4I0AA

Structure of the mutant catabolite gene activator protein v132a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKAGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0aA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0aA01
1QGPA 4JK1X 4LG0A 3LAPA 3NRVA 1L3JA 4QMAA 2W85A 3F8BA 4A0YA 4E70A 3U11A 1X3UA 4KFCA 1DPUA 1J3RA 4LK1F 1TNSA 3GYHX 4HVQA 4LFUA 1YW9A 3QOPA 3MYXA 3ABUA 3RPUA 3EETA 2DU9A 5JR3A 4UXAA 3GF2A 1G4DA 3LZZA 2HFHA 2H0VA 3BWGA 3NSTA 1IXCA 2VBXA 4Y17A 1E2XA 1FP1D 3JAMK 2M30A 4FT8A 4XFAA 3HTSB 3W6KB 3K69A 3SZTA 2K86A 1IRFA 4K8FA 4HYEA 4RGXA 3SCFA 3OF1A 2MLGA 1OYYA 2PMHA 2IPQX 1CGPA 3GX4X 1LVAA 3VOEA 3AAFA 4ZYGA 1W5TA 2I45A 5HS9A 2A3SA 4L2NA 3SMHA 4YIFA 1TLHB 4MGZE 3E97A 2O8QA 1G6NA 2JTVA 1ON1A 2KJCA 1YLFA 3T0YA 1FBUA 3LWFA 2QVSB 3DFGA 1UCRA 3IRQA 2DCTA 4U0WA 1U78A 1Z9CA 3KLOA 2E9QA 4EMSA 1SD5A 4ZYHA 3GVAA 4LB5A 5HVQC 4AD9A 1YFWA 1ZG5A 4J1WA 4A0ZA 3WU1B 4AVBA 2D40A 3IRRA 2DAOA 5KBFA 2FE3A 1RIOH 3K1NA 2Q0AA 4BH9A 4HX8A 2UXXA 3SHFA 4M71A 1U5TA 3BROA 2Q2EA 3RKXA 3LA7A 1J2XA 4IXAA 5AONA 4IEUA 4HVRA 1EH8A 2UWMA 1CAWA 2RDPA 4LJZF 4FX4A 1R58A 3UKNA 2CQKA 2NYXA 2IXKA 5BY5A 1CAVB 2XV4S 4GXOA 4DINB 2R3SA 4WZCA 3B02A 4I09A 2WTEA 3JW4A 5DUKA 3RI4A 4OINF 3BPXA 3BZ6A 1W7PD 4OMZA 5J6XA 3V8KA 5IT9Z 1ZHFA 2XIGA 4HQMA 4XFFA 4IEWA 3TO6A 4HLTA 2DTRA 3EYYA 1JUHA 4KUMA 4HSLA 1LB2A 1Z6TA 2TDXA 3HRUA 1R22A 1H9GA 2IRFG 1VR3A 1FX7A 4IEYA 2EAAA 2W57A 6PAXA 2EFWA 5EFUA 3FMQA 2F5FA 1EY2A 1I6XA 2Q8KA 1FPQA 2W84A 2QNKA 2STWA 3JTGA 4KWJA 1RNLA 3OV8A 1YS6A 3ZDSA 2QZ8A 2GH2A 3OD0A 4IRHA 1ZZ6A 4HF0A 2RNJA 4ENNA 4DNCA 3WTVC 2HDCA 1QZYA 2XL7A 4F7ZA 2A69F 1H0MA 3ES1A 4KICA 1B9NA 4EROA 5FQ0B 2P5LC 3MWMA 3L00A 4RAZA 4IEVA 4R79A 3IKTA 1ULYA 4Q0PA 4ZU7A 2PG4A 3QACA 4LTAA 4N9HA 1BOAA 1KGSA 2QQ9A 4DQ2A 3M7GA 1USSA 1P4AA 1NXMA 2PMUA 4GYIA 1IN5A 3WTUC 1W7PB 4NQWA 4B8XA 4BYYA 3CL1A 5E8IA 1FBQA 1IW7F 5C8WA 2VE9A 2HR3A 2QENA 1XCVA 5D6FA 4H7LA 2ETHA 5J8CA 2F5EA 4N0BA 3KZYA 2HJIA 5FLXZ 1SFXA 4IEOA 2FSWA 5KHIA 2M8EA 3HRMA 5IT3A 1DZRA 4G6DA 4O5VA 3GFLA 1MD0A 5FFZA 1X82A 2G7UA 4BQAA 4IPAA 1DP7P 3WE2A 4TV7A 3LA3A 1CF7B 4MHGA 3OTFA 3U9GA 4M6YA 3BPVA 3CUQA 3CUQB 1S7AA 4N9IA 2G9WA 3T1BA 3EO6A 3E6CC 3BU7A 3DN7A 2FEZA 3C3VA 4FAHA 1R23A 3RZZA 1I1SA 5CVVA 3FXRA 1R1UA 2EWNA 4CDGA 5F1RA 4B29A 2MH9A 2IT0A 4FAGA 3I54A 3T8TA 2D5FA 1NHAA 5LHHA 5E1RA 3VODA 3IWZA 4HF2A 2VC1A 1ZZBA 2WFPA 2VOPA 1L0OC 3PNAA 1UW8A 3HRTA 4XFCA 5D8LB 2BNOA 2K0GA 1Z1DA 4XF4A 2V1XA 3PQJA 1Q5OA 3E5UA 4MGIE 1LQ1A 1TQMA 1YLLA 2UXNA 3ZMTA 4YFNF 4J1XA 2GAUA 2E7XA 3JAMZ 1UHWA 1T39A 2HWVA 2ACJA 3WTWC 1EP0A 5AVPA 1HQCA 5IT9K 5FLHA 5BQTA 5ILVA 4EV0A 1R5GA 3LSTA 1FYMA 5BOXA 4Z07A 5I8SA 4L9VA 4UNOA 3IC7A 4A2UA 4WWCA 3ECOA 1XMKA 1Y3TA 4G9YA 4UVCA 5LBQA 2PN6A 3SXYA 4JV4A 1DZTA 4OIPF 3ZN1A 1H9TA 4META 1IXSB 2GC1A 2VQAA 4S04A 4IERA 3WTXC 3JTHA 2EB7A 5DEQA 4XF9A 3CEWA 3FM5A 4MNUA 4IVNA 3FX3A 3O2PE 4EM2A 2DT5A 2B0LA 2BBYA 3BCWA 1U2WA 1FLIA 3H3ZA 1QZZA 4WXDA 3LOIA 4JTNA 3PFIA 1S7OA 5I91A 5L3EA 1U12A 1ZZ7A 4P5OA 1KYZA 3LA2A 3KE2A 4JVAA 1IZ1A 1O3SA 4B09A 2QQBA 1I27A 3IDBB 4WX9A 1PDNC 4AIJA 2RV8A 1HW5A 5KVRA 3KEQA 1OKRA 2FMLA 1UFMA 1YW8A 1GHCA 1ZRRA 4LULA 1FZPB 5I8TA 4AQ2A 3D0JA 1ZG1A 2FXAA 3RTRA 3LWCA 3V7SA 1W4MA 2YX7A 4ENJA 1UIKA 3HOTA 2MPFA 1XE8A 2PEXA 5DUIA 5ICEA 3K1PA 2WC2A 5K5OA 3GWZA 1OR7A 2VBYA 1Q43A 2XHKA 4FHTA 3R0JA 1B6AA 2CAVA 5K5QA 3ACLA 5FLJA 3V4GA 2Q0OA 3JSPA 5HLGA 3RDIA 1UHMA 2P7CB 4YYOA 5K5RA 2XLFA 2HTJA 1CAUA 1RZ4A 5L3DA 3D82A 2EA2A 3M8EA 3G3ZA 2XLAA 1YG2A 2FRHA 3M70A 4FBFA 2RN7A 2QDRA 1WI9A 2VT2A 1RGSA 3IIAA 3CF6E 3J80Z 1ZAOA 2GXBA 4Q0UA 1ON2A 2UYBA 3GBFA 4G7OF 3HT2A 4NB5A 2OBPA 1D8JA 1OYIA 3NW4A 2XUBA 2BNNA 1GVJA 1V70A 3L2HA 1KQ8A 1BJAA 1HKQA 4A6EA 5KHKA 3RIRA 3ZMSA 4MZUA 5K8SA 3VHRA 3BB6A 3TO7A 1MDMB 2K7LA 1MDMA 2H6CA 3EYIA 2JPCA 2LSOA 2H09A 4XLNF 1CAXA 4IF4A 5I93A 3WW1A 1P2FA 3E3VA 4A5NA 3L9FA 2C0ZA 4KU8A 1Y9QA 2CG4A 2JRTA 3IBMA 3J7AO 1XMAA 4IESA 3HUGA 4HZFA 1NZCA 3IDCB 2ZO4A 3DKWA 5E8GA 2WV0A 5C6CA 1WLTA 3GYDA 2VC0A 4L0ZB 4YG2F 1IAWA 1SEFA 3CJNA 2EV5A 2H94A 3R60A 1J58A 3MEXA 3NJZA 4YNIA 3F6VA 2D1HA 5D5XB 3LAGA 4P9GA 4EGYA 1QBJA 5D4SA 3ES4A 2GC3A 2DPDA 3EJKA 2ZMEB 2KIMA 2CWEA 3BJ6A 4WXHA 3BJAA 2D1VA 2DQRA 4EM1A 2OQGA 3J81Z 3QAHA 4EM0B 3Q9SA 3R61A 3NL1A 3E6BA 2M45A 2ZKLA 1ODDA 3Q9VA 3H1MA 2HGCA 1HXDA 3BDDA 1ZVFA 4BAYA 2FBIA 1J75A 3GEZA 1PUEE 3I7DA 2PAKA 4KA4A 5LRSA 3F23A 2DFIA 4CYDA 5TJJA 4EJWA 1MJBA 1S8NA 3WTYC 2L01A 3C1DA 1SMTA 5BS6A 1QNTA 1DPRA 2Y48A 4U88A 3RYRA 4JBAA 4X6QB 2ZCWA 4GCVA 1CAVA 4HX4A 2CO5A 1J3PA 4L18B 3V7RA 4HSJA 5E20A 3D5LA 3CLPA 3CUQC 3COAC 2C6YA 4GYGA 1XGOA 5CADA 4YSFA 2BNMA 1T2KA 2PA7A 2PTMA 5D5UB 2GA2A 3RJPA 2ESHA 3EDPA 4Q5SF 4M9ZA 2DQLA 1Z6RA 4KMUX 5LGUA 1O5LA 1NE6A 2ZFWA 4LEJA 1WGPA 2O6GE 1ZYRF 4G7HF 5BMZA 1QWRA 2COMA 2OA4A 2E1NA 4QXKA 1TTYA 3NKTA 5A2QZ 3FJSA 4XETA 1LR5A 3HSEA 1ZZ9A 2VXZA 4LD5A 2IA1A 2ZXJA 4A6DA 3LQQA 3DL3A 5H20A 2XAFA 1K6OA 2HYGD 2XAQA 4CICA 5K1YA 2QCSB 3C3WA 3P9KA 1JXSA 2IW5A 2K4JA 4IRGA 1R1VA 2FF4A 2IXLA 2Q4SA 4P9UA 