4I0AA

Structure of the mutant catabolite gene activator protein v132a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKAGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0aA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0aA01
2CG4A 2O0YA 1O3RA 3T1BA 3TNPB 3JAMK 1J3QA 5A2QZ 1LQ1A 2ET1A 1FBSA 4KDPA 3U2RA 2DI3A 3MWMA 4A0XA 1ZG1A 1TBXA 1YUDA 1H1IA 3MYXA 3L2CA 3IRQA 3H92A 2FBKA 4PDKA 4S04A 1FY7A 3VOEA 3ACLA 1T6SA 4XFCA 2YSRA 4KUMA 4HX8A 3K1PA 2OD5A 2Z2SB 2LF7A 1KQ8A 2EFWA 1RC6A 2RDPA 4Z82A 2MD5A 4J1WA 1SD6A 2IC1A 3FX3A 3F21A 5E20A 3K1MA 2NRAC 5E16A 4DINB 3ZMUA 4HF2A 2DAOA 3KP2A 2ESHA 3PQJA 2C0ZA 3WW4A 3RZZA 1BJAA 3GFJA 3E3VA 5LBQA 3J7AO 3GEZA 1IAWA 2GQQA 2RGVA 4I3PA 1R58A 4MX3A 1G6NA 2NYXA 2OU2A 4YG2F 3BJAA 5ILVA 4U88A 2D1VA 3TQNA 5K5QA 2A6HF 2A5YB 4P9FA 1OFNA 5CYVA 3SCFA 2UXNA 4NB5A 3G3ZA 3GVAA 3T8RA 2VE8A 3M8FA 3GLXA 1CAXA 3DP7A 2UYAA 3GZ5A 5LHIA 1KU9A 4EGYA 2QBYA 1JGSA 4D0PA 3WTXC 2XV4S 3B73A 2ETHA 4A0YA 4YARA 1P4WA 3IL2A 2K86A 2UZKA 1JHFA 4B09A 1W7PD 4P96A 2VN2A 3M8EA 2Y0OA 2P4WA 3ZN0A 4Y15A 5JSRA 2L4AA 2Q8KA 2DQLA 2ZNYA 3LOIA 4BQAA 3QRFF 5F1RA 1LRHA 4KN7X 1Y0UA 4KWKA 4L0ZB 3DN7A 5ERIA 3JTHA 4UVAA 4KU8A 4OFGA 2O1QA 2E7WA 4EM0B 3VEPA 3V8LA 4BAYA 1DGWA 2J5PA 1MDMB 4WX9A 5H6QA 2GWRA 2NAZA 2UWMA 5KK1A 1YS6A 4XFFA 2IXKA 4IEVA 1ODDA 2K7LA 1LR5A 1BIBA 3ABUA 4RAZA 3U1DA 1Z7UA 4OIRF 1S29A 3K69A 3H7YA 2PBIA 2PHLA 3O3KA 1HBXG 1V70A 2QCSB 3BWGA 3RPUA 3E6MA 4XBFA 3U10A 1PUEE 3KGZA 3CJNA 1B4AA 3ECHA 4HYEA 2WTEA 2L01A 2QQBA 2JSCA 4OU0A 1QXJA 2OYZA 4MZUA 1B9MA 5HS7A 3SFZA 1O4TA 1YW9A 5BY5A 1L3LA 2KKOA 4Y13A 3LAJA 1W7PB 3SHFA 2B8MA 5I0TA 3FXRA 3I53A 3JSOA 5I0RA 4JK1X 3UKTA 3LFKA 2DTRA 3S2WA 3WTVC 1XCVA 4LUMA 4ZYGA 1O7LA 3KP6A 5KHKA 1YG2A 3BPVA 4FHTA 2M87A 4EJOA 4U7DA 4IEOA 2I45A 2IVMA 4MGIE 3KMHA 5AIQA 3CO2A 3EYIA 1FLIA 3FMQA 1L3JA 2O03A 4J1XA 1IN4A 4RB3C 2P7CB 5JI6A 3ROUA 1ZLJA 3FF5A 3IKVA 4FAGA 3QU3A 3HIFA 4Q4ZF 1IW7F 2ZCWA 1EH6A 1SMTA 4IXAA 3B02A 3W6JB 1DPUA 1KU3A 3ES4A 5HS9A 1FSEA 3F8MA 5K5OA 2FRHA 5JFRA 5HVQC 2P8TA 3JTGA 1ZHFA 4XSXF 5I8TA 1EV7A 1TW2A 1J5YA 1OKRA 1TQPA 5J3UA 3D0JA 1XSDA 1KQ0A 2MH2A 4ASNA 3SHRA 2ELHA 3KLOA 1R7JA 1G3WA 3HRMA 2VECA 5ICFA 1D5VA 5FPZA 1Z6RA 2ADUA 4R52A 5HLIA 5DV5A 4AVCA 2EJRA 4YYOA 3H3UA 1LB2A 3EBRA 4QM9A 2W25A 5D6FA 2K4BA 3LAGA 2A61A 3WTTC 2K0GA 2XLGA 1J9IA 2Z3YA 1NE6A 1YYVA 4I01A 2IXCA 4FX4A 1UFMA 2DFIA 1XGNA 1CAWB 3KZYA 3TO6A 2D40A 4L11A 4ZZLA 1X8EA 4LB6B 2IJLA 1HW5A 1SFUA 1FBUA 4META 1TTYA 2EA7A 3F8NA 2RNJA 2O61A 1SFNA 3OTFA 5K8SA 4ZYEA 4D7TA 1U5TC 2D5FA 4A5NA 4IF4A 4XF9A 2GIVA 3V8JA 3F8BA 4HA8A 1T0FA 1CAUA 3WE2A 2YX4A 2VBYA 2GZWA 4CZZA 4QLCU 4ENKA 3KP7A 5EZWA 4HN1A 3E6DA 5CVJA 1IXCA 4MEXF 4EM2A 3MAJA 1WWXA 5J7MA 2BV6A 2DT5A 4FX0A 2FNAA 3T5XA 3H1WA 3FXUA 3RKYA 4HLXA 2FNPA 1REPC 5L3EA 4IJAA 5JAXA 4A0ZA 2ZBKA 5CVRA 4MHGA 2K4JA 2P5LC 2HGCA 5LRSA 4N9IA 4GO1A 1V3FA 3PQKA 1BI1A 2PG4A 5BPDA 2XUBA 5BPIA 1JHHA 3D5LA 2A69F 5JSOA 2D45A 3PNAA 1G3YA 2FSWA 3LWFA 5EEHA 3SXWA 2P5KA 2D93A 3RIRA 3GUDA 2VE9A 4HDUA 4I02A 1QPMA 1Z6TA 2EB7A 1T38A 4AVAA 4XF1A 5FQ0A 3ZMDA 4I2OA 3HUGA 5HLHA 3EO6A 2V1XA 2EFQA 3OGJA 2VT3A 3KETA 3O14A 1T98A 4M6YA 4MUVA 3Q9VA 1X8MA 1CAVB 1I1SA 4HLTA 2STTA 2XAGA 2HKOA 4LB5A 2DK8A 1B59A 1XMKA 1XSVA 2LKPA 5FQ0B 3OOPA 2IA0A 4BHCA 4I0BA 5I0UA 1FZPB 3LA7A 2RC4A 2V1DA 2HYGD 5DD8A 1Y9QA 3FMSA 1MDMA 3MEXA 2FXAA 4WBBA 4KA4A 3USSA 1Q43A 5LEKA 1FC3A 1FNNA 1QO0D 4IVNA 5DCMB 4RGXA 1CAVA 3CUQA 5L3FA 3R0AA 5CJ9A 5I8YA 2E9QA 1EPZA 3L2HA 4HBNA 3KP4A 4PIXA 3WGIA 3CUOA 1ZAOA 2PEXA 1YS7A 4IHSA 3HT1A 3FJSA 4NVPA 4XFIA 3DQVC 5ILSA 5TRDA 1R5HA 4KL1A 3J81K 2FEZA 3TO7A 1OYWA 4YSFA 3LAPA 4JTOA 4OIQF 4O6JA 3E97A 3GX4X 4K2EA 4G94A 2ZO4A 4ZZDA 5IT3A 1Z91A 3U0ZA 1W7PA 4LGWA 1QZYA 3P7NA 1R36A 2N7GA 4TLFA 3HSEA 3C18A 4XFHA 4O9EA 1U8RA 3IDCB 5FD5A 3FZ3A 2LDUA 2VQAA 3FE5A 5CVIA 5C6CA 1HKSA 4LLNA 1YFUA 3GF2A 1VTNC 2K27A 2BYVE 5CVUA 1QWRA 4KU7A 2XHKA 1YO5C 2XAFA 5JR7B 3IDBB 4KMUX 2XRNA 2KRFA 3EYYA 2D5HA 4JVAA 4OIOF 3TDZC 4FAHA 2A6EF 3V7CA 3GW2A 3R61A 1J3RA 5D5VB 2MA3A 4S05A 4E2SA 4QWQA 4R1HA 4CYDA 3F72A 4Y17A 4IRIA 3JZVA 1KA8A 1QBJA 2RV8A 2XIGA 3VFZA 4XEZA 4EROA 1YFYA 5D5WB 4BIFA 3ELKA 3KLNA 4KNYA 4MGKE 1ZRDA 4P55A 5KHIA 1VP6A 2QENA 4Q0UA 4WZCA 2JPCA 3QU6A 1MD0A 3P9IA 2WFPA 4E2QA 3CUQB 3DL3A 3WGHA 2KIFA 3DPLC 5E17F 3CJXA 1J75A 1D3YA 3I59A 4RB2C 2VBXA 1EH7A 4ZU5A 4R8HA 3TOAA 2D1HA 2BNNA 5FLJA 3CLPA 4PZJA 3IBMA 1OPCA 4HVRA 3RJPA 1U2WA 1K78A 4PIYA 2JTVA 4OMZA 1PM7A 3H1MA 1GHCA 1ZNPA 3F6VA 3GFMA 3I59B 2HFHA 1GQGA 4BYYA 4EJUA 1ZVFA 3HSFA 4QMAA 2X4HA 1Y3TA 3MFKA 2GC2A 3TDUC 4CXFA 2CAVA 4MNUA 4HSJA 4HSLA 1S8NA 1YLLA 2KXLA 1Q3EA 1S6LA 2ISYA 1RI7A 1XDSA 3QAHA 3H9AA 4LTAA 1TW3A 1V4RA 1XCBA 4AIHA 3Q9SA 4AWXB 5D5UB 1KU2A 2GAUA 1W5SA 3BCWA 1F5TA 1E2XA 2VOOA 4Q0VA 4LEJA 4MQ9F 2IPQX 5BXXA 5BOXA 2G7UA 2IXIA 4M6XA 4QXKA 1FYMA 4IRGA 1GQHA 2ZKLA 1DPRA 2PFWA 3ABTA 2Q2EA 3I71A 4MTDA 1R1UA 3S0MA 3MPBA 1MJBA 2QYOA 2DU9A 3OCPA 5E1WA 2EA2A 2FMLA 1YW8A 4LLLA 4BHPA 1DZRA 2XROA 3C3VA 3RI4A 2KJCA 4A12A 1UCXA 2GC3A 