTGA 4XG9A 1Q3WA 4JDIA 4L01A 4DFZE 4ACMA 2ACXA 3RWQA 3E3PA 2H8HA 3LFBA 4MXOA 2CLXA 2YIRA 4O96A 4PV0A 5E91A 3OZ6A 3UZTA 3O50A 5E1SA 3BBTB 5CEPA 2WZJA 2YM5A 4CGAA 3IKAA 1UVRA 5AR3A 2BVAA 2FGIA 4YP8A 3DKFA 4XHKB 3TJCA 3SGCA 3W2QA 4G3FA 3R6XA 1QPJA 4W8EA 1A48A 2XKCA 5IA1A 4ZMFA 2IWIA 2XNGA 3UP7A 2OXXA 2OG8A 4GFMA 3Q53A 4D2RA 5IQHA 1J7UA 3DJ7A 1YI3A 4UALA 2CGWA 4CFVA 3WYXA 5GHVA 4ORKA 4WSYA 2O2UA 5AEPA 3TNPC 3HECA 3NNVA 4GIHA 3LMHA 2VTLA 2YWPA 3A7GA 4QYYA 4U79A 4DGGA 4E5AX 4EOQA 2HXLA 2VWXA 4U0IA 4JG6A 4FICA 5G1XA 5ICPA 5FBNC 2WKMA 3FY0A 3F3UA 3OEZA 4BDEA 1MQ4A 2R3LA 3O2MA 3MH0A 3V51A 3Q9WA 5ACBC 3M42A 1H1RA 3DLSA 3MTLA 3BWFA 2ZM3A 4GIIA 4BTKA 3GEQA 3N4UA 4GMYA 4CSVA 3FE3A 4DEEA 1WBPA 4AN3A 4M7IA 2C6TA 2WHBA 4I6BA 2XA4A 4IBMA 4NZWB 4O0XA 5HCYA 4ACGA 4HVDA 1OBGA 1Q8YA 4RLKA 3F6XA 5HIDA 4F7LA 4O86A 2QOHA 3QXOA 1H08A 2I0HA 3BYOA 1U46A 3PIXA 4RC2A 3D5XA 2YABA 2VO0A 4C35A 3PG3A 5CSPA 4FV8A 4F7JA 5JFWA 3OW3A 3GU4A 5CVFA 3E8DA 5AWMA 4AZSA 2XEYA 3ZSIA 1PKGA 5H8BA 4BFMA 5IA3A 3IW5A 2CLQA 3DJ5A 4OT5A 4NM3A 5HIEA 5J7HA 4BICA 2QOIA 5DIAA 4DG0E 4FVRA 3U54A 4BCKA 3FMKA 3HUBA 1CM8A 4BTJA 4AUAA 5IMXA 4TTHB 2OZOA 4WRSA 4IMYA 4XOZA 4I0RA 5BPYA 4F64A 1YQJA 1IG1A 4G9CA 3BYUA 3BIZA 2JIIA 1M7NA 1PXLA 3RHXA 4D28A 2HY0A 2VWYA 1SVHA 4BDJA 4CZYB 2CCIA 2O5KA 3PXQA 2RFEA 4FTIA 4L43A 3COIA 3ZXZA 2ZMDA 1U5QA 3IOPA 3VRZA 4O0TA 4CTBA 3RK9A 4DH8A 4R6VA 4G5PA 3WBLA 4FSTA 3G9LX 3QQGA 4ALUA 5L6OA 1UNHA 1MRVA 3CGOA 2OH0E 5AUUA 2IVSA 3IDPA 2EB2A 3OMVA 1ZYLA 3BHHA 2PVHA 5AR8A 1JSUA 3U55A 5ANDA 1G8SA 2XH5A 1JKSA 4CD0A 2QOQA 4HPUE 3VNTA 4PY1A 3EQDA 4FUYA 2QOCA 2WTWA 5FQDC 4JI9A 4MAOA 4OTRA 4EHVA 4MF0A 4YR8A 3FLYA 5H3QA 3PJ8A 5BVWA 3R7OA 5AUZA 3VIDA 5CI6A 3ZCLA 4XBUA 5BVEA 5LWMA 3WF9A 5CVHA 1YXTA 4IFCA 5AP4A 1CKPA 3FI8A 1OITA 2BMCA 5ETCA 3VN9A 2PUPA 3Q5IA 5M4CA 3R7EA 4M84A 3RZBA 3WZEA 4FODA 1QPDA 2X7OA 4G9RA 4RJ3A 2W5AA 4C62A 4IW0A 1QMZA 3POZA 5JT2A 4BIEA 4O7YA 3Q3BA 4QOXA 3CXWA 4QMXA 2WMUA 2B54A 3MJ1A 4FYOA 4QP6A 4RIYB 5A4TA 4R1YA 2B52A 3LFQA 3QTSA 3TV6A 4RX8A 3P9JA 2BFYA 1CKIA 2IW6A 1WVXA 4TWNA 3PXYA 4GVJA 2G2FA 4QQJA 4KIQA 3KVXA 3N51A 4OBQA 3VS6A 5EW9A 4ASXA 3IDCA 4J7BA 5CF8A 2X2KA 3CEKA 3G9NA 3I6WA 4FKUA 3R30A 4A9TA 5T3QA 4BIDA 4CCUA 3DXPA 5KZ0A 3O7LB 4OR5A 1STCE 2W99B 2PVKA 3PFQA 4HVSA 2C3KA 4QYHA 3F3ZA 1DAWA 3SOCA 2WU6A 3FLNC 1J1CA 4RVTA 3AT3A 5CALA 4FV1A 4EUUA 4TW9A 4FEQA 4K18A 4PQNA 2VO3A 3D94A 2G2HA 4H3BA 3FHRA 3ENMA 3E88A 4N0SA 2WIHA 5L2IA 3FLQA 4EZ3A 4TPTA 2RSVA 4K77A 2X1NA 2ITXA 2J90A 2YM7A 3LCOA 2C6EA 2IG7A 5DR9A 2X8EA 2C1BA 2BIKB 3FXWA 4QP3A 3DPKA 5HKMA 5IU2A 1PXNA 1IA8A 2VX1A 3MFRA 3VQHA 4O7NA 3PVBA 3CE3A 4BDBA 1KE9A 4IWQA 1YOLA 3C9WA 3AD6A 3F7ZA 3FI3A 2WXVA 3QX4A 3EN6A 5DOSA 4UBAA 3QTZA 5DNRA 2P4IA 4X2KA 3ZYAA 3LHJA 2HZ0A 4OUCA 2R3IA 4BCOA 1H24A 4ZLZA 1ZWSA 3HV5A 3BZ3A 1OPLA 4ALVA 2Z2WA 4QTDA 2VTAA 3U9NA 2XNEA 3HX4A 4FSYA 3KRRA 3OD6X 1HOWA 4TYEA 3QYWA 2ITZA 3MIYA 3PWDA 4GS6A 4D4YA 2KULA 4M68A 3F5XA 3BQRA 3QTQA 1KE7A 1OKYA 3BEGA 3ERKA 3ZH8A 4HGEA 4RRVA 5KUPA 3EOCA 3ORZA 4UEUA 4K1BA 2QKRA 4XRLA 4JX7A 4MXAA 4J99A 4QTCA 4CEGA 5HORA 3MB6A 3LQ3A 5E8SA 2OXDA 4C33A 4L44A 5AADA 4EC8A 3OTUA 4WRGA 3F5GA 5CSHA 3ZSGA 3QGWA 5L6WL 5DVRA 3LZBA 5EK7A 4I1ZA 4O0YA 3AD4A 4A4LA 3A7JA 3FYJX 3ZO2A 3LVPA 3S3IA 2BDJA 3L8VA 2VTJA 3AMAA 4UWCA 5IA2A 1PYEA 2IZSA 3D2KA 3NCZA 4YBJA 1F5QA 2ZB0A 5HO8A 2BZIB 3FC1X 3IO7A 3BU5A 3D0EA 2OW3A 4DFBA 4USEA 2OBJA 5A54A 3CPBA 3DLZA 3KY2A 3H4JA 4M0YA 4K8AA 4ANLA 3VWAA 4WT6A 1YWVA 3FMMA 4MBJA 2Y4IC 4GT4A 2ONLA 4GKHA 3DK7A 1G3NA 2R0IA 4LV5A 4O7WA 3A62A 4EQUA 1OKZA 3QHRA 3RCJA 3ET7A 5AP0A 4IH8A 4FKJA 4EHEA 3PVUA 3NW5A 4G16A 5I9YA 2C6IA 2OJ9A 4FKTA 5JMSA 3S00A 4UZHA 4FX3A 4HOKA 5F9EA 3R8LA 4F4PA 4BZOA 2GS2A 4YNOA 4FZ6A 2OF2A 3DBCA 5F95A 4ZJJA 2VTSA 3P08A 3KMWA 3ZLYA 4L45A 3UYSA 4E73A 4FSWA 3ZBXA 4BDAA 5IQGA 2GNJA 5CEMA 4CT2A 3PE1A 2CGVA 3FBVA 3OC1A 3PJ2A 4XV2A 4O21A 4MBLA 2VUWA 2XKFA 2QO9A 4QT1A 3IW6A 