4I0AA

Structure of the mutant catabolite gene activator protein v132a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
b'TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKAGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0aA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0aA01
3C18A 3I59B 1MJBA 4YIIA 4H7LA 4PDKA 2FOKA 3J80Z 4YRDA 2XAJA 5HDKA 2D5FA 3RYRA 4MUVA 4YG2F 1OI6A 3ZPLA 2H0VA 4M73A 4MTDA 4TLFA 4H0EA 1MDMB 2D93A 3EHKA 3FMSA 1EV7A 5KHHA 4UXNA 1QPMA 2CV6A 2X0LA 5HOOA 5EEGA 1TNTA 4AQ2A 5H6QA 5LLQA 2COMA 4P9UA 3SFZA 5FPXA 1PMIA 1ZGAA 4PIZA 5F6FA 4D7SA 3REOA 1OPCA 1Z6TA 4LK1F 1K78B 3H9AA 3EJKA 2JSCA 1I6XA 4RAYA 4F8AA 5CVRA 5JSRA 3ES1A 5KHGA 1WLTA 3BJOA 1WGPA 1LEBA 1IN5A 5LRRA 1V3FA 3R0AA 1X8MA 3L00A 2O6GE 4XRFA 1NYWA 2MHFA 3OOPA 2EFQA 1TW3A 1D8JA 4L5IA 1SFNA 4O6JA 4LLNA 1ODDA 1SFXA 4UNOA 2I45A 1J75A 4CZZA 3WODF 3IDCB 2YX4A 5E1ZB 4YFKF 4LG0B 2HTJA 5D8LB 1P92A 4I98B 4U7DA 3H3ZA 5KHJA 1Y3TA 3IWFA 1FYMA 2QQ9A 3CO6C 1YFHA 5LHHA 4UUVA 5TRDA 3TOBA 5LGNA 4A6DA 2IA1A 3BOQA 4HVOA 4X6RB 4BIFA 3ISPA 2KIFA 5FB2A 2DBBA 1ON2A 3RKYA 2GC2A 1MKMA 3GW2A 4L9NA 3RNSA 4OMZA 1LVAA 3F8FA 4FX4A 3Q9VA 4NHJA 2V1UA 4R52A 3SXYA 4CO8A 3KETA 3LAPA 4NQWA 3E5XA 1R36A 3EYIA 1YYVA 1GXQA 3WTVC 3HTSB 3WW1A 2JPCA 4XFFA 4EM0B 4LUKA 2Y75A 2F5DA 2ZFWA 1GVJA 5D6FA 3L2HA 2GH2A 3T8TA 2Z3YA 3IBMA 2KJBA 4L9VA 2M8EA 4P9GA 1HXDA 1ULYA 1SQ4A 1R00A 3GO5A 1ZX5A 3D82A 2FNAA 2VBWA 4I01A 2J5PA 2VPVA 4RB3C 4HDUA 1IF1A 4KU8A 3ZN1A 1BIBA 1LNWA 4ASNA 1J2XA 2BV6A 4IJAA 3TNPB 1U2WA 1KU2A 3LAJA 3MAJA 2XAFA 3S2WA 1HKTA 1G3SA 2FMLA 2E7XA 1SFEA 2XUBA 2PJPA 3CO2A 5D4RA 2V1XA 2CFXA 2XRNA 2WC2A 2HYFA 5AIQA 4MGZE 4IEPA 3F21A 4KT5C 2MH9A 4OU0A 3JSPA 3LFKA 1IPJA 4MNUA 1YW7A 5HVQC 2OYZA 1FI2A 1CF7B 2D5HA 1B4AA 4MGRA 5HS9A 1FXZA 3BPZA 3V8KA 3WTZA 2XLAA 2P5KA 2A6EF 4WXCA 2IA0A 2ZJ2A 4M6YA 2ZO4A 2PN6A 4OLLA 1LB2A 3WGGA 4ZU5A 3FWEA 1ZRDA 3SXWA 5LGTA 2MC3A 1XCVA 3CL1A 2Z5UA 3V7SA 1TNSA 1FYLA 1IN6A 4MH0E 3IC7A 1ZLJA 2CO5A 3K9TA 5E16A 1ZARA 1ZREA 2B0LA 5F64A 4LB5A 3CDHA 3CLPA 4K2EA 1S7OA 3WGIA 3DV8A 3ABUA 4GGGA 2R7DA 2OD5A 1JXSA 4L5JA 4IEXA 1RNLA 1OYYA 2P6TA 2LKPA 3NKTA 4EVIA 3L9FA 1X8EA 5FQ0A 2ESHA 1U12A 2D1VA 5BMZA 4ESBA 3LQQA 2O8XA 2D2WA 2VQAA 4META 3R60A 1ZNPA 3WG9A 3HHGA 3NL1A 4O9GA 4XSXF 3KMHA 1NE4A 3F6OA 3P9CA 3FF5A 2HS5A 5FFZA 3CTAA 5E1XA 5D5VB 5DD8A 2BNNA 4BNCA 1MJ9A 3FE5A 3GWZA 5A2QK 1DUXC 4AIJA 2NAZA 3HIFA 3CLOA 5I8SA 2EJRA 3F6VA 1KA8A 3BJAA 3NJZA 2MD5A 4EGYA 1R5HA 4KWLA 4EM1A 3PQJA 4R79A 2PLYA 3FXUA 3QPTA 4G6QA 4G7OF 3DP7A 1O3TA 4MQVA 3KP5A 4Q0QA 4G9YA 4YYOA 2ESNA 2IW5A 4EMSA 1XCBA 4HBLA 1STZA 3I64A 3LOIA 2E1NA 2H6CA 1IAWA 2QVSB 4HQMA 3EUHA 2BGCA 1ZZ8A 3GFLA 2Q1ZB 3NSTA 3F8CA 5J7MA 3HQXA 3W6KB 1JGSA 1ZN2A 1X82A 2B5HA 5FLIA 3C7JA 1BOAA 3T1BA 1YO5C 1LKNA 1R7JA 5D8KB 4UBHA 5FLJA 2DQRA 4XLPF 5CVVA 3SHFA 1K78A 3IRQA 4E2QA 2PBIA 4M6XA 5JVTA 3R4KA 4G7ZF 2EWNA 3IHUA 3IIAA 1U8RA 5JSPA 1YW8A 1SEFA 2GC3A 2ZBKA 1JUHA 2O8QA 2XROA 2RC4A 3IKTA 4L9TA 4HV6A 1BC7C 3K1NA 5I93A 1FBSA 3U0ZA 4ZYDA 2MPFA 3FJSA 3JAMZ 2BNMA 5J3UA 2VT3A 2QVOA 2W85A 3OTFA 2A3SA 2ISYA 4HVQA 3ELNA 3VHRA 4EJOA 5FDBA 4UVAA 5E20A 2VBZA 3HT1A 3GXOA 4EWAA 4LD5A 2ETHA 2KKOA 3L2CA 2MA3A 2GWRA 2VBXA 3SQNA 3ZMZA 4KDPA 1XD7A 3WTWC 2FEZA 3LSTA 2STWA 4LMYA 5EZWA 3O3KA 1IXCA 2PTMA 5DUKA 2XLFA 5BQTA 4TV7A 4HW0A 1XDUA 4IEWA 4I02A 2EA7A 1HSTA 4IETA 1XGMA 2NNYA 4FHTA 1TQ5A 2DK8A 2HTSA 1FOKA 1OFNA 3M1EA 3KP6A 3WE2A 1YLLA 4XF4A 4ENJA 2RDPA 2O61A 1R22A 1CGPA 2L4AA 3U11A 4LLGF 1W4MA 1LDKB 3QP5A 4UVCA 5FGMA 2BNOA 3GVAA 3FXQA 5D1IA 2GA2A 1YFWA 1ZRFA 2HZTA 1BBYA 3KE2A 2ISZA 1KU3A 3D5LA 1BC8C 4XFIA 5CVJA 3VFZA 1EH7A 2ETEA 1BI1A 4JTNA 2PHLA 2DLLA 2QUFA 5DCFA 3HOTA 2FE3A 4XFAA 1ZVFA 4XEZA 3V7RA 1F9NA 2QM3A 5HDNA 3TO7A 5FLXK 3HUGA 1SFUA 1Q5OA 1K6OA 3B02A 1Z9CA 2IXLA 3I0TA 5BOXA 1YWKA 1HKSA 2XAQA 3BPVA 3MQ0A 2UZKA 2XAHA 5HS8A 5DCMA 3GFMA 4DQ2A 5FQ0B 2HEOA 4IRHA 3RJPA 4IEOA 4LA2A 3QU6A 2LSOA 2MH2A 4HQEA 1UPIA 3HOSA 5E18F 4MHGA 3PVBB 2UYBA 4O9EA 2HQRA 3ML6A 4S04A 4O3MA 4JV4A 4RGRA 2D1HA 4AVCA 5C8WA 5LEKA 4EWEA 2M30A 5ERIA 4AIKA 4BXUA 1IN7A 1ZZBA 2EA4A 1ZGJA 3WE3A 4CHUA 2C0ZA 2HGCA 1PDNC 4ZU7A 4HBNA 1G6NA 3TKYA 5E8GA 2L02A 2IT0A 2YU3A 1HW5A 1R58A 5ICFA 2DCTA 3RTRA 5K8SA 4LULA 3F22A 2WFPA 5J6XA 4WBBA 2OAZA 1J59A 1FLIA 5FD6A 3MCZA 4YFXF 2VONA 4HLYA 2L54A 2Y0OA 2JT1A 2PMHA 4KMFA 3LA2A 1QQIA 4KIGA 3SCHA 3HHHA 4Q48A 1BI2A 4EJVA 4OIPF 1O5LA 1YFUA 3LWFA 1UFMA 2DAOA 1JHHA 4OOIA 1FBUA 1ON1A 2W57A 1DDNA 3NVCA 2RKHA 3ZMSA 4MTEA 2ATFA 5LEJA 1ZRCA 2Z99A 4Q29A 1ZLKA 2QQAA 4L9JA 1HBXG 2ET1A 3P9KA 4IPAA 2O1QA 1J9IA 2RNJA 5K1YA 5D5XB 3C1DA 1OMIA 2UY8A 5L3BA 2E1CA 3WW4A 2C6YA 3BWGA 2A07F 1L3JA 3K1MA 1TQPA 3LZZA 1P6RA 1V70A 3NEUA 3E6BA 2V09A 4L0YB 3S7EA 3KP4A 1REPC 1GQHA 4A0ZA 1Z7UA 4WVZA 1O3SA 4XFBA 4Q0UA 3DPLC 3E5QA 1J3PA 2Q2EA 4IRIA 1QZYA 1R1TA 2ADUA 1FSEA 3I71A 1L3LA 1GHCA 1P4XA 2O0YA 3USSA 2WTEA 3E6DA 2HQNA 1QBJA 4HX4A 3H92A 2PHDA 2XIGA 2YSRA 4KNYA 3EDPA 3J81K 4QGLA 2OQRA 3E3VA 3F72A 3ULQB 4QWQA 4ZYGA 2ZXJA 1TW2A 1H9GA 1PP7U 