2LSOA 3S7IA 4QX5A 1UIKA 2HTSA 2V79A 3FWEA 3H50A 3BJ6A 1NE4A 4ESFA 1FT9A 2GC1A 5TJJA 1HXDA 3RYPA 3K9TA 3ETQA 1UHMA 3I64A 2CO5A 5JR3A 4Z07A 1YFXA 4HVQA 1XGSA 2FQ3A 5LHGA 1H9GA 1PP7U 5HDNA 2M5WA 1NYWA 1GXPA 3CL1A 3LA2A 1XE7A 1HW2A 3MZYA 5D8KB 3ZMVA 2ISZA 3GZ6A 5LRRA 1IZ1A 2CSOA 4O3MA 1WI9A 4G9YA 5LGTA 4CO8A 5K1YA 4MTEA 1HW1A 1JE8A 3R6SA 4KWLA 1TLHB 3HOSA 4KT5C 4IESA 4UXAA 2OAZA 4P5OA 3BZ6A 4M72A 5KVRA 1UB9A 3S7EA 2BNMA 3J80K 1VR3A 1DGRA 4OIPF 4EGZA 3KSCA 2IW5A 2OA2A 3GWZA 4I09A 4QGNA 1Q5OA 1STZA 4BHBA 2E1NA 4HX4A 3WTZA 1IN8A 3N97A 2QUFA 2FMYA 4GYIA 3MDPA 4XLPF 3NW4A 1YTYA 3E6BA 2VPVA 2QDRA 4LLGF 2L02A 3NKTA 3TNQA 2JPBA 2H94A 2BBYA 3ZMTA 5H20A 2F5EA 3SXYA 1UW8A 1O3SA 3EHKA 1BI3A 2DQRA 2PAKA 4RAYA 1FI2A 2EFPA 3PFIA 4YIIA 2BNOA 3TOBA 4CICA 5JSPA 5EFUA 3FHIB 2OQGA 1O3QA 4LLOA 2EV0A 4YIFA 2UYBA 1BI0A 1USTA 1XGOA 4L9JA 3C1DA 4X6QB 2CAUA 1ULYA 3HTSB 3C7JA 4XF4A 3LWCA 2VOPA 3GXOA 3TGNA 3ULQB 2O8QA 2R7DA 4XRFA 3I54A 4JBAA 5KHHA 3CUQC 5E8IA 2CQKA 3IHUA 3HRTA 1LKNA 1I6XA 5ILUA 3BY6A 1ZREA 2PMHA 3EDPA 1BC7C 5D4RA 3IIAA 4Q0SA 2VT2A 1J2XA 2LNBA 5AONA 1BOAA 2YU3A 3NJZA 3WODF 3WGGA 1ZARA 2NS0A 1RUNA 4L9TA 3RKXA 3ZP5A 3R60A 1SD7A 3O2PE 1ZRRA 2CFXA 1U5TB 3VODA 3CO6C 2PN6A 4M71A 5FO5A 4G6DA 5DEQA 4EJVA 2MLKA 4Q29A 1LEBA 2OBPA 1UHWA 1QXRA 1YLFA 2TDXA 1ZZCA 1TNTA 4L5JA 3WW2A 2MBFA 1DDNA 5BMZA 3IWFA 4L18B 3LQQA 2XAHA 5HDKA 3G73A 3HTUA 1MGTA 1W4MA 2A07F 4UNOA 3DF8A 4IEXA 5DUKA 4WXCA 4L0YB 1QGPA 1OI6A 1I5ZA 1U78A 3DXJF 4HV6A 4RD7A 1UCRA 1WA4A 3ST7A 3F6OA 2F5CA 5D8LB 2AS5F 5J48A 2HQNA 3DFGA 4XF3A 3NQOA 2L3DA 4P9UA 2VC1A 5D4SA 4AQ6A 3HYIA 1RIOH 1U6GA 2VC0A 2PAMA 5DDGA 4G6QA 2FQPA 1BBYA 1ON2A 3ZN1A 4ENMA 2HWVA 2L54A 3NRVA 4UUVA 2KIUA 3H8UA 5IT9K 1ZRCA 1S7OA 1FWZA 2DK5A 4LULA 3WTSC 2QQAA 3P9CA 4RGSA 3SMHA 4LJZF 4EVIA 4JQFA 5E18F 4HAMA 2OZJA 3W6KB 1RL3A 1SFEA 3WW3A 4WF2A 4L2NA 1ZX5A 1ON1A 3KGLA 5HOOA 4HVOA 1NZCA 3RKWA 4X6RB 5I91A 2WWYA 2PMUA 4UVCA 3HQXA 5JCTA 5BQTA 2OQRA 2VONA 3NL1A 3TKYA 2HR3A 4LK0F 1EYBA 1Z1DA 4JTNA 3OF1A 1CAXB 4ZYDA 1J7KA 2H27A 2GXBA 4A6DA 1U12A 1XE8A 2Y0MA 1BM9A 1C0WA 2Z5UA 2ESNA 4KIFA 4RB1A 3RDIA 2EK5A 4HF1A 1YQAA 4MQVA 3H1YA 1U3EM 2MH9A 2A3SA 1ZH5A 2EFOA 3R0JA 3K1NA 2GU9A 3F8FA 1DUXC 1MJ9A 2NNNA 1WKMA 2ACJA 3E6CC 3KEOA 1Z05A 3L7WA 3BP8A 1EH8A 2M45A 3WE3A 3ZDSA 4IEPA 3GFIA 1WGPA 2YX7A 2XLFA 2OZ6A 1K79A 3GYDA 4ORFA 3SZTA 3D0SA 1IUYA 2B0LA 2NNYA 4O9GA 1JUHA 5LLQA 2CW0F 2HQRA 2QM3A 2DCTA 1F1ZA 1USSA 4IRHA 4ESBA 2H6BA 1XD7A 3MQ0A 2XKPA 2Q0AA 4PJYA 2ZXJA 1J0RA 4EWEA 4P9GA 5C8WA 4DNCA 4G7ZF 2O3FA 1UPIA 4WCGA 1OR7A 2ZMEB 1RZ4A 2IXJA 1HKTA 1XSXA 1CGPA 2GA2A 1TQ5A 3HT2A 1PMIA 1S7AA 1O5UA 1FPQA 1ZG3A 4KICA 1OYIA 4UV8A 1GVJA 3HRSA 3J81Z 4IERA 2W57A 1CAUB 4Z2YA 2XLAA 2QLZA 3MCZA 2MHFA 3J80Z 4A2UA 4KFCA 1D8JA 3SCGA 1R1VA 2R7FA 2YPRA 4AVPA 5AVPA 3L09A 1EY2A 2ZKZA 3WU1B 2ZMEA 2QVSB 5L3CA 4XFGA 2WV0A 2R3SA 2XAQA 3CLOA 3SQNA 3PVBB 4U0YA 5FDBA 2G7HA 4EJWA 2RVCA 1E17A 2RQPA 3KE2A 4XFAA 2DBBA 5FGMA 3Q5FA 3K0LA 3ISPA 1AWCA 2LF8A 2QVOA 4LK1F 1Q1HA 4OLLA 4Q0PA 1ZGJA 5D5XB 4L9NA 3COAC 1CX4A 3F23A 1MKMA 4ZH4F 5FCCA 3QOPA 3EJKA 3I0TA 4EV0A 5JVTA 1SD5A 3L9FA 4MV2A 2HZTA 2P17A 1XN7A 3F22A 3BPXA 3DKWA 1VJ2A 3E5UA 4HN0A 2E7XA 2A68F 5BUVA 3N4MA 5FLXK 1RNLA 1H9TA 4H7LA 4CHUA 2P6SA 3O6BB 1K78B 3BB6A 4Q5SF 5CU1A 5ICCA 2JT1A 4RGRA 4QGLA 1ZZ7A 3R4KA 1U5TA 4LA2A 3GYHX 3RYKA 3QACA 3BROA 4QM8A 4XSZF 2PAEA 3LQRA 5I93A 1IXRC 4KIGA 5K5RA 3M7GA 2EV6A 5E1RA 3SZPA 4HDVA 1ZZ9A 1MZBA 5J8FA 2RKHA 3HRUA 2HEOA 1P6RA 4ESJA 1LNWA 1CAWA 1FYLA 1JXSA 3QPTA 1T2KA 2FU4A 3CO7C 3VB2A 3LSTA 1Z9CA 2PI0A 2QWWA 4K8FA 4A6EA 3I4PA 4EQQA 3EQEA 3NVCA 2GH2A 2F5DA 3H7JA 3BPZA 1O3TA 2ZFWA 2F2EA 1SQ4A 2B9UA 4PGGA 1ZLKA 3FXQA 2UY8A 4UV9A 3M70A 2Z9OA 4RS8A 3G7DA 3LZZA 1OD5A 4M9ZA 1X3UA 6PAXA 4H0EA 3M1EA 4U7BA 2MPFA 3DV8A 4OOIA 2Z99A 1XMAA 4EJTA 4YRDA 1T39A 1LDJA 1WSUA 3IC7A 2PFBA 3ECOA 4LA3A 1TQIA 4G8XA 4N9HA 2Y48A 2BGCA 4ENNA 4CGZA 1S3JA 1G3TA 2HKXA 1K6OA 5CLSA 5D6EA 4YFXF 1O5LA 2RN7A 4KN4X 1IRFA 2O8XA 3U11A 4MH0E 1J59A 1SAXA 4I0AA 4U0WA 2Z33A 2QBYB 1R5GA 5LGNA 2MLGA 3BJOA 5ICEA 1FXZA 4TV7A 1RTVA 1LEAA 3I7DA 5LGUA 4ZYHA 3ZMZA 5ICGA 2H09A 2Q30A 3OD0A 5AIPA 5LEJA 1ZYRF 3BOQA 3T0YA 3D82A 3QP5A 2BEOA 1LDDA 4ON0A 4UBGA 3BDDA 2PTMA 3F8CA 2XL9A 1ZGAA 4KYWA 2IRFG 4OMYA 4KMFA 4RB0A 1SEFA 1I27A 3FZVA 4LUKA 4ZU4A 2ETEA 3WW1A 3HHHA 1UD1A 4WXHA 3E5QA 4NQWA 3CF6E 1ONVA 2PQ8A 2UXXA 4U0VA 2K02A 5F6FA 4YFKF 2H6CA 3DPTA 1A04A 2HYFA 2STWA 1PP8F 3I5UA 1HSJA 4FT8A 1SFXA 2Z69A 1R22A 4UBHA 1BI2A 5FFXA 2P7VB 2FA5A 2HDCA 2IA1A 3T8TA 1YW7A 4XF0A 1J58A 1R23A 3LA3A 1ZZ8A 3KEQA 4Q47A 1KYWA 5BV6A 2CV6A 1B9NA 3GBFA 4GGGA 2EFNA 5DYMA 4AVBA 2J5OA 3GFLA 3JAMZ 2QNKA 2DW4A 3V7RA 5BS6A 2AXLA 2GXGA 1AOYA 1QY4A 2DPDA 5DCMA 5L3BA 4GULA 1IN7A 4AQ2A 4IEQA 4G7OF 4HF0A 4CDGA 2V1UA 2B5HA 4LG0B 5J8CA 2Q0OA 3JW4A 5FFZA 2IT0A 3MZHA 1OYYA 5FB2A 4AIJA 2V09A 2BE5F 2P6TA 4HV5A 1P2FA 4AD9A 1B6AA 3UKNA 5H6RA 5CADA 4JV4A 4ONUA 2VODA 4I98B 4HX7A 2EV5A 4WXDA 5FPXA 4N0BA 4E2GA 4B8XA 5E1XA 5T3NA 3E5XA 1ZZBA 2JZYA 1O7FA 2PJPA 