4V01A 3ZFYA 4C3FA 3HL7A 3C13A 2QURA 2PZRA 3T3UA 5ANJA 2UZVA 4D58A 4FIGA 1MUOA 2UW6A 3DBEA 3KU2A 4UY9A 1CTPE 3RAIA 3NNUA 3VRYA 2X6EA 4BN1A 5KMMA 3QLGA 4M69A 4YUQA 4G6LA 4ZK5A 5B2KA 5KHXA 1R78A 4I6QA 4Z55A 5CAVA 5BYYA 4M67A 4ZAUA 4L7SA 5EH0A 2HZNA 2PVFA 5HBJA 4D5HA 1YRPA 4BCJA 3AD5A 4RT7A 3U4WA 2AUHA 3UVQA 4FEUA 3MVHA 4RG0A 3FMNA 4HYUA 3L9MA 4IZ7A 3S4QA 4DN5A 3CQWA 5LMKC 4I6HA 2WMSA 4ACCA 4GCJA 1H1SA 5BQ0A 3G5DA 3NUUA 4JLCA 3QCSA 1RJBA 3I81A 3MH1A 5GNKA 3OBGA 2PL0A 5F1ZA 2UZDA 3R73A 4BDCA 5AV4A 4PMMA 4DEIA 3FQHA 4CRSA 5C9CA 4OT6A 2XCHA 3ROYA 2OSCA 1YI4A 4UB7A 3ATTA 4FA2A 3QD0A 3DAKA 5F94A 5DYJA 4IXPA 4RQVA 3OWPA 5AAEA 5EOBA 3H9RA 3V5QA 4JQEA 5HX8A 1OUYA 3QKKA 3RTPA 2RGPA 3KCKA 5JEBA 2PVRA 4JBVA 4F70A 4P2KA 3R9OA 4L3PA 5BVFA 4Q5EA 2GNGA 3FZOA 2G15A 1WBWA 3RPVA 5FG8A 2W5BA 3R7YA 3EKNA 3GBZA 2P55A 4FF8A 4JBPA 2QQ7A 3DA6A 3VS4A 4DITA 5I9UA 3NGAA 5EYKA 4LOPA 2FSTX 3V8TA 2PVNA 4FG7A 1WBOA 4TNBA 4E5WA 2A19B 4F1OA 4Z3VA 1SMHA 5J9ZA 5HIBA 4KIKB 4OTQA 4F63A 2R7BA 4O7RA 2PYWA 3EQBA 5BNJA 4G1WA 4AN2A 3FKNA 1ZXEA 2QD9A 3BGPA 1YXSA 1H4LA 3U6JA 4QNAA 5FM3A 4AW5A 3FQEA 3ORTA 1U4DA 3KMUA 3F7WA 5CU3A 4OTGA 2HXQA 5CF4A 4U40A 4MVFA 1ZZ2A 2IPXA 1H07A 5CLPA 1Q4LA 3LE6A 3PYYA 5AP7A 3UIMA 2HWOA 1ZLTA 4GRBA 3MS9A 3F2RA 2CN8A 5E8YA 4AXAA 4KKGA 4FIHA 2YZLA 4C38A 2VO7A 4WUAA 3M2WA 4CLIA 2F2UA 5HD4A 3QLFA 4YJNA 4YPSA 4FNWA 5CQWA 5CXZA 4D0XA 4IAAA 4R3CA 3O51A 2CDZA 4DF3A 3KXMA 5JRSA 3D15A 4FKQA 4EONA 2JAVA 1Q62A 1PXKA 4G6OA 3OF0A 4XP0A 3QC9A 2X9FA 4B9DA 4IZYA 3HRBA 3IW4A 1GZKA 4JBQA 3ZFMA 3NNWA 2BTSA 2O8YA 1GOLA 4FSMA 4I5MA 3V3VA 2F57A 4A4XA 4BKJA 2UZUE 2QG5A 3PXRA 4FVQA 4YC3A 3WF7A 4D1XA 3QFVA 3WI6A 4FEWA 4JXFA 3BGQA 3MA6A 3QZFA 4Z9LA 1TVOA 4AE9A 4WUNA 3ZUUA 2VZ6A 4UXLA 3DKCA 4FIIA 3JYAA 4KWPA 4U80A 3FLWA 4WNPA 3UIBA 4H3QA 5EHYA 4EJ7A 1IAJA 3LFNA 4RIWB 3EN7A 4QPSA 3DZQA 3KVWA 4A07A 2IZRA 4D2WA 3K3IA 4O7TA 2UW5A 3GU6A 2B55A 3BPRA 4WNOA 4FV6A 3U87A 4PMSA 4O2PA 5AUYA 3QQJA 3R7GA 3OXIA 5AMNA 5J95A 4FZFB 3DBQA 4YPDA 4ZJIA 5KBRA 5M57A 2C3IB 4LG4A 1XH7A 3LJ0A 3NLBA 2UZBA 5DT3A 1YHSA 3ODYX 3TNIA 5IEXA 2NPQA 4H58A 2VD5A 2R4BA 5HG8A 5IQCA 4C0TA 2RL5A 5CF5A 4TY1A 1H1WA 2OO8X 4IB0A 4MQ2A 4K2RA 4E26A 3LFEA 1R1WA 4IM3A 5I9ZA 1Q61A 4ITIA 3FV8A 4NH1A 3QKMA 4E20A 2QOLA 2UUEA 3JY9A 3E5AA 2B53A 4FZDB 2WEVA 1GAGA 3PP1A 4FT9A 1UU8A 3CR0A 2YM4A 3FL4A 4O0UA 4ONAA 2X7GA 4NWMA 5E8ZA 1Q99A 3CPCA 1Q24A 3NUXA 1BYGA 3MWUA 3BRBA 1Y91A 4EH6A 4BKYA 3ID6C 4AZEA 2O63A 3FI2A 3UPXA 3SXFA 3VW8A 3BE2A 3H9OA 1BI8A 3WILA 1ZYSA 4G2FA 3SLSA 1OIYA 3RAHA 2RKUA 3WZDA 2ZDTA 3QHWA 3EQHA 3FYKX 3AOXA 3D83A 2VO6A 3FJQE 2C6DA 3CJFA 2PWLA 4BVUA 3GUBA 1OL2A 3R1SA 3RPSA 5IUGA 4L68A 5M53A 4E93A 2FUMA 3I5NA 3EH9A 2AC3A 4G6NA 4YZ9A 3W10A 3MFUA 4MWIA 3T9IA 4RIXA 5FXRA 4CYJA 5JFSA 3BLQA 3WF8A 3E64A 5E8VA 2HELA 3IW7A 4A4OA 3GFEA 3AQVA 3A8XA 4LRJA 4NFNA 5D12A 4ZY4A 2UZOA 5JGDA 2ZOQA 2FVDA 5AV0A 1F0QA 1NW1A 4MNEB 4M97A 2JD5A 4FV0A 4YBKA 5AUVA 3P7BA 2JFLA 4QPAA 4WHZA 4TNDA 3ALOA 2WTVA 3R8VA 4YHFA 5IQAA 4KSQA 4QPMA 3VF8A 1OGUA 4RQKA 1DI8A 3GGFA 1O6LA 4BF2A 2B9JA 4JIKA 2XJ1A 3AC2A 3KFAA 4ITJA 1PXIA 3FMJA 3NUYA 5T68A 5KMLA 1FGKA 2VWWA 3PJ1A 3S2PA 2J5EA 2QO2A 5JZNA 3NW7A 3Q52A 3AGMA 2ITTA 3EZVA 4O6EA 3II5A 4PDSA 4CFWA 3I4BA 3KXZA 3PSDA 4QP2A 5JQ8A 1YHVA 4CVAA 4GU9A 4R7HA 4YJOA 4DGLC 4Y8DA 5EI8A 1LUFA 5FUTA 2XIKA 5BX0A 5CVGA 3LXKA 5E90A 3SVVA 2CMWA 4JJRA 4QQTA 4FT7A 5DWRA 4ZTNA 3DZOA 3G2FA 3GOKA 4YZDA 3MESA 2C6MA 4L67A 5L3AA 3EKKA 3W16A 2C68A 4AW0A 2CHLA 4NM5A 4E4XA 2GHLA 5HICA 1OL5A 3Q4TA 3QQFA 4A9YA 1OVEA 4XYFA 5IMEA 4PPAA 5K5XA 5M09A 3VF9A 4P5QA 4U9AA 3TV7A 3NUAA 1NVRA 2YERA 3QRIA 2WD1A 3Q5ZA 5KKRC 5DA3A 3NYVA 4NW6A 4DFNA 1W84A 4EQCA 2W1DA 2JKMA 1SNXA 1NA7A 4X6QC 4O1OA 3PY0A 3E3BX 1MP8A 5HE3A 4YO4A 5HNIX 2GHMA 2OFUA 2C5NA 2HK5A 4YZBA 1XH4A 3QCYA 4U97A 3UJGA 3ZC5A 2PY3A 3C4FA 4BKZA 3BWJA 3R2BA 5K9IA 1REKA 4I23A 4BRXA 4EK6A 2FB8A 3ZBFA 3TUCA 2VWIA 3LMGA 4FZAB 4WIHA 