3KEQA 4U0VA 5H20A 1YLFA 4XSZF 3FFQA 4A2UA 1I1SA 3GX4X 1WA4A 2UXNA 4WZCA 1XMKA 4DINB 2IXKA 2DQLA 5BY5A 1ZG5A 4DNCA 3WW3A 3QACA 1U5TC 3JTGA 2IXIA 4MGIE 4MQ9F 4J1WA 4LB6B 4PIYA 4JVAA 5CYVA 4Z2YA 2GC1A 3WTXC 4QGMA 1Q3EA 1SMYF 2CG4A 4RGSA 2VC0A 3KZYA 5JR3A 1Z6RA 2EV6A 4IHTA 1W7PD 5T3NA 4UBGA 4XF1A 2H09A 3HSRA 4ESJA 1S3JA 2DI3A 1RL3A 4M9ZA 1EPZA 2VODA 2K02A 3E6CC 2W24A 2K4JA 4LA3A 4ENKA 4YFNF 1TLHB 2QCSB 2EFOA 1O3RA 5IT9Z 1W5SA 3DL3A 3O14A 4O5VA 1ONVA 3KFWX 2CWEA 3GYDA 4CICA 3ROUA 5LRSA 1PP8F 1XSVA 2A5YB 3ELKA 3WTYC 4J1XA 2OZJA 1G3WA 4MGYE 4I0AA 4BAYA 1VTNC 2WWYA 5D5UB 1FSHA 4K8FA 5DEQA 1L0OC 1YFXA 1T39A 3C3WA 1FC3A 3DEUA 4YSFA 1J3QA 2IC1A 1J0RA 2XKOA 2Q4SA 4BYYA 4IEVA 2VXZA 3G73A 3EQEA 5KHIA 1UHMA 1YHFA 4FX0A 2OU2A 2OQGA 2QENA 1VR3A 5DCMB 3T8RA 4NVPA 2Z2SB 4M72A 1K79A 1FWZA 4Y13A 4IEZA 2LDUA 1EH6A 4Q0PA 4WCGA 2HJIA 4N9IA 2XV4S 5FD5A 2F5EA 4MEXF 3M9AA 5IT9K 4QXKA 4OIRF 2JZYA 1Q1HA 4WF2A 1P4AA 2KRFA 2ZCWA 1I1GA 1UB9A 1P4WA 3TO6A 1USTA 1SD4A 1R1VA 1FY7A 4IF4A 5FPZA 4B8XA 2A6HF 2PFWA 5A2QZ 2PA7A 5CLSA 2V6CA 3OD0A 4EGZA 5JI6A 4I09A 4YARA 1ZRRA 2XGXA 3ES4A 3BPXA 1Y9QA 2GU9A 4RD7A 3IRRA 3I4PA 4M9SA 3V7CA 5JFRA 1H0MA 4U7BA 4PCQA 4CGZA 2QLZA 3KGLA 2VECA 4LTAA 1KU7A 4UHTA 2VE9A 3QRFF 2FBKA 2M87A 2FRHA 2PI0A 3PNAA 2E9QA 4CXFA 1UIJA 2QJVA 4ZZLA 3OF1A 1U6GA 2FNPA 3R61A 2Q0AA 3VEPA 1MZBA 2EFNA 2FMYA 2DO7A 3CUOA 4HN1A 1FNNA 4LJZF 1D5VA 3U2RA 2Q0OA 2DT5A 3SZTA 2O3FA 5EFUA 2ZKZA 2FXAA 1IXSB 3R0JA 1AWCA 1NE6A 1IPKA 4EWDA 4MGKE 2VBYA 1HW2A 1MD0A 2P8TA 3K1PA 2GAUA 2XL9A 4A5MA 3BROA 4GULA 2PAMA 2IJLA 5DDGA 2VN2A 1XMAA 4M71A 2QNKA 4B09A 3L09A 3JW4A 3BJ6A 1B9MA 2G7HA 3CF6E 1SAXA 3H3UA 4AQ6A 1JHFA 5EEHA 3CUQC 2JTVA 4EQQA 1NZCA 1OYIA 2FF4A 1EY2A 2ACJA 4YNIA 4N9HA 3PQKA 1H9TA 4N0BA 2CSOA 1QY4A 4KMUX 3WTSC 1TTYA 1RC6A 2HKOA 2CAUA 3G3ZA 1IXRC 5CVUA 4HA8A 1O7LA 1SD5A 3HRSA 3PFIA 3DF8A 2AS5F 1ZG3A 3TDUC 1KU9A 3WGHA 2AXLA 1B6AA 4JK1X 1QWRA 4JTOA 1MJAA 4E2SA 4JBAA 3HRMA 3QOPA 1YS6A 5AVPA 3MPBA 1KQ9A 3MDPA 1CAUA 5HDGA 4MZUA 1VJ2A 4KWKA 4XFCA 4IXAA 1BN5A 1V4RA 3MFKA 4PIXA 3CUQA 2IA2A 1ZZCA 3AAFA 1I27A 1I5ZA 4HX7A 3U10A 1ZG1A 1DP7P 2GA1A 2PYTA 3E6MA 1UW8A 1HW1A 5J8CA 3HRUA 3F8BA 5LBQA 2HFHA 3HRTA 4GYIA 1XGSA 1T2KA 3OCPA 3S7IA 4P55A 4PGGA 2CYYA 3U9GA 2RN7A 2BE5F 4XETA 1KYZA 2EV0A 2WV0A 2OZ6A 2CW0F 4I2OA 2QWWA 5L3EA 4F7ZA 1YIOA 1ZZ6A 2Q30A 2VC1A 1YG2A 3BY6A 4U88A 5E1WA 4FBFA 4ESFA 4KIBA 3KLNA 1YQAA 5DV5A 2OA2A 5I8TA 3O6BB 5FLXZ 4IERA 2UY9A 2STTA 6PAXA 5ICGA 4HSJA 3DKWA 3RIRA 4BQAA 1J3RA 2D40A 3GEZA 2EK5A 3FXRA 3VB2A 2M1BA 1YTYA 3NQOA 1LDJA 3GYHX 2L4MA 3ECOA 3IDBB 3ABTA 4QX5A 3QAHA 2LNBA 4U0YA 1IRGA 1Y0UA 3RKXA 5HLIA 3LA3A 4M74A 5ILVA 1RIOH 4IRGA 1XDSA 1J5YA 2XLGA 1U78A 1S7AA 2CAVA 4ZYHA 5E8IA 3H1MA 2IXJA 3W6JB 3LWCA 2D45A 3COAC 2NNNA 3ETQA 4HN0A 5HLGA 2UWMA 1K7AA 4HV5A 4UV8A 1GQGA 2YPRA 1ZZ7A 4KIFA 1W7PA 1O5UA 4A12A 1IUYA 3N4MA 5JR7B 4PJYA 2F4PA 4QGNA 3Q9SA 2PAKA 4KFCA 3MEXA 3CJXA 4HX8A 1CAWA 2DFIA 1ZYRF 2NRAC 1LJ9A 4EROA 2JPBA 4OMYA 1ZH5A 3E5UA 3E97A 1SD6A 3F3XA 4G6DA 4HLXA 4JQFA 3S0MA 3TO9A 2YR2A 1FP2A 4RS8A 3KEOA 4G7HF 2NYXA 1D3YA 3NW4A 4I7HA 5LHIA 4L18B 3MYXA 5BUVA 2PQQA 4BHPA 4Q4ZF 3BCWA 4S05A 1OD5A 2B8MA 2A61A 3I5UA 2BBYA 3BZ6A 2IXHA 2Z9OA 3GFJA 5D4SA 3FHZA 4G94A 1TQMA 5DYMA 2K7LA 1F1ZA 2PQ8A 4Q5SF 3ACLA 1O57A 3PLQA 3UKVA 1DPUA 5BS6A 2XVCA 4LUMA 3KLOA 3M8EA 1U3EM 4ONUA 2GQQA 4RAZA 4B29A 3M3IA 2DTRA 2FU4A 4RB1A 4ORFA 1BI3A 5I8YA 1ZHFA 1F5TA 1ZAOA 1O3QA 2MBFA 4AD9A 4Y17A 4OIQF 3MZHA 1UCRA 3J81Z 1IN4A 2W84A 5JAXA 3HYIA 4ZZDA 1H1MA 5CJ9A 4KU7A 3D0JA 3ZMVA 5CADA 5JSOA 1FT9A 2HKXA 2R7FA 3N97A 3LQRA 2RQPA 3EBRA 2A69F 4UVBA 1S6LA 1QGPA 4E70A 4Q0SA 2V1DA 1S29A 5ED4A 5J8FA 2GXBA 1P2FA 1XE7A 3VOEA 3ZDSA 1CAUB 1J1LA 1CAVA 2IP2A 2K0GA 1SMTA 1YW9A 4CDGA 3LA7A 3H1YA 4IEUA 4LK0F 3CUQB 4IEYA 2FBHA 2P5LC 1FP1D 1F4KA 3TDZC 2ELHA 1UIKA 2F5CA 5E17F 4AVAA 3D0SA 3KP7A 4GYGA 1Q43A 3LAGA 3TNQA 2QYOA 1BJAA 4UV9A 5HI0A 1T0FA 1IN8A 4MEYF 1O7FA 2ZKLA 4HLTA 1USSA 2G7UA 1BIAA 5E1RA 3GLXA 3OGJA 2PEXA 4BHCA 2F5FA 3KZZA 5HLHA 1EYBA 2HOEA 1UD1A 2CGPA 1LDDA 4HF1A 2EVXA 3HTUA 4IESA 1B59A 4QM8A 3J80K 4I3PA 3DQVC 2IRFG 1B1BA 1R5GA 2ZMEB 1CAXA 2UYAA 1G3YA 2K4BA 3GZ5A 3EO6A 2PAEA 1IRFA 5FLHA 2UXXA 1G4DA 1LEAA 1O4TA 5KVRA 1NHAA 2EFPA 4ON0A 5TJJA 1W5TA 4PZJA 1ZZ9A 3DFGA 1WKMA 1UHWA 3F8NA 4L0ZB 5IT3A 2ET7A 4Q0VA 2P7CB 3FM3A 3IWZA 1FX7A 2DK5A 3QPHA 4MX3A 1XRUA 3Q5FA 3WU1B 1QXRA 3I7DA 2LF7A 2NS0A 1DPRA 1NXMA 1U5TA 4WXHA 4WXDA 2EA2A 1G3TA 1TBXA 2TDXA 2P17A 3K0LA 1C0WA 1HKQA 4LLLA 4OFGA 2MLKA 1W7PB 2A68F 3KGZA 5I0UA 5BPIA 1GXPA 3BP8A 1BI0A 4E2GA 2FQPA 3TQNA 3UKTA 4KYWA 1XSXA 5D6EA 4OIOF 4QM9A 4GO1A 3V8JA 1XN7A 2N7GA 1H1IA 1LQ1A 4YIFA 1CAWB 3BALA 3VODA 4RB0A 2P4WA 3HSEA 3M70A 1FYKA 3FMRA 1WWXA 5DD4A 1WQ2A 5BPDA 3SZPA 3RPQA 1X3UA 1J7KA 4XFGA 3IL2A 1UCXA 3U1DA 3GBFA 4GCVA 4HOBA 1KYWA 2K9ZA 5I91A 2QBYA 2O03A 3HT2A 1JE8A 1T98A 1J58A 3WTUC 3F23A 4HYEA 4XF9A 2GXGA 2KJCA 4LFUA 2P5VA 1WRJA 3H7YA 1IZ1A 1A04A 3TGNA 1KQ0A 5DUIA 3EETA 4R1HA 1TQIA 4ZH4F 4Z82A 4KN7X 4EJWA 1XB4A 2IPQX 5AIPA 3SCGA 