4I0AA

Structure of the mutant catabolite gene activator protein v132a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKAGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0aA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0aA01
2VBWA 1IF1A 3NL1A 4XLPF 1DP7P 2BYVE 1LJ9A 3KZZA 1QZYA 3D0SA 2CYYA 1DPUA 2H09A 3E5QA 5E18F 4EM2A 1CAUA 1ZGJA 5HDNA 3VHRA 2XGXA 1QPMA 1MDMA 2MH9A 4M9XA 4CZZA 3E6DA 1QXRA 1YW9A 2FNAA 5CLSA 4EM0B 3CO7C 4AVAA 2N7GA 3MZHA 2PLYA 4E2SA 2Q30A 4A0XA 5JHUA 1OFNA 2OZ6A 1W7PD 3DEUA 4GXOA 5ILSA 3CO2A 2XUBA 2CWEA 4HN1A 3U11A 4QLCU 3VEPA 3E3VA 5J6XA 4RGXA 1Q5OA 2ET1A 4XLNF 1SD5A 4AD9A 3DPLC 2UYBA 4I3PA 4LB5A 5ICGA 1ZRFA 1JE8A 1O5UA 3R0AA 3MQ0A 5I0UA 4CYDA 3WGGA 4KICA 1REPC 3P9KA 1WQ2A 2O3FA 3MYXA 3NEUA 4N9HA 5C6CA 3I71A 1CAXB 1QBJA 1T6SA 3J81K 4L5JA 4ESJA 4X6QB 2F5EA 1TW3A 2H6BA 2A68F 1ZREA 2KJBA 2ETHA 3IWFA 4I0AA 1XSVA 3UKNA 5AONA 2QENA 2ETEA 3E97A 2ZNYA 1PDNC 2IW5A 2XASA 2QVSB 4RD7A 3DPTA 1WA4A 2EFPA 4LFUA 4IHTA 3LQRA 2FU4A 1G4DA 4Q0UA 3FF5A 1OI6A 4AIHA 3HSFA 2A3SA 4QMAA 1H0MA 1L3JA 4N9IA 3R6SA 4RGRA 1LRHA 2PAEA 2O8QA 1FYKA 2JZYA 2A69F 5FO5A 3RI4A 2EA2A 4UV9A 1ZRDA 4I01A 3LAPA 3IIAA 2CFXA 5H20A 3ECHA 3QU6A 1UW8A 3REOA 5FQ0B 3SMHA 2CO5A 2LF8A 4G6DA 4IEXA 3QP6A 4EMSA 1XE7A 4RB0A 3W6KB 3E5XA 3FMQA 4EGZA 4LK0F 1SAXA 2K0GA 2LF7A 2KIFA 4ENJA 3C18A 1DGWA 3EBRA 3JAMZ 4ZU5A 2M45A 3IRQA 1HKQA 2W84A 3GUDA 4IEPA 3EYYA 1MZBA 2IXHA 1S29A 1BJAA 4YFNF 4HOBA 3WTVC 3WW4A 5EFUA 3HOTA 3ZN1A 1BI1A 5A2QK 5KHJA 2KJCA 2IXCA 2R7FA 2F4PA 1CAXA 2PMHA 4YFXF 4HX8A 3HRUA 2J5OA 2HWVA 5T3NA 1FLIA 2WFPA 1I5ZA 1SMYF 2E1NA 3TNPB 3FMSA 4U0VA 2Q2EA 1LDKB 2IVMA 1X3UA 2MC3A 1XGSA 1R00A 4RS8A 4Z2YA 1XMKA 3V8KA 2DFIA 3IHUA 4O6JA 3NRVA 2R7DA 2XIGA 3M8FA 3MWMA 2L01A 5HS8A 2XAGA 1RGSA 4OMYA 4IEVA 4M72A 4LMYA 1R7JA 3DN7A 2MLGA 3ZMUA 1KGSA 4DINB 1IXCA 3GVAA 5TJJA 2F5DA 3WTYC 4EGYA 3R60A 2QDRA 2D1HA 1XSXA 4LTAA 5FQ0A 4HDVA 3PQKA 5I91A 1SD6A 2IJLA 1WWXA 2K4BA 1GXPA 5E16A 5FD6A 3ROUA 1UPIA 4UNOA 3GW2A 4G7HF 4IHSA 3QACA 1WI9A 4L11A 3I5UA 2Q4SA 3V8JA 1QGPA 3F8NA 1IXSB 4EVIA 5BPXA 2XAQA 2RV8A 4UBGA 3T8RA 3SZPA 4AVBA 2UYAA 3B73A 1T2KA 4YYOA 5HLIA 1JHHA 4LLOA 3EO6A 4ZZDA 4MGIE 3GFJA 3RJPA 3VB2A 2DLLA 1H9TA 1ZZCA 2OA2A 3K9TA 1CAVB 2IRFG 5KVRA 3K0LA 3BWGA 4QXKA 4PGHA 3FHZA 4KIGA 2IP2A 3K1NA 4M74A 2VECA 2YX4A 4U0WA 4BQAA 4CO8A 3F8BA 1ZVFA 3L9FA 4UBHA 4WK8F 3F3XA 4L9TA 2PHLA 3SXWA 2GQQA 4IESA 1Z1DA 3H1WA 2PAMA 3O14A 4UXNA 5JSOA 2BNNA 1TQIA 3O3KA 4LLGF 3MEXA 2VBXA 3H3ZA 2VBZA 1ON2A 2FA5A 3TDUC 4E2GA 2PEXA 2OQGA 1XDSA 2M5WA 4JV4A 4Q5SF 3PFIA 3JW4A 5FDBA 2E7WA 5LGTA 2VBYA 1MJBA 1J3RA 3RYPA 2F5FA 1O7LA 2QQ9A 3B02A 5D5UB 4P9UA 4Z07A 2EV6A 4UVCA 3KEQA 2YX7A 1GXQA 2DW4A 3RNSA 2PQ8A 3SXYA 5L3CA 2EB7A 2VC0A 1J0RA 1X82A 4HX7A 1RIOH 1FBSA 4LUMA 4Q0VA 2FF4A 4AXOA 3DQVC 3FZ3A 4FAHA 2MLKA 5E20A 3T1BA 5KHIA 4XSXF 4ON0A 2G9WA 4QWQA 2QWWA 4I7HA 3J7AO 2I45A 2Y48A 3ABUA 4HYEA 2QUFA 5D5WB 1IN4A 3IBMA 1TTYA 1NYWA 1XN7A 4YSFA 5FLHA 4IRGA 3PLQA 4XFIA 2H6CA 1CAVA 3ST7A 4XSZF 3KP7A 2VPVA 1R1TA 4EWEA 2OD5A 1HW1A 4KN4X 4ONUA 2EV5A 4G94A 4B29A 2CG4A 1FZPB 3KP3A 1CF7B 4ENKA 1BI0A 4LD5A 4HMZA 2O0YA 2VXZA 3W6JB 3N97A 2PBIA 2O8XA 4HVOA 3GZ6A 2BV6A 2PTMA 1I1SA 1JXSA 1SD7A 2RN7A 4NHJA 4Q4ZF 4IPAA 4M9ZA 1U78A 2GC2A 2R3SA 1QWRA 1IPJA 3F6OA 3EJKA 4KWJA 3OGJA 5AIPA 4XF9A 3GYHX 1RUNA 1D5VA 4NB5A 4L9JA 1ZNPA 4MTEA 4U88A 4OLLA 2ZO4A 5CVUA 3ZQ7A 4R79A 2RDPA 5E17F 2Y0OA 1J9IA 1WSUA 2VC1A 1VP6A 2FSWA 1J2XA 1GQHA 1IUYA 4J1XA 1ODDA 3GEZA 2K86A 5CVIA 3S2WA 3SQNA 1HKSA 3ZDSA 1G6NA 3M9AA 