3IGGA 4YMJA 1ZARA 4QMVA 2XUUA 1GIJA 1CKJA 1OECA 4ZTSA 4K11A 4F6SA 2ZV9A 3FZSA 3MYGA 1VZOA 3LFAA 2PZ5A 5GZ9A 3A7HA 3CKWA 4EH4A 1H8FA 1SNUA 2DUVA 3UIXA 4GK2A 2J0LA 3UIUA 2ETKA 3F3VA 3KL8A 4J96A 3MB7A 4Q2AA 3WARA 1NXKA 1H27A 2F4JA 1PMUA 3OW4A 3ANRA 3HMNA 4O91A 3F3TA 1ZYDA 3HMMA 4WG4A 1M14A 4DG2E 3PA4A 3CS9A 4FBXA 3FZRA 1UWJA 3FMDA 3S1HA 3QRJA 1LP4A 1FVTA 4FKOA 2VX0A 4C4HA 4F65A 4FT0A 5CEOA 3HAMA 2Y6OA 3OVVA 2YDJA 4UN0C 3NX8A 3ZEWA 3R22A 3HLLA 3NCGA 3HV6A 2YDKA 4I22A 2YA9A 4E6CA 2VNWA 1J3HA 3DXQA 2WQBA 5CXHA 5I3RA 2JEDA 4H1MA 4L00A 4RWIA 3QL8A 4DGMA 2CKEA 3GC9A 4GUBA 2J50A 3R9RA 4KABA 4F09A 4ZTMA 4U43A 5CSWA 3R8ZA 3QUDA 4NM0A 1XH6A 4L8MA 4B4LA 1U5RA 3R63A 5BVDA 4YLLA 3TNWA 4LOOA 4RJ6A 3R8MA 2J51A 2WMWA 3H10A 1Z9XA 2W96B 2I0VA 4UXQA 2C30A 1BX6A 1OL6A 2QR7A 2WAJA 3IQ7A 4O2ZA 4AFJA 4AACA 2WNTA 4MKCA 2WGJA 3JPVA 4JT3A 2BTRA 2X39A 4AP7A 4L9IA 2A2AA 2W9ZB 4K0YA 3UOHA 5HQ0A 2A27A 5HTBA 5AFVA 3DBFA 2XIZA 5CEIA 4ZTHA 3V8SA 4EJNA 4RWJA 4HGSA 3R7UA 2QCSA 5JFXA 2JFMA 2R3GA 3CY3A 5CU4A 4FOBA 5LMBA 3TUBA 5HOAA 4L3LA 4N6ZA 3VHKA 4BCPA 3TWJA 4Z16A 2C3JA 4J52A 3H9FA 4ZSGA 4IX5A 2VTHA 3SQQA 1XJDA 3DT1A 3BV3A 3QUPA 1BKXA 4FV4A 4ZEGA 3DB6A 3RPYA 4JQ8A 2PULA 4K33A 3RM6A 4FTOA 4KIPA 4XS2A 2NO3A 4AOTA 4DYMA 5AP1A 2WQOA 2QU6A 4EWQA 3MPAA 5L6PA 3GC7A 4FI1A 3ZDIA 2OU7A 4G34A 2YWVA 3G0EA 2BKKA 2ONLC 4HNFA 2LGCA 4L46A 3LKMA 1YW2A 5A14A 4QO9A 1WBVA 5AIRA 3WE8A 3BEAA 1OPKA 3EIDA 4JR3A 5CASA 5HGIA 2HW6A 4O83A 2Z8CA 2R3MA 1L3RE 5DRBA 3JY0A 4EOKA 2YCFA 4F7NA 4CZUA 1QCFA 1GNGA 4HYHA 4NK9A 3GCVA 3UYTA 4RLLA 4BDDA 4BIBA 2ZV8A 4J1RA 2IW8A 3PWYA 4XLIA 3O7LD 2XZSA 2V7AA 2WMAA 4DCAA 3PVWA 5C27A 3VQUA 4AOJA 5ETAA 4A9SA 2BROA 5CZIA 5DFPA 5ANEA 2G9XA 3GNIB 3UBDA 2CKPA 2WQNA 3W2SA 4EH9A 2WMVA 4IVBA 4HJOA 3VJNA 2XNNA 3LAUA 3QZHA 5M44A 4X3FC 4AS0A 4FZ7A 4O81A 3ORXA 3ORIA 4ENXA 3BGZA 4YJRA 5DN3A 1FMKA 3VS1A 3E8NA 3MY5A 4YJTA 2HW7A 4GVAA 3OCSA 4Y85A 5DH3A 3EL8A 1RDQE 4YC8A 3CTJA 2BAJA 1WCCA 3KXNA 2GHGA 4IWDA 1JAMA 2XKDA 5LOHA 4ZZOA 2XK3A 4LM5A 3VBTA 3QBNA 1FGIA 3I79A 4PDYA 2R3QA 4IANA 2QOKA 4AF3A 3IG7A 3MW1A 1JNKA 2ITVA 4X3FA 1HCKA 2CNUA 4E6AA 4DTBA 3BBWA 3MN3A 4NCTC 3A60A 4UMPA 5LMAA 3CKXA 5HU9A 2HENA 5J87A 3VUIA 1QL6A 2J7TA 4MHAA 3I0OA 2VV9A 2ERKA 1VYWA 4IC7A 5DG5A 4IDTA 3C4ZA 4EZ7A 3PA5A 3ORKA 4GJ2A 1KV2A 3V5TA 3HV7A 3V6SA 4IADA 4A06A 2WELA 1PXPA 3DK6A 3LCSA 3D5VA 4LYNA 4GYGA 4BGQA 4YURA 5M51A 3QTIA 4O84A 2E2BA 2W1EA 4FL2A 3TKUA 4GH2A 3ZM4A 5J7BA 4A9RA 3FSFA 5EDQA 2CN5A 3POOA 4YNEA 5GZ8A 4CFUA 4EOJA 2UW0A 4U41A 3GENA 3HDNA 5CSXA 2QU5A 3O8UA 4DA5A 4X2JA 4CQGA 2V7OA 3SD0A 4D5KA 2IO6A 1GJOA 2YFXA 3TTJA 3A4PA 3IDBA 4EC9A 3PY1A 3KRLA 3C4EA 4BY9E 2IZUA 5DLSA 3W2PA 3HP5A 4BTFA 5HI2A 4EOSA 1XWSA 4QRCA 4OGRA 4TRLA 4E4LA 5DBXA 5C26A 3JR1A 3IOKA 3SV0A 3PZHA 4C02A 2C6OA 3H3CA 3ZUTA 5E9EA 4I5CA 2PZPA 4Q5HA 1BUHA 4EH3A 5DR6A 5A4CA 2O0UA 3R71A 3NUNA 5E8XA 4G3GA 4APCA 4AU8A 3RINA 3TIYA 2X8IA 4FEXA 4R77A 3EQFA 2R0UA 3VS5A 3E7VA 4RIXB 3EB0A 1Q8UA 4M69B 5CY3A 3VUMA 3VS7A 1H1PA 3P1AA 3W1FA 3UP2A 4EZ5A 2ZM4A 4RVLA 5HHWA 2VTOA 1OBDA 4YLKA 4K6ZA 5CI7A 1GY3A 2DQ7X 5KMOA 1XBBA 3HGKA 4HCTA 3EHAA 2JDOA 2X9EA 2XMYA 1NVQA 3DOGA 4JRNA 5BYZA 3SRVB 3ZZEA 3MVMA 3E63A 3TNHA 3WIGA 2CKOA 4N57A 3ZO4A 3W2CA 4RX5A 3TZ7A 2PUUA 1AGWA 4E7WA 2WTKC 4EOOA 3DK3A 3HMIA 4ACHA 4WG5A 3O0GA 3UGCA 4RBLA 4XG2A 4XH6A 5EW8A 4UX9A 4MX9A 1Z5MA 2ZVAA 3C50A 4FSQA 3UQCA 4AAAA 1H1QA 1UV5A 3VBVA 4DH7A 4U42A 4OBOA 3HA6A 3GOPA 3K5UA 4DT9A 4O82A 3D5UA 1ZMVA 2QVSE 5EHLA 4S32A 4BDHA 2YM3A 3R9DA 5IA0A 1SYKA 4U81A 4CT1A 3QTUA 2CJMA 3THBA 4CRLA 2C47A 2QG7A 1O9UA 3SXSA 3O96A 3IONA 5FEDA 2YN8A 4G31A 3UNJA 4AZVA 2X7FA 1H00A 3A8WA 4IIRA 2X4FA 3RAWA 4FKRA 4D2SA 4ZSLA 5BMSA 1JKKA 4F9CA 2B0QA 3SDJA 1MQBA 4CFNA 3PPJA 1M2RA 2EB3A 2UVYA 5HG5A 3UODA 4CKRA 3PIZA 5J5TA 4C57A 4IX6A 4UMTA 5HEZA 2JDSA 4V0GB 3VAPA 4F0FA 2QHNA 5AR7A 5CU6A 4KBKA 3D7TA 3JVRA 4FL1A 2AYPA 4GEOA 3DU8A 2IW9A 3UZPA 4BHNA 1YXVA 