4IEWA 1HKQA 2HOEA 4KIBA 2Q1ZB 4YFNF 4G7HF 3KZZA 2QQ9A 4MEYF 3EUHA 1FSHA 1WRJA 2EWNA 4ETSA 4QGMA 1TNSA 1IN6A 2H0VA 3KP5A 4UVBA 3RYRA 2DLLA 4HQEA 1BC8C 2W84A 3IKTA 3UKVA 1F4KA 4WWCA 2PLYA 4AXOA 3TO9A 4KWJA 1LJ9A 1MJAA 3OV8A 1CF7A 2FF4A 5CVVA 3FFQA 3GO5A 2PYTA 4M9SA 2IXHA 2DPUA 1X7NA 5L3GA 1KYZA 3NSTA 5FLIA 1QNTA 3WG9A 5I0SA 3ZPLA 5ED4A 2F5FA 2FE3A 2MNGA 2XVCA 3HHGA 2GC0A 5JHUA 1O57A 2O6GE 4LFUA 3CDHA 3M3IA 4GCVA 4XFBA 3VHRA 2HJIA 5KHJA 2PHDA 4LMYA 1G3SA 5LHHA 2OA4A 2UY9A 1IPJA 4M73A 4IHTA 2PA7A 5F64A 1KQ9A 1HQCA 4MGRA 3EQLF 3M9AA 4I7HA 4RGUA 2KIMA 2ET7A 3PLQA 3FM3A 1K7AA 4XLNF 1XDUA 5DUIA 5HLGA 4D7SA 4HBLA 2IA2A 2MC3A 1QQIA 1YFWA 1YHFA 4HQMA 5FLXZ 4EWAA 4IPAA 4HOBA 4PIZA 3BALA 4ZU7A 3NEUA 1BN5A 1I1GA 1XGMA 3F3XA 2OZUA 4GXOA 2QJVA 5L3DA 5FD6A 1IXSB 2G9WA 3U9GA 2EVXA 3FHZA 5FLHA 1RUOA 3JSPA 1FOKA 1YFHA 3ML6A 3ERED 4WVZA 4HLYA 2D2WA 3KFWX 4MGZE 4L5IA 1NXMA 2IXLA 3WTYC 2COMA 5KHGA 2CYYA 2ZNZA 4EWDA 1TQMA 2VBWA 2XKOA 3V4GA 5EEGA 1R00A 1DP7P 1B1BA 5DCFA 2PQQA 2VXZA 1IN5A 1ZN2A 4AIKA 2C6YA 4EM1A 2HS5A 2KJBA 4UXNA 5E1ZB 1J3PA 2QZ8A 2M1BA 4NHJA 4M74A 3ELNA 1W5TA 1ZZ6A 4E70A 2GA1A 1ZRFA 2V6CA 1RGSA 1LVAA 2Y75A 1HSTA 1YWKA 3KCCA 4OINF 4FBFA 2XASA 4F7ZA 2V9VA 5DD4A 2FOKA 1KGSA 5E8GA 4F8AA 3CEWA 4HW0A 4HZFA 3ES1A 1XB4A 1FYKA 1IF1A 1D8KA 2CGPA 4O5VA 2DO7A 3K2ZA 2W85A 3WTUC 4EMSA 2JRTA 3H3ZA 4XETA 3WU0A 1WQ2A 1WLTA 3ZMSA 4YNIA 3QPHA 1IPKA 2FBHA 1P4XA 1FX7A 1P4AA 3AAFA 1J1LA 1L0OC 1P92A 4GYGA 3IRRA 2ATFA 2WC2A 5D1IA 1KU7A 5HI0A 1GXQA 2X0LA 1FP1D 5I8SA 3C3WA 5HS8A 4Q0QA 2L4MA 4IETA 1H0MA 4IEUA 1PDNC 4R79A 3I58A 3L00A 3WTWC 3SCHA 1SD4A 3RPQA 4BH9A 3QP6A 5BPXA 2EAAA 4A5MA 1QZZA 4LG0A 3EETA 1CF7B 3BU7A 4HMZA 1NHAA 3V8KA 2P5VA 3CTAA 3RNSA 3P9KA 3HOTA 4LD5A 5HDGA 4WK8F 2CWEA 3REOA 1F9NA 4BNCA 1YIOA 4IEYA 2K9ZA 4M9XA 1UIJA 3FM5A 1SMYF 3HSRA 3KP3A 3IWZA 1EP0A 2E1CA 4PGHA 1R1TA 2HTJA 2VBZA 1H1MA 2M30A 3ZQ7A 5IT9Z 1DZTA 2Q4SA 2XGXA 4ENJA 5KBFA 4IEZA 3V7SA 5A2QK 1G4DA 2XAJA 2ZJ2A 2IP2A 2W24A 4L9VA 4DQ2A 2M8EA 3DEUA 3RTRA 1ZG5A 1OMIA 1BIAA 4B29A 3FMRA 1IRGA 1FBQA 2OPKA 1FP2A 2EA4A 4BXUA 4MGYE 2FBIA 1X82A 2YR2A 4UHTA 2XL7A 4Q48A 1XRUA 4PCQA 2F4PA 1LDKB 5J6XA
chains in the Genus database with same CATH superfamily
4PCRA 2IGKA 1S0EA 3WV6A 4SLIA 4KDPA 3CCVI 1MS8A 1W05A 2JB8A 1NT0A 4OQ9A 1APNA 3MYXA 3IRQA 4C3IJ 2NS7A 4S04A 1FY7A 3ACLA 4AGVA 2H0BA 4KUMA 5F5AA 4UUSB 2XH6A 2VI6A 4P9LA 5FYIA 3LSRA 4DO0A 4LBJA 4X1EA 4XYXA 2NRAC 2E1OA 1H2NA 2B7YA 5LBBA 1BOBA 2H1KA 4HF2A 2DCYA 2GXAA 1OKOA 4Q4W1 5KCMA 3CU7A 3SEPA 3U4XA 3PQJA 2C0ZA 4MXWB 4LKFA 1OXCA 2VU9A 3GEZA 4AVSA 1Z7S3 4MX3A 2ARAA 3KT1A 2R7TA 3SCFA 2QSHX 2UXNA 3GVAA 1AL21 2IGNA 2OX0A 3DP7A 4IHYA 2GMMA 3G6EI 2ETHA 1P4WA 4XJZA 2CUJA 2NQYA 5L19A 3DYOA 1BKZA 4NN0A 1MVEA 2R7UA 5IAVA 3VZLA 2ZJPF 2P4WA 3BZKA 2V5DA 3CZ6A 2WO7A 1QJU3 2Q8KA 4CE8A 4K20A 2HWF3 2ZNYA 4BQAA 2DCKA 1RVF3 2E2HJ 1HJGA 1XXNA 2YYOA 3ZQHA 2GNDA 5F1RA 4KN7X 1PO21 1LTEA 4L0ZB 1U0JA 1HJFA 2KISA 3DN7A 1RINA 4KITB 2B42B 3KIOA 2PLV2 1PO11 3H42B 2E7WA 2HNHA 4EM0B 3BTAA 4NHMA 3RWNA 3M4OJ 2VO5A 2UWMA 1W0OA 4XKCA 2IXKA 4DB5A 4AWDA 2K7LA 3H35A 1LR5A 1K5MC 4RAZA 5L9RA 3K69A 5EG0A 2PHLA 1TT5B 2X9DA 2OCCH 2M4GA 4DIQA 1C4RA 1Y9MA 3DKXA 4YGDA 1B4AA 3ECHA 3DUIA 4QPIA 2BERA 2VMFA 1EA3A 2ZGKA 1QXJA 2OYZA 4MZUA 1YW9A 1RUI2 5BY5A 2KKOA 4Y13A 3O12A 1D4M1 3GZEA 2QGUA 4CCMA 2B8MA 1SACA 2P2KA 4Q1RA 1RESA 4JK1X 3A23A 4JGZA 1XCVA 1TZLA 3PU3A 3KP6A 4RS5A 4EJOA 3RKQA 4IEOA 2WA3A 4MGIE 2BOIA 1MZEA 3OIQA 3RS6A 2VVEA 3FMQA 2JEMA 2O03A 4YEJA 4J1XA 4RB3C 4QX8A 2Y30A 1I1EA 1RUH2 4QPGB 5HNFA 1FIPA 3N7LA 4YW1A 1M4WA 4PQQA 3AP9A 3KLSA 3WY6A 3KF3A 4XCAA 5FYHA 3ES4A 2R7OA 2UUZA 5IHRA 5K5OA 1FMD2 1IQDC 3ZFGB 4LO6B 5HVQC 4XW3A 4D1QA 3WG1A 1MMAA 4XDOA 3JTGA 4EN9B 2WO2A 1TW2A 4JGYB 5FZ6A 3VKFC 5KAFC 3HKZN 1TQPA 3JRFA 1VBE3 1WW5A 1MSEC 1CIWA 5FK8A 2L9RA 3ZYBA 2XJTA 3ASNH 1WJFA 1WW6A 5A70A 2YC2A 2ELHA 2OW4A 4GB32 1G3WA 4CP0A 2VECA 4G9SB 1Z6RA 2ADUA 4AVCA 4YYOA 1LB2A 3EBRA 1ZTRA 4LO5B 4QM9A 2W4SA 1OH3A 2GM4A 1TEIA 3WTTC 2XLGA 2ZEYA 5JXIA 2Z3YA 4YM3A 1ND2A 1V6LA 5FZOA 3PUBA 5EEAA 2G9GA 3GTJJ 3KZYA 2D40A 4L11A 3BTLA 2ZAHA 1SFUA 3ZR5A 3SZGA 2VMDA 1QQP3 2JA7J 2EA7A 2RNJA 3AZZA 4D7TA 4YVSB 4IF4A 2FOWA 4CZSA 4HA8A 2ZX2A 4CYCA 1GKBA 3H8XA 3N36A 5CISA 4W65A 3WHBA 1JZ7A 5JDBA 3PFYA 4QLCU 2QQWA 3JRCA 1SFKA 5TISC 1GZWB 4HN1A 2M0MA 2ZX0A 3MAJA 1IV6A 1WWXA 5J7MA 3ACFA 4ET7A 4QQOA 1OLTA 3ILRA 2BV6A 2GBYA 4FX0A 2FNAA 4YVWC 4BJTA 2MYSA 4HLXA 3FLTA 2FNPA 1REPC 4AE2A 3H0OA 1QU0A 2TRTA 3Q8CA 4FE7A 2P5LC 1RUC3 2Q8CA 5LRSA 4N9IA 1LAJA 2Y26A 3ILNA 2XF6A 4N53C 3H9JA 5BPDA 5ABJC 1C57A 3QH6A 1FOD1 3CJIC 2TNFA 4YVWB 2A69F 2KDOA 3PNAA 3LWFA 2VW0A 2GMPA 3SXWA 2D93A 5IK8A 2E1MB 2Y0SA 1ONAA 1T38A 2VAUA 5A80A 4Q4Y3 3B7MA 1X4PA 2X5IB 4PDWB 1UYYA 1X1BA 3GCMA 5FYTA 1FOXA 4JDMA 3GBGA 1CQ9A 1E3HA 4HL0A 4QQPA 1XYPA 2EIDA 4B4PA 2A5WA 2X6YA 2CUFA 2HKOA 2DK8A 1B59A 5CFCA 1NLRA 3OOPA 3I2KA 2VBPA 4I0BA 1WMDA 4CDXB 2RC4A 1MBGA 2V1DA 4N4OB 4CYCB 3ZXKA 2FZ1A 4XUPA 3LSPA 1VAMA 3WQBA 4WBBA 1Q43A 2A6YA 