3K1PA 3H9AA 2GAUA 1GVJA 3WU1B 3KZYA 1NXMA 2V1XA 2P6TA 3JAMK 4NVPA 1B59A 2HYFA 1FC3A 2VOPA 2Z5UA 1ZZBA 1RI7A 4X6RB 1ZRRA 3WW3A 1Z6RA 5D6EA 1IN6A 1JHFA 2B8MA 1LEAA 1YS6A 3KLNA 3BJ6A 3TOBA 3LA3A 4MQ9F 4GGGA 1YS7A 3E6MA 3O2PE 2EV0A 2VONA 2L3DA 1UB9A 4NQWA 1CF7A 2BEOA 5ILVA 3FXQA 3ERED 3CDHA 1IN8A 1XDUA 1EH7A 2DO7A 5JR3A 1B6AA 1PP8F 1EYBA 2HZTA 1TLHB 5K5QA 1H1IA 5TRDA 3LFKA 4XFBA 1HXDA 3T5XA 3WTZA 4PIXA 2Q8KA 4HW0A 3KP6A 1S3JA 1XB4A 5FLXZ 3C3WA 3H8UA 2KKOA 3QP5A 1XRUA 2EJRA 2M8EA 5L3EA 4Q0PA 2ATFA 5L3FA 5BPDA 4HBLA 4UXAA 2XL9A 3HTUA 4YIIA 1FI2A 4JTOA 2BGCA 2DCTA 2O1QA 2GC3A 3TO9A 4ESBA 3AAFA 1R1VA 4XRFA 3FJSA 4XFHA 3ZMZA 3H50A 3LA2A 3PQJA 2QCSB 3V7SA 2ACJA 2PG4A 3BCWA 4AWXB 2UXXA 3CL1A 2KIMA 4AIKA 1SEFA 1BI3A 3M1EA 3LAGA 3HYIA 1UCRA 5EEHA 5JSRA 2Y0MA 3R0JA 2D45A 3V4GA 5ICEA 1O5LA 1ZZ6A 4EJWA 2XHKA 5ICFA 2EA4A 4A2UA 2FBKA 5FD5A 1BM9A 3CJNA 1XGNA 1FT9A 4JQFA 1K78B 3QU3A 3M70A 2ELHA 1FSEA 5BUVA 5JAXA 2J5PA 5FPXA 3FE5A 2HQRA 1ZG5A 4GO1A 3H3UA 1Z05A 3RKYA 2OZJA 5DCFA 3ZMDA 5J8FA 3NSTA 3ELKA 3GX4X 1J58A 4KMUX 1ZHFA 2PHDA 4PIYA 4CGZA 2WC2A 4G9YA 5FLJA 4I0BA 2P4WA 2NRAC 5BV6A 3HSEA 1SQ4A 4P9FA 2EFWA 3QAHA 5D4SA 5F6FA 3HTSB 4Q48A 4D0PA 5FCCA 5I8TA 2DT5A 1YO5C 3SCFA 1E2XA 4EJUA 3DXJF 3F21A 3TOAA 4G8XA 4K8FA 5K5RA 4RB1A 1UIJA 5D1IA 1IN5A 2UY8A 2XRNA 4YIFA 1ZN2A 4KMFA 1OYYA 1DGRA 3OF1A 2ET7A 4PDKA 3FHIB 3L09A 1P4XA 3NW4A 1ZGAA 2A07F 1ZZ8A 3E6CC 1YYVA 3I0TA 2PAKA 2PFWA 1LNWA 4HVRA 2XLFA 2QNKA 3EQLF 4XETA 5I8YA 3HUGA 1R5GA 4ZU7A 2WV0A 1IW7F 1KYWA 4MX3A 5FGMA 5BOXA 2Z99A 4A0ZA 3BOQA 1SFXA 2IXJA 2EAAA 1FNNA 1Q43A 1EH6A 5L3GA 4MEXF 2MH2A 2O03A 1X7NA 3Q5FA 1K78A 3ES4A 1O4TA 1T0FA 3LWCA 5KHHA 2HGCA 1KU3A 1YFWA 2KIUA 4OU0A 1ZAOA 4XF3A 5K1YA 2Q0OA 2IXLA 2ZMEB 4J1WA 5I0SA 2PJPA 3P9IA 5D8LB 2EFNA 4HSLA 4IEWA 4KL1A 4A5MA 1FSHA 4BAYA 4JK1X 4M73A 1YFHA 4LK1F 2L4AA 2UWMA 1ZZ9A 1WGPA 3O6BB 4E2QA 4GULA 4ZU4A 1K7AA 2KRFA 4HBNA 1KU7A 1L3LA 4XF4A 2JPBA 4Z82A 1NE6A 3FMRA 4HF0A 1I6XA 2QQAA 1YLLA 1YFYA 1XCVA 3HSRA 3GFMA 2OZUA 2ZXJA 4ZYHA 1PP7U 4FAGA 3CF6E 3KCCA 3L00A 1C0WA 4XFCA 3F8MA 4IRHA 1P4AA 5BQTA 4BXUA 4G7OF 3WTWC 3F8FA 4RAYA 2ZJ2A 4EQQA 4HLYA 4LA2A 2EK5A 2K27A 3MCZA 3QPHA 1FX7A 4ZYGA 4IXAA 4OIPF 5D4RA 2GC0A 3IKTA 5CVRA 2DQRA 1QQIA 2JT1A 4EWDA 4FX4A 5F1RA 5BY5A 4H0EA 1V3FA 1U5TC 2HQNA 1SMTA 2P8TA 3LWFA 1EPZA 4MNUA 5DD8A 1TNTA 3DKWA 2BNOA 3HQXA 1IAWA 1U5TB 3T0YA 1PMIA 2Z9OA 2YSRA 4IEUA 2HTSA 3BPZA 1R23A 5I0TA 4RGUA 2LNBA 4OIQF 1CAWB 2FRHA 3I4PA 3TO7A 2FBIA 4HX4A 4P55A 2Z33A 5HLHA 4FBFA 1J75A 3FM5A 3TNQA 3I59B 2V9VA 2ZMEA 3H1MA 3ZP5A 2RKHA 3R61A 3U0ZA 2DTRA 1FOKA 1BN5A 1YW8A 3P9CA 1GHCA 4MGZE 2DI3A 3KSCA 1Z7UA 1GQGA 3WGHA 5ILUA 2XV4S 3NVCA 2DQLA 3BB6A 1CX4A 1FWZA 2C0ZA 4S04A 4Y13A 4XEZA 2AXLA 3ISPA 3RPUA 3HOSA 5FLXK 2FQ3A 5J3UA 5ICCA 5DDGA 4XF0A 5FFZA 4P5OA 3MDPA 4FT8A 3ES1A 3ZPLA 2IA1A 5EEGA 4KIBA 4MGKE 3S0MA 4L2NA 5DCMB 4KDPA 2PI0A 1SFEA 2VOOA 1IRFA 5E1XA 4HLTA 5FLIA 1W5TA 4YFKF 4YRDA 1LR5A 1J59A 1MGTA 1RZ4A 3D82A 1WLTA 1ZLJA 4O9EA 2W25A 5DEQA 3DL3A 2ZBKA 2P7CB 1U6GA 5LGNA 2BBYA 3WE2A 2F2EA 3FX3A 1WRJA 2MNGA 1KQ0A 2RGVA 1TBXA 3BPXA 4FX0A 2RVCA 2Q1ZB 3CEWA 1RUOA 5IT9Z 4IERA 3SZTA 2LDUA 3G73A 3WODF 2GH2A 2MD5A 4Q47A 2NS0A 4YNIA 1O3TA 5KHKA 3QOPA 4RGSA 3H7YA 1W5SA 3ZMSA 5CJ9A 1R5HA 1W7PB 2FXAA 4ENNA 1S8NA 1U5TA 4IEZA 3VOEA 4KUMA 5DUKA 1RTVA 3GBFA 2XAHA 3G3ZA 1V70A 4PIZA 3FWEA 3HRTA 2ZKZA 4P96A 3EETA 1S7AA 3GXOA 1CAWA 2ADUA 4KWLA 3CUQC 1J3PA 3U1DA 1TQ5A 2EVXA 3FFQA 3I54A 5I93A 1I1GA 1IXRC 2LSOA 3CUQB 1J5YA 1EY2A 1F9NA 4XFAA 3RZZA 3I59A 4A5NA 1XMAA 