2L3DA 2Z69A 2IXCA 4HMZA 1QXJA 4EJUA 4D7TA 5D5WB 2EAAA 2ZNZA 3I58A 3B73A 1CX4A 2RV8A 3BB6A 2MLGA 5L3GA 4KWJA 4KL1A 3JTHA 5ILSA 3P7NA 3DN7A 3G7DA 2KIMA 3T0YA 1EH8A 1QNTA 1FPQA 1S8NA 2GZWA 4UXAA 5L3FA 5K5RA 2EV5A 1DGWA 4OINF 3WU0A 3FMQA 1VP6A 4HVRA 1Z91A 2GC0A 2KIUA 3RYKA 4XF3A 3K2ZA 4FT8A 3GFIA 3FZ3A 4LLOA 5I0RA 2BYVE 1RUOA 1OKRA 3OV8A 1QZZA 4EM2A 1T6SA 3RYPA 1Z1DA 2OPKA 3IKVA 3RDIA 1CAVB 4FAGA 2EFWA 5HS7A 2FQ3A 4A5NA 1IW7F 2QQBA 3WTTC 3J7AO 3ECHA 4P96A 3H8UA 5I0TA 2F2EA 4Q47A 2PG4A 4KICA 4I0BA 3O2PE 5LHGA 4Z07A 1T38A 3SHRA 2K27A 4EV0A 1X7NA 3FZVA 3TOAA 4P9FA 1OR7A 2Z33A 1EP0A 3I59A 5KK1A 4KA4A 4ZYEA 2L01A 3RPUA 2W25A 4XF0A 3GZ6A 2Q8KA 4A0XA 1CAXB 4AWXB 2QDRA 3SCFA 1MDMA 1E2XA 3P9IA 2FA5A 1KGSA 4BH9A 2RGVA 4ENMA 3M7GA 2B9UA 3BDDA 2G9WA 5K5QA 3EQLF 4NB5A 3CJNA 5JCTA 3FM5A 3ZMUA 3H7JA 3ZMTA 2DU9A 2HR3A 3QU3A 4MV2A 4WK8F 2KXLA 4AVBA 4P5OA 4R8HA 3KP3A 1BM9A 3RKWA 1RI7A 4IHSA 1YFYA 4Y15A 4D0PA 4ETSA 1HQCA 4HZFA 4A0YA 4AVPA 5L3DA 3I53A 3KCCA 2HWVA 3GUDA 5I0SA 2XKPA 2HDCA 4XBFA 3ZQ7A 2HYGD 4HDVA 2J5OA 1QO0D 2IVMA 3GF2A 3MZYA 1YUDA 2MNGA 5ICEA 5C6CA 2VOOA 1U5TB 5FFXA 2OZUA 2RVCA 4G8XA 3ERED 2GIVA 2VE8A 5L3CA 3DPTA 3CEWA 4XLNF 2ZMEA 1R23A 2XAGA 1HSJA 3FX3A 5LGUA 2H27A 4EJTA 4LG0A 5J48A 2DW4A 4QMAA 3V4GA 2OBPA 1YS7A 3ZP5A 5KHKA 2YX7A 3CO7C 1RUNA 3T5XA 4AXOA 2R3SA 3WW2A 2M45A 5ICCA 2BEOA 4WX9A 2VT2A 1XE8A 1D8KA 1R1UA 3K69A 1FZPB 3JSOA 5AONA 3V8LA 2ZNYA 4L11A 2EB7A 4ENNA 1XSDA 3RI4A 4M9XA 3H1WA 4LGWA 3UKNA 2LF8A 2VOPA 4FAHA 1PUEE 5CU1A 1WI9A 3I54A 2QBYB 3L7WA 4BHBA 4KUMA 2P6SA 3H50A 1DZTA 2OA4A 1WSUA 4LEJA 4QLCU 5ILUA 5FCCA 4HF2A 3JZVA 3SMHA 5KBFA 2K86A 4HAMA 4HF0A 5BV6A 4X6QB 2Y0MA 3JAMK 3BU7A 1XGOA 2FBIA 1RGSA 1RZ4A 4IVNA 1XGNA 1E17A 2E7WA 4PGHA 1PM7A 5K5OA 1OYWA 1RTVA 2XASA 2XL7A 3QP6A 2Y48A 4RB2C 3MWMA 3KSCA 3FHIB 1Z05A 2JRTA 4RGXA 4RGUA 1B9NA 1LR5A 3F8MA 3KP2A 1DGRA 4KN4X 4ZU4A 3NRVA 3ST7A 1DZRA 4CYDA 2X4HA 2V79A 5BXXA 1SD7A 2H94A 1MGTA 3EYYA 4XFHA 5H6RA 1CF7A 2FSWA 2QZ8A 1AOYA 1FBQA 2XHKA 1LRHA 2M5WA 2PFBA 2CQKA 5JHUA 2DPUA 2PMUA 1KQ8A 3M8FA 4L2NA 4GXOA 3ZN0A 5CVIA 3R6SA 5BPXA 3DXJF 4IEQA 2H6BA 3C3VA 3HSFA 4U0WA 2V9VA 5FO5A 4AIHA 3RZZA 4WWCA 2DPDA 5F1RA 3ZMDA 2P7VB 4HSLA 4A6EA
chains in the Genus database with same CATH superfamily
1RUJ1 2M8GX 1GOFA 2WB1A 2VZRA 4HK9A 3LMMA 4QPGC 1MBHA 4PDKA 3J80Z 5J09A 5CNAA 4FPFA 3ZPLA 2H0VA 5EIYB 4M73A 1H8AC 4MTDA 2R061 4TLFA 1A6CA 4UXNA 3I4MJ 4NUBA 4FXGB 3WG7H 3BN6A 5BNPB 3HNMA 5EGOA 1W9TA 2X0LA 2DA6A 2L9RA 1TNTA 4PQQA 4LBQD 1ZGWA 4P9UA 2W91A 4GB33 5F6FA 4D7SA 2EQRA 3URFA 3VZOA 5KHGA 1WLTA 4AAPA 4XRFA 1UYZA 1NK2P 1GZWA 2EFQA 1TW3A 1D8JA 4NWWA 4JOMA 1ODDA 2VZUA 1JOPA 1UXXX 5DZGA 1JH5A 5FJKA 4K40A 1IG7A 2BOIA 4M00A 5E1ZB 3CQOA 4YFKF 2NVTJ 1P92A 3K4KA 2ZJPF 1H4GA 1BW5A 1E3PA 5C70A 5FZHA 1HRI1 3VBHA 3SDBA 1G9FA 1FYMA 2ECBA 3R4UA 1JU4A 5A7NA 3CO6C 4CPBA 3H9QA 4B8EA 3LEKA 1FOD3 5LGNA 2DTZA 3ZFGB 1H6XA 5GLVA 3I49A 5FB2A 2DBBA 1ON2A 4L9NA 3BZCA 1JBCA 1J09A 3P3NA 1XQNA 2V1UA 4R52A 2HWC2 2QSFX 1R36A 1OOPC 4CYCB 3ZXFA 5JXIA 2VM9A 3BLYA 2W3JA 4JRLA 1YI2I 1GXQA 4CDQC 3HTSB 2P4EA 2JPCA 2NOJB 2XF6A 2NP0A 4PJJA 2EBIA 3L2HA 1ODNA 1POQA 3KIOA 1ND2A 1K4SA 5D2AA 3KB5A 4YZ5A 1OD3A 1HXDA 1ULYA 2XWBB 1SQ4A 3DU6A 3AG4H 3HEIA 4JGYC 2VBWA 5CFDA 1SLCA 4Y7NJ 2V26A 4A41A 4XJZA 1LNWA 4FOVA 4IJAA 3NNFA 3POEA 1KU2A 3LAJA 5FYMA 2BY3A 3S2WA 1HKTA 2VMEA 2R6QA 2PJPA 2M9HA 5D4RA 2NOGA 5BNOB 4IHVA 2CH0A 1AZDA 2HYFA 4BJTA 4BMEA 4O65A 4E9KA 4MGZE 4KT5C 3JSPA 4MNUA 1SPPA 1C8M3 2HWF1 2WAQA 5B4XA 1IV8A 2Y31A 5EJZB 4MGRA 4WM7C 2NVQJ 2ZZJA 5GLZA 2HWE1 5DAXA 2PN6A 4OLLA 2AYHA 4ZU5A 1ZRDA 4DQAA 4AUXA 2XBO1 1AX1A 3DGTA 1RUG1 1OA2A 1XCVA 3LQCA 2IGNA 2HBUA 3GTGJ 4CCDA 2A6XA 1FYLA 3THTA 1IN6A 4MH0E 3NJVA 1ZLJA 1RUD3 1ZREA 1V6JA 5F64A 4O7XA 1JYXA 3CLPA 2Q8CA 4K2EA 1RUC3 2P3JA 4XILA 1LULA 1T6GC 3I3MA 2ZMLA 1RNLA 2R7VA 2E7AA 5DS9A 3NKTA 4DRVA 3L9FA 1TWCJ 3OYLA 2HH9A 5F6LB 2D1VA 5BMZA 3LSJA 4ESBA 4DXZA 2D2WA 2KQRA 1POV1 1R092 3VZLA 2AQEA 3NL1A 3WVJA 2VQ0A 2JA7J 5EGOB 2E53A 3PL0A 4CH7A 2WZPP 4M4RA 1OH3A 4HPQA 5A3OA 1FIPA 3PDQA 5E1XA 2R0FA 5D5VB 4BQ3A 4BNCA 1MJ9A 2X09A 2J1VA 3AG3H 1V54H 1SLBA 5HCBA 1UAIA 4A3ZA 4A3CJ 2VKDA 4AIJA 1G2HA 1STMA 1W6NB 2L7KA 2DMUA 3CLOA 5I8SA 1CX1A 4HETA 3F6VA 5LY2A 4R9CA 4CP0A 3WT3A 1GZWB 1E5HA 4RS5C 4YW2A 2XJQA 3MV01 1GP6A 3FXUA 5GZGA 4Z2AA 2FCTA 4G6QA 4AE2A 4XORA 3OPZA 5T55A 4LKSA 3G4SI 4Y26A 3KP5A 4Q0QA 2HPMA 4GB32 4YYOA 5SV5A 1XCBA 2YUEA 1MMAA 3LOIA 2FDGA 1IAWA 3ZGKA 2GN3A 5C7GA 1JXNA 3O12A 3VBHB 1X82A 2B5HA 3OOXA 3CCLI 2YYOA 5FLIA 5C4WA 5FZ1A 5CAZA 3T1BA 2PMZA 1LKNA 5D8KB 5FLJA 2WN2A 4XLPF 4PLOA 3PVEA 1K78A 3SHFA 3IRQA 1X9TA 4IO9F 2YZ4A 1UOFA 5JVTA 5F3CA 3IHUA 2WV1A 5A1AA 1C8NA 2VJIA 2ZOEB 2XROA 4YVSC 2RC4A 1WKYA 4DXTA 4HV6A 1BC7C 1R71A 4IE0A 2X53S 1ZKGA 4MFEA 1UZCA 5FLVA 4XQ4A 1MACA 1ENRA 3M4FA 4E4HA 4BUPA 4YEJA 1ZBE1 2LYCA 4JGZC 3JAMZ 1RUE3 4S2GA 2W85A 3POSA 3K4AA 1FOD2 3ELNA 5DXDA 4YM2A 5CFDB 5E20A 2NYYA 5FZLA 2MFZA 3HT1A 3GXOA 2RVAA 4G6TB 1ETWA 1RXGA 3NV4A 3L2CA 5EYYA 2CSGA 5E3OA 