2ZKNA 2VUJA 4IVNA 5FY7A 3P5JA 5FKNA 4BMBA 5FYBA 2JA5J 4RGXA 1CAVA 3O0WA 5CJ9A 1VQ5I 3PO2J 1NA1B 1EUTA 2E9QA 1EPZA 5H9PA 1UMHA 3EYPA 1MEC3 3L2HA 1DU6A 4XRSA 1YS7A 4Z1VA 3HT1A 3PM1A 4XFIA 3DQVC 5ILSA 5GTHC 1R5HA 5IWFA 3LAPA 1ZR4A 3ZQQA 1UMZA 2ZO4A 4ZZDA 1XE0A 4FVVA 4GB31 2MSYA 2IWGB 2WKKA 1W7PA 2L9VA 3P7NA 3ME2A 4B7EA 1G59A 4TLFA 4Y33A 2B45X 3HSEA 2DJIA 4XFHA 4A6SA 1U8RA 1ULOA 3J26N 3FZ3A 2Y6FA 3FN9A 3CDLA 2VJXA 3FE5A 3S1MJ 1W6MA 2VQAA 2E51A 4BMEA 2DMTA 1SAUA 4FFIA 4P9JA 4KU7A 2XHKA 2W92A 4KMUX 2A70A 5FZ3A 4S2FA 3CD6I 2D5HA 3OUIA 4XLHA 1RUC1 3KQ4B 5IW0A 2Z5WA 1FYUA 4XC9A 2K9LA 4Y17A 4K21A 4DYRA 4IRIA 2XBO2 1V6NA 3VFZA 4XEZA 1YFYA 3HPHA 3KLNA 1RUI3 1OQ1A 1AX2A 1VPHA 3I3BA 4C1WA 3FDYA 1ZRDA 4XMYA 4XM3A 1VP6A 4CEYA 3TB0A 5FZ8A 3FXOA 3DL3A 3WGHA 5FRMA 1OA4A 4BDZA 3BCAA 2XBO3 1ASJ2 2X29A 2ZXIA 3DPLC 3I59A 3Q0UA 3HZJA 1WLDA 1EH7A 5KXCA 2OC6A 2NLRA 1FOD3 3OYHA 1COV1 4LIUA 1F2NA 2WL1A 1SG3A 2BNNA 3CF2A 3HL2A 4PZJA 2ZACA 4A44A 3RJPA 1BQPA 1PM7A 3B00A 3WG3A 3VKMA 1FOD2 3GFMA 1ODMA 1QJY3 1VAVA 4XBQA 1W03A 2VW1A 1I5PA 3VLBB 5DAVA 1JU4A 3IDEA 4IV3C 1DU0A 4CXFA 4HSLA 1QJY2 5AC92 2KXLA 1YI9A 1BJZA 1RI7A 1GWMA 2X53S 3H9AA 5E3LA 3AZYA 3CP8A 4HG6B 3BG9A 2VXJA 4GMP1 3SDGA 4JAAA 1EUUA 1LE8A 5BXXA 1CD3G 1Y8QB 1GQHA 4BDVB 2ZKLA 5CFDA 1FNZA 4B1RA 1ZBE2 3ABTA 2IFWA 5KC5A 2WAQN 4W6YA 1R1UA 3S0MA 4NMIA 3S1QJ 2QYOA 4WM7A 2LKSA 5D8AC 5IVEA 1YW8A 2BVMA 4CH7A 4E4HA 1AZDA 2D6LX 3BG7A 2Q5TA 4A3XA 4PJJA 4DJAA 2Z1DA 4UFMA 2WZ8A 5IVBA 3K4KA 4XAAA 1A6CA 4LBQD 4MSVA 2KJCA 1NXD1 2DTZA 2JWTA 1OSGA 2YGLA 5DAQA 4OHYA 2GC3A 2LSOA 2LFBA 1GFF2 1UIKA 5T5PA 1J09A 2GC1A 5TJJA 1HXDA 1QNWA 5KAIC 2CO5A 1NCRB 5FZHA 1FV3A 3OGVA 3CMMA 4KISA 3MIEA 3LFIA 4CEWA 2EIGA 4X0GA 1GVDA 2AEZA 2V72A 1PP7U 5HDNA 4GKXA 4UW4A 3CL1A 3K6GA 1XE7A 1HW2A 3VKNA 3F9KA 3HOZJ 3AXDA 1NTCA 3S15J 2ISZA 2VZTA 1X4OA 3S93A 4MTEA 3DTIA 4BEHB 3EB7A 3R6SA 2YHJA 3HKZA 4KWLA 1TLHB 2XF7A 2YU9J 3V56A 2DCJA 1RUC2 3KYCB 3BZ6A 1RUJ2 3AKZA 3JRAA 1VR3A 1LENA 3VBOC 4P1WA 2CWSA 1Q5OA 4RA2A 2OV7A 2QUFA 4LE4A 1I3AA 3M4FA 5M5XJ 1LFBA 1IGNA 3NARA 3MDPA 4BOWA 3NW4A 2CS3A 3KCXA 4C2MJ 2JQ7A 3APBA 4CP1A 3JQWA 4XURA 1HDDC 3TNQA 3IH4A 2DBNA 1EAH3 4GMP3 2BBYA 1IS4A 1ETWA 3LNQA 4R4XA 1O3SA 2DT7B 2DQRA 2YUSA 4D0QA 5HXVA 1G9FA 3DLLF 2QSGX 5IVYA 3AJYA 3OY8A 1VQNI 4CICA 5JSPA 5EFUA 2WDBA 2OQGA 3KV9A 2EV0A 2XB5A 2QQJA 1ORKA 3U1XA 4YIFA 3CHXA 1HRV1 3LPGA 4D3WA 3M8LA 2CAUA 3HTSB 4XF4A 3LWCA 3TGNA 2O8QA 2R7DA 4XRFA 4JBAA 4KWUA 5KHHA 3CUQC 2VZOA 2CQKA 3IHUA 3HRTA 1LKNA 1W99A 1NG7A 5FP8A 5T54A 1LCLA 2D3SA 2PMHA 4QHBA 5CKQA 1QJEA 4YW7A 5FY4A 3PUIA 5FV3A 2LNBA 5AONA 2ZAAA 1JT6A 2CU7A 4RQPC 3N7MA 1HB4A 5AC91 4XUTA 4YFWA 4L9TA 3ZP5A 1SD7A 1N3OA 2VPRA 2CFXA 3ZSJA 2OKXA 2XJUA 4IV3A 4G6DA 5DEQA 4P00B 1LOEA 1LEBA 3GTGJ 1S55A 4DXSA 3U75A 2RHPA 4L5JA 1T95A 1MPXA 2VJIA 3LIHA 3RZOJ 4NRMA 5FKOA 2WAOA 1JUIA 5CKMA 3VWBA 1XNAA 4FCYA 1PK6B 3LQQA 2IS1A 3G73A 3HTUA 1MGTA 1W4MA 3R0RA 3S17J 1XC5A 4A3CJ 3DF8A 5DUKA 1N25A 4CXYA 4WXCA 1OI6A 2WIIB 1LOBA 4IV1B 3DXJF 4DZPA 1BL0A 4D6RA 5BNPA 5D8LB 4LO4B 2L9LA 1BMV2 2DFCA 2HQNA 4XF3A 3AP5A 3NQOA 1XNTA 2L3DA 5EJ3A 3VBUB 2HBTA 2HOTA 5GKAC 3HVDA 2G1MA 1QNYA 4E7HA 2Y8KA 1H8AC 3B5LB 3SYTA 4F55A 2R5ZA 1CIYA 2FQPA 3USUA 4IQJA 4HKLA 1ON2A 3A7QA 3ZN1A 5EWSA 2BOJA 2L54A 3WDYA 3CC2I 2KIUA 3JRIA 4LULA 4RGSA 5J4YA 3VYTB 1NZIA 4EVIA 4JQFA 1LVKA 3VZNA 3ZYRA 5L9BA 1SFEA 5A3MA 1FTZA 2DURA 1VALA 3OPZA 3LCPA 1B09A 1ON1A 1NZCA 2PMUA 4UVCA 3HQXA 5JCTA 2NP0A 5B5EC 5GLZA 4ASLA 3KPHA 4Y1XA 5EP9A 1LU1A 3TKYA 4XZUG 1EYBA 5KXEA 3P1IA 2JDKA 4N43B 3KVAA 4ZYDA 1J7KA 2XOMA 2XWBB 4C0HA 1XE8A 3MF6A 3AKTA 3PUSA 1BM9A 4NHXA 1DP0A 2VUCA 5A32A 2RJ2A 2VQGA 4MQVA 3H1YA 1ZH5A 2OF7A 2EFOA 3R0JA 3FHQA 4AGRA 2GU9A 4A3DJ 2J1TA 2FDIA 4IV1A 1WKMA 2ACJA 4E7JA 4WVMB 1W8UA 1W6PB 1Y4WA 2M45A 3UK9A 4OUMA 3ZDSA 1RUE1 2E36A 4IEPA 2VMIA 2WFF1 2M4KA 4FTEA 1PVEA 2EINH 2XG3A 2M2EA 2YX7A 1PZ7A 3THCA 2XLFA 4XLEA 3VBSC 2OZ6A 2VMHA 3I4IA 3GMEA 2CY6A 1IUYA 4BISA 2EILH 2X48A 1OCPA 5F27A 3BTCA 1OPMA 1Y43B 1MQTB 3WT3A 5IOYA 4LKEA 1R4MB 1SLIA 1WLWA 1UZCA 3MF9A 1OA3A 2YFZA 4OZOA 2Q0AA 4PJYA 1RUF1 4EWEA 4G7ZF 2O3FA 1UPIA 4WCGA 4QPQA 2QQLA 3RI9A 2ZMEB 3H1CA 2JN6A 4EEFG 1ZQ3P 2XWJB 1CGPA 3HT2A 1O5UA 3ZXEA 4AI2A 1OYIA 4OZXA 4FFHA 5C71A 1AHDP 2LY1A 1PYVA 4Z2YA 4LOCA 2MHFA 1D8JA 2ZGOA 2VZPA 4B3AA 4YG3A 2WQ8A 3L09A 2ELJA 5JXJA 3BZCA 1GU3A 4XONA 2R3SA 1FV2A 3BCBA 1YI2I 2E7TA 3A03A 1QVTA 4NE9A 2H8WA 2M3AA 3OSGA 2RQPA 3ZYHA 3KE2A 3OL4A 5FGMA 1VQ7I 4LMFA 1X33A 4AU7A 3MLJA 4ES8A 2QVOA 3GTLJ 4HOOA 4KQ7A 1QHDA 3HD8B 3ZYJB 1HXS3 2DFBA 5D5XB 4L9NA 1CX4A 5FCCA 4NIGA 5EJ1B 4NDLA 1SLAA 5K9YA 4O7XA 2HZTA 3O7OA 4FPYA 4II3A 2DF7A 2A68F 2P6SA 3O6BB 1K78B 1MQTA 1AR72 3WDXA 3JREA 5GAHJ 3R4KA 1VZ0A 1MW7A 3QACA 1IDYA 3BROA 3ASIA 4QM8A 3O1OA 2LALA 4FPCA 4PFPA 3AXEA 4GJZA 2I74A 5GLUA 5E1RA 4HDVA 1ZZ9A 2CGOA 4MLOA 2I07B 3IT8A 3VPRA 3N05A 3HRUA 4ESJA 1CAWA 1OF3A 1JXSA 1F36A 5C3EJ 2X51A 3VB2A 3LSTA 5C9AA 3RQIA 2OJED 2B9VA 5EV7A 4N53B 2ZFUA 4A6EA 3I4PA 2ZX4A 5D21A 2FJ1A 2GH2A 4YZ1A 