2X0LA 4HV5A 1OYIA 2P17A 1MKMA 4R52A 4IEQA 2P5KA 2DPDA 2K02A 4I02A 5CVJA 4L9NA 4EJVA 1Q1HA 2CSOA 4GYGA 1FP2A 4XBFA 4MGRA 3H1YA 4F7ZA 5BPIA 4IRIA 4E70A 3QRFF 4K2EA 3KGZA 3EDPA 1MJ9A 1G3WA 2HR3A 2K7LA 3GFIA 1RL3A 1R22A 4WCGA 1UFMA 1TQMA 2FNPA 1A04A 2L54A 2IPQX 4XFGA 5DCMA 3LQQA 3SCGA 1NHAA 3JSPA 3TDZC 2STTA 2ZCWA 1P92A 1USSA 4BHBA 1LB2A 1IPKA 3WU0A 2BE5F 4I2OA 5IT3A 5ED4A 4OIRF 3WE3A 1EV7A 1LDJA 2X4HA 3GZ5A 4UVAA 2TDXA 2FMYA 4CXFA 5FB2A 4R1HA 4OFGA 1SFNA 4LULA 3I53A 4U7DA 1KQ8A 4DNCA 5E8IA 1F1ZA 3I64A 2G7HA 1XSDA 4OIOF 2O61A 2H94A 2F5CA 2P7VB 2E1CA 1W7PA 2AS5F 1UD1A 4IF4A 4HVQA 4I98B 4L9VA 1QY4A 2OA4A 4TV7A 2M87A 1OMIA 4JVAA 2Q0AA 1R58A 3KFWX 4WWCA 4G6QA 4LA3A 3LSTA 4HLXA 2HTJA 2P6SA 2RNJA 4Q29A 3DV8A 3CUQA 5LEJA 4P9GA 2CQKA 4ZYDA 2CV6A 4KU7A 1RC6A 1KYZA 4ZH4F 1S6LA 3F23A 3CTAA 1U3EM 2A6EF 2W85A 3WG9A 2QQBA 4L18B 3ETQA 1Z6TA 2DU9A 3PNAA 3SFZA 1T38A 2JPCA 1VTNC 4WXDA 1BIBA 2HYGD 3TQNA 4WVZA 1NE4A 4LG0B 2K4JA 3TKYA 2L4MA 3LAJA 3RIRA 1IZ1A 1YFUA 2XKPA 1T98A 1ZG3A 3KP4A 3KEOA 3BPVA 3HRMA 4Q0SA 2CGPA 1YWKA 2HFHA 1EH8A 1YIOA 3FZVA 2HEOA 2IC1A 4BHCA 2V09A 1IN7A 3WTUC 1DZTA 5J48A 4EJTA 3SHRA 5LLQA 2D93A 2VQAA 3ML6A 1DUXC 1HKTA 2GWRA 1PM7A 2V6CA 4RB3C 4LB6B 5BMZA 1Y3TA 2XLGA 3OD0A 2ESNA 3RYRA 3NKTA 1O57A 1ULYA 3N4MA 4EROA 1D8KA 2ISYA 1Z91A 2GXGA 2H0VA 4PZJA 3IRRA 4GYIA 3ZN0A 4GCVA 1E17A 3MZYA 4L0ZB 4WBBA 3SHFA 5DUIA 3CLPA 1ZG1A 3ULQB 4BIFA 1FBQA 3C7JA 3OV8A 4PGGA 3ELNA 4O9GA 5DV5A 1PUEE 5E1ZB 1AWCA 2IA2A 2COMA 4HZFA 3TGNA 5CYVA 2CW0F 2XAFA 3BJOA 5JR7B 4MUVA 1FPQA 3V7RA 4UV8A 3S7EA 3RKWA 2ESHA 2QJVA 3MAJA 2DPUA 4AQ6A 2QLZA 1P4WA 3CO6C 1EP0A 4MGYE 4LG0A 1BOAA 2GZWA 3I7DA 2ZFWA 1HSJA 1U8RA 1KU9A 5LHIA 5JCTA 5BS6A 3T8TA 1I27A 1YG2A 4TLFA 1BC7C 3BU7A 2CAUA 2B5HA 3F6VA 2FMLA 2NYXA 3U10A 1NZCA 3KETA 2VE8A 4CHUA 1LKNA 2A5YB 3IDCB 2PA7A 4Q0QA 3GYDA 1ZARA 4RAZA 1P2FA 3ABTA 1ZZ7A 3J80Z 4LGWA 5IT9K 5ERIA 1XCBA 1TW2A 1ZRCA 3M7GA 4KNYA 1J1LA 4WX9A 2HS5A 4MH0E 3HHHA 2LKPA 2EFQA 4ESFA 2ISZA 1HSTA 1KA8A 2A61A 2D40A 3F72A 2GIVA 5AVPA 5J7MA 2D5HA 1IRGA 3ZMTA 1FP1D 3FM3A 4BNCA 2JSCA 3WTTC 2UZKA 4HAMA 4N0BA 4WXCA 2XLAA 3GFLA 2BNMA 1FBUA 3GO5A 4ZYEA 4YARA 3UKVA 3BY6A 5KBFA 1U2WA 3LOIA 5DYMA 4HF1A 2L02A 5H6QA 3EYIA 3GWZA 1YTYA 3LZZA 4ENMA 3H92A 3IKVA 5JVTA 2W24A 4AVCA 4M6XA 1G3YA 1YQAA 3WW2A 2O6GE 4IEYA 2V79A 1UCXA 4O5VA 4MV2A 5E1WA 4EJOA 2VN2A 1SD4A 5HS7A 5AIQA 1K79A 1H1MA 3RTRA 4PJYA 2DK5A 1MJAA 2E7XA 5HDGA 2GA1A 4OMZA 2E9QA 4F8AA 4ORFA 3BALA 2PQQA 3UKTA 4M9SA 5KK1A 3EQEA 4G7ZF 1YLFA 2PMUA 3Q9VA 1FYMA 1LEBA 1B1BA 3HT2A 1BIAA 3MPBA 2VT2A 3IWZA 2HKXA 4IVNA 1LQ1A 5HDKA 2YPRA 3S7IA 4HF2A 4MQVA 4WZCA 5HI0A 2K9ZA 4LEJA 4CICA 1OKRA 2QBYB 2FOKA 3U2RA 2EWNA 1K6OA 3C3VA 4AIJA 3K2ZA 2YU3A 2C6YA 1DPRA 3DFGA 1CGPA 2A6HF 5L3DA 3TO6A 2IA0A 3GLXA 2ZKLA 3I58A 3RPQA 4ETSA 1WKMA 3ZMVA 4KFCA 4LLNA 2M30A 2Z3YA 1ZX5A 3WTSC 5HOOA 1JGSA 2NAZA 2PYTA 2DAOA 4L0YB 1Z9CA 1FYLA 1U12A 2FBHA 5BXXA 1F5TA 2NNYA 4Y15A 5LRSA 3ACLA 3C1DA 3KMHA 4I09A 5CVVA 5KHGA 3WTXC 3VFZA 3OTFA 2H27A 1OYWA 4KA4A 4BH9A 5K8SA 1RNLA 2D1VA 3E6BA 4ASNA 1DZRA 3KGLA 1ZYRF 3LA7A 3WW1A 4META 1G3SA 1HQCA 3EHKA 2GU9A 4UHTA 4MEYF 4OOIA 1QNTA 2CAVA 2EA7A 1X8EA 1LVAA 1BBYA 5HS9A 3F22A 4EM1A 2GXBA 1ONVA 1OPCA 2VODA 4JTNA 3JZVA 1T39A 1AOYA 3D0JA 2QVOA 3KE2A 3HRSA 2HDCA 1XD7A 3VODA 4FHTA 1XE8A 2QBYA 4QGMA 5LGUA 2QYOA 4Y17A 4B09A 4QM8A 4DQ2A 1R36A 5HVQC 1X8MA 4M71A 4UVBA 3RDIA 3KP2A 4PCQA 3K69A 1V4RA 4LUKA 2QZ8A 3OOPA 3JTHA 4A6EA 5FFXA 2JTVA 2XAJA 1BI2A 3F8CA 4HSJA 2FE3A 1L0OC 2RQPA 5LRRA 1XGMA 3G7DA 2OQRA 