1FSHA 5CVRA 5JR7B 4O3MA 3SCHA 5JFRA 2Y0OA 3K0LA 1IF1A 2W24A 4KIFA 2IXJA 2ISYA 3RYPA 5TRDA 1RC6A 4ZH4F 4HN0A 1P92A 3K9TA 3DV8A 4UBHA 3I59A 3I59B 1TQIA 2FQPA 4UVBA 1GQGA 4HBNA 1IRGA 1F9NA 1BI3A 3GFJA 4WK8F 2M1BA 3E6DA 2V79A 1W7PA 2PFBA 2L4AA 1MZBA 2JT1A 4YFKF 4MTEA 2CFXA 3G73A 3FXUA 2PQ8A 4EVIA 2A6HF 4WF2A 4G8XA 4CZZA 3QRFF 1G3YA 1WWXA 2ISZA 4Y13A 1DGRA 1T98A 2V1DA 1ZN2A 1HW2A 4IRIA 1YQAA 5BXXA 2RC4A 5LHIA 1WRJA 1T0FA 2JSCA 2Z5UA 3KGZA 1V3FA 3DF8A 1Q1HA 4I0AA 1OI6A 2ZBKA 1K78A 1P4XA 2D2WA 2X0LA 4IHSA 1YUDA 1EPZA 4UXNA 2DW4A 4WCGA 2LF8A 3I64A 3KP5A 1J7KA 4PCQA 5CVIA 2IA0A 2XGXA 1XDSA 2DO7A 2A68F 3IHUA 2BGCA 3WW3A 2KIFA 1C0WA 5L3CA 2EFQA 3BY6A 4IEXA 1QPMA 3CTAA 5LGNA 2UY9A 1Y0UA 5FDBA 3REOA 5CYVA 3EQEA 3C18A 3RYKA 3BPZA 3V8LA 5J7MA 4XFHA 3H8UA 2L54A 4AVCA 3GZ6A 4L5IA 4LMYA 3TDUC 2O1QA 2PHDA 1OPCA 2PFWA 1D3YA 1A04A 4CO8A 3KP2A 5LEKA 1FY7A 3FMSA 3T5XA 1QXRA 3IWFA 5ICFA 5FGMA 4M72A 5LEJA 3GXOA 2BYVE 3FMRA 3ISPA 1TW3A 4EJTA 2ZMEA 1S3JA 3KP4A 1PMIA 3TOBA 3MPBA 2NAZA 1F4KA 4S05A 4GGGA 4RD7A 5LRRA 2DLLA 2JZYA 4KWKA 2YSRA 4EGZA 3PQKA 1ZNPA 1K79A 3RPQA 1YYVA 1Z91A 2VOOA 2O61A 4QGMA 1KU2A 2L4MA 5D1IA 4Q4ZF 4U7BA 2IXHA 3H7YA 4I02A 4R1HA 4HLXA 1KA8A 2XROA 1YO5C 1LKNA 4ZYDA 3HYIA 5DYMA 2L02A 3VFZA 1JHFA 2XASA 3LAJA 4K2EA 3HRSA 3SZPA 4MTDA 2IVMA 2M5WA 5A2QK 3OGJA 4O9GA 2FNAA 1SD7A 3BALA 5J3UA 2YR2A 2QJVA 3F8CA 3SQNA 4HLYA 2YU3A 5DCMA 3CDHA 1YHFA 2FMYA 1IN6A 4KWLA 3HSRA 3TO9A 1XE7A 3KFWX 5HLHA 2FBKA 4XF1A 1XGSA 3WTTC 2Z9OA 4NVPA 4M6XA 4RGUA 1ZGJA 5BV6A 1JGSA 1SD4A 5DD4A 2CV6A 2PQQA 5JSOA 3NQOA 1BIAA 1ZH5A 3MQ0A 4HQEA 3VEPA 1B59A 4YARA 1TW2A 2EJRA 4G94A 1D8KA 4LGWA 2HKOA 3MDPA 2EFNA 5HS8A 2Q1ZB 1X7NA 4KYWA 1K7AA 4UV9A 5CLSA 1V4RA 3CO6C 5D5WB 4JTOA 1I1GA 4BHBA 4MEYF 1EH6A 3GW2A 1O4TA 1LDJA 2A5YB 2D93A 2F4PA 5F64A 1ZRCA 4I3PA 4LG0B 3TQNA 3HIFA 1J9IA 2EV6A 4HV6A 3F8MA 4XF0A 2IC1A 4E2QA 3OOPA 3DEUA 2OPKA 4IJAA 3WG9A 2MLKA 1FYLA 3GUDA 1U8RA 2VT3A 1BI1A 3BOQA 3R4KA 1J5YA 4L0YB 4H0EA 3TNQA 2KXLA 1FBSA 3KLNA 4JQFA 4LLOA 1UB9A 2PHLA 2QWWA 3V8JA 3KP6A 2Z2SB 2MC3A 2VN2A 4YIIA 1O3TA 4HVOA 3OCPA 4CXFA 3ELNA 3O6BB 3K1MA 3N97A 2LNBA 3ZQ7A 4WXCA 3P9IA 4MQ9F 1ZZ8A 4RAYA 4ZU4A 3GZ5A 3WTSC 4OU0A 3SXWA 1OYWA 3IL2A 1KU7A 4L5JA 1NE4A 2XKPA 2RKHA 1KU9A 4Z2YA 4HN1A 2ET7A 2OQRA 5L3GA 3CO7C 1VP6A 4EJUA 3DPTA 4ZU5A 2EA7A 4MGKE 2ZNYA 5HOOA 3ZP5A 2BE5F 2K02A 1ZX5A 4YRDA 5D5VB 1ZRDA 1W5SA 2OD5A 5FPXA 5ICGA 3ECHA 3HHHA 2O8XA 1LEBA 4IHTA 1B4AA 2GQQA 3JSOA 1RL3A 3HOSA 1IN7A 4RB2C 5DDGA 2V9VA 2IP2A 1QY4A 4IEZA 1KU3A 1YFYA 1GXPA 4NHJA 1U5TB 1J59A 4E2SA 2GXGA 1LJ9A 3D0SA 3U2RA 4UHTA 1X8EA 3MZHA 1FSEA 2EFPA 2FBHA 2FOKA 2HZTA 2FA5A 2IXIA 5JSRA 3QP6A 1HKSA 5J8FA 5I8YA 2Z69A 5I0UA 1Z05A 4M9SA 4ZZLA 1XN7A 5BPIA 2BV6A 3DP7A 3RKYA 1CAXB 4QGNA 5ERIA 4D7TA 3J80K 4KMFA 3EHKA 1JE8A 4IEQA 1VJ2A 2A07F 1TQ5A 3LFKA 3KP3A 4HF1A 4I01A 4QWQA 3I58A 2IA2A 1F5TA 5JHUA 1ZZCA 1FC3A 2MBFA 2V09A 1ZLJA 4L11A 4QLCU 3WGGA 3RNSA 1YW7A 1S6LA 3H3UA 5JAXA 3PVBB 2O3FA 5L3FA 4X6RB 4ZZDA 4MV2A 4KNYA 2LF7A 5FO5A 2IJLA 5D6EA 1R7JA 1IUYA 5EEHA 1AOYA 4HOBA 2MD5A 1YFUA 4QM9A 5ILSA 1R00A 1T6SA 4XSZF 2QM3A 3HHGA 3U1DA 1FXZA 4A0XA 5BUVA 2H6BA 4ON0A 4PDKA 1Z7UA 5LHGA 5FD5A 4AWXB 4QX5A 4AVAA 3U0ZA 2M87A 4EWDA 2H27A 1QQIA 3ZPLA 4QM8A 2Z33A 5D4RA 4Q47A 3M1EA 2K4BA 1BM9A 1FI2A 1HBXG 3FHZA 2NNYA 3EQLF 2RQPA 2FQ3A 1FYKA 3TNPB 2QLZA 2GIVA 2OZ6A 1GQHA 4O9EA 4LUMA 5FQ0A 4ASNA 2MA3A 3P9CA 4Y15A 3PLQA 2UYAA 5KHGA 4PGHA 5JSPA 2ESNA 3CO2A 1U6GA 3KP7A 1UIJA 2OZUA 3GLXA 3L7WA 3S2WA 4AIKA 4F8AA 4GO1A 5DCMB 2RGVA 5BPXA 2BEOA 2B8MA 3V7CA 5CVUA 1RI7A 1O3RA 3WGHA 3HQXA 2IXCA 1MGTA 1R1TA 2GWRA 1MKMA 5HS7A 3WU0A 1KQ9A 1E17A 5ILUA 4G7ZF 2FNPA 5ICCA 2EVXA 5F6FA 3HSFA 1HSJA 3KETA 4XFIA 3WW2A 2P8TA 4P96A 4Z82A 4Q48A 3FHIB 2Q30A 5HI0A 1WQ2A 1BC7C 4BHPA 2CSOA 4AVPA 3DPLC 1DGWA 1IPKA 5BPDA 2NNNA 3Q5FA 3USSA 1I5ZA 4KN4X 3S0MA 1IN4A 2NRAC 2VE8A 2XAGA 1D5VA 2ADUA 1O3QA 1TBXA 3FFQA 3QU6A 4M74A 2HTSA 4U0VA 2QBYB 2OA2A 2P17A 4LB6B 1J0RA 2STTA 4UBGA 3H1YA 3FZ3A 1RTVA 3I5UA 4XF3A 3S7IA 2XKOA 3I53A 2VPVA 5AIQA 3M9AA 2EK5A 3WODF 2Y0MA 1NYWA 1USTA 2K9ZA 2B5HA 3WW4A 4RGSA 4LK0F 4OMYA 5HDGA 3F6OA 1EYBA 2AXLA 2J5PA 3SCGA 3E6MA 4HDUA 2V6CA 1FP2A 2XL9A 1YTYA 5D8KB 4WVZA 1FOKA 1WSUA 3O14A 4Q0VA 1B9MA 3QPTA 5FD6A 2EFOA 1QXJA 1VTNC 2GU9A 3GFIA 4RS8A 1H1MA 2L3DA 2PJPA 4GULA 4PIXA 3UKTA 4Q29A 1PP7U 1BN5A 4EJVA 2J5OA 5E17F 4XSXF 5I0SA 3UKVA 5FLIA 3M8FA 4RB3C 2XVCA 1BI0A 4AIHA 4HMZA 4L9TA 5J48A 3DQVC 3WTZA 1REPC 4Q0QA 3KMHA 3ETQA 4P9FA 4D7SA 4AQ6A 2MH2A 5DD8A 3H92A 4XRFA 2P6SA 4IETA 2XLGA 4OIOF 2DK8A 2EV0A 1S29A 3TOAA 5KHJA 5CU1A 3LQRA 1U3EM 2ZKZA 4OFGA 4KL1A 4ESFA 5E1XA 2UZKA 4QGLA 1QO0D 3TKYA 3FXQA 4I0BA 4ESBA 4XFBA 2PBIA 1WKMA 5CVJA 4CHUA 2P6TA 3F3XA 1SD6A 2B9UA 1XSDA 5ED4A 2FU4A 1LEAA 2KJBA 4EQQA 3HTUA 3M3IA 3FZVA 5T3NA 4LLNA 1SQ4A 5FFXA 4UV8A 3MCZA 2YX4A 2ET1A 1MJ9A 2A6EF 2W25A 4TLFA 2QQAA 3F22A 2PLYA 2XRNA 1RUOA 2V1UA 1J1LA 2DK5A 2QYOA 1BI2A 3ML6A 1YFHA 2NS0A 4ESJA 1ONVA 4I7HA 4KIBA 5DV5A 4ETSA 4OIRF 5FLXK 1YWKA 3QP5A 4MGYE 2HEOA 