2F5DA 1GOGA 1O3TA 2E5NA 1LOFC 3FUOA 2B9UA 5LA2A 3FXQA 2UY8A 3VHPA 1GYKA 3C2GA 2RS51 3CKHA 1MEC1 1PIV2 1RMU3 2O0OA 1XMAA 4YRDA 5K0UC 2JKBA 2VUMJ 3VBFC 3IC7A 1JKRC 4XN0A 3K2AA 4N9HA 2ZGQA 1S3JA 4IDZA 1G3TA 2YGMA 3CC7I 1D4VB 5IP9J 3JR9A 2HWF1 2PHXA 1WI3A 2R5YB 2IBDA 3N7JA 2XGEA 1O5LA 3D6EA 2YFUA 4MH0E 2FUG2 2CSGA 1ULDA 2RS33 2BBVA 4B48A 5JOZA 3BT9A 2E34A 3PUAA 4A3EJ 3BYWA 1S2BA 1F8VA 1IV8A 1BR1A 2RS31 2HVRA 1AX1A 1O8PA 4QWNA 5ICGA 4Q4Y1 3ZQLA 1MS9A 3JXSA 3AKRA 2AXTC 5AIPA 4AI1A 4FOVA 3BOQA 2KA3A 3ZFFA 3QP5A 5FBZA 2BEOA 1LDDA 2DDBA 3RSNA 3S57A 3BDDA 2PTMA 2OTLI 4KMQA 1W36D 2XL9A 4KMFA 1VFCA 5T55A 2W0XA 3VHOA 4OUSA 1S1AA 4FPHA 4Y4RA 3H0DA 1OCCH 3K51A 1R1A1 3B93A 2ETEA 4LBLA 3WW1A 3CF6E 2CDOA 4QHOA 1ONVA 2UXXA 3LE0A 4U0VA 1A04A 3WCRA 2XSDC 5KHDA 3LSJA 1BI2A 5HCBA 3UGGA 2WZR1 1IG7A 2RG4A 2FD5A 3LA3A 5DXDA 3KEQA 2V9KA 1UX6A 1B9NA 1CONA 4LITA 1KD7A 3T2PA 2DW4A 1AOYA 1GR3A 1QY4A 1X50A 5L3BA 4AFBA 4AQ2A 4IEQA 3JUUA 4F93B 5J09A 2VOWA 3LSKA 4CDGA 5E8AA 3PVEA 2LROA 3MVPA 4UFHA 1OYYA 2BE5F 3EXUA 5JVGF 2HEYF 2WSUA 1QJFA 4P9IA 1MBKA 2QZ3A 1P2FA 2L7MP 3ZIXA 5H6RA 2X1CA 3FXKA 3WSOA 3MV01 2VODA 4I98B 4XOPA 5T3NA 2KIQA 1O7FA 3MICA 3H9QA 1VQMI 4PJLA 4LT5A 1HKQA 2Q1ZB 2IVIB 2BP6A 2DUPA 4Y4YA 5F0FA 4Q26A 4ETSA 4XJWA 3LOCA 2W48A 3K3OA 3MUY1 2J42A 1MNDA 4QGMA 1W3VA 2VZ1A 5C8CB 5ABJB 3RZGA 1ZYBA 4LNVA 1SCSA 1BC8C 4A3MJ 3IKTA 1DIWA 1EAH1 2PLYA 4LOTA 1UL9A 1R1A3 3ESWB 1UYZA 2VZRA 1AKHB 2MG4A 3AL0B 3HMYA 1VMJA 3PMSA 2IXHA 1KYZA 3OYEA 4Q27A 5I0SA 2XGDA 1LFUP 1LHNA 3K75B 1QA6A 5ED4A 2MNGA 2XVCA 3UKGA 2Q1MA 1ND2B 5JHUA 1O57A 1E5IA 4XFBA 2WNUA 3FC0A 2BW3B 2PHDA 1POGA 1G3SA 1B8IB 2UY9A 5A3UA 5K7FA 4IQPA 4AEDC 4M73A 2J22A 3VDXA 5FXWA 1PK6C 1QVUA 4DOUA 1YQ2A 3CCUI 2RS12 4YLZA 5E89A 1UOBA 4XK4A 5G05L 2ET7A 4CP9A 4BUPA 5DZGA 1LECA 3OD4A 3FM3A 1K7AA 2IS4A 1H4HA 3QOEA 1VBD2 1POV1 2IA2A 3IPVB 2MC3A 1BEV1 3CMYA 2BV4A 4HQMA 3VYSB 1US3A 2VXRA 1CR7A 5F32A 3AB0A 4LOSA 3DXUA 4DY5A 1OC1A 2Y0IA 4DRVA 1GNYA 3BALA 5TGTA 1BN5A 4QKBA 4FXKB 1WBFA 3JQXA 2P6HA 4NNJA 4J25A 3T08A 2G9WA 5B1AH 2JRMA 2CNAA 2KFDA 1RUOA 3MW4A 3JSPA 5DAXA 4HPQA 4CA9A 3KFWX 1NXMA 4OYUA 3PO3J 3WTYC 3JBG2 3CQZJ 1US2A 2D3PA 3V4GA 3A01B 4S2DA 1PMJX 1DP7P 1B1BA 5DCFA 4IGPA 4M0NA 4BJ0A 2JVHA 4EM1A 2HS5A 1Q56A 2D97A 4YW2A 5E1ZB 3ZFGC 3JBG3 5FYZA 4XVHA 2QZ8A 3OB8A 1ZZ6A 2JE8A 2Y75A 3LOBA 3OYMA 4NHLA 2FOKA 2VNVA 2ZGPA 3W21A 4GALA 3I4NJ 1S0FA 4LO8A 4HW0A 1XB4A 2BDRA 3VN4A 1IF1A 3WINE 4JHZA 3SEEA 1W0TA 2W7NA 4EYUA 3WEZA 2DO7A 4NQWB 1KFXL 4M4RA 2GIZA 1K61A 1STMA 4EMSA 1ENXA 2JRTA 3H3ZA 3CJIA 3CESA 1WLTA 1EV11 1H8TA 1VMFA 2ZPXA 3QPHA 5E6HA 1FX7A 3AAFA 3POGA 3HBZA 3IRRA 2ATFA 1FAYA 5D1IA 1GXQA 3J7AY 2X0LA 3HOXJ 3LSEA 4CVUA 4COZA 1FP1D 3G2BA 5HS8A 4Q0QA 2L4MA 4Y1ZA 3AVRA 1PDNC 4B1MA 4M01A 1YQ5A 3OL3A 3J7HA 2VQUA 2YPJA 5FY1A 3OEBA 1SD4A 3GCWA 2A3WA 1H6YA 1QHHD 5JPNB 2DDUA 2JX9A 2ZZQA 1CF7B 5IVCA 3P9KA 1IC8A 4L5EA 4LD5A 3S32A 2OT7A 3LF7A 5LCWL 1T8IA 4FQZA 1F9NA 1YIOA 5IUQA 1W6NB 1SMYF 2PMZN 3HSRA 1TMF1 1MBJA 1EP0A 3WDTA 3PJYA 2O9LA 1IS6A 1VQ4I 1R1TA 4PGHA 2HTJA 1QJX3 2VH9A 1DZTA 5IVJA 5KBFA 1AL0G 1OLMA 4IEZA 3IUOA 3V7SA 1IDZA 2VUAA 3O1PA 5LY2A 3U78A 3FISA 2W24A 3DEUA 3KVBA 3RFRA 3GJAA 1UY4A 2KQRA 1PUFA 1VBD1 5CIRA 1WJDA 1W6OA 4BXUA 2FBIA 5FYMA 4XL9A 3H36A 5B66C 4COUA 2ZC2A 3RMXA 4UHTA 4MIMA 1K42A 2VC1A 3G71I 1U9OA 1O3RA 3KD4A 3JAMK 4QIWN 2DVFA 2B63J 1VIWB 4BLJA 1MS4A 3U2RA 5F1JA 2VULA 3KZIC 1ZG1A 1YUDA 4NBQA 2BW8A 1ZBA1 3L2CA 4E4DX 3H92A 2W39A 1UELB 1SLCA 1T6SA 4XFCA 2WS93 5B4NA 3AP6A 1AXKA 1ND3C 1YRNB 4HX8A 2OD5A 3NAPA 2Z2SB 4DZJA 2EFWA 3I4MJ 2TCTA 1C8M1 4IE0A 5ACA3 4QSHA 2RDPA 4Z82A 2DUOA 3PIJA 2IC1A 2WS91 3FX3A 2ZX1A 2VKHA 1HB3A 1YNAA 3ZMUA 4BBSJ 1WGXA 3WX5A 3PIOF 2LP0A 1AR83 3WW4A 3GDBA 5CYYA 2ZGUA 4IXLA 3M3OA 4AFDA 1FPN3 3S3NA 1SBEA 5CKNA 4W6WA 3AJZA 2HVSA 4I3PA 1R58A 2DOFA 3I3EA 1N1VA 4YG2F 3BJAA 2LS6A 5C4XJ 2D1VA 2A5YB 5CQGA 4RFRB 1SPPB 3DWLE 3T8RA 3UL2A 4CTEA 1FJLA 2EXIA 5LHIA 2QBYA 2VZUA 4JHTA 3NQHA 2XV4S 4PJNA 3QWLA 4K1YA 1PUFB 2E71A 3TEDA 1UZ0A 1W6OB 2D6KA 4RDUA 2HWC3 2WNUC 4U36A 4QPIC 2UWBA 2VN2A 3M8EA 2Y0OA 3DCQA 4Y15A 4QB1A 5JSRA 3LFUA 2RDNA 3LOIA 3VBSB 4AUXA 1YJNI 2BJSA 5A1FA 4W97A 1RUJ3 2B4KA 1Y0UA 1W1WE 3ABZA 3BTJA 3JTHA 4OFGA 1POQA 4Q4X2 3BIEA 4QQ2A 4WX9A 5H6QA 2GWRA 1A5JA 2NAZA 2XUMA 2DA3A 5KK1A 1NCRA 2Y69H 2CV0A 2YG0A 1OPOA 4PUSA 3ABUA 3MLKA 4I99C 1S29A 3T0AA 3H7YA 2HOSA 3S5AA 1QDCA 4Q4X3 1HBXG 4M3CE 4DMIA 4ZDOA 2QCSB 4PLOA 4XBFA 1PUEE 4XACA 3HEIA 3PTYA 2E7AA 3VYRB 2C4XA 4CA0A 2P4EA 4LKDA 4OU0A 5CKTA 1CX1A 2VNGA 3NWSA 5HS7A 1W7PB 2Y9YA 1BVP1 3FXRA 3JSOA 3A2KA 4IL7A 1RITA 4LUMA 1HV0A 2PHWA 1N1YA 1NUKA 1YG2A 4JX5A 4Y1VA 2I45A 1Y6IA 2IVMA 3U1KA 5IPAA 1AYM2 1PVC1 4LBOA 5AIQA 3CO2A 4HFSA 3UJQA 2YXSA 3AZWA 2WINB 1IN4A 2P7CB 2WJSA 4HPKB 2WNVC 3QLQA 2VD7A 2WR9A 3KV5A 1OQEA 2DVAA 3IP4B 3FF5A 2HWB2 4JGZB 4B44A 5ISLA 2V4JC 1EH6A 3ALQA 1JS9A 1H89C 1KU3A 3BKZA 1EKEA 1YOVB 4ZTFA 4XKBA 3F8MA 1R49A 1RUH1 1DQ4A 4HKWA 2FRHA 5FZFA 2WZR2 4GA9A 3LGRA 2P8TA 1K4TA 5I8TA 4IOAF 3ECQA 4UWDA 