2Z7SA 4E3CA 3EMGA 4IAYA 4PTEA 1ZRZA 4ZSJA 5LARA 3VS2A 3HZTA 3G51A 4FKVA 1QPCA 3LXPA 2OJIA 3FAAA 4YO6A 3HAVA 1OL7A 4HVGA 5CU0A 1AD5A 4I24A 4TWCA 2PMLX 3NEWA 3GVUA 4AA5A 4F7SA 2C1AA 2UV2A 2OIBA 2GU8A 4FTAA 1ZYCA 4O0RA 4XCUA 2XB7A 4C3RA 4FV2A 3EL7A 3U8WA 3LFCA 3VBYA 4AT4A 4DFUA 2VNYA 4RJ5A 3A7IA 2W1ZA 4RC4A 3LFSA 1YOMA 1B38A 1KOAA 3PJCA 4GKIA 2PVLA 5C01A 2VTMA 3MA3A 5A3XA 1IAHA 3SG8A 4ERKA 3HEGA 5CENA 2ZDUA 3OHTA 3ORNA 2EXCX 4RIYA 4FG9A 5HNBA 3PP0A 4OAVB 1REJA 2PMOX 5ANOA 5FTGA 2VTRA 2XIYA 3KCFA 3OTVA 4FTTA 2YDIA 4MXXA 2XVDA 3TIZA 5CAUA 5IA4A 4EUTA 3EFKA 3HV4A 2EVAA 3IS5A 2ZM1A 4GYIA 4RJ4A 4ANMA 3FWQA 3ZONA 4GU6A 1XKKA 3QU0A 4QP9A 1PY5A 4YJSA 3UG2A 1OIRA 5AP2A 1OIQA 4FTNA 4UV0A 4YGAA 2XNMA 2YJRA 4I94A 2ZMCA 4KS8A 3R7IA 2WPAA 4C4IA 3QQUA 1B6CB 1Q5KA 4M0ZA 5KCVA 4M15A 3LFFA 4FKSA 5M06A 2E9UA 3MVLA 3R1YA 4F6WA 3S95A 5I9XA 1B39A 1PYXA 2BAQA 2GDOA 5AAFA 4QNYA 2ITWA 2QOFA 2YM8A 1JBPE 2WMQA 3ODZX 3PUPA 3ORLA 3CIKA 1M52A 5KO1A 3TV4A 3VUDA 2XF0A 4O27B 3EQRA 3EJ1A 4S31A 2XP2A 3QKLA 4YSJA 2Q0BA 4PL5A 1JVPP 2WMXA 4U45A 3ZTXA 4I92A 3TEIA 4PNKA 1ZAOA 3UQFA 3EN4A 4H36A 2P33A 3C0IA 4G3CA 3ZFXA 4RFMA 1PKDA 4XP3A 5L2WA 4LFIA 3PSCA 1RW8A 4UWBA 4XBRA 5CZHA 3C4WA 3DS6A 3AXWA 4BGHA 5M08A 4W9XA 5IEVA 4V05A 1PMNA 2UW7A 2VTPA 4H3PA 2PMNX 5L8KA 4FTMA 2VWBA 4HVIA 2WO6A 3QGYA 4IZ5A 4RZVA 3UO4A 3OT8A 4O7LA 3KXXA 4ZLOA 4FE2A 5M4FA 3SG9A 4X7QA 2GTMA 1BL7A 3LQ8A 5B2LA 3DAJA 3TKHA 3RHKA 1P4FA 1V0BA 3TG1A 4E4MA 5DE2A 3WE4A 1H28A 4EL9A 2OI4X 2RG5A 3L8PA 3QZGA 2W17A 3AGLA 5IQBA 1JSVA 2P2HA 2C5OA 3QD3A 4X6RA 1ZOEA 4AZFA 4GT3A 1IRKA 3BYSA 4IAIA 4XG8A 3H0ZA 3ALNA 4LUDA 4CMOA 2XYUA 1TKIA 4JNWA 5EI2A 1YXXA 3ELJA 5HTCA 4O1PA 4QMNA 5JN2A 3BELA 1JWHA 1RE8A 2ETRA 3GCUA 3HMPA 4S33A 3H0YA 4DH1A 3PLSA 5CWZA 5AV1A 2RFDA 2XBJA 3FY2A 2UZNA 4FK6A 4II5A 2ZV7A 3CY2A 3LOKA 4CFMA 1W0XC 1ZOHA 1ZY4A 2I0EA 4PRJA 5IDNA 1KWPA 3R00A 1WFCA 3CJGA 1PW2A 3E8CA 3P79A 2XRWA 3DY7A 3GU7A 4U44A 5M56A 4MCVA 2F7XE 3QAME 4EBVA 3I6UA 3R01A 5LVPA 3DKOA 4ERWA 3JUHA 3G15A 3VBWA 4NJDA 4LL5A 4FOCA 4UYNA 4R3RA 3LFDA 3TJDA 4EHZA 2YLFA 2R3JA 5BYLA 3WZUA 3E93A 3LXNA 3OWKA 3ZDUA 5D7AA 3HP2A 4BCMA 4QP7A 3QWKA 1V0PA 4J8NA 4XNEA 3RJCA 2P0CA 3MVJA 5AR4A 4CTCA 3MGYA 5CAOA 1ZMWA 2HYYA 2C0OA 4QMYA 5FD2A 2BUJA 4IE9A 5J1WA 4ZMEA 4AZWA 3HDMA 5F20A 2NRUA 1U54B 1CDKA 3QUEA 3GT8A 4XMOA 4CKIA 3NAYA 4DCEA 3DCVA 4GFOA 1YI6A 5D11A 5FEQA 2YISA 3UPZA 4NYEA 2V22A 5AR5A 4BB4A 4Q9ZA 3BHYA 1FMOE 2PPQA 5HVYA 3TZMA 4Z7GA 3PG1A 2H96A 4N4SA 4C7TA 5KZIA 4M13A 5LCKA 2ITQA 5IISA 2PTKA 3EYGA 2R9SA 3GCQA 2PVYA 5HCZA 2OIQA 4U3YA 5B0XA 4BC6A 3AMYA 3KC3A 4BZNA 5M4IA 2NNWB 4RVKA 4IVCA 4DH5A 2A4LA 3RI1A 5HCXA 4F1MA 4PL4A 4JRVA 5L4QA 4EKKA 3F88A 3RWPA 4B0GA 1UU7A 4G3EA 4W4XA 5HLWA 2YHVA 3HNGA 4IB3A 4JQ7A 4YZCA 3CTQA 2I6LA 2DS1A 4KKEA 5ANKA 5HX6A 3NW6A 5CF6A 1LPUA 4Y72A 3OY3A 4EORA 2XK9A 1TQMA 1PMEA 2CNQA 5EKOA 3W33A 2IN6A 2WOTA 3CP9A 3LCTA 3BLHA 3KKVA 4HYSA 3GC8A 4H39A 2QR8A 3VC4A 2XNPA 5M55A 5HLNA 3KXHA 2R64A 3O8TA 2YIXA 4CV8A 4YTFA 4KUJA 4IB5A 5AV2A 2J9MA 4DE4A 4KINA 4DEBA 4MQ1A 3HKOA 4QMOA 1JLUE 2FA2A 4MD9E 4BCIA 5IQIA 4FNXA 2XM9A 5E8UA 4MNFA 4ZTQA 4HCUA 3PIYA 3UZRA 2J0KA 3F69A 4NTSA 3NDMA 4MBIA 5M07A 2YITA 3ZXTA 1P2AA 3DAEA 4KS7A 4QMSA 4XG7A 2XCKA 4ANSA 4B8LA 4LOQA 4D4RA 4CFFA 2BILB 4FVPA 5FGKA 2PMIA 5C8NA 3FKLA 1Y8GA 3DKGA 3MV5A 3NRMA 5LVLA 2IZTA 1OMWA 4Y46A 4TL0A 4GK3A 3BYMA 3ULZA 3TKIA 4FUXA 4TYHA 1K2PA 3U51A 4DTKA 5JGAA 3AT4A 4S2ZA 3D7ZA 5C03A 4UMRA 4Y95A 4BZDA 4MK0A 4DINA 3Q4CA 2HCKA 1ATPE 3SW7A 3CD3A 2NP8A 3R02A 4XG6A 1PRYA 1YDTE 3FI4A 1NVSA 5AUTA 2C5YA 1XH5A 1ND4A 5AUWA 5TKDA 3BKBA 3Q32A 3EQGA 4NIFA 4E6DA 4UWYA 5H8EA 3BV2A 4DLIA 4GV1A 2BRBA 4Z7HA 4NSTA 4YTHA 3HRFA 5BVNA 3OUNB 2QC6A 2YIWA 4FTKA 2OLCA 3R0TA 2QOBA 3NYOA 4CMUA 5HO7A 2UW4A 3R1QA 5K0KA 5IZFA 3O8PA 5B7VA 4EHGA 1P14A 2XJ2A 3VUKA 5EQYA 5CNNA 3C4CA 2FYSA 3U4UA 5LVMA 2W1CA 4U3ZA 4D1SA 4ANNA 2PUIA 2CNVA 5D7VA 4B8MA 5HU3A 3SA0A 2WEIA 