5HLGA 4R8HA 5J8CA 1FY7A 3BDDA 3CUOA 2MHFA 4QX5A 1UHMA 4QGNA 3HIFA 2UY9A 3FXRA 2V1UA 5D5XB 4BHPA 4ZZLA 4EV0A 4LJZF 2OBPA 1OR7A 5JSPA 1USTA 4XFFA 1VR3A 2B9UA 1HW2A 3J81Z 4S05A 1F4KA 1TNSA 4H7LA 1B4AA 4LLLA 2MA3A 3DP7A 4AVPA 2PN6A 4HQMA 1S7OA 2D5FA 4IJAA 3CJXA 1YHFA 2EFOA 4MHGA 3BZ6A 3J80K 1O3SA 2FQPA 2QM3A 3V8LA 1UIKA 3NQOA 2W57A 3U9GA 2FEZA 4WXHA 4UUVA 4MZUA 5JFRA 2KXLA 1XGOA 1W4MA 3Q9SA 2RC4A 4XF1A 1KQ9A 1KU2A 3RKXA 1Y0UA 2WTEA 1LDDA 1R1UA 2DBBA 4BYYA 5LEKA 4CDGA 1H9GA 1BC8C 1MD0A 3IL2A 3COAC 4KWKA 3USSA 2UXNA 2VE9A 5L3BA 4QM9A 4RB2C 2GA2A 2IT0A 4JBAA 5LHGA 1JUHA 4IEOA 2NNNA 2D2WA 5CU1A 3KP5A 4A0YA 2OYZA 3L2HA 1UHWA 3FXUA 4M6YA 2Y75A 2ZNZA 5I0RA 3BP8A 4L5IA 2MBFA 3JSOA 1VJ2A 5D8KB 3CLOA 3D5LA 4KYWA 3ECOA 5A2QZ 4U7BA 5E8GA 2XVCA 1B9MA 2WWYA 3JTGA 4KT5C 5C8WA 3M8EA 4QGLA 4D7SA 2G7UA 3HHGA 5JI6A 5F64A 4B8XA 3M3IA 4KIFA 4EWAA 4OINF 4A12A 2V1DA 2DK8A 4WF2A 2P5VA 2B0LA 3KLOA 4KN7X 5E1RA 1ZH5A 3R4KA 1HW5A 4KU8A 3K1MA 2XL7A 2PFBA 3QPTA 2P5LC 3BROA 3EUHA 1OD5A 1CAUB 1YFXA 3IDBB 1P6RA 1O3QA 2Z2SB 2IXKA 3PVBB 4IETA 3RYKA 4D7TA 1HBXG 2OPKA 1YW7A 2JRTA 2VT3A 3GF2A 6PAXA 2IXIA 2HJIA 2OU2A 1MDMB 1SFUA 2OAZA 1QXJA 5H6RA 5I8SA 4MTDA 1G3TA 2Z69A 4HV6A 1D8JA 2YR2A 2MPFA 4HQEA 1ZLKA 3MFKA 5CADA 3DF8A 2HKOA 1DDNA 1B9NA 3E5UA 5K5OA 3HT1A 4AQ2A 3OCPA 2GC1A 1D3YA 1ON1A 5EZWA 3BJAA 3L2CA 3NJZA 1QZZA 5LBQA 1Q3EA 5D6FA 3IC7A 1Y9QA 1QO0D 4HN0A 5D5VB 3P7NA 1STZA 1J7KA 2M1BA 2XROA 3SCHA 2HOEA 5DD4A 5LHHA 3WGIA 3L7WA 4O3MA 4A6DA 1FXZA 3V7CA 2STWA 4YG2F 2XKOA 4HDUA 3H7JA 4HA8A 1J3QA 1O7FA 1YUDA 5FPZA 1O3RA 4U0YA 1TQPA
chains in the Genus database with same CATH superfamily
2ZGNA 1VBC1 3VD4A 1LNSA 4LHKA 3DCQA 4CCJA 4LK7A 4BJ0A 2WZPP 3D0SA 3O0VA 2R062 4X8NA 1R092 5GP9A 2XGEA 3EYPA 2WZR3 4GKXA 1H89C 4JX0A 2XPWA 1CESA 2CGNA 3JD73 2XGXA 1QPMA 1MDMA 3VSLA 1RHI1 2E26A 1Q8PA 3RQIA 1YW9A 2EF6A 5CLSA 4EM0B 2KRCA 3HEIA 4AVAA 4AHWA 2PLYA 4E2SA 4NHKA 2WAOA 2ZMLA 1OFNA 2XSJC 4ES9A 3WF1A 5F0FA 1IUFA 4QLCU 4BXSV 3E3VA 2FCTA 4C3JJ 1W1WE 4FO9A 1Q5OA 4XLNF 5FZHA 1SD5A 3U37A 5SV8A 2R1BA 4LB5A 1ZRFA 1HV0A 4Z8BA 3CC7I 4BOWA 4K8RB 1REPC 3FXKA 4SBVA 2NVQJ 3EB7A 5ANNA 3OS1A 4XICA 1RUJ2 3FK7A 4HPQA 3NV2A 4AVTA 5FWJA 4PLOA 3G6JB 1HB3A 4I0AA 1F8VA 2QENA 2OPTA 2ETEA 2XWBB 2Q2EB 2ZNYA 1ALYA 2IW5A 3N05A 2ZJPF 2XASA 1WA4A 5LWBA 5DDJ2 3LQRA 4L0PA 1RHI3 2FMDA 1RXFA 3FF5A 2NLRA 3WG4A 2UV1A 4FPOB 3HSFA 2YDEA 1W36C 4N9IA 4RGRA 1LRHA 2O8QA 2X5IB 4COUA 1W0NA 5FO5A 2KFDA 3WHBA 3LAPA 2CFXA 3MVPA 2RS51 4YM0A 4J19A 2DDUA 4ZJZA 3O1UA 2XQXA 2LF8A 5GLTA 1V6OA 5M5XJ 2VXDA 3N7MA 4XBLA 1VMJA 5JHFA 3MO4A 3E5XA 3FMQA 4EGZA 1HA8A 4LK0F 1O6UA 1HLCA 2EBIA 2A75A 3AP4A 3MD2A 1DGWA 3EBRA 1I3AA 1ZBA2 3KYCB 2WNVA 4IEPA 3A2KA 2BPA2 4AEKA 3BR1A 2JDZA 1HRV2 5KHJA 2KJCA 2VZSA 1CAXA 1WCMJ 1CX1A 3GCMA 3HRUA 2HWVA 5FAXA 5CISA 1XS9A 4DW6A 1DGWY 1SMYF 2RVAA 4IE4A 3B9IA 2E1NA 3FMSA 1JI8A 2VBBA 4PDWA 1X3UA 4MFDA 4Z2YA 2RS53 3KZ4C 4Z2WA 4AYBA 1C8M1 1W2OA 3M8FA 1RGSA 2QKDA 4M72A 3ZGKA 4OHWA 4DPNA 4B1MA 4NIGA 3GVAA 3MLJA 2Y33A 3HEFA 3S5AA 2QDRA 2ARAA 2AEYA 4XPVA 4LTAA 4XQWA 5HV4A 5ERLA 5I91A 1QJEA 1WWXA 1GXPA 2OQ6A 3ROUA 2CNAA 3WDTA 3AG1H 4RFT0 3QACA 1X36A 1QOTA 2WA3A 1JTYA 2Q4SA 4BJ5C 4CCOA 4M00A 3LSRA 3F8NA 3VZNA 2FDGA 1DYKA 3IUOA 5BPXA 3ZDVA 4DRRA 4UBGA 3AZVA 4XXAA 4AVBA 3H9GA 3OYIA 1K3IA 1BQPA 4XDPA 3GFJA 3RJPA 4QX3A 1RUC3 3N9NA 1H9TA 5H9RA 5LA1A 2DV9A 5KVRA 2VVFA 2P2KA 1OCOH 4QXKA 3O1TA 4KIGA 2XJQA 3S17J 3K1NA 1KZHA 1GV5A 1DQ1A 3RRDA 3IPVB 4HK8A 3ZFFB 1MNMC 2ZX0A 4UBHA 1REDA 1HV1A 2HXOA 4L9TA 2PHLA 2OC6A 