3LSTA 4MLOA 2STWA 2VNOA 4AK3A 2M7BA 2Q8OA 2PTMA 3WEZA 3QYFA 4TV7A 1YYNA 4FFFA 1V5FA 3MIHA 4IETA 3ZVXA 3LEIA 1D5YA 2BGPA 1FOKA 3LL7A 1HQLA 3P5BA 4XF4A 4IOCF 3PNVA 2RDPA 2O61A 5J98B 2E1MB 1SPPB 4AI8A 1X4OA 3NJYA 4CP9A 4UVCA 5FGMA 2A75A 2LY2A 2Y2ZA 3FXQA 5EPAA 2DYCA 1NK3P 3GTLJ 2XRLA 2HZTA 3OJBA 4Q4V1 3SH4A 1GICA 1XNBA 5CYYA 3C2HA 1V5EA 3Q8BA 3S5AA 1GR3A 4JTNA 3E1SA 3FXJA 5DCFA 3AFKA 1SMVA 3DBLB 1F9NA 3FHQA 1IC8A 3HUGA 3B02A 1Z9CA 1AL21 4IOAF 3M2MA 2V5YA 4DUXA 1C8M2 5JLVA 2XAQA 3MQ0A 2WT0A 4XIKA 5HS8A 5CEHA 1PGW1 2YGMA 2HEOA 1ZRIA 1Y4WA 2BZDA 5KC5A 1BA5A 2LMDA 5FJHA 4CDXA 4OYUA 4MHGA 3WF4A 2OKXA 3OL4A 1IS5A 3THPA 3ML6A 3HB9A 4D7MA 1NKGA 5CQGA 1MR5A 4E4ZA 4GKXA 4FPGA 5FRMA 4JV4A 1RUD2 1SVLA 2ZC2A 2C26A 4ASMB 4AVCA 2A05A 4AIKA 4BXUA 1ZGJA 3WINE 2IWGB 5GKAC 4ZU7A 5E3NA 1X36A 4HBNA 1V9U3 1UY3A 2YU3A 1R58A 1QH7A 4BACA 4OHXA 3HAGA 3RTRA 3WD5A 4FCYA 3F22A 5DQ0A 3HNYM 1DYPA 2OAZA 3AMNA 3MCZA 4YFXF 2VONA 2EPFA 2VNGA 4KMFA 3POGA 1QQIA 2X1EA 4BA6A 4Q48A 3IUOA 1UFMA 2DAOA 1WZXA 4HSTA 1FBUA 3NV2A 3THCA 3ZYHA 5J3LA 2HDWA 2PLV3 5LEJA 2Z99A 2RS11 1ZLKA 2JWTA 5C4WB 4L9JA 2FJ1A 4IPAA 1J9IA 5E3LA 5M3FJ 5D5XB 5F5QA 1VQOI 5L3BA 1GYKA 1LEMA 1VQ9I 2MC4A 1P6RA 1CZTA 1V70A 2P1BA 3H8XA 3E6BA 4QPGA 1UMQA 3WNOA 3KP4A 3MICA 3S1RJ 5FY0A 2Q2EA 1QZYA 2DMPA 2WZR1 1FSEA 5DM7F 1L3LA 4GIQA 3U1XA 4XVHA 2O0YA 3USSA 4XURA 2WTEA 2HQNA 4X0GA 3UETA 3CJIB 4CRQA 5DTDA 5F5IA 1C5IA 1XYNA 1TWGJ 1C28A 4U0VA 4XJ9A 3GX4X 4E7JA 1WA4A 2UXNA 2VBPA 4ZZ8A 2R0QC 2WBMA 4AW7A 3WF2A 4JDNA 3WP3A 2R042 4XKWA 3USUA 4MGIE 2OC6A 2FOWA 2XVLA 4QGMA 2CMPA 5F37A 5LFAA 3KZYA 1N3PA 2V4AA 2NMOA 2VXDA 4IHTA 1A6QA 1YI9A 1RUE2 2QSHX 3HSRA 4ESJA 3ZYPA 4LO5B 1VMJA 3E6CC 2K4JA 1HV1A 2L7ZA 1ULPA 1TLHB 1V6MA 2EFOA 2VCMA 4BU2A 1ONVA 4IV3C 1AR62 2G1MA 5FKLA 1SFKA 3ROUA 1PP8F 1GFF2 1M1EB 4BAYA 4EJRA 1K5JA 1R081 1DU6A 4C9YA 5D5UB 3CMYA 1YFXA 1FC3A 3DEUA 4YSFA 4YIRX 1J3QA 2ZGTA 3HUGB 2LRDA 3FHAA 2Q4SA 2YY1A 3RZDJ 1R1A1 3EQEA 1Y6IA 4UF0B 2EAKA 5A6QA 1YHFA 2OU2A 2OQGA 1VBE3 2QENA 2BRTA 2W1WA 3LPFA 4CDQA 3UV9A 3T8RA 2Z2SB 1AR73 4M72A 3W6VA 1RC9A 3KVAA 5FZOB 2V5DA 1JHJA 4OULA 4CDXB 4IEZA 2LDUA 1TVGA 1O59A 4WCGA 2XV4S 1DF0A 5FD5A 2F5EA 3M9AA 5IT9K 4XACA 1SC7A 1GWMA 5F3EA 2JZYA 1JTYA 4WF2A 1UKGA 1P4WA 2L7MP 1SD4A 4XMYA 4KMQA 2IAIA 5CA6A 5CLSA 3AL6A 4EGZA 4ASKA 4LBLA 3RSNA 2XGXA 5EEAA 2R92J 1Y9QA 4RD7A 3Q0WA 5TISC 3QOEA 1W9WA 3IAM2 1O8SA 1IQAA 4EN9B 2QLZA 4QQPA 3KGLA 4ARXA 4LTAA 3ZPOA 2DV9A 2VE9A 3QRFF 1EAH1 4M3DA 4ZDLA 4NHXA 2M87A 4V1PA 4WM7A 1Z0XA 2VIXA 1VBD1 2E9QA 4FTEA 1E5SA 1JKQC 1UIJA 4ET7A 4BQ5A 3OF1A 1V9U2 3R61A 2Q0AA 3VEPA 1MZBA 4OUSA 2VMFA 1QJY3 1DU0A 3RZHA 4ZC3A 2EZKA 1D5VA 1QIQA 3T2TA 4G9SB 2O3FA 2D6PA 2FXAA 1AWCA 2IGMA 4MGKE 1I1EA 2VBYA 1PNGA 1JYVA 3UNPA 2XL9A 3QPLA 2D6LX 3MI8A 2JDKA 5DDGA 5A7WA 2VN2A 4PJNA 5FIXA 2Q2EB 1AJKA 1R6RA 5M5YJ 4AQ6A 5EEHA 3CUQC 4EQQA 3DF0A 1RITA 1NZCA 2F4OB 4I30A 1EY2A 2ACJA 2EXKA 4N9HA 3VLBB 1H9TA 2VW0A 3PNYA 4N4NB 4KMUX 1VQLI 1PO11 3NKGA 3HGGA 1W28A 1W2TA 1RC6A 2CAUA 3G3ZA 1PX4A 1O7LA 3WCSA 2JE8A 1OCTC 2VULA 2LLKA 5FK7A 1QWRA 4JTOA 2V1NA 4F55A 3USUB 3PMEA 1IGNA 1GWLA 1YS6A 3ZXGA 1KQ9A 2BVBA 5HDGA 2W48A 1VJ2A 4KWKA 1BN5A 4HRIA 5F8PA 4CUCA 2E5NA 2BBAA 2W92A 1BK0A 4XONA 1PVXA 2ZBJA 2ZXQA 1SBFA 1YJWI 2GA1A 4BXSV 2DODA 3E6MA 3GNEA 2ARCA 4AM3A 1VMFA 3ONQA 2OCEA 4NC7A 1QH6A 2E2HJ 4L97A 2HFHA 2FCUA 3DXUA 4GYIA 3I97A 3OCPA 2DFHA 2D6MA 2VY0A 2OZ6A 3CC7I 3IP4B 1ZZ6A 3O1MA 1YIOA 4RL7A 1UOBA 2Y6FA 4O61A 4FXKB 5LWBA 1OLQA 3T1MA 1OCRH 4AVZA 1X1DA 1GVDA 1YQAA 4PF1A 5DV5A 5JHFA 3O6BB 1A6IA 3T08A 3ZQCA 2VO5A 2BDRA 4BBSJ 2XJPA 5JZGA 4DB5A 4YZ1A 5FZ4A 2P81A 3RS6A 3GEZA 2EK5A 3AKZA 4L8QA 5EDNA 4CDQB 4LXLA 3NQOA 2DFCA 2XXZA 2XUEA 4JGZA 2J1EA 3WUCA 2D3SA 2VVFA 4BISA 1Y0UA 2IS4A 2CY6A 3ZFFC 2LG4A 1HLVA 1TWFJ 1RHI1 2IFWA 5IOZA 4IRGA 1PVC3 1J5YA 2HVQA 3MVPA 4P1WA 3M3EA 3GZNB 3CF5F 4IXLA 2CAVA 1UZWA 2P0WA 5E8IA 2AUYA 4JKLA 4XHBA 1OT5A 5FKCA 2IXJA 1AVBA 3LWCA 1JZ5A 3AK0A 4HN0A 5HLGA 2UWMA 4ZY9A 2AGSA 1K7AA 4BQ4A 1VBE2 2L0KA 4HV5A 3N9MA 1GQGA 2YPRA 1W7PA 2XGDA 1AR72 1FV3A 3AZYA 1C1LA 2XPUA 2NS8A 5LBBA 4ZPIA 3AB0A 3IMMA 3WG2A 2JA2A 3SQOA 4AQSA 5F27A 2WQ8A 2CTVA 2CFOA 3OIQA 4A7YA 1MS3A 3JUUA 4WM7B 3F3XA 3S0MA 4COWA 3TO9A 5DPNA 3X2QH 4DRRA 3DCFA 1LVKA 2GP5A 2NVXJ 5FMOS 3I2OA 4I7HA 4E7ZA 2R93J 5F04A 5JOWA 4IKFA 2PQQA 3QH7A 3BCWA 3JBG3 4Y20A 4P9JA 2XJRA 4F92B 2IXHA 3MIBA 1VQPI 2Z9OA 3KF5A 3GFJA 5GLWA 4DFSA 3ESWB 3FHZA 4G94A 3RPUD 4L0PA 2VQLA 5DYMA 1F1ZA 1O57A 4FISA 2HWB1 1BJQA 1WH5A 5A7WB 1KS4A 5C33A 1OURA 3TEXA 3M8EA 3CHXA 1U3EM 1TMF1 4B29A 3M3IA 4IE5A 2DTRA 2ZACA 3OYWA 2CRGA 4M4PA 1I39A 2MBFA 1ONAA 4L99A 3J81Z 1DLCA 5JIAA 3ACGA 3T2PA 1GP5A 5E79C 1BOBA 5KXEA 1PK6C 4KU7A 1OQ1A 5J37A 1WD4A 1FT9A 2R7FA 4A4AA 2RQPA 2RJ2A 4LO4B 1PVEA 1QGPA 1QA6A 4E70A 3S57A 4Q0SA 2FZ1A 2PJRB 3ZDSA 1K5MA 1YW9A 3LA7A 2DDUA 3PHMA 2LM3A 2GOXB 2ELHA 2A70A 3WP5A 1UIKA 2ARXA 4XLEA 5E17F 4AVAA 4G12A 2DT6A 1ZYBA 5FXZA 4GYGA 5DM6F 3TNQA 3L2VA 2A71A 4EN7B 4UV9A 3RJRA 2OTLI 4MEYF 2ZKLA 5JXHA 2ZGUA 1AXZA 4HLTA 