3P0MA 3FC2A 1JSTA 1DAYA 4LL0A 1OIUA 2JKQA 4KNBA 3RK5A 4I5HA 4EK8A 5J8IA 4MD7E 4QYFA 4EOPA 3KULA 3R21A 1WVWA 1GIIA 4IDVA 5D9HA 3T9TA 4BR3A 3HRCA 2VN9A 2GQGA 3L8XA 5CX9A 2OICA 3V5WA 2X2LA 2ZAZA 3VUGA 3PXZA 4E5BA 5IUIA 5L2QA 2BFXA 4BDIA 5EOLA 4HZSA 3N4VA 1FVVA 3Q4ZA 1CSNA 1XBCA 3MBLA 4FK3A 4GG5A 4RIWA 3NVMB 1SM2A 2W7XA 4CV9A 4HW7A 5FP6A 3R83A 4I3ZA 3B8QA 3LPBA 5DRDA 4JDHA 4R8QA 2O3PA 2WMRA 3G90X 3DFCB 3M1SA 2WQMA 4V04A 4LV8A 2WTDA 3KB7A 4PTGA 5JK3A 4RMZA 3MY0A 5IQFA 5CAQA 3BHVA 4J97A 3Q9ZA 2GFSA 4JDKA 4OLIA 4NW5A 4WNKA 3R9NA 2F2CB 4ALWA 4DEHA 3UO5A 3I0QA 3GU5A 3OUKA 4RIOA 2YLEA 2R2PA 4W4WA 2QO7A 5J9YA 1XH8A 3AC5A 4OTPA 4OTWA 2WIPA 4NCTA 5FBOA 3ZUVA 4RJ8A 4ZOGA 1YKRA 2XIXA 2YZAA 5AUXA 4DEDA 4ZTRA 5ETFA 5J9LA 3PVGA 2OXYA 4U7ZA 4EI4A 5LQFA 4BBFA 5BUJA 1OM1A 1APME 4RGJA 5CSVA 1YXUA 2W1HA 4QQCA 5IQDA 4MF1A 3MIAA 4LQMA 4DGOA 4EOLA 3KK8A 3QZIA 4NJ3A 4IACA 3RALA 5K4JA 4ZIMA 1XBAA 4HPTE 1GZOA 1K9AA 1M17A 3I1AA 4IFGA 2HWPA 3W8LA 1QPEA 3BHUA 2HOGA 3LXLA 3NR9A 3RMFA 3UC4A 3R7VA 1JPAA 2BIYA 2C5XA 2QLUA 3IGOA 3UO6A 2PSQA 5BUEA 2ZJWA 3EQPA 3UTOA 3ETAA 2R7IA 5AP6A 2O65A 2W4KA 1XHAA 2O64A 3FHIA 2GTNA 4PDOA 2R3NA 4R5SA 2GFCA 2X8DA 3QCXA 4R7BA 1WBNA 4I20A 5HG9A 5FDXA 2C5VA 2Y8OA 3EQCA 3ZU7A 3FPMA 2ITPA 3OP5A 3WYYA 3DQWA 3P7CA 4FT3A 2J4ZA 2BZKB 5KX8A 4FGBA 3U6IA 3DQXA 2Q83A 5M4UA 2RG6A 3C4XA 2W1IA 2GCDA 4P5ZA 4RJ7A 3QD2B 1T45A 3UDBA 4WSQA 3BYVA 1Q41A 4AT5A 4GFGA 3DFAA 4QMTA 3BU6A 3DJ6A 2JKOA 3NIZA 3TZ9A 4BDKA 3TDVA 4FSNA 2JAMA 1GIHA 4XJ0A 3DB8A 4HYIA 4LGGA 4C2VA 5AA9A 4I6FA 4USDA 2YM6A 3P23A 4GG7A 2UW9A 3QALE 4QQ5A 4JG8A 4WBOA 4NKAA 1FOTA 1L8TA 1OB3A 2VRXA 2GQRA 4AG8A 3LCKA 3B8RA 2JIVA 5K0XA 2Y4PA 3QCQA 2VTNA 1UNGA 4PDPA 3DTCA 4IWOA 4JG7A 4QMPA 3E8EA 5FM2A 5FTQA 3RM7A 3D14A 5EHOA 4JDJA 5EM8A 3V04A 4BTMA 4NEUA 4WO5A 2Z7QA 2W05A 3HUCA 3OWJA 3UNKA 1H0WA 4FKPA 1O6KA 2PE2A 4FKWA 4RVMA 4UMUA 1W83A 4MEDA 3IK3A 3R04A 5HVKA 5IG1A 2W0JA 1WZYA 2J0JA 3FZTA 1UU3A 2GNIA 4WA9A 3P86A 3MJ2A 4ZZMA 5A6NA 5BMMA 5LCJA 2H9VA 3KREA 2QODA 3F66A 3MH3A 2Y7JA 3QQLA 4EK4A
chains in the Genus database with same CATH superfamily
1PXJA 3HYHA 3TI1A 3RCDA 3MI9A 2EWAA 2H34A 3FLZA 3QRUA 4R5YA 4YJQA 3ACJA 4GT5A 3DNEA 4IJPA 5AP5A 4MWHA 3EQIA 3ANQA 1RQQA 1YDRE 3L9LA 5GZAA 3A61A 3QF9A 4O7ZA 4R1VA 1OL1A 3A99A 3JVSA 3QYZA 3PSBA 5IUHA 4JAIA 1XH9A 5L8JA 4F08A 3JS2A 3WZJA 4DC2A 4ZJVA 4Y73A 5JKGA 2R3HA 1R3CA 1VEBA 2BPMA 2I0YA 4FIEA 4TYHB 5FLFA 4ARKA 4BWPA 5E8TA 3CC6A 4D2TA 5KMNA 4PX6A 5BV3A 4P4CA 3RK7A 2JC6A 3QX2A 4FV7A 4F9YA 3AT2A 2BDFA 2HZ4A 4S34A 4UZDA 5IH5A 2YCSA 4R78A 3C0GA 4IZAA 1JKLA 2E9OA 3FQSA 3GCPA 3NUPA 4XV1A 3AC3A 1H01A 3D4QA 3G6HA 3OCGA 4O0VA 3D7TB 1E9HA 4ZZNA 4ZXTA 4I4EA 5CYIA 2F9GA 1EH4A 5LXMA 3FKOA 5CEKA 1ZOGA 2C6LA 3BU3A 3FMEA 3BL7A 2JDRA 3ZRLA 3UOJA 3O17A 4YLJA 3LW0A 1Q8ZA 3RNYA 4X2GA 5HO6A 4TKSA 5C8KA 4XP2A 5H8GA 2XM8A 4AT3A 4KIKA 1H25A 4D9TA 2PU8A 4BGGA 4C34A 3V5LA 4KKHA 3OEFX 2P3GX 3FXZA 5LMKA 3LJ2A 4L42A 3MSSA 4KBCA 4IM0A 1X8BA 1P4OA 2E9NA 5J79A 2BZHB 3QC4A 2CGUA 4KAOA 2PUNA 4L3JA 4M12A 3SXRA 2GNLA 1OI9A 3NWWA 2YAKA 5FRIA 2OF4A 1DM2A 1PXOA 4KSPA 3EYHA 4QTBA 4RC3A 3ZSHA 3KRJA 3F2AA 3R1NA 3UQGA 3U6HA 2JIUA 4ACDA 2VTQA 4W8DA 3IPHA 1HCLA 3A7FA 2C6KA 3SOAA 4QMQA 1ZY5A 2YAAA 5GIOE 4NL0A 4F99A 4KRCA 1LEWA 2Z7RA 1GZ8A 5E8WA 4DTAA 2R3KA 3NMUF 2VAGA 4DBNA 4TXCA 2JLDA 5HTIA 4I21A 4BDGA 4QTAA 1W2CA 5A9UA 4CQEA 3GXLA 3HV3A 2BRGA 3F5PA 5DHJA 3K2LA 3K3JA 4YU2A 5DGZA 1O6YA 2R3FA 4IWPA 5A6OA 4IX3A 2YCRA 4AE6A 3AMBA 5AA8A 5C1QB 1YWRA 3F2NA 5DI1A 2XBAA 2EUFB 4FNZA 2G2IA 2UZWE 5IQEA 2HZIA 5LVNA 3FDNA 4JS8A 5KBQA 4FSZA 2Y4IB 2PE1A 5CTPA 5ACKA 2LAVA 5HESA 4QTEA 3EWHA 3ZC6A 4DFYA 4E8AA 5LVOA 4D4SA 3MDYA 2I7QA 3VW6A 3JXWA 2FSMX 2RF9A 2XEZA 3Q6UA 1FPUA 5EW3A 4F0IA 4FIFA 4LMUA 1I09A 3NSZA 5I4NA 3MTFA 4C4JA 4QMWA 2RIOA 4ZLYA 1J7LA 2YEXA 1WAKA 3Q9XA 4M3QA 2YIYA 4YTCA 1PJKA 3A4OX 5EYMA 3PDTA 4QYGA 4L6QA 3P5JC 3PPKA 2V5QA 2BCJA 4C4GA 2B4SB 4X2NA 