5DM6F 3NJYA 1I50J 1OKRA 2DVDA 3K77A 3TP3A 1UF2C 2I5UA 1NQDA 2B39A 1KQ0A 5HLTA 2MH2A 4CXWA 4ASNA 1Y1WJ 1P8JA 4YGCA 3U4SA 4R9DA 3K4CA 1D5VA 5FPZA 3JB8A 4R52A 5HLIA 3UV9A 5D6FA 4ZPIA 3CMGA 1H2KA 3TW7A 2A61A 4EE2A 1J9IA 2LW8A 3JB4C 2NN8A 5FP4A 1ND3A 3ACHA 3V0AB 4H2AA 1YYVA 4I01A 2IXCA 5J40A 2QQOA 4LG3A 3NNJA 2RR12 1W5CC 4ZZLA 2A6WA 1SLBA 5DDJ2 4NHYA 2NVXJ 1MMGA 1X58A 3K4AA 4XQWA 1JHJA 1W2NA 4META 5AVAA 3DKYA 3F8NA 1XX5A 2O61A 1AR91 3QCWA 5FKMA 2Y9ZA 5K8SA 4ZYEA 3LDRA 2UV1A 2CU5A 2D5FA 4XF9A 1CZVA 1JZ6A 4CPBA 3F8BA 3I2OA 1BLZA 5IFTA 4NPLA 2FHRA 2GZWA 5KXBA 3SJMA 5C3RA 4CZZA 3QYEA 3DEMA 1D0GA 3N9OA 4L99A 4V1PA 4AHWA 4RHV3 3POWA 4EM2A 1XNBA 2LTNA 4C3JJ 4D8MA 2P3YA 3QODA 3T5XA 3H1WA 2F5VA 2IXSA 2XJQA 1XSQA 3ZR8X 3AK0A 1RMU1 1LOFA 2DA1A 5JHFA 1HF0A 3CJRB 5JAXA 4ZHNA 5KR7A 1UU4A 2ZBKA 2WAAA 4MHGA 1T2XA 2R49A 1RUG1 4XLCA 4FISA 4P5YA 3L9JT 4U2AA 4MXVA 4RA0A 3AM2A 2LRDA 2D45A 1G3YA 3AMQA 3K4LA 1WCMJ 5IP7J 1VRH2 3AKPA 4AF9A 3HC7A 1JU3A 2EB7A 3NV3A 1ACCA 4ISQA 3KF5A 2CW7A 4QQLA 4XF1A 5FQ0A 3ZMDA 2VL8A 3HUGA 1NCQA 3VZOA 3POEA 2V1XA 3KETA 2YV8A 2ZGLA 4XQFA 3Q9VA 2E31A 2JJ6A 2STTA 4LB5A 4YW6A 1V6IA 1XMKA 2VMCA 3LSMA 1O91A 2VM9A 5I0UA 2WAFA 1FZPB 5B1BH 1X1AA 4ITVA 1Y9QA 2LY2A 4BQWA 3FMSA 1MDMA 1JUSA 2Y0SN 1FC3A 3J7LA 1QO0D 2CUEA 3I3MA 5DCMB 2E53A 4AI9A 5I8YA 4XILA 2ID4A 1AR62 4PIXA 1V6OA 1LODA 3WG4A 1HOMA 4XXAA 4IHSA 4K9SA 1TME2 5TRDA 2W1OA 4KL1A 3TO7A 3E97A 4KGQA 4K2EA 2HPMA 4G94A 3WNOA 2L0KA 5EQUA 5IT3A 1N1TA 2W82A 3J7ZI 4PJMA 4Y5TA 2AACA 4LHLA 4YIRX 5EDNA 1IGOA 1BZWA 2E2JJ 3HNYM 2WA4A 3C18A 5FD5A 2LREA 3KYDB 5KC6A 2LDUA 3C7EA 2E2IJ 5CVIA 4AGGA 4RLQA 1HKSA 2ZZJA 3GF2A 2K27A 1Y1VJ 4I76A 1Y9GA 2XAFA 5JR7B 1PO12 5J47A 3IDBB 3WUDA 5BNNC 4M3FA 4OIOF 4FAHA 2A6EF 3IAM2 1UKRA 2OCEA 3MMYB 1AR92 2IZWA 4B3NA 3OYBA 1JYTA 5J1YA 3OMYA 3T2TA 3W59A 3OYNA 2YMZA 2ENRA 2JB4A 3CCLI 4UF0B 4EROA 4XHBA 1IG3A 4MGKE 3CJTB 1IUFA 2FCUA 4L9BA 5AFEA 4W1UA 2B9SA 1O59A 4O65A 2DA7A 2W1QA 2VXDA 1YHQI 5C5UA 5E17F 3O1RA 3CJXA 1IQAA 2L7ZA 1IO2A 1B72B 1KS5A 3J8F1 2D1HA 5FLJA 1W2UA 3AYDA 3H9GA 4PF1A 3BOWA 4HVRA 1K78A 1W8ZA 2CQNA 2GP3A 3RZKA 4FOYA 3FIWA 1GHCA 3WUCA 3F6VA 3I59B 3K4BA 3A1YA 2HFHA 1R082 4NRPA 4MHRA 4EJUA 4FETA 3R4UA 3OUJA 4DW6A 2PLV1 4DPNA 4XN3A 1Y3TA 3MFKA 2L5QA 4BM8A 5A6YA 3A0KA 4CCLA 1O4YA 4OWRB 2YU1A 4CCCA 1YLLA 4CP2A 2R4GA 3MN2A 1Q3EA 2XJPA 3MW3A 2ISYA 2ZHKA 4IV3B 1DF0A 1H9WA 2V7FA 1TW3A 4CCOA 3ZDVA 3Q9SA 5D5UB 1KU2A 1PIV1 1XG1A 5C33A 1Z0XA 3SH3A 1F5TA 2VOOA 1XS9A 4MQ9F 2Y6GA 4P14A 4DEVA 5LY1A 4M6XA 4A3LJ 1R5ID 1HRI1 4QXKA 4QQHA 2K85A 4IRGA 5M3FJ 5CG8A 1DPRA 1DCSA 2PFWA 2Q2EA 3BR6A 3I71A 2GSYA 4MTDA 5LASA 3C7FA 3OCPA 2RREA 3HJRA 5FREA 4XXPA 2FMLA 4LLLA 3LPFA 4UY8I 2HDWA 4BHPA 1TMF3 4BXXJ 2JG8C 4JKKA 3OOXA 4FQGA 2P0WA 2FCVA 4Y1UA 4A3GJ 1DZRA 1ZBE3 1S72I 5BNOC 5FKKA 3E1F1 3S7IA 4QX5A 2HTSA 3H50A 1BXHA 2CJJA 3JRBA 4ESFA 1FT9A 2CFOA 3RYPA 3K9TA 1XBFA 5JR3A 4Z07A 2P34A 2O8KA 3HBKA 5FZBA 2GN3A 1OLQA 1YFXA 4G3YC 3UR3C 5IK4A 2FQ3A 3N9LA 4HG2A 5LHGA 5HCHA 4TXWA 3AVSA 1GXPA 4CEYC 3LA2A 1Q1VA 3MZYA 5D8KB 2ZMLA 1GBGA 4YW3A 3AG2H 5LRRA 2VE1A 1WI9A 2FDKA 2HWC2 3MO4A 3DLAA 4OCTA 4ASKA 1XNCA 1WJBA 3G1MA 3HOSA 3VBRA 5IOZA 2AH2A 5H2FC 4IESA 2W95A 1QIQA 4UUTA 2OAZA 4P5OA 2IGMA 3J7YJ 5GM0A 1UB9A 3ZVXA 4E4ZA 1JYWA 4OIPF 1WCSA 1COV3 4EGZA 1JH5A 2K9SA 1A6QA 4HNUA 4I09A 1QDOA 3RG0A 4M3EA 3WTZA 1IN8A 2FMYA 4GYIA 1RUI1 1KDKA 3E6BA 1E57A 2XQXA 2QDRA 4LLGF 2WQZC 2IGOA 3S1RJ 4X8PA 2A05A 1UW8A 3WG2A 3EHKA 1Y7BA 1GZCA 4PJ0C 4EN7B 4LBNA 2XRLA 2EFPA 3MEPA 3PFIA 3PNYA 3TOBA 1FATA 2D6PA 5APAA 3WVJA 4ES9A 4G12A 2R043 3M2MA 4ANJA 2P1BA 4LLOA 2ZTNA 2R6QA 2UYBA 2D98A 1XGOA 4L9JA 3C1DA 4C2UA 5F6LB 1YI7A 1LHWA 4H55A 4UT5A 5A7OA 5L7OC 2VOPA 3GXOA 3RPUD 4CDXC 2VZ3A 4YGEA 1RPWA 3AYEA 1I6XA 2XPJA 1ENRA 4TZDA 2IUWA 1NK3P 4DUVA 1BC7C 1MEC2 4IHXA 4Q0SA 4AEDB 3BG3A 1SBDA 4WVWA 1J2XA 2XB0X 4BDYA 4PDWC 2QF7A 1MZ5A 2YU3A 4RS5C 4B8EA 3HQRA 5A6XA 4AK3A 2L7KA 1RHI3 1DBNA 1QH6A 3CO6C 2PN6A 1N47A 5FO5A 4EJVA 1C1FA 4Q29A 2MEV1 3ZQIA 3VDAA 4B47A 1UHWA 4BB3A 4YZ3A 1QXRA 3HJEA 4YELA 2DMNA 1ZZCA 3LEMA 3SNMA 3FBYA 2ZGRA 2KL4A 2W91A 2BZTA 3IWFA 5HDKA 3FK6A 4GJYA 3IZOA 2XB6C 2O8OA 4DS0A 2R062 3TL4X 4UNOA 1C5HA 1I5ZA 3LQCA 3ABMH 1KRIA 5GADJ 1WD4A 2YB7A 3DFGA 5DG2A 4BQ4A 5EG0B 2MABA 3CZUA 2LLKA 3KWVA 1YQCA 2VUDA 1U6GA 4RLFA 1ZR2A 1GP4A 1UMIA 5DDGA 5IVFA 3ZQGA 3O1UA 1N1SA 3INAA 2P3IA 1JZ3A 1OCRH 2ELKA 1RUH3 2HWVA 3H3LA 4UUVA 5IT9K 1WMXA 3JCUC 5EYRA 3UETA 1XYOA 1FWZA 4GRIA 3SMHA 1Z3YA 5E18F 2OZJA 1RL3A 3TN92 2Y6LA 4ISRA 5F3CA 2EIKH 4WF2A 1JI8A 2A3XA 2ZOEB 4D7YA 3G1LA 3TEXA 4OULA 2V4AA 2A73B 4HVOA 4RN5A 5I91A 4CUCA 2IS6A 2M7AA 4FOQA 4RFT0 4LK0F 4BQ1A 3ZMOA 3DEWA 2QA4I 4LR4A 4JTNA 3OF1A 4FPFA 2OPTA 1CAXB 1ND2C 2R32A 2ZGMA 4A6DA 1U12A 1H9PA 1C0WA 3NJXA 5DUVA 3ZFGA 4HF1A 1YQAA 1U3EM 1KONA 2WFF2 5EYXA 4LBQB 3K1NA 3F8FA 4N43A 1DHKB 5LBCA 4COVA 1W8NA 3KEOA 1Z05A 3H5AA 3BP8A 3L7WA 1ENSA 3MIGA 1EH8A 3WE3A 1W9WA 5FZMA 2COBA 4BJ5C 5FBJA 4CDUC 3GFIA 2RMU2 4AI0A 2ME0A 1B35B 1N77A 1MS5A 1K79A 3GYDA 3D0SA 