1TNTA 3BJOA 3F72A 4PIZA 2DPUA 5JCTA 3KCCA 2G7HA 3FWEA 5DCFA 4A12A 2OU2A 4M73A 5FPZA 4BXUA 2HOEA 1R5HA 2X4HA 5E16A 4AXOA 4MUVA 2UY8A 2ATFA 3S7EA 4KIGA 2P7VB 3L2CA 5AIPA 1BC8C 1P6RA 1ZGAA 1CAUB 3I0TA 3F21A 2HS5A 2MHFA 4HX7A 2F2EA 4FX0A 2VECA 2D45A 3CJXA 3E5XA 5CJ9A 2KRFA 4U0YA 1G3SA 4BIFA 1YS7A 3GO5A 5EZWA 2PAMA 4PGGA 4PZJA 2R7DA 4BHCA 3C7JA 1IPJA 4XEZA 4A5MA 1JHHA 1X8MA 3NEUA 3ROUA 5HDKA 1ZRFA 2HKXA 3SFZA 4KU7A 1ZLKA 3I4PA 2VODA 1OD5A 1IN8A 1Q3EA 4R8HA 1UD1A 4KDPA 3GFMA 3I71A 5H6QA 2GA1A 4LLLA 2XAJA 2PAEA 2XAHA 1J3QA 5HDNA 4LUKA 1XGMA 5H6RA 4BNCA 5FB2A 1BBYA 2Y75A 3O3KA 4MQVA 1U5TC 3HT1A 1DUXC 2VBWA 3WE3A 3FF5A 1GXQA 1O5UA 2QUFA 1DDNA 4R52A 3JZVA 1SFUA 4HBLA 2GZWA 4RB1A 2E7WA 3ZMVA 3P7NA 4HW0A 2YPRA 3T8RA 2DI3A 2ZJ2A 3QPHA 3L09A 5LLQA 1XSXA 1PP8F 1G3WA 1ZARA 4P55A 3ZMDA 4ORFA 2F5DA 4UVAA 1YFXA 2OZJA 3J81K 4XLPF 4WBBA 3TGNA 3G7DA 3KSCA 2KKOA 3R6SA 1KYWA 3MFKA 5I0TA 5LGTA 3H50A 4EWAA 4Q0SA 3N4MA 4MEXF 2N7GA 1RUNA 3ZMUA 3QU3A 3ZMZA 4OIQF 5KHHA 4E2GA 3KGLA 4KT5C 4L9JA 2D5HA 3KEOA 1F1ZA 4M9XA 4MX3A 1LDDA 2CGPA 1WA4A 2JPBA 3ERED 1FT9A 1T38A 2AS5F 1O57A 5HLIA 3ZN0A 2GC0A 2HQNA 4LA2A 1XD7A 1B1BA 2DBBA 4YFXF 4LA3A 1IXRC 4OLLA 2RVCA 1CF7A 2EA4A 1MJAA 3U10A 1SMYF 3ABTA 3W6JB 1ZREA 3TDZC 3IKVA 1OFNA 5E1ZB 4HA8A 4ZYEA 3CUOA 1EH7A 1STZA 1SFNA 2GC2A 3F8FA 3R0AA 1UCXA 4KN7X 3E5QA 1K78B 1R36A 4HV5A 3EBRA 1H1IA 4ENMA 2VONA 1XGNA 3KZZA 1CAWB 3MZYA 2Z3YA 2HQRA 4MH0E 1L3LA 1O7LA 5JVTA 1SFEA 2ETEA 1LRHA 4ENKA 2K27A 3K2ZA 5E18F 4HDVA 1YIOA 4IEPA 2O0YA 3NVCA 2MNGA 2R7FA 2LKPA 3BP8A 1XDUA 3B73A 1UPIA 5L3BA 3H9AA 2CW0F 3H7JA 1FNNA 3SHRA 4XFGA 3MAJA 1TQPA 1LDKB 4G6QA 4PIYA 1FWZA 1PM7A 2A61A 1HKTA 2PYTA 4XBFA 1P4WA 1CX4A 3ULQB 4EJOA 1XSVA 1G3TA 2ZNZA 3CLOA 2LDUA 2CAUA 3EUHA 4RB0A 2ELHA 2F5CA 1LNWA 1OMIA 2Z99A 4D0PA 4I2OA 3WGIA 4O6JA 4UUVA 3H1WA 4ONUA 2QBYA 1XCBA 4HAMA 5KK1A 4EWEA 5JI6A 1HSTA 2CYYA 4PJYA 2VBZA 1SAXA 2P5VA 2P4WA 5I0RA 3DXJF 3ST7A 2E1CA 2P5KA 5EEGA 2KIUA 2HYFA 1HW1A 1ZG3A 5E1WA 3FE5A 2OYZA 1KQ0A 2QVOA 4U7DA 5FCCA 2O03A 3ELKA 1BIBA 2WWYA 1EV7A 1AWCA 2PI0A 4RGRA 3FM3A 3RKWA 3VB2A 1XRUA 4I98B 4LLGF 4OOIA 4L9NA 1XB4A 3F8NA 4CGZA 2OAZA 4MGRA 1O7FA
chains in the Genus database with same CATH superfamily
1QGPA 5FXVA 3H9QA 2UU8A 3HOYJ 1QZEA 3NRVA 4QMAA 1GP5A 1V0AA 5A3WA 4KFCA 2DOEA 2ZSHB 2R30A 1DPUA 4Y20B 4LK1F 1TNSA 3GYHX 5F7UA 4BJ0A 4QPGB 1YW9A 3VYUB 4CUGA 2W87A 3MYXA 4OVEA 4CVUA 5DN2A 1W3XA 3BQZA 3LGRA 3EETA 1YCIA 4UXAA 3LZZA 1CPNA 1FOD2 3BWGA 4IO9F 1YI2I 1FTTA 2NP0A 1NK2P 3PIGA 3K3OA 5FP9A 5FMCA 1WBLA 2K86A 3UETA 4NHMA 4C91A 5GZGA 3VDBA 4Q4X3 1QJFA 3C2BA 4YVWA 2RDNA 2WADA 1OYYA 1V55H 3VOEA 1ODMA 3TB0A 4ZYGA 1AU7A 2A3SA 2R7TA 4C2MJ 3SMHA 2CH0A 1MQTB 4M3GA 4YIFA 1ENQA 2EILH 2KJCA 4XUQA 1V54H 4HT1T 5EDNA 1VF9A 1OCCH 1COV3 1Q8VA 4FOQA 3FXMA 2DBNA 4LB5A 2ZX3A 3B9IA 1ZG5A 4A3CJ 2PLV2 5EYXA 3WU1B 3IRRA 5KBFA 2FE3A 2ZABA 2RM21 3K1NA 5LK7B 1ENHA 4CPBD 4HX8A 2MGQA 3SHFA 3HBKA 2XQXA 2FDGA 2DYCA 4IXAA 2WWSA 4CH7A 4IEUA 4CDUB 2Y8KA 4ZJZA 3AC0A 3I3EA 4LJZF 1OURA 3DTIA 4IHWA 2CQKA 1VBD2 5KR7A 4DINB 3I3QA 4WZCA 4I09A 4N8MA 1CZVA 5DUXA 3RI4A 3MLKA 3BZ6A 4NOTA 1W7PD 3QH6A 4B47A 2Y6KA 2VBBA 3UGFA 4FFFA 3GZUC 3ZIXA 3JUUA 5FYVA 4HSLA 4Y3OA 4XRSG 3IN9A 4WZFA 2TDXA 3HRUA 3W2VA 1VR3A 2D6OX 1UWWA 2W57A 6PAXA 5CEHA 2EAKA 3KPHA 2E26A 2LFBA 1GV5A 2F5FA 3POYA 3H5AA 1I6XA 4E6KG 3GTLJ 1V5FA 1VE0A 4XHBA 2QCOA 4RS5C 3VBOB 1RNLA 3OV8A 1YIJI 4JGYC 3VKMA 5E3LA 1HOMA 1W6MB 2A6ZA 5GAGJ 4LBMA 5JLWA 3K10A 2CQNA 3OD0A 2GNBA 2WFF2 2HDCA 4OHWA 2XL7A 3K6GA 3VBUB 3ES1A 2XXZA 1B9NA 1OJLA 4EROA 3BTAA 2AQEA 2HDWA 2KA3A 1OFCX 2ZZQA 3IKTA 3AG1H 4ZU7A 5AFBA 2PG4A 3AG4H 4N9HA 4UFIA 2NVTJ 1SLBA 1O8PA 3AZXA 1R1ZA 1XPWA 5CIRA 1RUE2 3MD2A 1W7PB 4MHUA 3CL1A 2DTWA 2KIQA 2O7OA 2QENA 1DYOA 5JPNB 2FDKA 5D6FA 2ETHA 4XLFA 5J8CA 4N0BA 4RMNA 2WA0A 1W0TA 3ZXLA 1BJQA 4L5EA 2EXJA 3HRMA 1DZRA 2BY3A 4G6DA 4O5VA 1OQ1A 2ZSIB 1XQNA 2RS31 3DF0A 1GKBA 1GUIA 2G7UA 1X9TA 4MXWA 3WE2A 3LA3A 1DBNA 5E79C 5DZEA 3BR6A 3M1HA 4M6YA 3BPVA 2ZACA 4F83A 2G9WA 3DN7A 3VBHB 4NE9A 2WAAA 3C3VA 4YEJA 4RQPC 4P9XA 4IE0A 4XJ8A 3K75B 4FAGA 3T8TA 2HPIA 3F9KA 2JA2A 5LHHA 2VZOA 3VODA 1TME2 3IWZA 3WG7H 2VC1A 1ZBE2 2DDAA 2WFPA 5FMOS 3ZYJB 5FYHA 1AXZA 1L0OC 3PURA 4XFCA 1MIJA 5IFPA 4A6OA 2P37A 4JQRA 3ACGA 3K7AJ 2DDBA 2VVFA 2LROA 4XK4A 5FKLA 1Q5OA 3E5UA 5CFCC 3ZMTA 3CMEI 4B4QA 2JICA 4CCEA 4CCDA 3BOWA 2VZQA 4DEVA 2HWVA 2VZ1A 1JODA 1ULEA 3OD4A 3DXTA 2D6MA 2E2HJ 1OISA 4YZ4A 2K9MA 5BQTA 2XJPA 1NCQC 4EV0A 4FPJA 3HC7A 3IC7A 3ZQGA 4ES9A 2XPUA 3ZXDA 4A45A 1IZ3A 5FYUA 3T3YA 1A6IA 2PN6A 3SXYA 2GSYA 2VUAA 4META 3L2WA 4E7IA 4NRQA 3IKWA 4AI1A 5CB7A 1KITA 3JRFA 5DEQA 1JYTA 3FM5A 1RINA 5IOZA 2XWJB 2CY6A 3VD9A 1W8HA 4CXWA 1IV6A 1RUD1 2DT5A 3BCWA 2BBYA 1GZ9A 1XU2A 1JT0A 1U2WA 2JE8A 1QZZA 3LOIA 1W0UA 4LIVA 2BW8A 3J7NA 1S7OA 2DCKA 5L3EA 3ZMOA 2QBXA 4P5OA 4COVA 4I76A 3OYAA 3WR0A 2XQRA 3VUOA 4OI0A 4LBKA 1KYZA 3B01A 2QQBA 1I27A 3OYGA 2NM1A 2K85A 4AIJA 2FZ1A 2RV8A 1HW5A 1LVKA 4QX1A 3PL8A 5J4VA 3ZIWA 2I5UA 4XLAA 4RS5B 5FMOL 4N43B 