2YIQA 2J6MA 3QRTA 3RP9A 3PUFC 4FEVA 4E6QA 4QP4A 1VYZA 4FT5A 5ANIA 1YWNA 4ZY6A 3KGAA 3PZEA 3FXXA 3R9HA 5HLPA 2ITOA 4H05A 2Z7LA 4FKGA 3F61A 4RX7A 4BL1A 5A46A 2WTKB 2V62A 2FH9A 3K54A 4NTTA 2V55A 1R39A 5IF1A 4M66A 4D4VA 3T8OA 3LCDA 3Q6WA 2OJFE 5C8MA 4QYEA 1F3MC 3VUTA 4TWOA 3Q60A 3D2IA 5F4NA 3T3VA 4AW1A 4DHFA 4BCFA 2BKZA 2PVJA 5GINE 1Y6AA 2HAKA 3PJ3A 2OJGA 2QONA 3RNIA 5IDPA 4G3DA 2BZJA 3BQCA 3LM5A 5EDPA 2E9PA 1H0VA 1I44A 2IF8A 3P5KA 4PPCA 3SRVA 2BDWA 3W2OA 3NAXA 4FMQA 2DYLA 3VJOA 4BCGA 1A9UA 4IEBA 4S30A 4W4VA 3SC1A 4EYJA 2P2IA 2R3OA 3WF5A 4AGWA 4CLJA 4YHJA 5EYCA 3R8UA 4Y5HA 3QD4A 4A7CA 2NRYA 4IC8A 4D9UA 3NYNA 5TR6A 3ENHA 4XLVA 1PXMA 4UMQA 2WMTA 3KXGA 1JQHA 3QTRA 4GUEA 3RBWA 5DMZA 3GP0A 5EFQA 4J53A 5CNOA 4GSBA 4QMUA 2FO0A 3KN6A 2VWUA 3SW4A 3ZLWA 3GI3A 5ANGA 2R5TA 3IECA 4TYJA 3NNXA 4E1ZA 2ZYBA 2BRNA 3GQLA 4M14A 4TT7A 1J1BA 4Y5QA 3VS3A 2VTTA 4CXAA 5ETIA 1NT2A 1JKTA 2VWZA 2FSOX 4CFXA 4TN6A 4WNMA 1U54A 2BALA 1ERKA 2V0DA 4IAZA 4WBBB 4F9WA 2X0GA 4GW8A 2GMXA 3N9XA 4FSRA 3N4TA 4U8ZA 4U6RA 2UW3A 2WTJA 1TQPA 3HVCA 4FYNA 4FV5A 2ITNA 3UOLA 1T46A 4JBOA 2C3LA 2PZIA 2C0IA 2XIRA 3UOKA 4PPBA 3CCNA 4D0WA 4MXZA 2J0MB 3TACA 4LUEA 4EH8A 4PTCA 4IQ6A 4RWKA 3TTIA 5H2UA 4D2VA 2B9HA 4D55A 3W18A 2VGPA 5HG7A 1A06A 1CMKE 2I40A 4UYAA 4ZS0A 1UA2A 1M2PA 2QHMA 3VONA 2JBOA 3Q2JA 3PA3A 1KE5A 4AWIA 3D9VA 1Q8WA 4DH3A 5KMKA 1IR3A 2VX3A 5BVOA 3W32A 3OG7A 4LRMA 5AJQA 3AC4A 1KOBA 3HA8A 3VBXA 3MY1A 2XK8A 5AIKA 5EQPA 4BCNA 3L9NA 4MTAA 4BHZA 3ZS5A 5FDPA 3QTXA 4LGHA 5CU2A 3LLAA 4YZMA 1JOWB 3RPOA 3PXFA 1WBSA 2BAKA 1BMKA 2OWBA 2JKKA 4MXYA 3BCEA 5DT0A 1FQ1B 4ANQA 5J5SA 1VLRA 2HIWA 5D1JA 4C58A 3CGFA 3CQUA 3PRFA 4CZTA 4QMZA 3L9PA 4ZY5A 4AXEA 4FTRA 4WD5A 4O7SA 3KN5A 4W9WA 5K3YA 4H1JA 3UVPA 5GIPE 4CYIA 4EK3A 4EWHA 2XJ0A 5CAPA 5JZJA 1W98A 3FSKA 2G01A 5I0BA 2J5FA 3C5UA 4FNYA 2GQSA 4KB8A 3QTWA 4FG8A 4KRDA 5L2SA 2PVMA 2SRCA 3TCPA 5AX9A 2VGOA 4FTCA 4KBAA 4PWNA 4TYIA 5J1VA 1KE8A 4DLJA 2FSLX 4AZTA 3NVKI 2QKWB 2XRUA 4O22A 3E7OA 2B9FA 1DS5A 2UW8A 4NIFB 4MUQA 2ESMA 5EM6A 3ACKA 1W7HA 2AQXA 4IVAA 5IH6A 2BHHA 1IASA 4IM2A 4AA4A 2UZEA 2WMBA 1UU9A 2ZFYA 3QRKA 5B2MA 4O7VA 2WOUA 2PE0A 4FGRA 4YTIA 1H26A 5GJFA 1S9IA 4WKQA 3ZMMA 4DEGA 2HY81 2GS7A 4BBEA 3KRXA 4CKJA 5JGBA 3OCBA 3U9CA 4CMTA 5KMJA 2XNBA 5FTOA 4EKLA 5AV3A 3EFJA 5IPJA 1SZMA 4R7IA 3W55A 5IKWA 2X6DA 3EFLA 3VO3A 3C0HA 4ANOA 1VR2A 2PK9A 3ZZWA 2XKEA 4RX9A 3ULIA 1SVGA 3KULB 4FTLA 4IAFA 4PMTA 4GL9A 3V6RA 3PY3A 4JVGA 4YSMA 4RPVA 3OT3A 4DBXA 4YHTA 5HBHA 4AGDA 4BJJB 4AFEA 1W82A 1LR4A 4YJUA 4EH7A 2F7EE 3TNQB 4YJPA 1WVYA 4LGDA 4XRJA 4X0MA 4BDFA 1URCA 3GC0A 2WFYA 1PHKA 4XG3A 4DAWA 3PE2A 3I7BA 1Y57A 3KK9A 3WIKA 4JL9A 4KD1A 3FZ1A 3UC3A 4RFZA 4CCBA 4RZWA 3M11A 1ZMUA 3OXTA 3O23A 2Y6MA 3I7CA 3H30A 3QWJA 3OOGA 2JGZA 3ZEPA 4C3PA 4I5PA 1V0OA 3UG1A 4BI2A 4O0WA 5EG3A 3CLYA 4RWLA 2ZB1A 4OW8A 5GJDA 4TZRA 3SX9A 2J2IB 3RZFA 2WB8A 3VVHA 4HZRA 4E4NA 2OKRA 4FSUA 3RVGA 5EKNA 3C5IA 3AC8A 4LDTA 2C69A 2EXMA 1WBTA 1TQIA 2OGVA 3OCTA 3OROA 2BHEA 1XQZA 2UZTA 2OFVA 4OTFA 4OTHA 4BYJA 3MPTA 4MNEA 3RAKA 3TDWA 4IAKA 2ITYA 2YJSA 3OWLA 4NM7A 5GJGA 3ROCA 4JOAA 5HVJA 4AGUA 2CSNA 4QMLA 1OKVA 5CS6A 1OPJA 2YACA 3LIJA 3QA8A 4ANBA 3V5PA 4J98A 4IHPA 4FL3A 4FR4A 3LQ5A 3TZ8A 1OZ1A 2R3PA 2Z02A 3V5JA 3DTWA 5JQ5A 3LMIA 4K9YA 3DBDA 5H9BA 1SVEA 3W2RA 4EOIA 3OBJA 4DGNA 2B9IA 2XS0A 4RSSA 4BBMA 2PZYA 2W06A 4QP8A 5D10A 4N70A 3DXNA 1R0PA 1Q3DA 4ASDA 2X2MA 1J91A 4WOVA 4AN9A 5AX3A 5CEQA 3EN5A 3REPA 3UMXA 5K4IA 4M8TA 2OJJA 5JSMA 3TM0A 4XUFA 4DFXE 3VULA 1IA9A 4MH7A 1MRUA 3MH2A 2AC5A 2I1MA 1G8AA 4QD6A 3LM0A 1URWA 1LEZA 2REIA 4C36A 2OIDA 3FUPA 4N6YA 4PP7A 2BRHA 5HBEA 4C2WA 3RKBA 3ZM9A 3FMHA 2QI8A 4Q9SA 4X2FA 2WTCA 4I0TA 3EZRA 3FMLA 3TL8A 2UZLA 2W1FA 2IVTA 2WU7A 5HE1A 3WOWA 2H6DA 1ZZLA 3F5UA 1KE6A 3MPMA 1WMKA 1YHWA 1J7IA 4EEVA 2BR1A 4LRKA 3P7AA 4J95A 4NT4A 5DEYA 5G6VA 3TT0A 2Y9QA 2OH4A 3F9NA 4P7EA 5JRQA 4BWXA 3R28A 4G17A 3NZ0A 2VWVA 4EH2A 1KV1A 3L8SA 4FTQA 