3T30A 2MSYA 1BIAA 5E1RA 5CZKA 3OGJA 3M07A 4BHCA 3KZZA 4N43C 1EYBA 3CQZJ 1L7RA 1LDDA 1OCZH 2EVXA 3HTUA 2W68A 2WS91 1B59A 4UYBA 2H8RA 2WDBA 4M3GA 1GT0C 2ZMEB 1CAXA 1ZM1A 1XX5A 5HCFA 1G3YA 2K4BA 1XS9A 5JZGB 5FLHA 2UXXA 4C2UA 2OS2A 4GWJA 1G4DA 1K61A 3HOZJ 1B8IA 1LEAA 4N8MA 3RSJA 4RM2A 4QHZA 2JUCA 3LB9A 2ZEZA 3NWKA 1QJU1 4QX1A 1US2A 3KV5A 1UHWA 3F8NA 1FMVA 4FFHA 5FYYA 2F6BA 1PIV2 3PSFA 2ET7A 4Q0VA 3H8OA 3IWZA 1FX7A 3IB3A 2DK5A 3C7EA 4IQ4A 4BQQA 5A6ZA 3H0GJ 2QFEA 3S3OA 1AYN3 4PF5A 1REFA 1PO21 3TBDA 2R1DA 4WXHA 2EA2A 1G3TA 2TDXA 4NHYA 2QF7A 3BVCA 1OPOA 3K0LA 1HRI3 2KP6A 5GLUA 4OFGA 1W7PB 2A68F 4R4ZA 2CHHA 2DUQA 3PJQA 3SKVA 4KYWA 5D6EA 1RKTA 4AVSA 2TBVA 2O9LA 1N1TA 2RG4A 5F3GA 2N7GA 3PUIA 3RZGA 2DMNA 1PVC2 4GXLA 5FMDA 1YNAA 4D9JA 1Y1VJ 4IV3A 3B9IA 4BQXA 3IL2A 3RZKA 3U1DA 2WR9A 4GCVA 3LFUA 2A3XA 4HOBA 2VJ4A 2XB6C 1I50J 2K9ZA 4ISRA 4IEJA 2QBYA 5FWEA 3HT2A 1ULDA 1T08B 1A78A 1IGOA 3M8LA 3H7YA 5K0UC 1IZ1A 1A04A 1RYYA 3TGNA 2DA2A 1QGLA 2XSJC 5DUIA 4ZH4F 3ZXKA 4Z82A 2IZWA 2ZMNA 1XB4A 1YE9A 2OT7A 2IPQX 1MH4A 5AIPA 2RV9A 3SEPA 2YU2A 4HXCA 4AQTA 2IXCA 3BKZA 4BY1J 1WFXA 4PI0A 4NROA 5GAEJ 2ELJA 4D7TA 2EAAA 3H5AA 3VZKA 5FWJA 3LNQA 1MMGA 1CX4A 2ADDA 3T3YA 4NRQA 2X29A 3OYWB 3MPPG 3JBG2 3VB9A 2JG9C 3OBRA 2R7UA 5HNFA 3DN7A 1AXYA 2CNAA 5HCAA 3GZEA 3BOPA 2DOEA 1LU2A 1G9CA 1NQJA 4Q4Y1 5FOBB 2ZXWH 3GDBA 4LR4A 2EV5A 2VZSA 4OINF 1S0IA 3FMQA 1VP6A 3WDVA 1W90A 5B3SH 3RYKA 1RUF1 1ZA4A 3W21A 3ZFEC 1OKRA 4MO7A 3OV8A 2LW8A 2BY0A 2YROA 1Z1DA 2HEYF 3IKVA 3GF6A 1K5MB 4FAGA 4N53C 2VOVA 4CUAA 3J7AO 4GJZA 3O8GA 3ECHA 3LSPA 1IDYA 5FZ0A 2PG4A 2WLPA 3ZSKA 2EINH 5LHGA 1H6YA 3MIDA 3WNKA 2Y34A 3CP8A 3SHRA 2K27A 4QX7A 4EV0A 1X7NA 5A7OA 3FZVA 1LOCA 4CPBD 4P9YA 1JHNA 3Q9OA 1HXS3 4OZXA 2AO9A 5KK1A 4TLGA 2C24A 3VL8A 1ZBA1 3K4MA 1NY72 3GZ6A 4S2FA 1XPWA 1CAXB 2J22A 1OFCX 9ANTA 1MDMA 1KQRA 4LBKA 3SH5A 5FPAA 4XBNA 1RVF3 4BH9A 2K9SA 3OBTA 5FP7A 2C5DA 1B8IB 3OYEA 5K5QA 4NB5A 3FM5A 4CU7A 3ZMTA 2HR3A 4MV2A 4WK8F 2QQLA 4AVBA 4P5OA 2NLRA 1BM9A 3RKWA 4IHSA 2VPRA 3JXSA 2Y0SN 2AACA 4P5HA 1VZ0A 4YM0A 3WXPA 4HZFA 1UL9A 2HWVA 1UJ8A 3GUDA 2WNOA 2XKPA 2YC0A 3DKXA 4MHRA 2LC2A 2VAUA 2VMIA 2IGKA 1QO0D 3MZYA 2WY7Q 5DUWA 2HLEA 3MIEA 2VKEA 5ICEA 2E7TA 4AFCA 3VYRB 2CJJA 3IN9A 1JGGA 1Y43B 2VE8A 2VUAA 3PMSA 5L3CA 2MGQA 3DPTA 5FP3A 1D0YA 4EQVA 1VQKI 1R23A 2E32A 3HBKA 3TWIA 4LG0A 2XAUA 2OBPA 3PTYA 5KHKA 3CO7C 2X8KA 3T5XA 4TYSA 2GOMA 2EXHA 2DDBA 3NO8A 4W6XA 3WW2A 4YW6A 1S4CA 4FE4A 2ENRA 1N47A 2X6WA 4FOQA 1JYCA 4IV3B 3GTOJ 1D8KA 3K69A 1DCSA 1AYN2 5ANNA 3BUCA 4B48A 3OPTA 4AR2A 3V8LA 3I3EA 3EPZA 4DYRA 4M9XA 3H1WA 1HRI2 1F9KA 2E51A 1SBEA 3HQRA 2QBYB 3MHZA 3M1CA 2RM23 4QKBA 1JKOC 2OA4A 3DU5A 5FKOA 4QLCU 1F8VA 3THDA 5FCCA 1UNBA 5FYHA 4I76A 4LORA 3JD73 2K86A 2C1FA 2P6CA 4X6QB 4ZS3A 1PM4A 2FBIA 1RGSA 5FV3A 1RZ4A 1F5FA 2VXRA 5KAIC 4WM8C 3CP2A 4AG4A 2CV1A 5K5OA 2B7EA 2ZXIA 4CP2A 3ZFFA 3HZJA 1HC8A 1WLWA 4UW6A 3CDZB 3K77A 2DXIA 2JRTA 4A93J 4URTA 3A03A 3H5RA 2VC9A 1I3HA 1B9NA 2UV1A 3F8MA 2M4GA 1S0CA 4YRVA 4XKCA 1KFUL 4ZU4A 1IRZA 1VPHA 1W8UA 4Q4V3 2JVHA 2VOWA 3DUIA 1W04A 2VOTA 3O1RA 1SD7A 4BM8A 4ASLA 5GZCA 1MGTA 3H36A 2ELKA 3VHPA 1MSFC 2FUG2 5H6RA 3VZNA 2FSWA 2QZ8A 1FBQA 3X29B 1CQTA 5ACA1 4X1EA 3OGGA 2WYFA 2JQ7A 1KDMA 2EIBA 3W2AA 3AYEA 2MW8A 4GXOA 3R6SA 5BNQA 3FLRA 3C3VA 4U0WA 4QDSA 3CCMI 1FATA 3K70D 2VZQA 2WO7A 1DQ1A 2QDNA 2P7VB 4HSLA 4A6EA 1ETVA 4YIIA 1FYUA 1VQ4I 1SDDB 1ERDA 2NXNB 2C6SA 1ASJ1 3RYRA 5DG1A 2DU1A 1P9QC 4CDWC 1JUMA 1XTAA 5FZIA 1MDMB 1U9NA 3FMSA 1EV7A 2BY1A 2DCEA 1QPMA 3LDRA 3BZKA 4AU7A 5EEGA 5HLTA 2GNDA 2COMA 5GPAA 5FPXA 3IPVB 1ZGAA 4PIZA 2XG3A 3UGHA 3OR2C 1B72A 1HXS2 3J7AY 1KJLA 1QHHD 5CVRA 4C0HA 3ES1A 5DDJ3 3HOYJ 1JKRC 1PK6A 2WO1A 1DGLA 1X8MA 3L00A 1NYWA 3OOPA 5FY7A 4OVEA 4UB8C 5CKQA 1F15A 4QPIA 1RVF2 3NAPC 2B7YA 2PHFA 4GRIA 5EF6A 4UNOA 3VKNA 4UFMA 1J75A 3WODF 1IZ3A 3AP5A 1VBC1 1RMU1 4HOOA 3OUIA 2YX4A 2ZHLA 2PHXA 2CQXA 4LG0B 2VMDA 4FQ4A 1WJBA 1Z7S1 4I98B 3VGIA 5A32A 2QQJA 5KHJA 1RKWA 3K4ZA 2HOSA 3AKRA 4PJ0C 2UWAA 2K2SA 1SHWB 2F4MB 1DP3A 2QQ9A 5LHHA 1Y9GA 2BXYA 4DXRA 2DVDA 4HVOA 4X6RB 3GMEA 2KMUA 3ISPA 4N43A 1PGSA 3S6PA 2XH6A 3Q9VA 4XIDA 4NQWA 4A45A 3TN91 5LA1A 2BPA2 1YYVA 1A31A 3PUAA 3WTVC 1W8FA 1NCQB 1DQ5A 3WDUA 1RJ7A 2Y75A 3PM1A 5A3WA 1ST8A 2KJBA 4P9GA 1GV5A 1UY1A 4FO9A 1R00A 3LIGA 2HXOA 2J5PA 3ZFFB 3K48A 3TNPB 4D69A 1U2WA 1NG0A 1PYVA 1WW7A 2RM22 2R0HA 1G8XA 1UZZA 2JDNA 3VN4A 1LU1A 1G3SA 3OBZA 2FMLA 2E7XA 2PMZN 1SFEA 2XUBA 3KX2A 1FX5A 1TEIA 2ZXHA 3JD72 1IS3A 3BG9A 3F21A 1HQNA 1UOJA 2Y26A 5DAQA 4XCBA 1N25A 4UUSA 5HVQC 2OYZA 1DGWY 4QPOA 4XQDA 1MS4A 1B4AA 3OYNA 2ID3A 5HS9A 3BPZA 3WTZA 2XLAA 4Y4YA 2A6EF 4GALA 2ZJ2A 1GQPA 2D6KA 4LOCA 5LA2A 1XBFA 3I3BA 5K9YA 3SXWA 4Y3OA 3N9NA 2E19A 4AAXA 2Z5UA 1HF0A 1JYWA 2ZHMA 3U1KA 1GNYA 3CLQA 2W52A 5FBZA 1OF4A 4Q4V2 3K9TA 2DJIA 1MMDA 2R071 1NLSA 4BXXJ 1Q8PA 3CJQB 4YFWA 3TYJA 2DMTA 3DV8A 3ABUA 5K0UA 1ALYA 2R7DA 2OD5A 1JXSA 5APAA 1OYYA 3PIPF 4NIHA 4EVIA 1X8EA 1SLLA 2FMDA 1LTEA 2O8XA 3Q8AA 3ZYRA 3QODA 4META 3OG2A 3GLLA 4GMP1 4O9GA 3S3NA 1E57A 3ORJA 