3AVRA 1CQTA 1TVGA 4YGBA 2BERA 3O14A 1MSFC 2VD7A 3HM5A 4UXNA 4EZ4A 2GP5A 1GOHA 3HWJA 3KX2A 2VBXA 2VBZA 5A33B 2FA5A 4GRIA 2ZEZA 4H3WA 2AQFA 1XDSA 1GVDA 4JV4A 5ISLA 1W03A 4XLEA 3CJIA 4XW3A 1MJBA 5LBEA 1O7LA 2QQ9A 3B02A 1GV9A 3GTPJ 4IV1B 4UVCA 4QB1A 4PFOA 2RJLA 2DW4A 4AAPA 3D5OA 3PURA 3HGYA 2VC0A 2BQPA 4R4ZA 1FBSA 4DXZA 4LUMA 3FZ3A 4AGVA 4XSXF 2VL8A 3GCWA 1PO23 1ZBE2 4Y1ZA 1OLTA 3CF2A 1UZZA 4C1XA 4OUMA 2VC9A 2Y48A 3ABUA 4HYEA 1OLRA 3W20A 1IN4A 1TTYA 1NYWA 4HNUA 1XN7A 2EXHA 1BR1A 4IRGA 3O0XA 5LK7B 1CAVA 3ST7A 3KP7A 4HKWA 3RZOJ 4EWEA 3FISA 1MMDA 2DMTA 4Q1PA 3TOJA 2CGOA 2WLPA 2WZEA 1TZOA 1JT0A 1LULA 1CF7B 1SACA 5H2FC 5EG0B 3N97A 4OULA 2O8XA 3WVJA 1STMA 2BV6A 1S0DA 4CDWC 2RMU2 1JJ6C 4NHJA 4BXXJ 1S2BA 4IPAA 1U78A 1SEUA 2HI3A 3N7KA 3MIFA 1IPJA 3F6OA 2WAEA 1R1A3 5T55A 3K70D 3GYHX 3GBGA 1D5VA 4N53C 5FV3A 3K6GA 4DBRA 1W6NB 1ZNPA 4OLLA 2ZO4A 1KXGA 4FFIA 1KQRA 2ARCA 4XQ4A 1R082 5J09A 1D0XA 4PLNA 1VP6A 2MEV2 3J8F1 5EXOA 1HKSA 5C71A 4II3A 5EWSA 1RR8C 2LOOA 5JR2A 3LFUA 3M9AA 2A6TA 2GAUA 4PJ0C 3JAMK 4NVPA 1Y56A 1B59A 2HYFA 5FROA 1FC3A 2VOPA 3KHCA 1JZ7A 1RI7A 1ENHA 1NX9A 3WW3A 1Z6RA 4Q27A 2YBSA 1JUIA 2ZZQA 1IN6A 3ZXJA 2R0FA 3AMPA 4A7YA 5A7WA 2XBO1 1YS6A 3KLNA 4XMYA 3BJ6A 2J1AA 3GZTB 2NVTJ 2W82A 2X6WA 4WM7B 1YRZA 1US3A 2R041 3CDHA 1VBD2 4QPGC 4YFZA 2DO7A 5JR3A 5K5QA 1H1IA 5TRDA 4QTRA 4LO8A 3C2BA 3G2BA 3FBIB 3QP5A 5JDBA 3GM8A 3U1XA 2J1EA 2EJRA 5L3EA 4LOTA 2ATFA 3J8F3 2WLQA 4BMEA 3CC4I 2WWJA 3KYDB 1VQ7I 2HWE1 4HBLA 2VU9A 2XL9A 4CDUC 3KQRA 3ZFGC 4YIIA 2E63A 5F5CA 2H8RA 1AL22 2O1QA 3CZ6A 2XQRA 4ESBA 1X3ZB 3H50A 3LA2A 2WBKA 2W1SA 5AC92 4XONA 4XMIA 3USUB 2VH9A 4AIKA 1SEFA 1BI3A 3AZZA 1UCRA 2EIBA 3WNMA 3CCQI 5JXIA 3DPRA 2D45A 4CEYB 3AM2A 1ZR4A 3ETPA 3F9KA 4FFHA 4AVZA 2EA4A 4A2UA 1RPWA 2VPLA 1H8TB 2W92A 1ZM1A 2R16A 1XGNA 2WA4A 1T0FC 4IE5A 1K78B 4IGPA 1BEV1 1RMU1 4JGZB 2ELHA 4F92B 1FSEA 4GMP0 1G9CA 1ZG5A 4II2A 2WYFA 5BNOA 2OUHA 3V56A 2VQCA 2A6WA 3I4MJ 3RKYA 1K83J 4A41A 1NAEA 1ZHFA 1W0UA 4UB8C 4CGZA 2OQ7A 2WC2A 2HWE3 1PIV2 1E5SA 5FLJA 4I0BA 3ZN6A 1GZTA 2H1LA 1W39A 2JENA 3GBWA 5D21A 2BV4A 2WFF2 2JJ6A 4JGYB 4Q48A 3OOXA 3SCFA 1E2XA 4AI3A 5T50A 5C9AB 4CYCB 1MEC3 4K8FA 3B69A 2KLOA 1RUD1 3ZN5A 3JBG1 2RHPA 2HYKA 2VMFA 1N77A 2RNGA 5EJCA 1BMV2 3FHNA 4KMFA 5FJKA 1W3XA 3LSDA 4GZ9A 5JOXA 1A34A 4GALA 3H3VK 3HR9A 1BBT3 2HVRA 2D43A 4M3DA 3ZSEA 1P4XA 1UF2C 4YFWA 1S5LC 1YYVA 3PUSA 1LE8B 2QNKA 1BR4A 5IUQA 3EQLF 1NY71 3HUGA 1FOD2 3Q9OA 1SFXA 1YITI 1TWHJ 2MH2A 2QQJA 4HG2A 1X7NA 1AU7A 3ES4A 4MYEA 5EPAA 5A6XA 3FBNB 3LWCA 2JICA 2DN0A 5IYYA 4BQ1A 1V6JA 3POGA 2LH9A 4Q26A 2HGCA 3R0RA 5D8AA 2KIUA 4K1YA 1ZAOA 3L2YA 1RETA 2IXLA 2ZMEB 4J1WA 5I0SA 1VRH2 2JSPA 3ZR6A 5D8LB 2HWD3 2DOEA 2ECBA 4M3CE 4HSLA 2ZXQA 4KL1A 4A5MA 1SPPB 1YFHA 2EZHA 4GIQA 1LPQA 5LASA 4LBMA 4AI1A 5C5UA 1FPN2 2VJXA 1A6CA 4Z82A 4HSTA 1YXWA 1SBEA 2VNRA 2WQ4A 4NPLA 4P02B 3IAS2 3R4UA 3QH6A 1UELB 2BGPA 4XCAA 5DXDA 2EAKA 4XJWA 1WBFA 2OZUA 4ZYHA 3KCCA 4NWVA 3NMBA 1KS5A 4FETA 2FZ1A 4ZHNA 5JXJA 4XLAA 5BQTA 4WVWA 4S2DA 1GLNA 1H4GA 5FYIA 2P3YA 1MSEC 1SCRA 3F8FA 3NNJA 2EK5A 4RHV1 5D4RA 2GC0A 3IKTA 4YVSC 5CVRA 2DQRA 2RS33 1G9AA 4PLMA 2VE1A 5BY5A 4H0EA 1D7PM 1V3FA 1IQAA 1JJ8C 1SMTA 4BQ4A 1I1EA 1OQEA 2CFOA 2BNOA 1S0IA 3T0YA 1PMIA 1B72A 4IEUA 3VDCA 2WJSA 4HSRA 4OIQF 2R5YA 2L9SA 2DCKA 2BP6A 3SKVA 3I4PA 3TO7A 2FBIA 1RUG2 2Z33A 4D6SA 1ND3B 1IKPA 2N8GA 4JYKA 2MABA 1NCQC 2VGDA 4NUBA 1PK6B 2V9VA 2QSGX 3H1MA 1AJOA 3R61A 4RAFA 4OI2A 1YW8A 3P9CA 2ZGKA 4Q4W3 2JD4A 4AU7A 3NVCA 3BB6A 4YZ1A 2C0ZA 4CP1A 4XEZA 1S0BA 3LOBA 2LRPA 5J3UA 