3MFTA 5IA5A 4ZSAA 3V01A 4DT8A 4D1ZA 3Q4UA 3QA0A 4R3PA 4X3JA 4O6LA 3G6GA 5TOZA 1Y6BA 3LLTA 4AQKA 2F49A 2Q0NA 3KA0A 3WZKA 3CQEA 5K5NA 3FLSA 3CSVA 4B99A 1GZNA 4QP1A 4TWPA 4NFMA 5IH4A 4KA3A 3IW8A 1FVRA 1M7QA 1YOJA 4GJ3A 3TYKA 3W0PA 4O38A 3PLAE 4FKLA 3BX5A 4FV9A 1ZYJA 5EDRA 3E87A 3NS9A 3O71A 4J71A 5EI6A 2NYAA 3C7QA 3A2CA 1U59A 5T6KA 3VS0A 3ORMA 1Y8YA 5EYDA 5I3OA 3ZHPC 4ZSEA 2RFSA 5E4HA 4PL3A 2EU9A 4XOYA 4F0GA 5EQEA 5C4LA 4JX3A 4AOIA 4IB1A 5AM7A 4BCQA 3QQHA 5TO8A 1E1XA 3AG9A 2OZAB 5EM7A 4DEAA 2BRMA 3QXPA 5IEYA 5E92A 3UMWA 5LWNA 2QOOA 3OS3A 3W8QA 2UVXA 4WG3A 4DFLA 2ETMA 1AQ1A 3ZLXA 3E62A 5JH6A 3PRIA 3V8WA 4EYMA 4HVHA 1PF8A 1W8CA 2XK6A 5E7RA 4MXCA 3GB2A 4XG4A 3FPQA 3SHEA 3COHA 1P5EA 2KTYA 2GNFA 2XK7A 5LJJA 3AC1A 5TE0A 5CT0A 3PPZA 5D41A 3RGFA 4G5JA 3CTHA 3Q04A 3S0OA 2OZAA 5EM5A 4XX9A 4ITHA 5DPVA 4C4FA 3DDPA 2F7ZE 1OKWA 2IVVA 4AQCA 4I4FA 4IJ9A 1V1KA 2Z60A 3COMA 2W1GA 3C1XA 3R2YA 5FP5A 4BCHA 3ITZA 3LJ1A 2QLQA 4FC0A 5KMIA 4I41A 2E9VA 2Y0AA 3L1SA 5I9WA 3ZOSA 4JR7A 3TN8A 1Q8TA 3PXKA 1W2FA 2R3RA 2W4OA 2WTIA 5CQUA 1BI7A 3G33A 4O4BB 4V0GA 3SAYA 1M2QA 2X4ZA 1FINA 2A0CX 2CPKE 3NIEA 4CNHA 5L2TA 2X81A 3KIOC 4EK5A 5FXQA 4XV9A 2W4JA 4AGCA 4ASEA 4PMPA 4I93A 3F3WA 4F9AA 2ITUA 3BHTA 3COKA 2JDTA 4OTDA 5CT7A 3ZO1A 5KNJA 4HNIA 4ID7A 4F1TA 5BUIA 4MYGA 2XK4A 2GNHA 4Y83A 3ORPA 5AR2A 3GQIA 3GFWA 4FTJA 5HD7A 4D2PA 3ML1A 3ZO3A 4F6UA 3W0MA 4CG8A 5KE0A 2YCQA 5CANA 3OFMA 5C4KA 2EXEA 3I5ZA 3KQ7A 4L52A 3ZRMA 5JFVA 4C37A 3OOMA 3NPCA 2VTIA 4FTUA 3BI6A 3HMOA 4BYIA 3I60A 3P4KA 4RA5A 4ZTLA 5I9VA 1BL6A 3F82A 2W5HA 4ENYA 2PHKA 5FWKK 5AM6A 4PF4A 3NYXA 4C59A 2A1AB 5FXSA 2ERZE 3UVRA 3K5VA 3DGKA 4PNIA 3CBLA 5DEWA 4XEYA 4BWKA 2XYNA 2B7AA 2JITA 2OK1A 3QQKA 4GK4A 2ZV2A 3BE9A 4XV3A 3ATSA 3Q2MA 1G5SA 2GS6A 3DDQA 4O0SA 4FKIA 4USFA 5AP3A 4C4EA 5HZNA 1DI9A 4NU1A 3RPRA 1R0EA 3P78A 4HGLA 4NKSA 3UNZA 2RFNA 3EFWA 4BI1A 3C51A 4EBWA 1BLXA 4PP9A 3SKCA 4AXFA 2C0TA 3CD8A 1KSWA 1Z57A 4OTIA 4YZNA 3EN9A 1PMVA 5FEEA 3VBQA 2IVUA 3VUHA 1S9JA 3B2TA 4MD8E 1XO2B 4JAJA 5HE2A 3KEXA 3WF6A 4DG3E 5KKRB 4OAUC 4P90A 1Q97A 4JIAA 4AA0A 2JDVA 4A9UA 4NUSA 4RA4A 3Q9YA 5HE0A 5A4LA 4FIJA 4I0SA 2J0IA 4W4YA 4YC6A 2IJMA 4LI5A 1FBNA 2GPHA 4TYGA 1K3AA 3OXZA 4IVDA 4L53A 4CG9A 3R8PA 5E1EA 3ZLSA 3Q96A 5A4EA 1E1VA 2XNOA 5I5ZA 1OUKA 4KIOA 4RFYA 3KF4A 3FZPA 4F9BA 5AAGA 1UKIA 3TUDA 1UWHA 1UKHA 4AW2A 5HNGA 3GCSA 3OY1A 1VJYA 4X21A 1IEPA 2DWBA 4BI0A 4EH5A 4PUZA 3MFSA 2C4GA 4LMNA 2CCHA 3NUSA 1UNLA 5TF9A 4FV3A 3DV3A 3ZRKA 3UE4A 4B7TA 3FL5A 5L8LA 3DNDA 3KMMA 4X3FB 3VHEA 2CKQA 2WQEA 5DT4A 2JBPA 2G1TA 2B1PA 4HCVA 4HGTA 2QNJA 1XR1A 2CGXA 4ASZA 4IX4A 4OBPA 1NY3A 2VU3A 5ITAA 3FEGA 4YJVA 3KF7A 3G0FA 4C61A 4U5JA 4APPA 1KUTA 4ZS4A 3KRWA 5BVKA 2XALA 2W9FB 3GU8A 2GSFA 4EOMA 5A4QA 4C8BA 5KHWA 3B2WA 1MRYA 4L7FA 5TT7A 4EQMA 4ZP5A 4J8MA 5DR2A 4QMMA 3TXOA 3E92A 3W0OA 4AX8A 2UVZA 1YVJA 3BLRA 3D5WA 1YDSE 3PTGA 4XG9A 1Q3WA 4JDIA 4L01A 4DFZE 4ACMA 2ACXA 3RWQA 3E3PA 2H8HA 3LFBA 4MXOA 2CLXA 2YIRA 4O96A 4PV0A 5E91A 3OZ6A 3UZTA 3O50A 5E1SA 3BBTB 5CEPA 2WZJA 2YM5A 4CGAA 4BJJA 3IKAA 1UVRA 5AR3A 2BVAA 2FGIA 4YP8A 3DKFA 4XHKB 3TJCA 3SGCA 3W2QA 4G3FA 3R6XA 1QPJA 4W8EA 1A48A 2XKCA 5IA1A 4ZMFA 2IWIA 2XNGA 3UP7A 2OXXA 2OG8A 4GFMA 3Q53A 4D2RA 5IQHA 1J7UA 3DJ7A 1YI3A 4UALA 2CGWA 4CFVA 3WYXA 5GHVA 4ORKA 4WSYA 2O2UA 5AEPA 3TNPC 3HECA 3NNVA 4GIHA 3LMHA 2VTLA 2YWPA 3A7GA 4QYYA 4U79A 4DGGA 4E5AX 4EOQA 2HXLA 2VWXA 4U0IA 4JG6A 4FICA 3TMOA 5G1XA 5ICPA 5FBNC 2WKMA 3FY0A 3F3UA 3OEZA 4BDEA 1MQ4A 2R3LA 3O2MA 3MH0A 3V51A 3Q9WA 5ACBC 3M42A 1H1RA 3DLSA 3MTLA 3BWFA 2ZM3A 4GIIA 4QEBA 4BTKA 3GEQA 3N4UA 4GMYA 4CSVA 3FE3A 4DEEA 1WBPA 4AN3A 4M7IA 2C6TA 3UDSA 2WHBA 4I6BA 2XA4A 4IBMA 4NZWB 4O0XA 5HCYA 4ACGA 4HVDA 1OBGA 3PFYA 1Q8YA 4RLKA 3F6XA 5HIDA 4F7LA 4O86A 2QOHA 3QXOA 1H08A 2I0HA 3BYOA 1U46A 3PIXA 4RC2A 3D5XA 2YABA 2VO0A 4C35A 3PG3A 5CSPA 4FV8A 4F7JA 5JFWA 3OW3A 3GU4A 5CVFA 3E8DA 5AWMA 4AZSA 2XEYA 3ZSIA 1PKGA 5H8BA 4O4CA 4BFMA 