5I8TA 1HQWA 2GMMA 3Q8EA 1W06A 3WDUA 4GAZA 1HDPA 4C0BA 2FOWA 4PQ9A 1MNMC 1UIKA 3S14J 2V7FA 2DU1A 2BVLA 5K4LA 2JWTA 1I3AA 2Y30A 5J37A 2WC2A 4D69A 4EN6B 1HRI3 2HEYF 1GWLA 3OUJA 2XHKA 4FHTA 4DUXA 4JCKA 1W2UA 1K42A 5CKTA 5K5RA 4MFDA 2HTJA 5LD2C 2CV1A 3D82A 2QQ8A 2XJRA 2R7WA 2F48A 3G3ZA 1YG2A 3M3EA 3M70A 4FBFA 2WA3A 3AFHA 2QDRA 1WI9A 2VT2A 3NNLA 5FLVA 2VTXA 3CF6E 4KI5M 2JE9A 2H8RA 3J80Z 4Q0UA 1XG1A 2WABA 2VQHA 4AFDA 4FTSA 5BNOC 4G7OF 1U9OA 2OX0A 3NV1A 2IS6A 2YGMA 1GVJA 2XPWA 1W04A 1V70A 2DFEA 2HVRA 5EGOB 5EGOA 5A3NA 3ZMSA 2JDAA 4XJWA 3KX2A 3KF3A 3EYIA 2LSOA 1WLCA 4XLNF 4ISRA 1TZOA 1WCDJ 5I93A 3L9FA 2JRTA 3J7AO 4FOYA 3HUGA 1ZR4A 3IDCB 2ZO4A 1L7QA 5C6CA 3AK0A 5A7WA 2P34A 4AEDB 1ASJ3 4FE4A 1OOPC 2BZDA 2W0XA 4QWNA 4XLEA 2OT7A 2CV0A 2JDUA 1PNFA 1J58A 3CJIA 3ZO0B 3CJIB 3NJZA 3F6VA 3HJRA 5D5XB 3F2ZA 4P9GA 4QKDA 3L2UA 1ST8A 1UMQA 1S2KA 3NNMA 4O7XA 4LXLA 2BY0A 5A6XA 5JXHA 3JRIA 3J81Z 4QB6A 4P02B 2J22A 4IQPA 3VDAA 2H0BA 3E6BA 2ZKLA 1ODDA 3H1MA 2PLV3 2HGCA 3BZKA 3ZSLA 4IXLA 3LF7A 2ARXA 1Z7LA 2BW3B 5LRSA 3HNMA 4HRIA 4CYDA 1MJBA 4YW6A 1WJCA 4XILA 2DU0A 3RG0A 1QNTA 2Y48A 4U88A 2G0EA 1XNCA 4HL0A 2P81A 2NVQJ 1CAVA 1RUD2 5E20A 5T5JA 2O5RA 1T2XA 4GYGA 1XGOA 4FISA 3M4FA 5CA6A 2UWBA 1T2KA 2PTMA 1B35A 1RVF1 2ESHA 5LA1A 4WV8A 3EDPA 5KC6A 1Z6RA 4L0PA 2J1UA 4Z8BA 1IS5A 2F17A 4A6SA 4LEJA 4D5CA 1CPMA 2O6GE 1ZYRF 1Z0XA 4UB8C 2E1NA 4QXKA 5JI9A 5A2QZ 3OUIA 4B4CA 4Q1RA 2Y6GA 4K40A 4BJTA 2QUOA 3VBRA 2ZXJA 4A6DA 3W21A 3MVPA 5H20A 4QKNA 3T4VA 2HYGD 2A70A 1VBA1 5K1YA 2O0OA 1AL0G 3NKGA 2IW5A 1S0FA 5IP7J 1R1VA 2IXLA 4BACA 5HBAA 4O3MA 2CWSA 1VBC3 1EUUA 1GWMA 1SVMA 5TRDA 2ZKNA 4XDOA 2OTJI 2LM3A 1P92A 2VMCA 4MFEA 1UZVA 1AUYA 1PVC3 2DCZA 3DV8A 4XDPA 3I59A 4WM8A 5GPAA 2UV1A 5IVJA 4UVBA 2P0WA 2W1WA 4HBNA 2RDRA 1BI3A 1BJZA 3GFJA 1AJKA 1HKDA 3IV5A 1GLNA 3Q0UA 3IDAA 3VPRA 1QOSA 5TSWA 1OKQA 4AGVA 2ZX1A 1W7PA 4R9AA 2E5ZA 4IQJA 1GYKA 1NX9A 2O8KA 1X1CA 4AC0A 4ES8A 2L9NA 3M4OJ 4KGGA 3W5MA 2PQ8A 4XOGA 1PK6C 4CZZA 1DF0A 1AL23 4DXTA 4XBQA 4XQDA 1F2NA 4IHYA 3LEKA 4Y13A 1DGRA 4CUBA 3OIOA 1ZN2A 1ZA7A 1F9KA 1W5CC 2E7QA 1YQAA 1WRJA 1T0FA 2YU2A 3PL0A 1W8OA 4LHNA 3KGZA 4I0AA 2JN6A 2HWE2 2D44A 4FTHA 3BTJA 3OPTA 3H35A 1YUDA 4ZKTB 4WCGA 1GICA 2C1FA 3IH2A 2Z5WA 1RUE3 3I64A 5FY8A 2WB1N 3OY8A 3ZCOA 3KP5A 3C2GA 5JLVA 2DO7A 3AMNA 2IGNA 3T09A 2BGCA 3S15J 1JJ6C 1AR63 4IEXA 2HYJA 2UY9A 3NAPA 2WSVA 1GUUA 5CYVA 3A0BC 3C18A 3RYKA 3V8LA 3ZXGA 3T2OA 3I3DA 4XFHA 4AI0A 4LO4B 4A42A 5FUPA 3GZ6A 1M4WA 3HNYM 1OPCA 1DGRN 4XXAA 4A3BJ 3HOZJ 2PMZA 1R6RA 1WJFA 5FFOC 4XHXA 2C6SA 2B9VA 3PTYA 5FGMA 3GTOJ 3U1KA 3FMRA 4KH9A 1LFPA 2ZMEA 1S3JA 2Y6LA 2YDEA 1OQDA 1CR7A 1V9U1 4S05A 1WCSA 4RD7A 1X1AA 2E2JJ 4EGZA 3JB4C 3OSDA 5F27A 4XN3A 5B4XA 3GHNA 5C44J 2L4MA 2OIIA 3J7YJ 5SV5A 5HCBA 2B7EA 2QKMB 3ON7A 1MH3A 2KRCA 2VXRA 1FTZA 1ERDA 4CDXA 5C5UA 2MG4A 2B39A 3HYIA 3MGUA 3BR3A 2R7EB 4XJZA 2BDRA 1BL0A 2Z4FA 3VFZA 3J7AY 5L9VA 4K2EA 3WXPA 3OGJA 2M5WA 5ANQA 3ZFGC 1MMAA 3VKOA 3R4DB 2HZDA 3N7KA 4KBZA 3F8CA 1V6NA 5DCMA 1KDKA 5LY1A 3BR0A 4AM3A 2N8GA 5F5AA 4KWLA 3HSRA 3QYEA 3AMQA 3KFWX 2Z79A 2ZHMA 4NVPA 1JGSA 5JZGB 3UGGA 2COBA 1ZA4A 5DD4A 1I50J 2NVXJ 3DXUA 4ZC3A 4HQEA 1XBFA 1S4CA 1X3WB 1B59A 2EJRA 3CF2A 4LGWA 1YRNA 3VLBB 3VDDB 1XX5A 1KD7A 1VMHA 3GDBA 1BHGA 5F04A 5FZLA 1J1TA 4AWDA 5A70A 2AXTC 1R081 1O4TA 4XCBA 4K8RB 4F3JA 1ORKA 4EEFG 3ZYRA 2F4PA 4JX5A 2A3YA 3APBA 1MS8A 4HV6A 4XF0A 1LOCA 4GA9A 2IC1A 4DY3A 3RSNA 5L9RA 5HNFA 5EG0A 2XJVA 2ZEZA 2TBVA 3THCA 3QWLA 1BI1A 3BOQA 4RL7A 3WG4A 4H0EA 4A3GJ 1OCRH 4DZGA 5E3OA 2PHLA 3A01A 2K40A 1F35A 3JBG2 4ATEA 2MC3A 4YIIA 1O3TA 3N05A 2JEMA 1YX5A 4GIQA 4ISQA 3ELNA 3N9MA 3K1MA 4FPGA 2WAQA 3USUB 5JMCA 2KHMA 3ZQ7A 4Y26A 1D7PM 3MKWB 3P9IA 3MKZA 1AR73 3HOVJ 1FMD3 2XBO2 4J19A 3GNEA 4DO0A 3SEEA 3IL2A 1KU7A 5A7SA 4JRAA 4P9WA 5D8AA 5DAWA 4HN1A 2OQRA 5F0HA 3LSGA 4YGEA 5EJCA 1UZWA 2HOTA 3DPTA 5H9SA 3WDYA 3ZP5A 5D5VB 1ZRDA 1W5SA 5ICGA 2QQVA 3LQCA 5J1XA 1RL3A 3DEWA 5DMYA 1JKOC 2IP2A 1QY4A 1KU3A 5JUVA 1YFYA 4CU8A 2GXGA 4LOSA 3KQRA 3D0SA 4GJYA 4XMIA 1FIAA 2Y0IA 1VFCA 1OKOA 1X8EA 2EFPA 5T5PA 2DMPA 2HZTA 2IXIA 1HKSA 5J8FA 4Y52J 2Y34A 5I8YA 1SFOJ 2Q8EA 3BYWA 2HNHA 5BPIA 2BV6A 3WDTA 1I5PA 1HN0A 1WJ5A 4ASLA 4KMFA 2DDUA 2KT0A 1IOAA 3KP3A 3FISA 1N3QA 2D6KA 3UGHA 4LBQA 1PO12 1MPXA 3Q0WA 1F5TA 4PF5A 3CCSI 1P8JA 4RQPA 4N43C 1ZZCA 4PDWA 2JIJA 4KITB 2BTVC 1QJEA 4YM0A 5IYCJ 4XR6A 3AP9A 1K5MB 4URAA 1PZ7A 2EZHA 2DUPA 1G2HA 4J25A 2VJJA 2L0KA 5BNOA 4KNYA 2LF7A 1R7JA 5EEHA 3I3MA 2MD5A 1YFUA 4O61A 4R4XA 4QM9A 5ILSA 3B94A 4AVTA 1UKRA 4KT6A 4UFHA 3DU5A 3K4BA 4LJHA 3GTQJ 1S9HA 2CQXA 4H2AA 3SDGA 1YIPA 2H27A 1P7IA 1QQIA 2FCUA 4QM8A 4Q47A 1ZK8A 2LBFB 4F92B 1FI2A 3FHZA 3IP4B 1PVXA 3HZJA 1FYKA 2NQYA 2LKSA 1XYOA 5EYRA 3NJVA 1D5YA 3UYJA 3V42A 2MA3A 1TVGA 1MMDA 5KHGA 1LUJB 4BJ5C 3FDYA 3AZYA 1UU4A 4NC6A 1LKXA 2M4GA 3KP7A 1F4HA 3PUHA 4CDQA 2DCEA 4GO1A 5M5YJ 5CVUA 3Q8CA 3I56I 5GLUA 2DMUA 3WGHA 3HQXA 4OI4A 1R1TA 3POJA 1RUI1 3H0DA 2A1XA 2GWRA 3WU0A 1KQ9A 4AHYA 2BGOA 4BIOA 1R49A 1XYNA 1RUI2 4YELA 2EVXA 4JGZA 3WW2A 4QKFA 