5M0TA 4BKXA 5JZGA 1RKWA 5FY0A 4RS5B 1JUHA 2FCTA 1TT0A 3MZ8A 1Z3XA 2CW0F 2DCTA 4P9YA 1QF3A 3AMNA 1AYM1 4IRHA 4NIAA 4ESBA 2H6BA 1JMUB 3MQ0A 1UU6A 2E33A 3PVNA 2ZXJA 3AKSA 4P9GA 3K7AJ 1OR7A 3J4UH 4YVSC 3IDAA 4K7JA 1XSXA 2GA2A 2EXJA 1S7AA 1FPQA 3UESA 2B7EA 1UMQA 3HRSA 4IERA 2W57A 3RCOA 1UHSA 3LFMA 1KJRA 1F35A 2XLAA 2QLZA 3MCZA 2LYCA 3BTZA 3J80Z 4A2UA 4KFCA 1W8TA 1B35C 3BOPA 4B43A 2ZKZA 4NROA 2ZMEA 5FXZA 3OR1C 5L3CA 4XFGA 3OY9A 2K9MA 1MH4A 1XJAA 5J96B 2CDPA 1X3WB 2G7HA 2BU9A 2RVCA 3B3QE 4FPGA 3DECA 4XFAA 1AR61 3ZPYA 3V64A 2BVBA 3K0LA 1AWCA 5FYSA 2VZSA 4UUSA 2JE9A 1Q1HA 3S6PA 3W9AA 1ZGJA 2D7FA 2HWD1 3F23A 4ZH4F 1PM4A 5FAXA 2VGDA 2MD0A 4BIOA 4N90A 3E5UA 3PNVA 3GTOJ 4RR3A 1D5YA 2NMNA 3DBHB 5CZKA 4FOWA 1JBCA 3AFHA 1H9TA 4RHV1 4CHUA 3O1SA 4Q5SF 1REDA 4RGRA 4QGLA 1ZZ7A 2LR8A 5JMCA 3VD4A 3POFA 3POJA 2X6OA 1ACIA 3CF5F 2E7QA 1LNSA 2Y60A 2X5IA 2XVLA 2KT0A 4PDWA 2PAEA 3LQRA 1XYNA 1UQXA 3P6BA 1IXRC 4ATEA 4KIGA 3M7GA 3SZPA 3ZXDA 1MZBA 4NIDA 5J8FA 3FXMA 4Y24A 1QGLA 5HCAA 4XBLA 2F6CA 1Z7S1 3QPTA 5L7OA 5ABJA 1UG0A 3CO7C 2RS52 2QWWA 1LULA 2W9XA 3EQEA 1PO23 3BIWE 3T0BA 2H1LA 5FZIA 3BPZA 3BVCA 3H8OA 4ZDLA 2ZFWA 2F2EA 3QH7A 2A7AA 3ZCOA 3LEIA 3M70A 5J36A 2PHFA 4M9ZA 3ZSKA 5LK7B 4H0EA 5FZ9A 1CWPA 2JDAA 4FTBA 1W9TA 2MPFA 4OOIA 1T39A 1LDJA 4LO7A 2RV9A 5GLTA 4FI9A 3S2HJ 4HK9A 4MADA 4LA3A 3O1VA 4RM3A 1TQIA 4G8XA 1BA5A 1ENHA 4ENNA 4XJ8A 3HOWJ 2W1UA 2KLOA 2DT6A 5D6EA 3HM5A 3FBNB 4GMP0 2W3JA 4KN4X 2XSJC 3A22A 1W28A 1IRFA 2O8XA 1VMHA 3U11A 1J59A 1SAXA 4U0WA 3LEKA 2YY1A 4Z6YA 2QBYB 2R063 1F4AA 2MLGA 4A4AA 3BJOA 2F6BA 5ICEA 1FXZA 4TV7A 4GIQA 2HZDA 2SBAA 5LGUA 4ZYHA 2CRGA 1ZRIA 2Q30A 3OD0A 2VR4A 2WBKA 1UN1A 4XCBA 4UBGA 3F8CA 3URFA 2WAEA 2IRFG 5FZAA 4OMYA 4RB0A 1SEFA 2IEKA 4ZU4A 3HHHA 1UD1A 3E5QA 4NQWA 4FTHA 2D6MA 4UB8C 5ERLA 2DODA 2K02A 2DTYA 5A33B 3OYCA 2HYFA 2STWA 1PP8F 1ULEA 3T09A 2XPVA 4XIDA 2HDCA 2IA1A 3T8TA 4OI0A 1WH7A 1J58A 4E7IA 1UY2A 1ZZ8A 4Q47A 3OYDA 4CDWC 5BV6A 4RR3C 3GXUA 4GGGA 4CEWC 4KT6A 3A01A 3V7RA 3CMAI 1I3HA 1W6MB 3GCXA 1HDPA 4DGWB 3HQUA 5JXHA 3OG2A 1OJLA 1AUYA 3SKVA 5F3EA 4AAXA 4HF0A 2V1UA 3NNGA 4HRIA 2R93J 4OMCA 4RHV2 1OOPA 3MZHA 5F6KA 2XJSA 5JOXA 3M3EA 3GZAA 3G4SI 5C9AC 3UKNA 4JV4A 3OYIA 2XXZA 5IYYA 2WS92 2ZMEC 1CZSA 3RZHA 4F3QA 5FPXA 4N0BA 5DAPA 3O1TA 4PK4A 2JK3A 1QJX1 1ZZBA 1XNDA 3LDKA 4ZJZA 5A7SA 2PJPA 4IEWA 1ZK8A 2HOEA 4KIBA 3OYLA 1XPXA 1JJ6C 4G7HF 3KZZA 2QQ9A 1SHWB 1DGWY 2R7XA 1LE8B 3EUHA 1VQ9I 1MMDA 5GAEJ 4YVSA 5K7PA 2E19A 1Q8PA 1ZA7A 4PSXA 4LK7A 2WSVA 3AZXA 3KX2A 4TYSA 2LC2A 4UVBA 4L8QA 2VW2A 3I2IA 2DLLA 4HQEA 5FZEA 3WHCA 3UKVA 4DXTA 2Z42A 2BUKA 1PX3A 4KWJA 1LJ9A 2OS2A 3ENRA 1F4HA 2QQ8A 4NO4A 4M6VA 1CF7A 3FFQA 4M9SA 5L3GA 3VKLA 4P5HA 3WG9A 3KZ4C 2Y31A 4PLNA 2FE3A 2ZGTA 2KRHA 4RMNA 4P9XA 1GP5A 1COV2 2OQ7A 4LIVA 2O6GE 4LFUA 3CDHA 1VBA2 3CP2A 4B4RA 1NA1C 3B6AA 4LMYA 5LHHA 1R092 3V0BB 4LXLA 5LBEA 2W87A 1RVF2 3ZN6A 2PA7A 1KQ9A 1AYN1 4MGRA 3EQLF 1HIXA 3M9AA 2F48A 1HC8A 3MW2A 5L73A 4BE0A 1RJ7A 2KIMA 3BGAA 5CFDB 1XSRA 4JQRA 2I2SA 3E0JB 2WNUB 1VNDA 1XDUA 4QX1A 4OAZA 2BZDA 4D7SA 4WM7B 5L9VA 3OOUA 1SPPA 2LBFA 1QJY1 1V0AA 1OA2A 4E7ZA 4IPAA 3OS1A 4HOBA 3WF1A 3WG7H 5EIYB 4E6KG 3K3NA 1YJWI 1KXGA 4WZFA 2E1MC 1AR71 3ETPA 4BQQA 1S7EA 3U9GA 5JI9A 3SKJE 3VBSA 3FKIJ 1FOKA 2WWUA 3ERED 4HLYA 2D2WA 5IVVA 2CGNA 1SFPA 2QQMA 2L7FP 5BNGA 3I8TA 2ZNZA 5JOYA 1TQMA 2XKOA 4LHKA 1XU2A 1R00A 2PQQA 2VXZA 2ZEZA 3RSJA 1K12A 3JBG1 3MV11 3AG1H 1R1ZA 2K46A 4NHJA 3HOVJ 1APLC 3C2HA 4LE3A 4LORA 2MW8A 1ZRFA 2V6CA 3IV5A 5K7ZA 1IRZA 1WFXA 2DN0A 3KCCA 2ZX3A 5JMOA 2XASA 4F7ZA 4H14A 4AVVA 3UGFA 5H9SA 2PQSA 5E8GA 4HZFA 3HGYA 1AXYA 1EV12 1PNFA 1D8KA 2IFRA 2DCEA 2CGPA 3RZJA 5C44J 1MNEA 3VZJA 4QB2A 2NXNB 4H3WA 3VBHC 4BGDA 1Z77A 1WQ2A 3OYJA 1JTZX 2DWRA 3OY8B 1W6QA 2FBHA 4OHWA 1AR81 1P4XA 1AJKA 1P92A 4GYGA 2ADDA 4DUXA 1I39A 2WC2A 1KU7A 1IJWC 4K3UA 1PX4A 3C3WA 4IETA 3FUQA 1H0MA 1ODNA 1WJEA 5FZGA 4C0BA 4YGBA 5FJKA 2R7ZJ 3WF0A 3L00A 2XC7A 1W0UA 3FBMA 1WD3A 5BNPB 1D7PM 1DGWX 2ME6A 4BH9A 1A8DA 4UW6A 2RDRA 2EAAA 1JUMA 1VQLI 3VBUA 4LG0A 1AU7A 3KT4A 2D43A 4HMZA 4L97A 1ASJ3 2P5VA 3HOTA 5T5OA 4CDWA 1BBT3 1QJX2 2RMU1 4FSJA 1N3PA 3RQ0A 1LHUA 1SDDB 3REOA 4BNCA 2QSFX 3RZLA 2QE3A 5HNHA 3FM5A 1LGNA 4Z92B 4XIOA 5LWBA 3AYAA 2MGQA 3IWZA 2E1CA 3MI8A 1H1MA 2XGXA 4ENJA 3AP7A 3LB9A 3MIFA 2RJLA 1YIJI 1YX5A 3NNLA 1G4DA 2X1EA 4RYDA 4DQ2A 3H0GJ 1ZG5A 4AEMA 2VCCA 1S0GA 5HPOA 3OBAA 3FMRA 1IRGA 3OYWA 1UZYA 3SFIA 2BQPA 1FP2A 3MHZA 2AZ5A 1WJ5A 1NAEA 3VD5A 1W8WA 5EZHA 1XRUA 2O0YA 1LUJB 3T1BA 3IAQA 1JYXA 1DU3D 2D44A 2XMLA 2WN2A 2BWCA 5A2QZ 2PMZA 1DQ6A 4F52A 2CQQA 2DI3A 3MWMA 4RGAA 4A0XA 4QD2A 4EN0A 2FBKA 4QPYA 4GWNA 2GNTA 2YSRA 1HKDA 1JKOC 3DU5A 2Q8EA 2J1SA 2LF7A 4Q4V1 3JRDA 3VGIA 2KR2A 2R30A 2MD5A 1SD6A 3K1MA 1PGW1 2ES3A 2NM1A 2X05A 2OUHA 5E16A 4DINB 1AR73 2DAOA 3KP2A 2BY0A 1C8M2 2VLAA 5FZCA 4K8RB 4CDWB 4DFSA 1YRNA 3EUAA 1JOBA 2GP5A 5BNOA 1NOVA 3K4DA 3RZZA 1BJAA 2NYYA 3VBHB 1V9U2 2LG4A 3J7AO 1IAWA 1C3HA 5G04L 2GQQA 1RETA 1A36A 3CJQB 2RAEA 1G2HA 4BQNA 4H4KC 4U88A 5ILVA 1OFNA 4NB5A 4OMDA 