3LSEA 2NM1A 1HB4A 1H2MA 5IP6A 2P3JA 1YQ6A 3WD5A 1SVMA 2ZJQF 3AL0C 4D0QA 3S0MA 4RHV3 2E1OA 4KDPA 1EAH1 2ADDA 1SFEA 3ATGA 2L2OA 4YFKF 2I2SA 1LR5A 1J59A 3OUIA 2DUQA 2BTVC 4N43B 2BBYA 4BUPA 1TBXA 3WQBA 3AFHA 1LESA 4D6QA 2GH2A 1POV0 4ASKA 1O3TA 2OCEA 3H7YA 3ZMSA 1NG0A 1C1LA 2R7EB 1S8NA 1BYHA 1PGL2 1U5TA 4IEZA 5F2SA 2E60A 5DUKA 2XAHA 3ZFEA 3G3ZA 2B9SA 4YM3A 3L2QA 1PUFA 1S7AA 2VCBA 4B7KA 1CAWA 5G05L 3CUQC 3HOVJ 3FFQA 1I1GA 1SHWB 1J5YA 2W46A 1F9NA 2VMHA 5KAFC 3GDBA 3OPZA 5HV0A 1NLRA 3I59A 5EJ1B 2VLAA 2DODA 2OIIA 2X0LA 2P0WA 3KT4A 3UETA 2VNOA 4DXRA 1GKBA 4FPJA 3O1OA 2P17A 4AI0A 4IEQA 4XQFA 1Q1HA 2CSOA 1FP2A 2YV8A 2JB8A 1MS1A 4CDXB 5L36A 2F48A 1VBA2 3KGZA 4Q4Y1 1BHGA 3HZJA 4XAEA 3OYWA 4MGQA 3ZIXA 5A7SA 4LXLA 1D1BA 1NG6A 3OIQA 2WS93 3TDZC 3ZQLA 2XOMA 2ZCWA 1USSA 4BHBA 1LB2A 3DEEA 2P6CA 4I2OA 2R073 5IT3A 5ED4A 4XJUA 4NAMA 3RS6A 2FMYA 4CXFA 1Y7BA 4QKDA 2VAUA 5FB2A 1XYPA 5FOBB 2WNUC 3VBSA 2Z1DA 2H8WA 3ZN4A 1SFNA 1Q8SA 2W00A 1AZDA 1F1ZA 3I64A 2G7HA 1XSDA 4OIOF 1AR93 3N9PA 2A6XA 2B4KA 2AS5F 3PO3J 3NARA 1UD1A 2QQNA 2RR12 5B4XA 3CP2A 1S4CA 4L9VA 4TV7A 2Q1MA 1ETKA 4QPOA 3KFWX 4A3MJ 4AYBN 4BEHA 4WWCA 2GH8A 3T0AA 4LA3A 4A7ZA 4F91B 3SFIA 1DCSA 4IGQA 2RNJA 1JHNA 3LE0A 3ZXLA 1ONAA 4Q4Y3 4AF9A 4P9GA 1EUTA 3I3DA 1ZK8A 3KVBA 4KU7A 2QA4I 2J7MA 1KYZA 4ZH4F 1RJ8A 4IL6C 1KDMA 4Q5OA 2QQVA 2JVGA 3AKSA 5K4LA 4BKXA 3LPFA 3MI8A 1Z0XA 5FKLA 1N1SA 5FO7B 1XYOA 2ZMNA 1FMD3 3ZXDA 3KQ4B 1W6OB 2R061 4WVZA 4LG0B 1R091 2A5WA 3LAJA 1JZ5A 4Y4YA 4IO9F 3HRMA 1YIOA 2RDRA 3C2GA 2ZOEB 3ZSJA 3BTIA 2JE7A 3SHRA 5LLQA 3MIHA 2H0BA 3M1HA 3J7ZI 3ML6A 1RUE2 4COWA 4IOCF 1DUXC 3BU0A 5FY4A 1HRI2 2LW8A 3OD0A 3ZQHA 4NIDA 2VTXA 1Y1VJ 3BC8A 3G6EI 3J9SA 1O57A 2K46A 4NHYA 1Z3XA 4LHNA 5TSWA 4LIUA 5ABJB 1UQXA 2GXGA 3VZOA 2JWTA 2JDYA 4UB6C 1VBE2 3ZN0A 5JLWA 4GCVA 3DU6A 2IEKA 3MZYA 4L0ZB 4WBBA 2GXAA 4OWRB 1ZG1A 1RUJ1 3ULQB 4Q4V2 2OF7A 3N9MA 4XC9A 2E1MC 2VKHA 2V73A 3KV9A 3VBFB 3A03A 1D4VB 3OYLA 2R063 5DV5A 1R093 4ARYA 1PUEE 5IVFA 5CYVA 2CW0F 3O7OA 3BJOA 2P4EA 4A3XA 3BPSA 3S7EA 3RKWA 1KFUL 5DDJ1 3NWSA 2QJVA 1YRNA 4N90A 1MS8A 3SH5A 1DG6A 3E1SA 4QPYA 1UKRA 1VQ5I 1QNWA 1HSJA 5GZEA 3C2HA 1AR63 3D3AA 1I27A 1LOEA 2HWC2 3P3NA 2ZJRF 2LY2A 2B5HA 4JHTA 1XPXA 2VNVA 5KC5A 2CW8A 1GNZA 3U10A 4QPGA 3RZMA 4RS5C 3H1CA 4CHUA 3IDCB 3ZMOA 2W4SA 3THPA 1P2FA 1XXNA 3J80Z 1SDDB 5IHRA 5L73A 3ZX7A 3CJTB 5B1BH 2BY0A 3RQ4A 1ZRCA 1WI3A 1N1VA 3IB3A 4KWUA 3S93A 3LDRA 2ILMA 2JDMA 1GWLA 2LKPA 1HQNA 4CDUA 2D40A 3P1IA 3ZFGA 5AVPA 3OYAA 5DDJ3 1HRV1 3TB0A 5K7ZA 2K40A 3A01A 4LK6A 3A4UA 2JA5J 4BNCA 3WTTC 2XLAA 5FUPA 3GFLA 5FR3A 3UKVA 5DAVA 5KBFA 2P3IA 2E2JJ 3CHXA 1RUH1 3H92A 1IG0A 4DFSA 5K9YA 1J83A 3RZDJ 5GAGJ 3WZ1A 5IK4A 2O6GE 3MFCA 3IDEA 3S14J 2V4AA 3K70C 5FRMA 2DCEA 1YQ8A 1LU2A 3PVEA 4Q8KA 5E6HA 1ZBA3 1ND2C 2DK5A 2WRAA 1O4XA 2UUZA 3PU3A 5F3GA 2GA1A 2L9NA 1WKYA 1PO12 2IZWA 3BALA 3EQEA 4FQ4A 1SMVA 1HRV3 2WNEA 1G86A 1BIAA 1A3KA 1TNRA 2JDUA 2HDWA 3BG7A 3IWZA 1V54H 1IG7A 4I0WB 5HDKA 4XACA 2JA6J 4MQVA 4DOZA 5HI0A 4LEJA 2FZ2A 2G4IA 3P6BA 2EWNA 1K6OA 1PX4A 2M7BA 2YU3A 4FQZA 5F32A 2BVMA 5L3DA 2EIKH 3TO6A 4C0BA 4EN8B 2IA0A 4RM2A 3HQUA 1KD7A 2ZKLA 4R9DA 3RPQA 4Z92B 2LKSA 1WKMA 4B3NA 2M30A 1AR82 5CFCC 4L0YB 5E3LA 1Z9CA 2JKBA 4NE9A 2GLOA 2QQOA 4Y15A 5LRSA 4W65A 2ADEA 2WV1A 2X53S 3FUOA 1OYWA 4KA4A 4DGWB 2D1VA 2E53A 4ASNA 1DZRA 1HX6A 4MOAA 1OOPA 1BOBA 3OSGA 1PHMA 2NVYJ 3LSMA 2MYSA 2ZPXA 3EHKA 2GU9A 4MEYF 3FXJA 4OOIA 5CG9A 5LFAA 2EA7A 1X8EA 3F95A 4Y1XA 1N3QA 1K61A 3ME2A 4Y7NJ 5H9SA 5F9TA 4X1EA 4OUEA 1IS5A 3FC0A 4XIOA 4E7JA 1XNBA 