3FHIB 2QQPA 1NCRA 5HI0A 1WQ2A 3KEYA 1O91A 5JIAA 2PHXA 1BC7C 4BQ4A 2YUSA 2CSOA 3DPLC 1LEDA 1DGWA 1MSEC 1RR7A 2A6VA 3D8CA 1DP0A 2PLV1 4Y5SA 5BPDA 2NNNA 2JVHA 3SJMA 1QJX1 3CBNA 2VVEA 3GZAA 2VE8A 2XAGA 2NRAC 1D5VA 5IVVA 1N78A 2GNMA 2YU9J 1Y1WJ 3RZHA 2HTSA 3S17J 2QBYB 4CP9A 2XR4A 5JXIA 4XVHA 4NC7A 3H1YA 3GBGA 4FFGA 4GJZA 2V9PA 3AP4A 2LTNA 3ZSEA 3S7IA 4ZS2A 2XKOA 1K3IA 3I53A 3M9AA 1QQP3 1D1BA 1UYYA 3H5RA 2VQCA 4LK0F 4C2UA 3WP6A 3JRGA 1Y0NA 2I10A 3I8TA 1L7LA 1FP2A 4JHZA 2XJTA 1VALA 5HV4A 3QPTA 1KXGA 2EFOA 5A1AA 4DRRA 3WNPA 2HWB3 1QJX3 1QJY1 3VL8A 5FLIA 4G6TB 1BI0A 2WKKA 4L9TA 2DA2A 5ANNA 3WTZA 5FKBA 1DLCA 3ETQA 1LOEA 4HK8A 3HN3A 4D7SA 2J1AA 2WWUA 4AQ6A 4QTRA 5IK5A 1IDYA 1OA3A 2JK3A 2DUQA 3WF3A 4NPLA 2ZPXA 5JLXA 2VTFA 3G6JB 2VQGA 4FI9A 3AXDA 4OI1A 1OXCA 2DK8A 3C7HA 3A22A 1JBCA 1S29A 5KHJA 1U3EM 1K4TA 2RS11 4QQLA 4V2WA 1F36A 4OFGA 2IGMA 4KL1A 1JS9A 2ZMEC 2UZKA 1QO0D 1XC6A 4UT5A 5FZAA 4HNTA 2WSUA 2I07B 4A3ZA 4XFBA 2PBIA 1WKMA 1PVC2 3L2RA 4HONA 2BBVA 1SD6A 1T95A 4XLHA 1XSDA 1B35B 2UWCA 3ZVXA 3CCQI 3RVHA 1LEAA 1LJ7A 2DJIA 3A2KA 3PU3A 1V6KA 4QPIA 5FOJB 3CDZB 1HXS2 2WR9A 1RHI2 5T3NA 3AM2A 1NA1C 1UZ0A 1SQ4A 5A33B 2DT7B 4NJ4A 1S55A 3VBHC 2YX4A 3WNMA 2W25A 2XGDA 4TLFA 2H8WA 5CKMA 5F6KA 3IAM2 3F22A 3KYDB 1AL21 4MG2A 4ESJA 1ONVA 5TGTA 3QP5A 2AUYA 2X9DA 3LB9A 1NY72 5JCTA 3LNQA 4MOAA 1POGA 1A5JA 2QSHX 2WO2A 3FWEA 3B6AA 3CC2I 3OL3A 5HCAA 1MBFA 4N4NB 4MUVA 4CE8A 2UY8A 5EIYB 3RS6A 4CEWA 5CFDB 3L2CA 4C0HA 1BC8C 4PJJA 1ZGAA 2ZGTA 5FZ1A 1NG7A 4HX7A 1POV1 4K3UA 1LE8B 2W9XA 1TME1 3WQ1A 3GZTB 3OY9A 5J4YA 4BIFA 4IV1C 1LAJA 4JGYA 3KCXA 1R9TJ 4PZJA 2R7DA 4Q8KA 5IYBJ 4XEZA 3B6CA 1ETWA 1SLIA 3NEUA 1UY3A 1GNZA 2HKXA 1VIWB 3SFZA 4DB5A 2TEPA 4GH4A 1PMJX 1PJRA 3K4MA 2AH2A 5D8AB 1OD5A 4UUSA 4R8HA 2JG9A 1UD1A 4KDPA 3WNXA 4X0GA 3CJTB 5LA0A 2BOJA 2G1MA 2X1DA 4OMCA 4LUKA 3WD5A 3CKHA 2VKHA 5FB2A 1BBYA 2Y75A 1SPPB 3O3KA 3AG2H 1DUXC 2VBWA 2MYSA 1OT5A 2HWC2 5JOWA 2ORXA 2QUFA 4XKWA 1SFUA 2GZWA 4HW0A 3MI8A 2DI3A 3H8RA 4GFBA 2ZJ2A 2K9LA 4HNVA 3ZXEA 3L09A 5LLQA 3CQOA 1G3WA 4AOCA 2OUMA 1QOOA 4MGSA 4AHXA 1WCUA 1MS1A 2X5IC 5C3QA 4UVAA 3AJZA 2ZXWH 2CUZA 3TEYA 3ASNH 4LO6B 3G7DA 3KSCA 3VBFC 4BEHB 1KYWA 1X1DA 2OQ6A 1PGSA 4B8EA 3GF6A 3MLJA 4EWAA 4Q0SA 2DTZA 3N4MA 1N75A 2CW7A 2QQKA 3ZMUA 2WBMA 1HRV1 4BY7J 4EYUA 1STMA 5KHHA 2ELJA 3KGLA 4FPHA 4KT5C 2D5HA 1F1ZA 1GFF2 2VW1A 1CX1A 2HBUA 4OHXA 3H0OA 2VMGA 1NLRA 2W7NA 1C8NA 3ZFEC 2HQNA 2V9KA 1QJU2 5B1BH 3HVDA 2GOXB 5IUQA 1R083 3ZXFA 3S5QA 4Q4Y1 5FWJA 2EA4A 5J36A 2M8GX 1X1BA 3ABTA 1K6YA 1X58A 4CPBA 2D6PA 1W9FA 4ZYEA 4HA8A 3CUOA 3A02A 1STZA 4D9JA 3F8FA 1R1A2 1SFPA 3I2JA 4CYCB 4LBQB 4HV5A 2VQLA 3U21A 2PXJA 4RM2A 4ENMA 1ITYA 4BLJA 4RQPB 2LG4A 1EAH3 2RJLA 2XHNA 2I74A 1QQP2 4MH0E 5IY5H 4RDUA 1W03A 4CCCA 1RRJA 1RMU1 4SLIA 1W2AX 3WHTA 1LRHA 4XZUG 4FPEA 3AZZA 3NVCA 3ZX7A 1W6OB 4YW5A 3N36A 1W6OA 3BP8A 3G1MA 4NAMA 2VG9A 4Q4Y3 4QPIB 2XF7A 4AU7A 3SHRA 2ZXQA 4XFGA 4KQ7A 5FZ0A 3MAJA 3A03A 1LDKB 1QU0A 3HDDA 3WY6A 1CX4A 2LC2A 1XSVA 2CAUA 4RB0A 2ELHA 2NVYJ 3RQIA 1FAYA 1LNWA 1D0GA 2BVBA 4IE5A 4NWWA 1Z67A 4ZTJA 2VKEA 1XCBA 5KK1A 4Q4V1 2WS93 1HSTA 4DEQA 2VBZA 1G9DA 2P4WA 2X5IA 4EJRA 1CWPA 5ABJA 5EEGA 1CZTA 1T08B 1ZG3A 5E1WA 3FE5A 3MIDA 2QVOA 5CAZA 1JYCA 4U7DA 5EYYA 2R061 5L7OB 1AR72 3ELKA 1AR83 1M06G 1QHHD 1AWCA 2DCYA 2HBTA 3DBLB 1XRUA 4OOIA 4IW3A 3CF5F 4N7IA 1BQPA 1DIWA 1JYVA 2VO5A 1PUFA 1H8TA 4RM3A 4FETA 4JK1X 4LG0A 2VAUA 3LAPA 3VYRB 2ZMKA 4NRPA 1L3JA 4BLIA 2EIDA 3AVRA 4E70A 3U11A 4FP3A 1JXNA 2LYCA 4I3GA 3DKYA 3K3NA 4LPLA 4B48A 1P7JA 1REFA 3LE0A 3QOPA 4CU9A 2E1MB 1ULCA 5JR3A 2ZGLA 2R7XA 1OCPA 3GF2A 2OF7A 5FZ7A 1IXCA 5C4WA 4BE1A 2PHUA 3AYDA 1TWFJ 3W6KB 2DA6A 1IRFA 2ES3A 3ZKUA 4K8FA 4RGXA 2W1SA 4B3AA 3SCFA 3DU6A 3OF1A 2PMHA 3PMSA 2IPQX 1CGPA 5JMOA 3BTXA 1HRV2 1QHGA 2F5VA 3QYFA 2I45A 2JWPA 1BR2A 1VAVA 1EA3A 4M3EA 4XNFA 4N4OB 4KISA 2QVSB 3DFGA 1UCRA 3IRQA 1O4ZA 2DCTA 5DABA 1QJU1 1OOPA 2E9QA 5F5CA 4XJUA 4EMSA 3GVAA 1AKHB 3IH3A 2JRMA 2VMIA 1YFWA 2EALA 3VKNA 3AP7A 4LBLA 4N53C 3ZRGA 2DAOA 1MBKA 3GMEA 1RIOH 3C8XA 1R1A1 4R4ZA 4AF9A 1Z3XA 4J01A 4CZCA 2VXDA 1S0GA 1U5TA 3BROA 2Q2EA 3RKXA 2QKLB 2ADEA 3AL5A 2X1CA 1QH6A 1V6LA 5CQGA 4HVRA 4HK9A 2FD5A 1QQP1 1CAWA 2DF7A 2RDPA 4FX4A 3UKNA 2X1EA 3H36A 2NYXA 3MIEA 5BY5A 2XV4S 1RIRA 1WKYA 2R3SA 2VQ0A 1GV2A 1H2KA 4QPQA 1OPOA 2CW8A 3MICA 4OINF 3BPXA 4CDWC 2B46X 1MNEA 1YEWA 1OLME 1ZHFA 2HVSA 5DPNA 3U07A 2M34A 3TO6A 3EYYA 2K9SA 1CZSA 4NPRA 4LHSA 4M00A 4H4KC 1LB2A 1LOGA 2P1BA 1JZ2A 3ZN5A 5J40A 3ZSMA 4IEYA 3Q0VA 1LTEA 4ASKA 4UFLA 4RAFA 1YQCA 1UG2A 4SBVA 3OYNA 4E9KA 1W8TA 5FXWA 3R4SA 4BWOA 4FPYA 5EPAA 2ZA9A 3VD3A 1N1SA 4K7JA 2VY0A 3ZN4A 2STWA 2PJRB 3JTGA 5F08A 1NG6A 1K12A 2R0FA 3ZDSA 1YX3A 2GH2A 3OYIA 3L2QA 2DVBA 2RS33 1JYNA 1HB3A 4DQAA 3RI8A 4IRHA 1ZZ6A 2RNJA 1AHSA 1DGWX 1H4HA 3G1OA 2HVQA 4F7ZA 2A69F 4E8CA 2UURA 4ZTFA 3AFGA 5FZKA 2P5LC 3MWMA 4OAZA 4RAZA 3ZOBA 2BOLA 1ULYA 3A4CA 1DG6A 1Y9GA 1BBT3 1IQDC 1DZQA 1USSA 3HBZA 4YVSC 4KNCA 2YXSA 1LGNA 5E89A 1XCVA 3KZYA 2XUMA 4OYUA 4IEOA 2FSWA 3IUOA 2FZ2A 2M7BA 