5IA3A 3IW5A 2CLQA 3DJ5A 4OT5A 4NM3A 5HIEA 5J7HA 4BICA 2QOIA 5DIAA 4DG0E 1TZDA 4FVRA 3U54A 4BCKA 3FMKA 3HUBA 1CM8A 4BTJA 4AUAA 5IMXA 4TTHB 2OZOA 4WRSA 4IMYA 4XOZA 4I0RA 5BPYA 4F64A 1YQJA 1IG1A 4G9CA 3BYUA 3BIZA 2JIIA 1M7NA 1PXLA 3RHXA 4D28A 2HY0A 2VWYA 1SVHA 4BDJA 4CZYB 2CCIA 2O5KA 3PXQA 2RFEA 4FTIA 4L43A 3COIA 3ZXZA 2ZMDA 1U5QA 3IOPA 3VRZA 4O0TA 4CTBA 3RK9A 4DH8A 4R6VA 4G5PA 3WBLA 4FSTA 3G9LX 3QQGA 4ALUA 5L6OA 1UNHA 1MRVA 3CGOA 4DDIA 2OH0E 5AUUA 2IVSA 3IDPA 2EB2A 3OMVA 1ZYLA 3BHHA 2PVHA 5AR8A 1JSUA 3U55A 5ANDA 1G8SA 2XH5A 1JKSA 4CD0A 2QOQA 4HPUE 3VNTA 4PY1A 3EQDA 4FUYA 2QOCA 2WTWA 5FQDC 4JI9A 4MAOA 4OTRA 4EHVA 4MF0A 4YR8A 3FLYA 5H3QA 3PJ8A 4LV7A 5BVWA 3R7OA 5AUZA 3VIDA 5CI6A 3ZCLA 4XBUA 5BVEA 5LWMA 3WF9A 5CVHA 1YXTA 4IFCA 5AP4A 1CKPA 3FI8A 1OITA 2BMCA 5ETCA 3VN9A 2PUPA 3Q5IA 5M4CA 3R7EA 4M84A 3RZBA 3WZEA 4FODA 1QPDA 2X7OA 4G9RA 4RJ3A 2W5AA 4C62A 4IW0A 1QMZA 3POZA 5JT2A 4BIEA 4O7YA 3Q3BA 4QOXA 3CXWA 4QMXA 2WMUA 2B54A 3MJ1A 4FYOA 4QP6A 4RIYB 5A4TA 4R1YA 2B52A 3LFQA 3QTSA 3TV6A 4RX8A 3P9JA 2BFYA 1CKIA 2IW6A 1WVXA 4TWNA 3PXYA 4GVJA 2G2FA 4QQJA 4KIQA 3KVXA 3N51A 4OBQA 3VS6A 5EW9A 4ASXA 3IDCA 4J7BA 5CF8A 2X2KA 3CEKA 3G9NA 3I6WA 4FKUA 3R30A 4A9TA 5T3QA 4BIDA 4CCUA 3DXPA 5KZ0A 3O7LB 4OR5A 1STCE 2W99B 2PVKA 3PFQA 4HVSA 4O4DA 2C3KA 4QYHA 3F3ZA 1DAWA 3SOCA 2WU6A 3FLNC 1J1CA 4RVTA 3AT3A 5CALA 4FV1A 4EUUA 4TW9A 4FEQA 4K18A 4PQNA 2VO3A 3D94A 2G2HA 4H3BA 3FHRA 3ENMA 3E88A 4N0SA 2WIHA 5L2IA 3FLQA 4EZ3A 4TPTA 2RSVA 4K77A 2X1NA 2ITXA 2J90A 2YM7A 3LCOA 2C6EA 2IG7A 5DR9A 1ST4A 2X8EA 2C1BA 2BIKB 3FXWA 4QP3A 3DPKA 5HKMA 5IU2A 1PXNA 1IA8A 2VX1A 3MFRA 3VQHA 4O7NA 3PVBA 3CE3A 4BDBA 1KE9A 4IWQA 1YOLA 3C9WA 3AD6A 3F7ZA 3FI3A 2WXVA 3QX4A 3EN6A 5DOSA 4UBAA 3QTZA 5DNRA 2P4IA 4X2KA 3ZYAA 3LHJA 2HZ0A 4OUCA 2R3IA 4BCOA 1H24A 4ZLZA 1ZWSA 3HV5A 3BZ3A 1OPLA 4ALVA 2Z2WA 4QTDA 2VTAA 3U9NA 2XNEA 3HX4A 4FSYA 3KRRA 3OD6X 1HOWA 4TYEA 3QYWA 2ITZA 3MIYA 3PWDA 4GS6A 4D4YA 2KULA 4M68A 3F5XA 3BQRA 3QTQA 1KE7A 1OKYA 3BEGA 3ERKA 3ZH8A 4HGEA 4RRVA 5KUPA 3EOCA 3ORZA 4UEUA 4K1BA 2QKRA 4XRLA 4JX7A 4MXAA 4J99A 4QTCA 4CEGA 5HORA 3MB6A 3LQ3A 5E8SA 2OXDA 4C33A 4L44A 5AADA 4EC8A 4QDVA 3OTUA 4WRGA 3F5GA 5CSHA 3ZSGA 3QGWA 5L6WL 5DVRA 3LZBA 5EK7A 4I1ZA 4O0YA 3AD4A 4A4LA 3A7JA 3FYJX 3ZO2A 3LVPA 3S3IA 2BDJA 3L8VA 2VTJA 3AMAA 4UWCA 5IA2A 1PYEA 2IZSA 3D2KA 3NCZA 4YBJA 1F5QA 2ZB0A 5HO8A 2BZIB 3FC1X 3IO7A 3BU5A 3D0EA 2OW3A 4DFBA 4USEA 2OBJA 5A54A 3CPBA 3DLZA 3KY2A 3H4JA 4M0YA 4K8AA 4ANLA 3VWAA 4WT6A 1YWVA 3FMMA 4MBJA 2Y4IC 4GT4A 2ONLA 4GKHA 3DK7A 1G3NA 2R0IA 4LV5A 4O7WA 3A62A 4EQUA 1OKZA 3QHRA 3RCJA 3ET7A 5AP0A 3AKKA 4IH8A 4FKJA 4EHEA 3PVUA 3NW5A 4G16A 5I9YA 2C6IA 2OJ9A 4FKTA 5JMSA 3S00A 4UZHA 4FX3A 4HOKA 5F9EA 3R8LA 4F4PA 4BZOA 2GS2A 4YNOA 4FZ6A 2OF2A 3DBCA 5F95A 4ZJJA 2VTSA 3P08A 3KMWA 3ZLYA 4L45A 3UYSA 4B6LA 4FSWA 3ZBXA 4E73A 4BDAA 5IQGA 2GNJA 5CEMA 4CT2A 3PE1A 2CGVA 3FBVA 3OC1A 3PJ2A 4XV2A 4O21A 4MBLA 2VUWA 2XKFA 2QO9A 4QT1A 3IW6A 4V01A 3ZFYA 4C3FA 3HL7A 3C13A 2QURA 2PZRA 3T3UA 3NFGB 5ANJA 2UZVA 4D58A 4FIGA 1MUOA 2UW6A 3DBEA 3KU2A 4UY9A 1CTPE 3RAIA 3NNUA 3VRYA 2X6EA 4BN1A 5KMMA 3QLGA 4M69A 4YUQA 4G6LA 4ZK5A 5B2KA 5KHXA 1R78A 4I6QA 4Z55A 5CAVA 5BYYA 4M67A 4ZAUA 4L7SA 5EH0A 2HZNA 2PVFA 5HBJA 4D5HA 1YRPA 4BCJA 3AD5A 4RT7A 3U4WA 2AUHA 3UVQA 4FEUA 3MVHA 4RG0A 3FMNA 4HYUA 3L9MA 4IZ7A 3S4QA 4DN5A 3CQWA 5LMKC 4I6HA 2WMSA 4ACCA 4GCJA 1H1SA 5BQ0A 3G5DA 3NUUA 4JLCA 3QCSA 1RJBA 3I81A 3MH1A 5GNKA 3OBGA 2PL0A 5F1ZA 2UZDA 3R73A 4BDCA 5AV4A 4PMMA 3O5AA 4DEIA 3FQHA 4CRSA 5C9CA 3NFFB 4OT6A 2XCHA 3ROYA 2OSCA 1YI4A 4UB7A 3ATTA 4FA2A 3QD0A 3DAKA 5F94A 5DYJA 4IXPA 4RQVA 3OWPA 5AAEA 5EOBA 3H9RA 3V5QA 4JQEA 5HX8A 1OUYA 3QKKA 3RTPA 2RGPA 3KCKA 5JEBA 2PVRA 4JBVA 4F70A 4P2KA 3R9OA 4L3PA 5BVFA 4Q5EA 2GNGA 3FZOA 2G15A 1WBWA 3RPVA 5FG8A 2W5BA 3R7YA 3EKNA 3GBZA 2P55A 4FF8A 4JBPA 2QQ7A 3DA6A 3VS4A 4DITA 5I9UA 3NGAA 5EYKA 4LOPA 2FSTX 3V8TA 2PVNA 4FG7A 1WBOA 4TNBA 4E5WA