2WWSA 1CONA 3IAQA 2VODA 3UT0A 2VUDA 1ZBE1 2Y26A 5FO9B 4DY5A 3RQ0A 3D0JA 2XAUA 3KE2A 3LGRA 1Z21A 3OJBA 4OCTA 1DLLA 3PO2J 4FHTA 3K46A 4FOVA 1T56A 2ZX3A 4H2AA 4QGMA 3HBKA 2CWMA 2GOXB 1R4NB 4YGCA 1MBKA 3VDXA 4QM8A 1UZVA 5KXDA 3PJRA 4E8DA 3CC2I 3SEQA 4DQ2A 5HVQC 4IGOA 1RINA 3THDA 1FMVA 3KP2A 1OJLA 3T08A 5DABA 5T52A 2QZ8A 1NA1A 3OOPA 3JTHA 4E7ZA 1S0JA 2X8KA 2RM22 5L9VA 3VBHB 3HAGA 2XAJA 1QQP2 4GH4C 4UUSA 3F8CA 1X9PA 4Y4RA 2RMU1 1XGMA 2OQRA 1YC61 4R8HA 1SBFA 1YJWI 4R9BA 4CA9A 3OYJA 2GNMA 2BY1A 1BK1A 5FYZA 4KGQA 5ANQA 2GOMA 1W2TA 5FK7A 1ZBE3 5A3WA 4Y33A 4ZZLA 4JX6A 1JZ4A 4JQTA 1P7IA 2C4XA 1VR3A 1HW2A 2VCMA 1NCQA 4S05A 3VBUC 1GSLA 3CMEI 3T2QA 4LLLA 2MA3A 1R081 1SZBA 3DP7A 4AVPA 3VBRA 2DUOA 2MEV1 1S7OA 5KCMA 4P9IA 4ZY9A 3K4NA 3BZ6A 1H2KA 1TMF1 3LIGA 3A0NA 1O3SA 3ACGA 2FQPA 3V8LA 1UIKA 5FKKA 3U9GA 3WP6A 3ESWB 4YVWB 5JFRA 1W4MA 4IQPA 3Q9SA 4DEVA 1W8HA 1YE9A 2WTEA 1R1UA 4R4XA 3OYDA 2RMU3 2DYSH 2OV7A 3TW7A 3COAC 3UL2A 3HJEA 4KWKA 5C8CB 2BWCA 2P81A 1XNAA 2Q8OA 3GJAA 4QM9A 1VBD1 1BKZA 2JECA 5FUIA 1NCRA 3HNMA 5C3QA 1ENRA 1DP0A 1LTEA 2GA2A 1JUHA 2NVUB 4HKOA 3MICA 1K5MB 4A0YA 3BQZA 2W94A 5FXXA 1R083 4CCDA 2WSUA 5E3MA 5J1XA 3BP8A 2OX0A 2VUMJ 1Z7S2 3CCJI 4HXCA 1AL21 3LMMA 4A45A 4UI9L 9ANTA 2XVCA 5B3SH 3JTGA 2LRDA 4BDYA 1UOJA 3A0BC 3OYHA 4KIFA 2ES3A 4FXGB 3VHPA 2VZTA 5AC91 3RPUD 3ILNA 4LO7A 2ZFUA 2V1DA 1OLMA 2W91A 2DK8A 4P9JA 1OCPA 2IUWA 2ZAHA 3KLOA 1VBB1 4KU8A 4FE4A 1VBD3 4FOWA 1W8WA 1RUF2 3RWNA 5F8PA 5JIUA 1RUI2 2A6VA 2BZTA 1YFXA 1P6RA 3NRUA 1AX0A 2IXKA 3VV1A 2HQAA 4IETA 1EUUA 2LP0A 4BE3A 3QODA 6PAXA 4RDUA 2HJIA 4I99C 3W2AA 4RSUA 1MQTB 1ZKGA 1RB8G 1I3QJ 4CTEA 1D8JA 4QHBA 5B66C 4HQEA 2WNUA 1PIV1 4B4RA 3MFKA 4CA0A 1DDNA 1C3HA 3DEMA 3PJYA 3AX4A 1D2QA 2C26A 5FYCA 3OCPA 2GC1A 3ZN6B 2WFF1 4RL7A 3BJAA 3L2CA 2DVGA 3OIOA 1ASJ2 3O5SA 1QZZA 4COZA 5AC93 3DYMA 1Y9QA 4HN0A 4ISQA 1J7KA 2JB4A 1LUJB 5LHHA 4QQOA 3WDYA 3WGIA 4IHYA 1V6IA 1FXZA 4ES8A 1BMV1 2QQUA 3V7CA 4HDUA 3ASNH 1T8IA 4RR3A 3S32A 1JYVA 1QH7A 2LK2A 4CEWC 3L2UA 2KZVA 1H2LA 1YUDA 5FPZA 3LB9A 2WKKA 3LKJA 5JZGB 4YM1A 2R1DA 2HU9A 1VI0A 4C9YA 2Z79A 2IS4A 2VOXA 1IF1A 1TWCJ 5LZ6A 2IVIB 2BYVE 3A22A 3HUGB 1LJ9A 4HPKB 5DAQA 1QZYA 5HNHA 2CYYA 1PIV3 1DPUA 4FVVA 1CAUA 1ZGJA 5GALA 1FOYA 5HDNA 1BLZA 2WFF3 1X50A 2A1XA 2L9LA 2DDAA 4AEDC 4AOCA 2MH9A 1DQ4A 3IIIA 4AIDA 2YS9A 3SJMA 1VNDA 3O1MA 1UMHA 5JHUA 4WM8A 2OZ6A 1W7PD 3DEUA 3CO2A 2XUBA 2CWEA 3S5QA 4XTPA 1AYN2 5FZOB 5A7OA 2DA3A 5J6XA 2WT2A 4JP0A 1HLVA 4K20A 4AD9A 1ETQA 3DWLE 3I3LA 2UYBA 2V4VA 1WJ5A 2DCZA 1S7EA 3R0AA 4KICA 1W05A 5C33A 4XOTA 4XRSG 1QEXA 1FOD3 1WQ2A 2F4IA 5C6CA 4P08A 4YZ2A 1QBJA 1T6SA 2L7KA 4L5JA 3WDWA 4ASMB 4ESJA 4X6QB 2F5EA 2JN6A 1TW3A 1F5JA 2KJBA 4BDVB 3IWFA 3NJVA 1XSVA 4K21A 4QKNA 5CQGA 2W9XA 4NR1A 3D4KA 1PDNC 2R0HA 2QVSB 4RD7A 3DPTA 3ZYHA 4LR4A 5GTHC 4LFUA 5GZFA 1JZ2A 1X9TA 1JBCA 4Y5Z0 4PFPA 4AIHA 1VBC2 1JN2P 4BY7J 2DMQA 5F5AA 2W68A 1VRH3 1U5ZA 2B45X 1H0MA 1L3JA 5C3SA 4HG6B 2DFHA 4GB32 1QZEA 5DMYA 3W3CA 4LBQD 4PSXA 4B7EA 5CFDC 4UV9A 1ZRDA 4I01A 3IIAA 1VRBA 2V5YA 4LBKA 3M3OA 3ZXAC 1UXZA 3SMHA 1FTZA 1CR7A 1RUG1 3SISA 1FPN3 1R64A 3QP6A 1YEWA 1SCSA 1Y9GA 4F3JA 1BA5A 2ZMEC 2ZACA 3KT7A 1MS9A 3W6KB 2NS7A 2GN7A 5FZ9A 5GZGA 2ME0A 2K0GA 2LF7A 1W6PA 2KIFA 3FK6A 4ENJA 2ZEXA 2V72A 1K45A 2M45A 1GP6A 5F5IA 2W84A 1QOOA 4M4PA 4FTSA 2IXHA 3FKJA 1W2NA 4YFNF 2D6OX 2BXYA 3GTOJ 4E7IA 3HOTA 3ZN1A 2NYYA 3B94A 3PL0A 3AMQA 1C57A 2PHWA 1HDPA 3VWBA 3CESA 1VAVA 3BYWA 4A3JJ 2WFPA 1MS5A 4U0VA 2Q2EA 1LECA 2JG9C 5FZLA 1R00A 2E36A 1XMKA 4AC0A 3KYLA 4UF0B 2DFIA 4XN0A 