3VBFA 2M8EA 1LCLA 2E35A 3GFLA 1MD0A 5FP7A 4COYA 4LQRA 2E5NA 3OTFA 3CUQB 2DVGA 1VBA2 3T1BA 1AYN3 1R082 3BU7A 5IVCA 1ETOA 1DQ5A 2C9AA 4EE2A 4DMIA 1I1SA 1R1UA 5FZEA 4B29A 1BBT1 3HL2A 2IT0A 3UKGA 3I54A 2D5FA 1GOHA 3S57A 4MGQA 1ZZBA 1XNDA 1S0CA 2WZEA 3O1UA 1UW8A 1TWAJ 4BCUA 2VOXA 3PM1A 5D8LB 5BNNC 4QHOA 3BIWE 3NAPC 1ACCA 1G8XA 1YITI 4XF4A 4QB1A 3PQJA 3X29B 2XJSA 2GH8A 4JDOA 3WT3A 3KT7A 1ZBE3 1FV3A 2W48A 1W2OA 1OUSA 1TQMA 2QSGX 4YFNF 4J1XA 1ZKGA 3ORJA 2GAUA 2L7KA 2E7XA 3CCRI 2LOOA 3JAMZ 2DODA 3AL6A 2WQZC 2ACJA 4FOWA 4XORA 3AB0A 4W6XA 2VL8A 1BCXA 5IFTA 3NNGA 3LSJA 1MBEA 1HQCA 5FLHA 4CCOA 4PF1A 3LSTA 4Z07A 4L9VA 2DFBA 4XXPA 4OUEA 1XMKA 3WNLA 3KWVA 4G9YA 2CWMA 3CC7I 4GWMA 4JV4A 3VHPA 1RUJ3 4P9LA 2JKXA 3KV5A 3ZXJA 3ME2A 3HJEA 4GKXA 3CDIA 2VQAA 4IERA 3WTXC 3JTHA 4XF9A 1IDZA 3MN2A 1GP4A 1VRH3 3VD7A 1IQAA 4IV1A 1GLHA 3POIA 4EM2A 1LU2A 5A3UA 1W6NB 3H3ZA 1MVQA 4LE4A 5DG2A 1WBFA 3EXUA 4HPQA 4WXDA 4JTNA 5HODA 3OG2A 4ZONA 4AVSA 3RZMA 4XIKA 5BNOB 5I91A 1Z7S3 1U12A 1ODNA 1LECA 2DCJA 3OR1C 3LA2A 2JG9C 4GZ9A 1IZ1A 1VI0A 3LD8A 4PQQA 3Q8FA 3DTKA 1BMV1 3AKRA 5KVRA 2GM4A 4XMAA 2YG0A 2FMLA 1SLAA 1ZRRA 1GHCA 2RREA 4AQ2A 5H9PA 3D0JA 2WZPP 3V7SA 2YX7A 4E7JA 2GN3A 2MSYA 2DT6A 3LSKA 3I2FA 1XE8A 1VQ4I 3ESWB 5DUIA 4QX0A 4XYXA 4RYDA 4CP0A 2WO1A 2ZXIA 3GWZA 1OR7A 2Q8DA 3LSEA 3VBSA 2DA7A 3O1VA 2ELKA 2VBYA 3R0JA 5K5QA 3O8GA 3JSPA 3RDIA 2P7CB 2E32A 2VVDA 1VAKA 4P5HA 3ZPYA 3WCRA 4AVVA 4JKKA 1VQ7I 1B8IB 1CAUA 4A3KJ 2YHJA 1KEXA 5FR3A 3A01B 1VZ0A 1QDOA 4OQ8A 1HB2A 4UUSB 1OUXA 1YYNA 4PSWA 1SANA 2RNGA 3IIAA 3ILNA 3OYDA 1YRNB 2UYBA 3GBFA 1VBE2 1QHDA 3KV9A 3PJRA 3U4SA 3VKFC 3NW4A 2PHWA 4CDWA 5EJ3A 2KISA 2VIXA 4B1RA 4CCKA 2E34A 4A6EA 4Q8LA 4MZUA 5K8SA 1P9QC 2E19A 1H9PA 3BQYA 1OLMA 2JQ7A 1Y4WA 1MDMA 2JPCA 1H9WA 5C3EJ 1QNWA 3ITQA 1UQXA 2C0ZA 1Y9QA 3IBMA 1U5IA 2VCMA 4MO7A 1NZCA 2DFCA 1BBT2 1HN1A 4Y24A 1JU4A 2GXAA 3CD6I 2WNEA 1MEC2 1W99A 5FK8A 1K61A 4FQGA 3R0RA 3L2VA 4BM8A 3GZNB 2FX0A 3K46A 1UXZA 1QOTA 4A69C 5F32A 5IHRA 2D1HA 1AR81 4EGYA 2AO9A 4RFT0 1QBJA 5D4SA 3ES4A 4E8DA 5EXOA 5AC91 2DPDA 3EJKA 2ZMEB 3BJ6A 3BJAA 1V6MA 1DQ0A 2DQRA 3ZYIB 4EM0B 3NL1A 1A78A 3CJRB 3C7GA 3BDDA 4A3LJ 4XAEA 1JOPA 1C4RA 4XTMA 2FDIA 3I7DA 2PAKA 5K7ZA 4KA4A 3FXLA 4CDXB 2IWGB 3BCBA 4CDUC 5TJJA 5LBBA 3MFAA 1LHOA 5AFEA 4WVVA 1FYUA 2ZHKA 2L01A 2LVSA 2VMFA 1SMTA 3Q3SA 3HEIA 1OC1A 1IUFA 3RYRA 1SBDA 4JBAA 4X6QB 4D5FA 1PM4A 2CO5A 3D5LA 1CONA 3CLPA 3CUQC 3COAC 4A3DJ 3KT1A 4OHYA 2Y9ZA 1RUF3 4YSFA 2BNMA 2PA7A 1IC8A 3AP5A 5D5UB 3AFKA 4JC1A 1FNYA 4FFIA 1O5LA 2K2SA 4A7ZA 3AMPA 1PGL2 1DU0A 5L9BA 2ZHLA 5E88A 4CDQB 4G7HF 5A3LA 2HI3A 2HWF1 2OA4A 3VD5A 5GADJ 1BK1A 3NO8A 1TTYA 3NKTA 4NHKA 3FJSA 3GLLA 1LR5A 5F2SA 4B3XA 3KVBA 3UR3C 4RGGA 2IA1A 4NAOA 3LQQA 1ONAA 1K6OA 2FDFA 4AG4A 3PTRB 4UW4A 2JA7J 1W2NA 2KD7A 2QCSB 2CS3A 4XUOA 2BFUL 2VCBA 2Q4SA 5CVRA 5JR7B 3SCHA 2Y0OA 3K0LA 1IF1A 3I3BA 3V0AA 2IXJA 2DFHA 2G19A 2V1NA 2DUOA 1I39A 1W8UA 3TEXA 3GTGJ 3AMHA 2WLPA 2IFWA 3DCQA 3WDXA 2WZR2 2DVAA 4D7YA 3MW4A 1QVUA 3I59B 2OCCH 3B9CA 3VN4A 2R0QC 3AJYA 1LPQA 1EV13 1RVF2 2HWE3 4AI9A 1F9NA 2M1BA 4K1ZA 3E6DA 4KMQA 1HF0A 2V79A 5I0DA 2GP3A 4RLFA 4XE9A 4YFKF 2GBYA 4GMP3 2VXJA 1HXS3 5HXVA 1PUFB 2CFXA 3I55I 5FP8A 3NV3A 4Y4RA 3I49A 4P9IA 1WWYA 2FHRA 2OQ7A 3G1LA 2OPTA 1DU6A 2A6HF 4G8XA 5B66C 1HJGA 1WWXA 1TC3C 3RWNA 2V1DA 4IRIA 5JZGC 2Z5UA 2JJ7A 1V3FA 3DF8A 4ARXA 2L2OA 1OI6A 2ZBKA 1K78A 1P4XA 5FYCA 5K9YA 1PMHX 2X0LA 5EJZB 4IHSA 5JHFA 3CQZJ 4BJ6C 4M6VA 1JZ5A 1F4AA 4GKYA 2LY9A 1JZ8A 3IHUA 2SLIA 5L3CA 1TME3 4K9SA 3BY6A 4OQ9A 1QPMA 2QA4I 3BPSA 1TL8A 5FDBA 5GLWA 1AYM2 3EQEA 1RUH1 2EZIA 3RMYA 4YFWA 5A3TA 3KZIC 4AK3A 4B4PA 4Q2FA 4DXRA 1S0DA 4L5IA 2PHDA 1XE0A 2VW0A 3RCOA 1LHUA 3FBYA 3T5XA 4IX7A 2WT2A 3VSKA 1LFBA 3TW6A 1Y8RB 3ABKH 1RUG3 3M07A 3GXOA 4RR3B 5K7PA 1TW3A 3KP4A 3MPBA 5IWFA 3ZFFA 1F4KA 5LRRA 3WQ7A 3CCMI 2YSRA 3PQKA 1ZNPA 1EAH1 1TEIA 1SMVA 1YYVA 2VOOA 5SV8A 1KU2A 2HWC1 3WF1A 3RKQA 4R1HA 1RUH3 3HWJA 1KA8A 1YO5C 1W05A 5KCMA 1LKNA 3ONQA 3S5AA 4ZYDA 1TMF1 1ZGWA 2KMUA 1SVLA 1GANA 3MV11 1ASJ1 3DLAA 2L02A 5FTTC 3LAJA 1SCRA 1OCTC 4MTDA 2IVMA 5FZOA 2ID4A 4AE2A 3K2OA 4AEMA 5CISA 3BALA 1WUVA 4XOTA 4HLYA 2BWCA 2YU3A 1G9FA 3E7LA 4CDQC 1YHFA 2FMYA 4CEYB 4G9SB 2KM2A 3I4NJ 3TO9A 5HLHA 2FBKA 1D0HA 4NHYA 5GJ6A 1YOVB 3N3HA 1DHKB 4JX4A 5F5QA 1JZ3A 2CV6A 1OD3A 5JSOA 1BIAA 4Q4X2 3O1RA 2JG8B 3RRDA 2MABA 2BV4A 1VQ6I 2VQUA 2HKOA 2R0HA 4KG8A 4Q4V3 3WHUA 4BKXA 1K7AA 4UV9A 5CLSA 1V4RA 4F93B 4JTOA 1A36A 1W6QB 5GM0A 5GPCA 5DS9A 1ZRCA 1REDA 3HIFA 1QXPA 2EV6A 4GDFA 3LFUA 3DEUA 2IS1A 2R063 3BTLA 4YLZA 3S16J 3BG3A 1U8RA 2VT3A 3V56A 1VBD3 3TL4X 4EN7B 5A7WB 1S0JA 2QWWA 3FIWA 1LESA 2Z2SB 3KP6A 1W90A 5FPVA 2B4KA 5DUWA 4HVOA 2QE3A 4ITCA 3KLSA 2FUG2 2JXAA 2VZ3A 3S2HJ 4D6SA 1BVP1 4WXCA 3QCWA 4IGQA 3LSMA 2E1OA 3HG9A 1RXFA 2LK2A 2D5VA 1QPIA 1W0NA 1IJWC 1MEC3 1OYWA 4M3CF 4K20A 1GDTA 1E5IA 2Y64A 1KU9A 2RQQA 1EUTA 5L3GA 1SCSA 4ZU5A 1Z7S1 4BBRJ 1MQTC 5HOOA 4X1EA 2BE5F 2JENA 4FO9A 2Q1MA 2R5ZB 2BY2A 4GXLA 4URTA 4AGRA 4DFSA 1B4AA 5J1UA 2D98A 2GQQA 3HOSA 1AF9A 