1HN0A 2VE8A 3M8FA 1OLRA 1FPN2 1UOGA 3GLXA 4XOGA 2V5YA 4EGYA 4D0PA 3B73A 2HWF2 4YARA 2K86A 5F0HA 2X10A 2UZKA 1JHFA 5A32B 4B09A 2DU0A 2FD8A 1IS3A 4P96A 4BQ3A 5DZFA 5JIAA 1VBE1 5A1AA 3CBNA 1PGL2 3TMOA 2CWMA 3QYBA 3Q0VA 4Z2WA 3QRFF 4MG2A 4QPOA 1LRHA 2W1SA 4KWKA 3ONQA 2X6XA 3ZSLA 5ERIA 4KU8A 1YITI 2O1QA 4ARYA 4IE7A 3U14A 1DGWA 5FY8A 1MDMB 1WVRA 4BQOA 2JA6J 2XVKA 5GLWA 3Q3SA 4OAYA 4JRAA 1BIBA 1Z7UA 4OIRF 1SBFA 2RM21 1X1PA 5EJZB 3O3KA 2ECBA 3FK7A 1AR93 1A78A 1K5MA 1R71A 5FRNA 4ZC3A 3E6MA 3U10A 2FQ4A 3KGZA 1FEXA 3CJNA 3CNAA 4KI5M 4HYEA 2KMUA 5F3GA 2PXJA 2JSCA 4AI3A 3SFZA 1WKYA 1O4TA 1L3LA 3OR2C 3CCMI 4BL0B 3LAJA 3SHFA 4FPJA 3HDDA 4CCKA 3I53A 2JG8B 4XLFA 1TL8A 1ETKA 1YIPA 3UKTA 3GZTB 4A3BJ 3WTVC 4ZYGA 2L9SA 1O7LA 5KHKA 3BPVA 2M87A 3PL8A 5IYDJ 1Q8OA 4W8JA 3FHNA 5FKCA 1H8VA 4MO7A 1GV5A 4WM8C 1FLIA 4DY3A 1ETQA 1ZLJA 3QU3A 2JDYA 3HIFA 2ZCWA 3L2QA 1SMTA 5J98B 3OYKA 1G8XA 4HETA 4AL9A 2JMWA 5HS9A 1FSEA 2HYXA 2YBSA 3J9SA 1HN1A 3RI8A 4M3CB 2W5FA 4A3ZA 2KHMA 1U5ZA 5JFRA 5FP3A 1K83J 2NVQJ 4AC0A 1Z7LA 1OISA 1ZHFA 4XSXF 1H4GA 2PHRA 1EV7A 2YDEA 1J5YA 1G9AA 2ICWG 3BR3A 2C5DA 3CZJA 1F5FA 5SV8A 1MVQA 1NQJA 1XSDA 2ZJCA 4PSWA 2JIGA 2VJ5A 1B72A 3KLOA 3HRMA 2Y33A 5ICFA 1BHGA 2RQQA 3NNFA 1WHUA 5DV5A 4XABA 2RR13 3H3UA 5DDJ3 1OFSA 1TZOA 2K4BA 2R5ZB 1HV1A 2G9FA 4QT6A 1GUIA 1NE6A 4QXBA 1VQPI 4FX4A 3I2FA 1FNYA 3QYFA 4UYBA 1CAWB 4NWVA 1JZ8A 1X8EA 2R92J 2E6VA 2R0HA 1HW5A 3VDBA 2UURA 3ZX7A 1TTYA 1E3OC 2G19A 2VCBA 2JKXA 2Q1FA 1SFNA 4YW4A 3OTFA 5C4WC 1U5TC 4DZGA 5JIUA 3X29B 1CAUA 2YZ4A 2VPLA 3CIHA 3IMNA 2XBO1 2VBYA 4I30A 1VBC2 3BTXA 4ENKA 4A3KJ 3UNPA 4F92B 5J37A 2JG9C 4MEXF 1IXCA 3LKJA 1KZHA 1W90A 2DT5A 2R5YA 2YC4A 1SEUA 3SISA 1TNFA 1UNBA 3RKYA 2VQLA 2Q2EB 2E26A 4PF5A 3IN9A 2UWCA 4YW5A 3R4DB 2DA6A 4IJAA 2ADEA 3NKGA 2HPIA 4GZ9A 3VUOA 2BGOA 5A7WA 1SDWA 2HGCA 1R093 1VRH3 4YFZA 4GO1A 1V3FA 2ZJQF 1ZBE1 2PHUA 2GH8A 2AENA 2PG4A 1HQNA 5FZ0A 5CAZA 3QQAA 5BPIA 1G9BA 2XONA 1HA8A 5KWRA 5JSOA 5FZ4A 2VZVA 3VL9A 4Q8KA 3RIRA 3PUQA 3E7LA 4KG0A 1QPMA 5EF6A 3IH2A 3LMMA 3SEZA 2ZXQA 5H9RA 4JCKA 1MBFA 3S3MA 3ZQFA 5FZDA 2BHYA 2EFQA 3OGJA 4XMIA 1ERDA 3C7GA 4QX3A 2VT3A 2ZJRF 3O14A 1T98A 5FMCA 4M6YA 3ITQA 4GXLA 3B9IA 4QKNA 1X8MA 2JWPA 4NAMA 4Q4Y2 1XSVA 3UJOA 5FQ0B 2IA0A 3IH3A 4ZZ8A 3LA7A 3AMPA 5DD8A 5C8CA 3MEXA 1VBB3 5E88A 4KA4A 3USSA 5LEKA 4DRRA 1FNNA 1DQ1A 1DDLA 5L3FA 3R0AA 2BXYA 3T2QA 4HBNA 3WGIA 4S2HA 1ZAOA 2PEXA 2ZA9A 4IV1C 2RS13 3FJSA 4NVPA 4C30A 2W94A 1IRXA 2ARXA 1YCIA 5JZGB 4MVTA 1OYWA 4YSFA 1ZM1A 2JIJA 3WNMA 5A7WB 5DG1A 5FO7B 1RHI1 3GX4X 4M3CF 4PLMA 3DTKA 3WP6A 2YU2A 3NAUA 1Z91A 3U0ZA 3AG4H 4LGWA 3L2WA 1NG6A 2RDSA 4HONA 1R36A 1TME3 1YX3A 4QPGC 2XF5A 3M07A 4LKSA 4O9EA 2NOGA 2JG9A 2VOVA 3LSHA 2F4LA 1XPWA 2FDJA 4GAZA 1H0BA 5FJHA 5CVUA 1OR7C 1HB1A 4GWJA 1YO5C 1LKXA 4CU9A 3EYYA 4HNVA 1K4SA 4JVAA 3GZNB 3FKJA 4JC1A 3V7CA 5C4WA 5BNNA 3R61A 2DMUA 1J3RA 2L9NA 2DTWA 5D5VB 4LPLA 2MA3A 1S5LC 3CCJI 4BCUA 1UOFA 4DBRA 4R1HA 4INDA 3OJBA 4GH4A 5EHDA 4CYDA 1KA8A 1EPWA 2RV8A 4NRQA 2PJRB 5D5WB 1W9FA 4BIFA 4ZYAA 1BCXA 1DZQA 1O4ZA 3POYA 2X85A 3W2WA 5KHIA 2VOKA 4Q0UA 2JPCA 3WNLA 1MD0A 5M5YJ 2WFPA 5T5LA 4R4ZA 4MOAA 1J75A 4ASMB 1YC61 4ZONA 3ZXFA 4BQXA 3KM5A 4GFBA 4ZU5A 4R8HA 3TOAA 2XAUA 4A45A 1B8IA 3JD73 1P7IA 2W46A 4BPZA 3IBMA 4PQ9A 2P3KA 1R091 4PIYA 5HODA 1ST8A 2JTVA 5FPBA 4QDSA 5FR3A 4OMZA 3J8F2 1CZTA 5IYBJ 1AYN2 1ZNPA 2QEXI 3WNXA 4BYYA 2QZ2A 1XOYA 4ZKTB 2R7VA 3HSFA 1X1DA 3IAS2 5F0CA 2WZR3 3VDDA 2JDUA 1REFA 4S0HB 2G0EA 1TWFJ 3JCIA 2CAVA 4MNUA 1VB2A 1S8NA 4J6GA 4BXSV 4TN7A 1S6LA 3EMRA 1RUG3 3T30A 3QAHA 4LTAA 5C4WB 4AIHA 2Z79A 1FOWA 1W5SA 3ZFFB 3BCWA 2BGPA 1W0NA 4Q0VA 4M00A 4LEJA 5LD2C 2IPQX 4QDQA 2YBKA 5BOXA 2G7UA 1E5SA 2IXIA 4X8NA 1BW6A 2R073 3HAGA 4FPKA 4IE4A 2NVYJ 2LD5A 1JI6A 4AR2A 3NV4A 5E1WA 1W3XA 2XVGA 3VKOA 2A75A 4D6SA 3Q8AA 1BR2A 4YG0A 2WNEA 1FTTA 3IM0A 4Q4V2 4FP2A 2RR11 2XROA 1NKGA 5DDJ1 1PVC2 4PT6A 3O8HA 1ZGWA 4A12A 4XZPA 1UCXA 4HNTA 5JUVA 3H3VK 3FWEA 1NE4A 4JX4A 3NNMA 5K7HA 1HLVA 2EIJH 3ETQA 3I64A 1V6JA 1DGRN 5CBLA 1QXPA 3LDBA 3MIHA 1W36C 1YE9A 2ORXA 1Q8SA 2HLEA 4J19A 1OURA 4UI9L 1H9GA 1QJU1 1NYWA 4IGOA 2OXBA 4XRSG 1CPNA 3W58A 3ZMVA 1L7QA 4L0PA 4UFKA 1IZ1A 1R6RA 4O3MA 5LGTA 3D4KA 5K1YA 3NRUA 1FPN1 1LFPA 4NPMA 2F4IA 1W9YA 5F2SA 4UXAA 5LATA 4D5FA 3POIA 2EICA 4M72A 5KVRA 3S7EA 4V2VA 1DGRA 3HB9A 3I49A 1CJDA 2IW5A 3L2YA 1STZA 4HX4A 2E1NA 1ZELA 3ZMNA 5FMOS 2EZHA 2KZGA 5FY9A 1LU2A 4FQ4A 4XLPF 1YTYA 3BTYA 3I56I 3ZOIA 3K46A 2HDDA 2WV1A 2JPBA 2H94A 1K5JA 3ZMTA 5H20A 2Z16A 1VRH1 2F5EA 2NZ9A 5K0UA 4BQYA 2PAKA 4KH9A 4Q2FA 4RAYA 5GZEA 1LHVA 4YIIA 1W6NA 1NK2P 1S2EA 2XR4A 2DVGA 3KCYA 2BY1A 5A3WA 4ZY9A 2HBUA 3WXPA 1BI0A 1USTA 4BXFA 4WM8B 3C2BA 4WM7C 3WF4A 4Z8BA 1ULYA 2OUJA 4KBZA 3PU8A 5GZCA 3HWJA 5CG9A 1U5XA 1IKQA 1BW5A 3PUHA 2XQRA 5ILUA 3MBWA 3UGHA 3HR9A 3PDQA 5D4RA 3VBRC 2VT2A 1JZ5A 1DYKA 3C2UA 2RNGA 3TYJA 5FRAA 3THDA 5KXDA 1E5HA 1UZWA 3NJZA 2EZLA 2WY7Q 3TRSB 2P3JA 3O2PE 1ZRRA 4CCNA 3E1SA 3VODA 2MLKA 2J1UA 1FX5A 2W52A 2JDZA 1GP6A 2OBPA 3WF3A 3NAPB 1YLFA 2NVUB 1FMD3 2TDXA