4B3NA 1NE4A 2JA5J 1LOAA 1LESA 3VD4A 2HS5A 3CTAA 2BNNA 3KZ4C 3UGFA 4FOWA 1QPIA 2A6YA 1H1AA 1B72B 2ZX3A 2JG9A 4LHKA 5DABA 2PQSA 1DUXC 2KRHA 3LSKA 2NAZA 1EAH3 3HIFA 5TSWA 1CQ9A 3VD5A 1O4XA 1ETQA 3NJZA 1ZK8A 2E36A 4QPIB 4UW4A 4NHMA 3WHTA 4PK4A 4QTRA 4G7OF 3U4SA 2VNRA 2DA4A 3CJTB 1PGL2 3BODA 2RDRA 1DGRN 2IW5A 2P2KA 4EMSA 2Z1DA 4PI2A 3WNNA 4HBLA 4A3IJ 4FP2A 4BIOA 2E1NA 2WAEA 4HQMA 2BGCA 3FBNB 5DDJ2 1YQ5A 5GALA 3W6KB 2ZJRF 1EA3A 2HU9A 1OUXA 1V0AA 1JYNA 1W0OA 5GJ6A 2ZGOA 4BQ2A 4UBHA 4JRAA 2DQRA 3FLTA 4E2QA 4G3YC 1QHGA 4A69C 4G7ZF 2EWNA 5JSPA 4N43B 2VQHA 1X3ZB 1VFCA 5GZFA 3POWA 2R7EB 2JN6A 5A3TA 3IKTA 4L9TA 2ADEA 2R49A 4BK5A 2ZGRA 1PO13 3ZN4A 1ETYA 2IVJA 4D6RA 4ZYDA 4V2FA 1KITA 4CEWC 3LOCA 2MPFA 2XPVA 4NBQA 1YX5A 2XJSA 3NNMA 2C4XA 2QVOA 3OTFA 4LIVA 2ISYA 1JOJA 2BOLA 4YPJA 2M4KA 4E4SA 4Q4W1 3C2GA 4LBOA 3SFIA 5FDBA 1D4M1 1QVTA 4BMBA 4EWAA 3A1YA 3HOUJ 2MA3A 1BCXA 5FZMA 4DIQA 3T2QA 2Q5TA 3WTWC 3KWVA 4LMYA 3O3KA 1WMEA 4KJZA 1YITI 3ZYIB 5FUNA 5DUKA 5BQTA 3K2OA 4HW0A 4IEWA 2SLIA 4I02A 2EA7A 1HSTA 1XGMA 1H88C 1TQ5A 2DK8A 2HTSA 1OFNA 3OMYA 4FPYA 3ZOIA 4ENJA 1NH3A 1CGPA 3OS0A 1H0BA 2QQVA 1G59A 1WVRA 4GKYA 4UUSB 3BR2A 5H9QA 2BNOA 3U21A 2IBDA 5J1UA 2YBKA 2GA2A 1PMJX 4OQ8A 1JI8A 2R7SA 3PIGA 4CCLA 1CIWA 1H8TC 4XFIA 3KYDB 2W7NA 4B44A 3VFZA 1JZ3A 1AR81 1EH7A 1VMHA 2ETEA 4AHZA 3P3PA 3ZXDA 4ES8A 2DLLA 1CZVA 2IFRA 2QUFA 2VL4A 3HOTA 2FE3A 3SEEA 3F2ZA 1T2XA 3PUBA 4JQRA 4CUGA 3G1LA 2JMWA 1SVOA 1Q5OA 1K6OA 5IW0A 5BOXA 1H2MA 3MD2A 4NNJA 1HKSA 3AL0C 2OF7A 1MQTC 3POYA 5K0UB 5ANQA 3V64A 2Y69H 2DFBA 5DCMA 5A7QA 4A7ZA 4LA2A 2D5VA 1YIJI 2VQTA 3IH3A 2A1XA 1HJFA 1D0ZA 3HOSA 4RR3A 4GH4C 5KHDA 4WM8A 1LECA 4LLFA 4O9EA 3ILNA 5LW9A 4RGRA 4NMIA 2VXJA 2LR8A 5LEKA 2B63J 5JMCA 2RREA 2EA4A 2HGCA 3W9AA 1G6NA 4IQPA 5E8GA 3KHCA 1JU3A 2IT0A 2PN5A 2W0XA 4DXSA 4GAZA 4KH9A 5ICFA 1W03A 1RETA 1ND3A 3JRIA 1YX3A 4Q2FA 2WFPA 5J6XA 4Y22A 2W82A 2HQ5A 4URAA 1ODMA 4Y1XA 4IGQA 1GKBA 3PVNA 5FOJB 5B66C 2L54A 1YI7A 2Y0OA 2JT1A 3LA2A 4KIGA 3L2WA 2V9KA 3SCHA 3A2KA 5B5EC 4OIPF 2AH2A 2PXJA 2R7XA 3LWFA 1HRV1 1S0JA 4KGQA 5FY4A 3JB4C 4Q4X3 1MBGA 1JHHA 3TMOA 3CU7A 4OOIA 4NJ4A 2GLOA 5IAXA 2RKHA 1L7QA 1X4PA 2LBFA 1EAH2 4ANJA 2ATFA 1T0FC 4Q29A 3F0CA 2QQAA 5H9PA 1HBXG 3P9KA 5K1YA 3C1DA 2E1CA 1TMF3 3AFGA 2A07F 3I3DA 1SZBA 2QCOA 3NEUA 2DCYA 3K4CA 2VMGA 5BNNC 2RR13 2TNFA 4OUMA 4QB2A 5B2GB 2CUFA 1LGCA 1GQHA 3J26N 2OV7A 2X10A 4UFHA 4CDWA 1O3SA 3DPLC 1W9SA 4GWMA 3ZXJA 4GZ9A 3FBIB 4IRIA 3ZYBA 2AR6A 2ADUA 1R1TA 4INDA 1G8WA 1NTCA 2VCCA 2JE7A 1AX0A 2FDIA 2RJKA 4Y52J 3E6DA 1NQDA 1QBJA 4HX4A 1GMMA 3H92A 1HB2A 3ERMA 3KZIC 2PHDA 5G04L 5EJCA 1OBNA 3KV6A 4LMFA 3K2AA 2ZXJA 1TW2A 3G1OA 1PP7U 1QEXA 3FFQA 5H20A 2VW2A 2CUZA 1I1SA 1E5RA 4DINB 2ZX4A 1YXWA 5F5CA 2IXKA 2DQLA 4P5YA 2VTXJ 4DNCA 3WW3A 1LAJA 1PO12 4J1WA 1NG6A 2GC1A 3WTXC 1Q3EA 1SMYF 2VC0A 2OPWA 3NAPA 3BTAA 1W7PD 5T3NA 4XF1A 4LKEA 3D4KA 4EE2A 4M9ZA 5IATA 5FPVA 1A8MA 2W24A 5DUUA 2FDJA 4ENKA 3I8TA 1O3RA 1W5SA 3JRFA 1DG6A 4Q1RA 2R7RA 3FBMA 4H14A 1BR4A 2MEV1 3LDKA 3BCAA 3GYDA 2WT1A 1XSVA 3ELKA 4J1XA 1G3WA 4BEHB 2CWMA 2WWYA 4FCAA 4RHV3 1L0OC 2CUEA 3NAUA 4Y5SA 2HDDA 1FMD1 3ZQIA 4QHOA 1IHMA 2XKOA 4BYYA 4Q26A 3W2VA 1W6QB 4V19K 2JKBA 5DCMB 4NVPA 2YBSA 4OAZA 5L19A 4UY8I 2WUHA 3RWNA 4RR3B 3VKFC 1UO9A 3M3CA 3BR5A 4WM8B 1HV0A 4I6ZA 3J8F3 5K4LA 4OIRF 3V0AA 4BL0B 4QSHA 3I2JA 2GSYA 2WT2A 1K45A 4CU8A 4B7KA 1I1GA 1UB9A 1Q8QA 4BZ4A 2DUOA 4B8XA 3IZOA 3N7KA 4B47A 2PA7A 2QKMB 1YCIA 2BFUL 5JI6A 2OQ6A 1ND3B 5FKBA 1ZRRA 2YHJA 3RWKX 3I2GA 4Y22B 5HNHA 3G71I 3N35A 4M9SA 3V7CA 2ZHNA 2OUJA 3N9OA 2VKHA 4C2TA 4PDWA 3BQZA 3HBZA 2VECA 3V65A 2WSVA 1KU7A 4PHZA 4E8DA 5IPAA 2HPIA 2PI0A 2KLOA 1N1YA 1X50A 4NE9A 4ZZLA 4KT6A 3NRUA 4OI0A 2XJUA 4Q8LA 4YZ3A 1BKZA 2LBFB 3RZMA 4Q1PA 1QXPA 2JG8C 1AR93 4XMAA 1NXD1 3AZWA 3U2RA 2DT5A 1QZEA 2E33A 5F7UA 2UWBA 4EWDA 4RQPC 2KT0A 2OW4A 1WCQA 1MD0A 2BVLA 3LE0A 3K1PA 2GAUA 4JP0A 1UQXA 2NVUB 2PAMA 5EZHA 2IJLA 4C30A 3RQ4A 1K42A 4B09A 1N78A 1GUIA 4Q4X2 1W5CC 3BJ6A 3DWLE 2G7HA 3CF6E 4IGOA 1JHFA 3IM0A 2JTVA 2O0OA 4LBJA 1UMHA 3FIWA 1YQ6A 2IS1A 3OR1C 2CSOA 1QY4A 1D0GA 2ZGLA 3O0VA 3PUHA 1TTYA 5FTTC 5F6KA 5CVUA 2RMU3 5J1YA 3DF8A 2AS5F 2RR12 1SLAA 1KU9A 3Q8FA 1YJNI 2BUKA 4MGTA 2HWC1 1B6AA 2ERFA 1TZLA 2WNUC 1MJAA 2FDHA 4E2SA 3HRMA 3QOPA 5AVPA 2BW8A 1KS5A 2NVYJ 4IXAA 2YC4A 1V4RA 3NAPB 5JI7A 3IIIA 3MFKA 3VD9A 1ETXA 3LD8A 1I5ZA 1ZG1A 3AC0A 2PYTA 3RVHA 3F8BA 3K51A 1XGSA 3UNGC 1GNZA 3P5JA 2DYRH 4P55A 5CQEA 2CYYA 5FZ3A 4AIDA 3U9GA 2BE5F 4XETA 2EV0A 3P1IA 2WV0A 1QF3A 3WDYA 2CW0F 2KPMA 2ME6A 4I2OA 1W8OA 2V7FA 4F7ZA 2Q30A 3BR3A 3VV1A 4N90A 2QGUA 5JVVA 1YG2A 2X05A 3BY6A 2W94A 3BTIA 2OCCH 5IVVA 4XJAA 5DAVA 4KIBA 1LCLA 2AC1A 2OA2A 3AYCA 2UY9A 4KQ7A 6PAXA 1HDPA 4HSJA 2LUWA 2YMZA 3QCWA 1MVEA 3RIRA 4TSVA 1NCRC 3OPWA 4KI5M 1OHFA 2M1BA 4I0WB 3ZN6A 4DY3A 3ZSEA 1LE8B 2LALA 3IDBB 5A3PA 3ABTA 5L36A 4QX5A 3QAHA 1XNDA 3HDDA 3CJRB 2R7WA 4RHV2 3AKTA 3LA3A 3SH3A 3V0AB 1MS9A 1U78A 1D1CA 3H1MA 4DZPA 3OS1A 1R9TJ 4JX4A 3OEAA 4YW5A 5LK7B 1BBT3 4MIMA 3MO4A 1EUUA 3COAC 2NNNA 3I56I 1ZELA 