1IN7A 4RB2C 3J8F1 2PX9A 5IYDJ 1J59A 4A7YA 1LJ9A 3ZFGA 3WP5A 2W08A 2ZGSA 2MW8A 4UHTA 1MMSA 1F8VA 1ND3B 4N90A 2YC2A 2FOKA 5JSRA 3QP6A 4AYBN 1Z05A 4CU6A 4ZZLA 1VQNI 3NAUA 3OYKA 1S2EA 1E3PA 1ULDA 1CAXB 5ERIA 1MEC1 3EHKA 3ILFA 3OYCA 4IEQA 1VJ2A 2M2EA 2A07F 3ZQCA 2CQQA 2WBKA 4YW4A 5FOBB 3OYJA 5GZCA 4D0QA 3J7HA 4QWQA 4RSUA 2RAEA 2R062 5HNHA 5JHUA 3WF2A 3LEGA 3FHNA 3AXEA 2MBFA 3N35A 4AGGA 3WGGA 5T5LA 3RNSA 1N1YA 3J8F3 1IS4A 2BZTA 5JAXA 3PVBB 2O3FA 5L3FA 4X6RB 4XRMA 3M3CA 5A80A 2X05A 1QA6A 5FO5A 1JOJA 2I8DA 5D6EA 1IUYA 4W6WA 1T6SA 1UOJA 3AL0C 3JRDA 4XSZF 2QM3A 3UESA 3U1DA 2RE9A 5BUVA 2JMWA 4ON0A 4PDKA 1V5EA 3IH4A 5BNPC 4HPKA 3T0AA 3S3OA 5LY2A 3HKZA 4QX5A 3U0ZA 2M87A 3ZQIA 3KT4A 2AR6A 3ZPLA 1LU1A 3HQRA 3M1EA 3K4LA 3W59A 2K4BA 3UV9A 5B2GB 3RPUD 1HBXG 4OCTA 5LA2A 3CCUI 3OBZA 2FQ3A 3DPRB 1QVTA 3KM5A 2QLZA 4JKLA 2OZ6A 1KGYA 3IB3A 4O9EA 4LUMA 3HQUA 1YNAA 4ASNA 3THPA 2HWB2 3HOWJ 1C5HA 2SBAA 2UYAA 5FROA 2XAUA 2C26A 4JGYB 3CO2A 4QXHA 1UIJA 2OC6A 2OZUA 2BHYA 4AIKA 4F8AA 2RGVA 5BPXA 2B8MA 3QOEA 3V7CA 2XF5A 3WNOA 1MGTA 1CQTA 3BN6A 4V19K 3VBRB 1XOYA 1MKMA 4COZA 2VL4A 5GLTA 3PUAA 2LRPA 2Q5TA 3SITA 5J96B 1RUF2 1HSJA 2ZGOA 1QJU3 4P96A 1F5FA 3QH7A 3RSJA 5A6QA 2Q30A 3IDEA 4BHPA 3L1PA 2YC4A 4AVPA 1Z78A 5FV3A 5FZCA 4XACA 1OH3A 1JYWA 4AYUA 3USSA 1ULOA 4N7UA 5GALA 2RV9A 3FFQA 1TBXA 5DXDA 4M74A 4X8PA 4U0VA 3INAA 1ZYBA 3NARA 2Z42A 2OA2A 2W46A 2P17A 4JDNA 2VMDA 1LULA 3ZLIA 1YJ9I 3MW3A 4QPGA 2VBPA 2VPVA 1USTA 2K9ZA 3UJQA 4MO3M 4F55A 3WW4A 4OMYA 3F6OA 1DFQA 3OS0A 1NK3P 4HDUA 3Q8AA 2V6CA 5L7OA 2XL9A 2CUFA 1YTYA 3SLIA 1E5RA 4Q0VA 4UI9L 4GALA 3WP4A 2GU9A 4DOUA 2NS8A 2NPIA 1H2NA 2PJPA 1W8FA 4H55A 3N9PA 3UKTA 2R5YB 5C4XJ 1BN5A 4EJVA 2J5OA 5E17F 3SH3A 4XSXF 2HWF3 3GCMA 3WNKA 2R4GA 1VQ5I 2XVCA 2KDZA 2CV2A 2IS2A 3HMYA 5J48A 4MADA 1OLTA 1C8M3 1X2MA 1V5GA 4Q0QA 4P9FA 3ZR8X 2J1EA 1QJX2 2OKXA 2BXZA 2Q8OA 5FYIA 4BQXA 2HU9A 4XRFA 2L9RA 1OFSA 1N3PA 3WDVA 4BMEA 3KCYA 4V2VA 2EV0A 3TOAA 5CU1A 3BZCA 4AYBA 4X6AJ 1GZCA 1QF3A 2ZKZA 1EPWA 5DUVA 1WGXA 1HLVA 4ESFA 4RA2A 2ME6A 3PNVA 3FXQA 2P3YA 2JUGA 2V72A 1D1AA 5M3MJ 4YVWB 1YHQI 3F3XA 2B9UA 2FU4A 2AYHA 4HFSA 4AIDA 2KJBA 3HTUA 1MZFA 3UNPA 5GAEJ 2QSFX 1A8MA 3PFYA 5FFXA 2ZTNA 3T1MA 1TNRA 5J98B 4QQHA 2QQAA 5DAQA 1V6JA 4LO8A 2QYOA 5C3RA 5FY4A 1EAH2 3JD72 4Z1VA 2OJED 4KIBA 4LOTA 3ZDVA 5FLXK 1YWKA 4MGYE 5IVYA 1TNTA 3F72A 1NXD1 4CA0A 1OVPA 3B69A 5DCFA 1NH3A 2DFFA 2OU2A 4M73A 3PVNA 4BXUA 4QXBA 1REEA 3VZOA 2X4HA 2RR12 4CP1A 3S7EA 4FPCA 5B4NA 2X5IB 3S3MA 1GNHA 5C3SA 3CMYA 1CAUB 1VMJA 3I0TA 1UELB 2WFF1 3AYEA 4FTEA 1IS6A 4FX0A 1IGNA 3DECA 3E5XA 4BK4A 2OCEA 2WZ8A 1B72A 3P3NA 4BHCA 3ETPA 4A5MA 3CCJI 4NQWB 4Q4X1 2P4EA 5HDKA 1T8IA 5FPBA 3KD4A 2ZEXA 3JXSA 5FZ8A 1APLC 1UYZA 3FBIB 2J42A 2VZPA 2VODA 1IN8A 4DBQA 2MC4A 1RUG1 4LK6A 1K45A 3GFMA 4PK4A 3O1PA 3VZKA 4LLLA 2RMU3 2XAHA 1J3QA 5HDNA 1PX4A 1U5TC 2P6CA 2W95A 3HT1A 5CBLA 1O5UA 1FOD1 2XGEA 4LBQD 2ORZA 2C5DA 1O4YA 2XRLA 4BQOA 3JZVA 4HBLA 5C33A 4RB1A 2E7WA 3U4XA 1W39A 3QPHA 3LEIA 5C4WC 4C1XA 3A21A 3USUA 1UZCA 1ALYA 2OZJA 4XLPF 4M3CA 4BEHA 3R6SA 3MFKA 3WV6A 1OH4A 2XMLA 3NMBA 4MEXF 1KRIA 1KDMA 2RMU1 4AI3A 2R041 3QU3A 4QDQA 4E7LA 4XICA 4E2GA 4IEJA 4L9JA 4UWDA 3TBIA 4M9XA 5LASA 1AX1A 1HLCA 2VNGA 2ZMLA 2A6YA 2ZOEB 3N7LA 1IHMA 2AS5F 3ZN0A 2D3SA 1XXNA 3AZWA 1X9PA 2E63A 4LA2A 1B1BA 3MIBA 2DBBA 1US2A 5EEAA 1N1TA 4CEYC 4XZPA 2QQLA 4UUTA 3AKPA 1AXKA 5FAXA 2RVCA 1MJAA 3O0VA 1QIQA 5HXMA 5DUUA 3BLYA 4O65A 4TSVA 1SFNA 2OUJA 3R0AA 3L9JT 4GB31 2JX9A 4BS9A 2B63J 3O1OA 1FX5A 3KZZA 2L7FP 1VBD1 1RR8C 1GNYA 3VWBA 1IRZA 3ZQHA 5LFAA 5GTHC 4DXZA 1SVOA 4AFAA 1L3LA 4YVSA 4LBOA 3BTIA 5J47A 3I2HA 2D43A 2K27A 5F6LB 1Z77A 1J83A 5FKOA 3FXOA 2V5YA 2E60A 2O0YA 4DZPA 1RJ7A 1PIV2 4E7SA 5BNNB 2MNGA 3BU0A 2MD0A 4PUSA 3B73A 1NLQA 1PO21 3HGGA 5FYBA 3W3CA 4HNUA 1PIV1 3CP2A 4KWUA 5A33A 1TQPA 2A6TA 2UUZA 2ZJCA 1FWZA 1PM7A 2A61A 2PYTA 4XBFA 3LDKA 1FATA 2ZEYA 1NA1A 1GVDA 1SFYA 3H3LA 3DWLE 2RS52 4RHV3 3LFMA 2A6WA 3DPRA 2F5CA 3QYBA 1TP4A 1OCZH 3ZOIA 3PUSA 4OULA 3AKQA 1M1EB 1NTCA 4D0PA 1A31A 2RS13 4I2OA 1SZBA 4O6JA 3TEZA 4ONUA 1W2TA 3VHOA 2WQ4A 3DBRB 4JX0A 3GTJJ 1AHDP 1SAXA 3QPSA 4IE4A 1ND2C 5TISC 1YRZA 4IOCF 4MYEA 2HYFA 1HW1A 3AVSA 3KZ4C 4R9CA 2OYZA 1I3QJ 1KQ0A 4HG2A 3VGIA 4W50A 3DEMA 1FPN3 2DYRH 3CJIC 5H9RA 1JTZX 1HV1A 2WWYA 4IV3C 3WOGA 4RGRA 3CZ6A 1Q8QA 2VLAA 4I98B 1NCRB 4L9NA 3F8NA 2OS2A 2WNUA 1MBGA 2A75A 1TNFA 2EZKA 3LSIA 3JRAA 4COWA 5ACA3 1VQ8I 4BPZA 4C1WA 1WJBA 1X3UA 5FZ3A 2R5ZA 3ILRA 1J3RA 1DYKA 1WMXA 3FUQA 1CIWA 4HVQA 4Q4W2 3ABUA 3RPUA 1GU3A 3T4HB 3TWIA 4BQ1A 1G4DA 4Q4W1 5KXCA 3RMXA 3I2OA 3O0WA 3EUKL 3OBTA 4P00B 5C4WB 2VBXA 1PK6B 1E2XA 3JQWA 2ECCA 1OF3A 4NBQA 2AQFA 3JAMK 1YJNI 2R6QA 1WMDA 3I97A 3HTSB 2IVIB 3T2QA 4B1MA 1A3KA 4HYEA 4UB6C 1TG7A 2AHQA 2MLGA 2RMU2 3GX4X 2R042 2R1BA 3MMYB 3GGLA 1W5TA 2Y31A 3FXKA 1JU3A 2EIGA 2MFZA 3ZQFA 4S2HA 2VM9A 4CEWC 4LORA 4QPOA 3SQOA 3O7OA 1S1AA 4MGZE 5DG1A 4PLOA 2JTVA 3CESA 3T0YA 1U9NA 2W82A 3LWFA 1U78A 1Z9CA 3KLOA 5J1YA 4Y5TA 4ZYHA 2Y0SA 3P1IA 1LHWA 5HVQC 1US3A 1BW6A 3BODA 4J1WA 1JZ4A 2D40A 1RKWA 4IHXA 1MS9A 2R7UA 5CYYA 4WVMA 3LOBA 1N1VA 2Q0AA 1BR4A 2UXXA 3VBOC 1W0PA 4M71A 2DA1A 3LA7A 1Q8SA 3P6BA 5IW0A 4FXGB 4IOAF 2UWMA 4AUXA 4L92A 5A3PA 5KWRA 2YPJA 1WJDA 5FZ6A 1R58A 3C7OA 3FBNB 1MBJA 2IXKA 1CAVB 4GXOA 1HRV3 4PFPA 3B02A 3J7MA 5CZKA 5DUKA 4A3FJ 1AYM1 4W4ZA 2A71A 4XCAA 4OMZA 5J6XA 3V8KA 5IT9Z 3QODA 1W6QA 4HQMA 3P5BA 3POWA 5BYNA 4IEWA 4HLTA 4NIDA 2DTRA 1JUHA 3SDBA 1COV2 1PX3A 5BNQA 2Y6JA 2VTXJ 4KUMA 5IP9J 4ZDOA 4TLGA 4QD2A 1D0YA 1VQPI 3WQ0A 1R22A 1H9GA 3JCIA 1H4GA 4V1PA 1C8M1 2M0MA 5F3EA 4LBJA 4EZHA 4A3MJ 2RHPA 3FMQA 4M3CE 2PHRA 2RR11 1EY2A 3T0BA 4A41A 2A5ZA 2Q8KA 1FPQA 1YQ6A 2W84A 2ZEWA 3I3LA 3VBSB 4KWJA 2DA4A 2WRAA 3DPRC 1KFUL 2QZ8A 4YM2A 3OOUA 4GWNA 3POEA 3LPFA 3ZYPA 3OSGA 1PNGA 2P3KA 4A3JJ 3W6VA 1TMF2 4DOZA 4DNCA 3PUBA 1T6BX 1SC7A 1W8WA 4MXVA 1H0MA 4KICA 5JR2A 2AACA 5J1RA 4ASMB 3U37A 4IEVA 4IV3B 4RBOA 5FZGA 2JG8A 4M01A 3QACA 4LTAA 1A8DA 2QQ9A 4Y5Z0 3C7EA 1NXMA 1RUG2 3PUIA 1Z21A 3VDDA 4GYIA 1IN5A 4AI2A 4B8XA 4NQWA 4BYYA 1ENXA 5E8IA 1FBQA 5C8WA 2VUDA 4LE3A 2W5FA 4ARYA 4H7LA 2F5EA 5FLXZ 2LS6A 3CCEI 5HCHA 2WYFA 4HSRA 4RN5A 5FFZA 3CMMA 4CTEA 4IPAA 1U5ZA 3W5NA 5C9AB 2XWBB 3EMRA 3U9GA 1IO2A 3CUQA 2EXIA 2EXHA 5FUIA 1N25A 2XVGA 3G6EI 4FAHA 1R23A 1D0ZA 3RZZA 5GTIC 5CVVA 4NIIA 3FXRA 2EWNA 3G4SI 2MH9A 1O59A 3JRHA 5F8PA 2WNVB 4QIWN 2JA8J 2VOPA 3DCFA 4AL9A 1G9AA 1MH4A 3PNAA 4DS0A 4LKSA 3IAS2 3KVAA 3CU7A 3PO3J 2V1XA 4I6ZA 2WAQN 5E6HA 3TP0A 2WUHA 1LQ1A 1DGWY 4UOJA 1YLLA 2UXNA 3OJBA 5DDJ3 3OGRA 4QX7A 2BRTA 4F91B 4YZ3A 2VMHA 3WTWC 3AZVA 4OZXA 1EP0A 4YGBA 1JTYA 2NMOA 5AVPA 3VSLA 2RJKA 5LWBA 5ILVA 1F15A 3JRCA 1R5GA 1FYMA 1VBC2 2WT0A 4UNOA 2HWD3 3D6EA 4WWCA 1MNDA 1PHMA 2FCVA 4UVCA 4BL0B 2HXIA 1NY71 1VBC1 4XUPA 2ZBJA 1DP3A 3ZSJA 3ZN1A 2WAEA 4EN0A 1TWCJ 5CFDA 1IXSB 1WLDA 1GZWA 3ZPOA 1V00A 4S04A 3NAPB 2OV7A 2AREA 2EB7A 1NCRC 2XH6A 3CEWA 2VNRA 2QTWB 4IDZA 5JZGA 4MNUA 1ZQ3P 4IVNA 4G12A 5CFCA 2DMNA 3FX3A 1QKQA 2BGPA 2HQ5A 2E6VA 2XB6C 1OCOH 3MF6A 3DKXA 2R043 1NQDA 4YG6A 5FMDA 5KAIC 3TN91 1D1CA 1ZZ7A 4YZ1A 3C2HA 3OWTA 2WNUB 3ZM8A 2HWD1 4CCLA 4ATFA 1COV1 1W0OA 3KE2A 5J3LA 3WZ1A 4JVAA 5FZBA 2WINB 1O3SA 3MF9A 3IDBB 4WX9A 1VQMI 1PDNC 3O1TA 3AKTA 3A7QA 1MSFC 5C8CA 4AFCA 3A1YA 1F43A 3KEQA 3HEFA 1FZPB 3V65A 3H1CA 3S1RJ 2VNVA 2CFOA 4ENJA 3HOTA 2MPFA 2LH9A 1CQ9A 2WNVC 1TT0A 3H5NA 4JYKA 3OYWA 2OVUA 3K1PA 5K5OA 4AI8A 2VZSA 2PJRA 2C9KA 2Z1DA 4XQ4A 1R092 3V4GA 3B00A 1ASJ2 2Y33A 5C9AC 4CEWB 2W1OA 3ALQA 1AR61 2JE7A 3ZR6A 2X6WA 1RZ4A 2KPMA 2EA2A 3LMMA 3SZGA 5GZEA 2ZX0A 3M8EA 2I2SA 4PCRA 3WINE 2GIZA 2ZGPA 4TWTA 2XLAA 4D6RA 5JVGF 1VQ9I 2FRHA 5IP6A 4AAPA 5FXZA 4QQ2A 1RGSA 1WLWA 1VBB1 1ZAOA 4Y22B 2EZLA 2M4KA 3HT2A 2OBPA 3LSPA 1SACA 1SG3A 2KDOA 2CDPA 4CDXC 1H30A 4PBOA 2BNNA 3NWKA 5EWSA 3GBWA 3L2HA 5EQUA 2O8OA 1OR7C 3JB8A 2W39A 3RIRA 3VHRA 3TO7A 3FXJA 4DPNA 1WMFA 3T08A 2YBPA 4XMYA 2H09A 1CAXA 4IF4A 2M0CA 4YZ2A 3E3VA 4KGQA 3LPGA 3WF4A 4IESA 4V2FA 3IMMA 4C90A 1JTXA 2HWB1 5E8GA 2XPJA 2WV0A 2BP6A 4XRSA 1VAMA 2IEKA 3WUDA 2EIJH 3MEPA 1IAWA 2JDNA 1SEUA 3CJNA 2HWF2 1UHSA 5T50A 3F95A 4K1YA 1OLQA 2VPRA 2W91A 2H94A 4U2AA 3R60A 3BGAA 1KJRA 2ARAA 2QQIA 3D5OA 5F0FA 1CN1A 4YNIA 1RMU2 3GJAA 5LA9A 3LAGA 1VBE3 2NN8A 1IPSA 4C3JJ 1IG0A 2BU9A 3CMAI 2P3IA 1QGLA 2GC3A 1LOFA 1RUF1 4J00A 2CWEA 5IVBA 4WXHA 3THDA 2D1VA 2V4AA 4EM1A 3JD73 4NMIA 3QAHA 1HC8A 3Q9SA 5A7PA 1YE9A 1ZBA2 2M45A 3Q9VA 2HQAA 3H3VK 3D4KA 2V5DA 1ZVFA 4NIAA 4BAYA 4U87A 1LODA 5ACA1 1J75A 3U1XA 3ZQQA 3GEZA 1PUEE 2CU7A 2DFIA 2JECA 3KB5A 1HJFA 4EJWA 4CXXA 1JUPA 1S8NA 3WTYC 2EIEA 2ZC2A 3C1DA 1JH5A 2MEV1 3HNBM 2V26A 4R9DA 5BS6A 3K70D 2XSJC 3JRBA 4INDA 2NZ9A 4HX4A 4II2A 4NO4A 4L18B 1PVEA 1X4OA 4V2GA 2LBFA 5CADA 1OVSA 4CU7A 2A05A 3G2BA 2WYSA 2E51A 4BBSJ 3RJPA 4Q5SF 4M9ZA 3KHCA 2DQLA 4PJ0C 3K4KA 1EF4A 3CDLA 4KMUX 3D5SC 1AR82 4IV1B 2DYSH 4BQ2A 2F4OB 3OB8A 5H9QA 3RZLA 2ZFWA 4IV3A 4QXCA 2VU9A 1WGPA 5EF6A 3BVCA 2COMA 4RA0A 1AR71 2HWD2 1W28A 1NA1B 4NDLA 2R071 3HSEA 1EJ9A 3A23A 4LD5A 5FPUA 1LOAA 4FQ4A 3DL3A 2CQ7A 2XAFA 4ZS3A 1UX7A 4GMP1 2XAQA 2WN2A 4CICA 4F52A 1JXSA 2K4JA 4IRGA 2FF4A 3X2QH 3BT9A 4P9UA 4QT6A 2F6BA 3N9NA 4DGWB 3RYPA 1YXWA 4ZH4F 1RB8G 4DY5A 4M3CB 3NRUA 4BB3A 2BBAA 1DCSA 2Y69H 1W9SA 4ZDLA 2ZS6B 1KQRA 1VRH1 3CZJA 2FQPA 4HKWA 5T55A 3OS2A 2WNVA 3SKJE 3ECQA 4GWIA 3NV4A 4QPGC 1K5JA 4XQWA 2R7VA 3PSFA 3OIPA 3ZN6B 1DQ4A 3D1NI 5FREA 1AZDA 3FXUA 1ETXA 3JU9A 4EVIA 2OW4A 4WF2A 1AR91 5EZGA 2JUCA 3CJQB 3QRFF 1G3YA 4A4AA 1MQTA 1OHFA 1YIFA 2JDHA 5ERLA 4HXCA 4AEJA 1HW2A 4XIDA 1R4MB 5FJHA 5BXXA 5LHIA 5FUNA 3MUZ1 2RS12 3WHBA 1T6GC 5T52A 3EB7A 4UXNA 2LF8A 1UY4A 2WN3A 1HRI1 1ULGA 2CRGA 3RJRA 4BQ3A 1AA7A 1J7KA 2JDPA 2VOTA 1F31A 2FDJA 2R16A 2XGXA 1XDSA 1W3VA 2HOAA 2VI6A 2A68F 4QX8A 2KIFA 1C0WA 1H8TC 3ACIA 5J09A 5F5IA 3QPLA 5DM7F 3REOA 4FCYA 2QFEA 4C30A 3CCLI 5J7MA 3H8UA 3WSOA 1PK6A 2M7AA 2WAOA 4LMYA 3TDUC 2O1QA 2WV1A 3CLQA 4CO8A 4DIQA 1E5HA 2FDHA 4HANA 4ABZA 5LEKA 5C3OA 3FMSA 2B42B 5DDJ2 2DOAA 5FKNA 2EXKA 1ZBA1 5LEJA 4M72A 3S1QJ 4KBBA 2C4XA 5ACA2 2BYVE 2DURA 3ISPA 4EJTA 4ZY9A 1BLZA 2NOGA