3W2WA 3OYJA 4D94A 1TME3 5CFCC 4OMDA 1K83J 1ZZ7A 3TW6A 5FXWA 5FRAA 1DQ0A 1IUYA 5JLWA 5JR7B 4QGNA 5J47A 5CB7A 4AEKA 4NC8A 3U4XA 3GM8A 3MEXA 4RA2A 3JQXA 2DFIA 3TAYA 1ZYRF 4PDWB 2G0EA 2ZAAA 5FY8A 2NRAC 3J7LA 3J8F2 1Z78A 3AMMA 2Y8KA 4EROA 1XMXA 4OMYA 1ZH5A 1WHUA 1PUFB 4CCCA 2DOFA 1SD6A 4G6DA 3TEZA 4HLXA 4HKWA 3WQBA 1WCMJ 3KEOA 2WRAA 5HCHA 2NYXA 3CC2I 5LHIA 2XDVA 2B8MA 2XQRA 3GJAA 2A61A 1Z7LA 2VLAA 2YGLA 4CDUC 2BBYA 2YV8A 2HQAA 5D4SA 5HPOA 2HWD1 2KZGA 2VOXA 1OVPA 3ACLA 3PLQA 4NO4A 2Y0SA 5BS6A 4NAMA 4IZZA 4GB31 4LUMA 4Z1VA 2C9KA 3J4UH 1HJGA 1N75A 4EYUA 4DNYA 1U8BA 4RAZA 2GMMA 2A6TA 3CNAA 3VDDC 2X5IC 4GH4A 4B43A 2W4SA 2BVVA 4RB1A 4ORFA 5IP6A 5I8YA 3OYAA 3AX4A 1JYIA 1F5TA 4HFSA 1AR92 4FPJA 1UN1A 4Y17A 5FYZA 3SITA 1OFSA 3D0JA 3ZMVA 2ZA9A 2HKXA 2D6OX 2JVGA 1B35B 4AC0A 4CCEA 1YEWA 3I4NJ 3ZYFA 1S6LA 5CG8A 1LJ7A 4XDOA 1XB9A 1P2FA 2BQPA 1J1TA 4YLZA 2IP2A 4IEUA 4LK0F 1MZFA 3KD4A 4V2WA 4B3AA 3TDZC 2XF7A 1FOD1 3BQYA 1XNCA 3D0SA 2LS6A 1Q43A 1AYM3 3JQWA 2RMU2 4H7MA 4FE7A 4UWDA 2BVMA 1BJAA 5HI0A 1T0FA 2CQQA 1MZ5A 5IP7J 1JZ7A 2XPJA 2OUMA 4NIIA 1QHDA 3GLXA 1OCPA 4LIUA 2PEXA 2F5FA 5K7HA 4HF1A 1W8HA 3HOXJ 4BOWA 1VIWB 5FZAA 1B1BA 1R5GA 2WWSA 2HNHA 5BNNA 1RUI3 1KXGA 4NRPA 3EO6A 1H9PA 4EATA 1ZA7A 3S15J 1W6PA 3MLKA 3OYBA 2WA4A 4YVWC 3ZN6B 4NPRA 3L2QA 4CCMA 4FPCA 2QZ2A 2A3YA 4UUTA 2A3WA 1O6UA 2HOTA 2E2IJ 4W97A 1JMUB 1K3IA 3K4NA 3EUKL 1WKMA 2CQ7A 2FHRA 2TRTA 1VBC3 1XRUA 3Q5FA 4BQ1A 2A6WA 3UKGA 2NS0A 5HV0A 5K7PA 2XWJB 3NV1A 1C8M1 2AREA 4DS0A 5A7SA 3CZUA 2BZTA 1FOYA 4LLLA 1EV11 1YRZA 1X3WB 4K9SA 5I0UA 5BPIA 1GXPA 3BP8A 2QQKA 3UKTA 4OIOF 1XYPA 4GO1A 4JAAA 5BYNA 2DVAA 4HK8A 4BS9A 3O0WA 4AEDC 3ASNH 1H1IA 1LQ1A 4YIFA 1DHKB 2ME0A 3VODA 4W1UA 2ZPXA 4Y5TA 3VBUC 2TEPA 1BEV3 3HOVJ 1WQ2A 3SZPA 4I99C 3RPQA 5M0TA 3OIOA 1X3UA 2XSDC 2VZVA 4XFGA 5DZFA 5IY5H 5LD2C 1BBT2 1SFPA 2VUCA 3GBFA 4A6SA 3VBOA 1WCSA 1TME2 2KISA 3A01A 3JRAA 3WTUC 2VZPA 1GOGA 2A6VA 3WZ1A 1QDCA 3CESA 4ITVA 4LKFA 1ITYA 4LFUA 2P5VA 1WRJA 2DA1A 2JJ7A 4PSXA 2E63A 1KQ0A 3VSLA 1TQIA 2E60A 4A3GJ 3UGGA 2Z69A 3QLQA 2YPJA 4AYBA 4HMZA 2Q8DA 1N3QA 4EJUA 1YJLA 2WZEA 4Y1YA 3FHNA 4YG6A 1WH7A 1F5JA 2PHWA 4GH4B 2ZNZA 1POV0 3B73A 1LOEA 4JZRA 3DYMA 3JTHA 2JDYA 2ZEWA 3DPRA 2K9LA 4QPWA 2WWJA 4JQTA 1GLNA 1NZIA 3MGUA 1VLNA 4LE4A 5K5RA 1RB8G 4RYDA 2WQ4A 3I2KA 4HVRA 4BE1A 1Z91A 2GC0A 2CW7A 4IX7A 2GNTA 2Y0IA 5G05L 4J00A 3CCYA 4FVVA 1RUH3 4LLOA 3FZ3A 1TT0A 2BYVE 3HG9A 2JDPA 1UG2A 1COV1 1Q8SA 2QQBA 1VE0A 4JDMA 1OLME 4X6AJ 4P96A 1VRH3 3H8UA 5A3UA 4FOYA 2VUMJ 3KF3A 5C3EJ 5I0TA 3EUHC 4KICA 4I0BA 2BHYA 2QUOA 3UJOA 4IHXA 2LP0A 3DKYA 2AQFA 1M4WA 3ZLIA 1DBNA 1HB1A 2JG8A 4QXHA 3HN3A 2V6EA 2R041 3JU9A 1OR7A 3D6EA 2Z33A 3I59A 3MZ8A 4ZYEA 1US3A 2W25A 5JXGA 2Q8KA 5IVJA 3LSGA 4P08A 3K4LA 5BNNB 4AWXB 2JDAA 4BE3A 2JDUA 2RHPA 3TRSB 5FYUA 1W6PB 2RGVA 4ENMA 5J4YA 2B9UA 3BDDA 2LY9A 1AHDP 1AYM2 1W6OA 2G9WA 2DMQA 4CCOA 5JCTA 1ACIA 5JIUA 1AR61 2KXLA 1LFUP 3RCOA 3OSGA 1SACA 3KP3A 3G6JB 1UX6A 1JJ6C 3N3HA 4FPLA 4Y15A 4ETSA 1HQCA 2CGNA 3LSIA 3ME2A 3KCCA 4NAOA 1JUPA 1O4YA 2HDCA 3ZQ7A 2HYGD 1LODA 3J7MA 3CKHA 3BTJA 2IVMA 1E0EA 1JW6A 1RUI2 4OHYA 1W1WE 5C6CA 2JDHA 1V6OA 3WP4A 1NLRA 2E7QA 2WNUA 4XRMA 2RVCA 3R4DB 4A6OA 4DO0A 3ERED 5T5OA 3CIHA 3CEWA 3W59A 4DOZA 4COUA 5K7FA 2XAGA 3ZOBA 5LGUA 3E1F1 1ND2B 2DW4A 5LZ6A 1YS7A 3ZP5A 2YX7A 3ZQLA 1RR7A 3VD3A 4TN7A 3A02A 3PO3J 4WX9A 2Y6JA 3FL7A 1VBC2 2HXIA 1UZ0A 1R1UA 3JSOA 3FMGA 2ZGPA 3UKNA 2R32A 3B5LB 3VBOB 3OSFA 5CU1A 3I54A 1VBB3 3A01B 4BHBA 4N7UA 4KUMA 2P6SA 1KRIA 1DZTA 1F35A 3AXDA 4Q4W3 3WR0A 2D97A 4HANA 3PTRB 1CVNA 4FASD 2ZGNA 5B4NA 5BV6A 1BEV2 3H9GA 1TE1B 4IVNA 2E7WA 3MIFA 2LREA 4PGHA 2K46A 1V9U1 1OYWA 1ULGA 1JZ2A 5FY5A 3QP6A 3AP4A 2Y48A 4RB2C 4R9BA 2QKLB 2ARAA 3MWMA 3QQAA 3AP7A 5FROA 3FHIB 4B1LA 1Z05A 1HDDC 4RGXA 4S2HA 3CMGA 3ZX7A 3DPRB 5GPCA 1DGRA 2DU0A 1DZRA 3PFYA 4N4OB 2X4HA 5FZGA 5D8AC 5CFCA 1D4VB 2EZHA 3I2HA 1HN1A 1CF7A 2VJXA 4PLNA 4RGAA 5FZ8A 3OWTA 2ECCA 2M5WA 3JRBA 1L7LA 4KITB 1GOHA 2V9PA 3M8FA 4L2NA 1BJZA 5HXVA 1RUC2 1WCDJ 5CVIA 2MD0A 4YW7A 2J1AA 5BPXA 1JZ6A 3KCXA 4C3HJ 3RZJA 3L2YA 2KHMA 1LENA 5C4XJ 5FO5A 4DZGA 4OQ9A 4WWCA 3ZMDA 2WNVA 3SISA 1RUH2 1QU3A 4HEA2 2R7QA 2ZZQA 2E6VA 2AZ5A 3I59B 3TP3A 3EXUA 5FFOC 2FOKA 4HNTA 4YRDA 4K7JA 4XK4A 4MUVA 1OI6A 3ZXSA 3D3AA 1VRH2 2D93A 3PSIA 2JKXA 4DPNA 3KS7A 1VBA1 2I74A 2W39A 1ACCA 3POJA 3VDDA 2X5IA 3KHBA 1W6OB 3MEPA 5H6QA 5LLQA 1HB3A 3SFZA 4C3JJ 4Z6YA 5L7OA 3LKJA 3N9QA 2VZ3A 3REOA 1OPCA 1K78B 3A23A 3K10A 5H2FC 3EJKA 2JSCA 3IT8A 4FTHA 1MIJA 4NDLA 1HN0A 1WGPA 2D98A 2MG4A 2R7TA 1AX2A 2B45X 4E8CA 1LEBA 1IN5A 5LRRA 1V3FA 3N05A 3R0AA 3B00A 2MHFA 2XVGA 1HRV3 5IHRA 1SFNA 2WNUB 1GUUA 2BOJA 4LLNA 1JUSA 2RNGA 2GH8A 4DBRA 2DT7B 4HG2A 4CZZA 2Y6KA 3JR9A 1BXHA 2AHQA 1CPNA 4ZZ5A 3MUY1 5D8LB 1DZQA 3ZQHA 3RQIA 4U7DA 1SBDA 4BY7J 1Y3TA 1JKPC 1I5PA 3ACIA 4UUVA 5TRDA 4YW3A 3TOBA 2EIGA 4A6DA 5CFDC 2ZX0A 1FMWA 3BOQA 1BHGA 3OYCA 2LD5A 2KIFA 1VBE1 3GW2A 2W1SA 2YFZA 3H35A 4D1QA 3RNSA 4OMZA 3F8FA 4FX4A 1AR71 3EYPA 4NHJA 1UU4A 1WCUA 3KETA 3E5XA 1W3XA 3HEFA 3EYIA 3WHCA 3MUZ1 1GZCA 3W20A 4SBVA 4CP9B 1VB4A 2W87A 3WW1A 3HGYA 3K4JA 4XFFA 1IQDC 2F5DA 2ZFWA 2KFDA 4YVWA 1KD7A 2C9AA 3T8TA 2Z3YA 3IBMA 4IHWA 5L9VA 3CZJA 4EZHA 3OSDA 3D82A 1BMV2 4YWAA 2F6CA 2VPVA 3WDTA 3RZLA 2VTFA 2EIEA 4KU8A 3ZN1A 3B69A 5IYDJ 4ASNA 1J2XA 1E3OC 1VBB2 1XU1A 2BV6A 4AVVA 4YG0A 3WNLA 1DYOA 3HVDA 1U5ZA 4QX8A 2XAFA 4Q4W2 5EJ3A 3GHNA 3CF2A 1OOPA 2VQUA 5FZEA 5H9RA 3S17J 1Y39A 4QKNA 3CO2A 1G9BA 2CFXA 2XRNA 2WC2A 5AIQA 4WVMA 5A3MA 4IEPA 5GM0A 2DA5A 4OU0A 3LFKA 1UY4A 1YW7A 3OYMA 3JCIA 4B7EA 1FI2A 1HQWA 3QBQA 4BQNA 1CF7B 4JGYA 1Z77A 2EXJA 2D5HA 3MV11 2ID6A 2KDOA 1FMD3 3M7AA 3V8KA 1BW6A 5A7PA 3VBUA 1FNZA 4GQ7A 1PZ7A 4M6YA 3TW7A 3B3QE 3WGGA 5KNLA 3FWEA 3WNMA 2DCKA 2A7AA 2HYKA 4QWNA 1MEC1 5A80A 3CL1A 3ILFA 1LFPA 1OJLA 3V42A 2DCJA 3V7SA 3AKSA 2QQIA 3FBYA 3LEGA 1NAEA 5E16A 5T5JA 1ZARA 5A6YA 2QSGX 3ZN5A 2B0LA 2WNVB 4QAWA 3KYCB 4LB5A 3F95A 3CDHA 2FDFA 1S7OA 3WGIA 1HOMA 4L5JA 2P6TA 1D0HA 1V6NA 5FQ0A 2ESHA 1U12A 1F4AA 2B9VA 2HEWF 3LQQA 4XAAA 2LY1A 3I55I 2Z4FA 1B09A 4RFT0 3R60A 3WG9A 1QDOA 3HHGA 5IK7A 3BTYA 4XSXF 4UB6C 3KMHA 1OISA 2YB7A 4XJUA 3F6OA 3FF5A 2NPIA 1UYPA 4AFAA 5FFZA 3UESA 2EIDA 3HPNA 5L7OB 3ZIWA 4ZDPA 4QU2A 5DD8A 3M8JA 3O1UA 4UFIA 2VL8A 3CDIA 3ABZA 5DN2A 3GWZA 2VCBA 5FZ9A 2P3KA 5A2QK 2IVIB 2B4KA 2R1BA 3KT7A 1IRXA 4WV8A 5C4WC 4BKXA 4QPGB 4QPYA 2EJRA 1AKHA 4Y33A 1U5IA 4M6VA 4EGYA 1R5HA 4KWLA 4PCRA 3PQJA 3FK7A 2DBIA 1T8IA 2ZEXA 4HNUA 2R16A 2PLYA 2RDSA 4LNVA 4M3CF 3QPTA 2JEMA 3DP7A 1O3TA 4ISQA 2QBXA 3T09A 2OIIA 2PLV2 1PHMA 4G9YA 1XU2A 3SKJE 4XYXA 3DTKA 2QVSB 5LB6A 3EUHA 5M3MJ 1ZZ8A 3GFLA 2I2SA 5T5LA 1PIV1 3LGRA 3NSTA 2XMLA 1JGSA 3CCSI 4A3JJ 2LRPA 3DLAA 5EJ1B 3AMHA 3CJIC 4CE8A 1HRV2 5CVVA 2YUSA 3U07A 1EJ9A 3AYDA 3R4KA 4RS5A 2Q8EA 1U8RA 5A70A 4GFBA 1SEFA 2GC3A 2IGOA 1JUHA 2O8QA 4YGCA 4AGVA 1YIPA 4DZJA 2HBTA 3W3CA 1XNKA 1FBSA 4LKDA 3K3OA 1JODA 4WVVA 4J01A 4RFRB 4JX5A 3DKQA 1BZWA 1CWPA 1PVC1 3FJSA 4YVWB 5J3UA 2VT3A 4Y1VA 5FYTA 2A3SA 4RGKA 3A0NA 1MVQA 5KXDA 5E6HA 3OYHA 1D1BA 1SFYA 2XQXA 2VBZA 4LITA 4LD5A 2ETHA 2ZABA 2KKOA 2WAFA 3SQNA 3ZMZA 1VI0A 3BIWE 5C8CC 2BERA 4YVSA 1XD7A 1V6IA 4C1WA 3GXUA 2FEZA 5E3MA 5EZWA 4H2AA 3MKYB 3FXOA 1OOPB 2QQOA 1IXCA 3GTKJ 1XDUA 1YJ9I 3BIEA 4NN0A 2VBBA 4RN5A 2RS53 3GTQJ 2NNYA 3VBFC 4WVMB 4AOCA 1YLLA 5T52A 4ZXKA 2V73A 4CYCA 2L4AA 2L9NA 5C4JJ 3BT9A 4LLGF 4NC6A 3ASIA 4CXXA 5ISLA 1MNMC 4JGYB 3GVAA 1VNDA 4QIWN 1YFWA 3I2DA 3VBUB 3KE2A 2YXSA 2ISZA 1KU3A 3D5LA 3L2UA 2CV0A 1BC8C 5CVJA 3VHOA 3JBG1 3UJQA 1S7EA 4C8DA 1BI1A 2VQGA 2PHLA 2PHUA 3SJMA 1VAKA 1ZVFA 4XEZA 5FZFA 4A3DJ 4XUQA 1ULCA 2CDPA 4COZA 5FLXK 4M3CE 2WFF3 4MGSA 4A3XA 3I0TA 3FLPA 2UZKA 3N7JA 1RPWA 1IOAA 1QQP1 4DQ2A 5FQ0B 1FMD2 5JXJA 3AJYA 4IRHA 1GSLA 1UMZA 1WUVA 3RJPA 5JOXA 1GANA 1DLLA 2LSOA 1QJX1 5F32A 2MH2A 1I3QJ 1UPIA 3MF9A 5E18F 5F2WA 3PVBB 4MO3M 3MBWA 3AVRA 2Z16A 2HQRA 2IUWA 3Q8EA 1S55A 2QQNA 1GZ9A 4XLCA 4O3MA 3LSDA 2D1HA 5ERIA 4FFIA 1IN7A 5DAPA 3WE3A 4CHUA 1LEDA 1PDNC 5T50A 1SANA 2KR2A 3IDEA 1HW5A 2DCTA 2CYFA 5K8SA 1NY71 2BV4A 4LULA 2J42A 4HKLA 5D8AA 3ZM8A 4RMNA 3MFCA 1S1AA 4QT6A 5FD6A 3JRHA 4PSWA 3IV5A 5JDBA 2M0MA 2PMHA 4D0QA 4PJMA 1U0JA 1HKDA 2M0CA 3HHHA 1QJY2 1REEA 1BI2A 4EJVA 1YFUA 1O5LA 4J6GA 1JS9A 2DDAA 1WZ2A 1JUIA 3NV3A 3DEWA 5FMCA 5FZDA 1DDNA 2E26A 1JI6A 2HWD3 3ZMSA 4XUTA 4L9BA 1ZRCA 2ET1A 2O1QA 2RNJA 3AP9A 1OMIA 2UY8A 2C6YA 3FFZA 1L3JA 3DECA 1TQPA 1UG0A 1H8VA 4RS5B 2ZEYA 2DWRA 1W6NA 3S7EA 3WG1A 5JWPA 2BJSA 3W5MA 3R05A 3VDXA 1REPC 4B4RA 4A0ZA 2K9QA 1F4HA 4WVZA 4XFBA 1RUJ3 3E5QA 1IUFA 1Z0HA 4P14A 4GA9A 4S2DA 3A0BC 4CEYC 1A34A 1HCRA 3APBA 2WNEA 3D5OA 2R063 2XIGA 2YSRA 3ENRA 3EDPA 1AYN1 3OUHA 4QGLA 2GXAA 4FTSA 2OQRA 2XC7A 3F72A 1MS5A 4QWQA 4XN3A 1AHSA 3F9KA 4ZYGA 2DN0A 1H9GA 2DF7A 1XC6A 3PJYA 4WZCA 1XMKA 2EIKH 3B01A 2GMEA 1ZG5A 1MMNA 4YVSB 1U5TC 1SDWA 2IXIA 2DJNA 1JN2P 4PIYA 4LK7A 3ZXEA 4XUPA 2V4VA 1VQMI 2CG4A 1UY2A 4CCNA 3R4SA 5L9BA 4UBGA 3K4DA 4JGZB 4QDQA 4XMIA 1S3JA 2DI3A 1FPN1 2ORZA 4GJYA 2YU1A 2TCTA 1EPZA 2VODA 2K02A 2VNVA 5HXMA 3BYWA 3WOGA 2BHZA 2QCSB 5FZ7A 3VPRA 5KXCA 4O5VA 2QZ3A 2RAEA 3KFWX 4CICA 5LRSA 2WA3A 2A5YB 3K6GA 5GTIC 1ORKA 4AVTA 4QQLA 3I3LA 1GDTA 3VYUB 5FPBA 1FSHA 4K8FA 5DEQA 1FTZA 1T39A 1SLTA 3U14A 3S32A 4QB1A 4BDZA 3C3WA 2RS52 3ASOH 2MYSA 3WF3A 4XJ8A 4IEVA 2VJJA 2VXZA 2EICA 1D2SA 5KHIA 1UHMA 3S2DJ 1HDKA 4BBRJ 3WHBA 1H2LA 2HZDA 3VKMA 1NA1C 4FETA 4RA0A 1H9WA 3GBWA 4YM3A 4U2AA 1S0BA 4N9IA 2VE1A 2YPDA 4QXKA 1EV13 1WJ5A 2GNBA 1Q1HA 2E71A 4RLFA 4WVWA 2KRFA 2WFF2 4Y20B 4A7KA 3MFAA 3TO6A 3ZIXA 1R1VA 1FY7A 3PIOF 5FPZA 2A6HF 3LSHA 2RE9A 2ZMKA 3VSKA 4R9DA 3OD0A 2VG9A 4I09A 4IGPA 5M5WJ 5FZKA 2J1UA 3ES4A 4A3LJ 2GU9A 5D8AB 1WCKA 3VDAA 4IUGA 4XZPA 4TZDA 3K3NA 1H0MA 2I10A 4U7BA 4UW5A 1W36D 1JT0A 4IV1C 4AI3A 4UHTA 1YQ2A 1WWYA 5J36A 2UU8A 1KDKA 3PNAA 4XOTA 2HWF3 3HPHA 1HXS1 2XPWA 2QJVA 4NPMA 4ZTJA 3GTJJ 4LHLA 1W2NA 4XM3A 3NMBA 2E2JJ 3VD7A 2EFNA 2HWE3 4RSUA 1FNNA 2XBO3 4TWTA 1A35A 1RUG3 2Q0OA 3LF7A 3SZTA 5EFUA 2ZKZA 2EIJH 3R0JA 1RVF1 1BQPA 2P8TA 4YZ4A 2WIIB 3ZRGA 4CSWA 4A5MA 2VPLA 2KZVA 3QWLA 2ZTNA 4GULA 3AL5A 1WJEA