1D2SA 4O6JA 2ZHKA 2TEPA 1MBHA 2ECCA 1N1TA 5CNAA 5J3LA 2TUNA 1NKGA 4OMYA 4LMYA 4Q2FA 1PGL1 1S0EA 3DYOA 4DINB 1IXCA 2X5IA 1UY1A 3ITQA 5TJJA 4LO6B 1MR5A 1W9YA 4HDVA 1ND2A 4C3IJ 1W8ZA 3RCOA 3NJYA 4Y1YA 2K4BA 4HT1T 1YX5A 3I3QA 1UPIA 1PK6C 2ZGSA 4G7HF 4IHSA 1WI9A 4L11A 3I5UA 3TEXA 3GTMJ 3V8JA 1QGPA 4N4OB 4EVIA 1W0PA 1U0AA 5FP3A 4LLFA 1S1AA 3GZUC 1VBA1 1AHDP 2ERFA 2PHTA 1PVC2 3W9AA 2ZX4A 4RLQA 5FIXA 3W2WA 2DLLA 4JAAA 2XXZA 1QPIA 2BVVA 1XPWA 4PGHA 2VECA 2Y64A 4A3DJ 5FYMA 4CO8A 2D97A 1ZVFA 1BXHA 3ZQGA 1UU5A 1FOWA 4AI9A 4RLFA 4N4NB 2GQQA 2XB5A 2L0KA 2VASA 3P5BA 4AVSA 4NHMA 1AUYA 3KPHA 4IE7A 3FN9A 2R7WA 3I8TA 1C8M2 3PUIA 3JW4A 4AHXA 2RR11 3ZYGA 2ZGQA 2IS2A 5IWFA 2DBNA 5BYNA 1LEDA 5LGTA 1OFSA 2KIQA 3JRDA 1T2XA 4PK4A 2L7FP 2A05A 4P9UA 4XIDA 4BEHB 1IG3A 1VBA3 5KNLA 3PUAA 4B1LA 1ULPA 1JYIA 4MHUA 4JX5A 1J0RA 1X82A 4HX7A 2CDPA 1RIOH 1UY3A 3UR3C 3MN2A 2AC1A 2RDQA 3DQVC 3VKMA 2MLKA 3T1BA 5KHIA 1GZWB 2QWWA 5A32B 2LTPA 1M1EB 3J7AO 2I8DA 1ZELA 4XLCA 2K85A 5FXWA 2QUFA 3IBMA 2CQNA 2TBVA 2R32A 5FLHA 2GNBA 3PLQA 5M5WJ 2R5ZB 4BE2A 2WABA 5ACA1 3I2JA 4ZS2A 5KXBA 2EV5A 3IPVA 3ZFFA 2CG4A 2RR13 4PJJA 3KP3A 4OMCA 4ENKA 3W6JB 5H9QA 2XHNA 2V4JC 4XUNA 3AZYA 1RUE1 1Y9MA 1OURA 2PTMA 5F3EA 3MHZA 4XAAA 1JXSA 1SD7A 1HRI1 5A33A 2BW3B 3MLKA 4PSWA 1B35C 3LIHA 5M5YJ 4CDWB 3JRIA 3BG5A 5JPMB 3VHOA 2R3SA 2QQIA 2W47A 5K0UC 3CU7A 3OGJA 4XF9A 4XZPA 3BVCA 4MIMA 1XNCA 4IV1A 1VBE1 3H9QA 1QKQA 3K2OA 5T5LA 2C6SA 4KG0A 4FP3A 4N53B 2VQTA 4QXBA 5J98B 2VXRA 3ZQ7A 4X6AJ 4QX8A 2KL4A 4R79A 3HBZA 2EIGA 3AFKA 3QPSA 4GMP3 1IDYA 2Y0OA 1J9IA 1WSUA 3Q8CA 2VC1A 5T5PA 4WV8A 2FSWA 2K9QA 1GQHA 1ODDA 3ZDSA 1BJZA 5JVVA 1UU4A 3H9AA 4QXHA 5CPRB 1GVJA 2V1XA 1D1CA 2VMDA 5IP7J 4XE9A 4FOQA 1R1ZA 1LFPA 2Y0SA 4JRAA 1X58A 1ZRRA 3BODA 5D6EA 1QJU2 2J1SA 2ZGLA 2B8MA 1AF9A 1RUE3 3CCUI 2PJRB 5GLUA 1HRI3 2AH2A 2HWC1 4H55A 3VKOA 3LA3A 2M9HA 1SLCA 1YS7A 3BZKA 1GU3A 1AVBA 4NQWA 1CF7A 2BEOA 1OUSA 3BT9A 3MV11 5EG0A 1EH7A 1AHSA 3NV1A 2ZSIB 4QPGB 2E7TA 4PHZA 2IAIA 1VBE3 3HOUJ 4XFBA 2JDAA 3N7JA 4XORA 2Q8KA 3KP6A 2XDVA 4Q4V3 5FLXZ 3C3WA 3H8UA 2C1FA 3LFIA 5L3FA 5BPDA 1CQ9A 4UXAA 1HDKA 1HJFA 1FI2A 4CDUB 1W6NA 2BGCA 1OKOA 4EN7B 4F3QA 5H9PA 5AFEA 4XRFA 2BZDA 2I5UA 3N3HA 1X2MA 2CV0A 2EIEA 3JCIA 2KIMA 1YHQI 2Y6HA 3M1EA 3LAGA 3CMYA 5BNQA 1ZTRA 1Y8QB 5ICEA 1O5LA 3S1MJ 4EJWA 1OCTC 1MBEA 1I50J 1BM9A 2WDBA 1FT9A 3M70A 2XPJA 2J5PA 4D7YA 3FE5A 4GO1A 4XKWA 2XBO2 4Y20B 1GZCA 2OZJA 1E57A 2LREA 1LODA 5J8FA 1XOYA 4WM7A 1S0CA 2XB6C 1PO11 1WUVA 4KMUX 1VQLI 1JU3A 4UWDA 3M7AA 3E7LA 3DLAA 4G9YA 3K4DA 2R042 3ZOBA 2ELJA 5BV6A 4G9SB 1SQ4A 4P9FA 1QDOA 1LHNA 5D4SA 2R49A 3WP3A 2Y9YA 3HTSB 4A7KA 2AQEA 4D0PA 5FCCA 4NJ4A 4FASD 2AO9A 1YO5C 1V6MA 1JI6A 2YG0A 3F21A 3S2HJ 1TME2 3SLIA 5JOZA 3AJYA 1UIJA 5D1IA 4AQSA 2OKXA 5BNNC 2UY8A 4YIFA 2X29A 1OLME 2ZXIA 4AFMA 1O8PA 3OF1A 4PDKA 1UMZA 3NW4A 4J01A 2A07F 1ZZ8A 4QPIC 4XLHA 5F2WA 4NC7A 1Q8OA 2PAKA 3USUA 2W3JA 2K2SA 3ORJA 1C5IA 2ZGRA 5C4WC 4BCUA 2NZ9A 4OMDA 5EYYA 2WV0A 4ZU7A 1IW7F 4MX3A 4CEYA 2Z99A 1GYKA 5C7GA 3BOQA 2EAAA 5LD2C 1SVOA 1H8TA 5CZKA 1K78A 4JGZA 1CPMA 1RMU2 1MVQA 2ORZA 2JMWA 5FTTC 4QPWA 3S1NJ 4YELA 2DYCA 4A4AA 4OU0A 4XF3A 5FZ6A 4D7MA 5FKCA 4BQ2A 2PJPA 3P9IA 5FO8B 4IOAF 2JXAA 2Y6KA 3W21A 3ZQIA 2GN3A 3GF6A 4Y24A 4ZTJA 2YC2A 1V5FA 1X2NA 4CCKA 1ZZ9A 1AR83 4JGYA 5EYXA 3O6BB 4E2QA 4ZU4A 3VBOC 1EKEA 4HBNA 1ULGA 5KXEA 5C9AA 4CYCA 4OI1A 2JPBA 1J09A 4ASLA 1I6XA 1YLLA 1YFYA 2O9LA 3GFMA 2ZXJA 3JBG2 1WCQA 4OHXA 1C0WA 4DYCA 2DTWA 4XFCA 3MIDA 2YZ4A 5EDNA 4B8EA 4BXUA 4G7OF 2VZPA 2R4GA 3WTWC 2RM21 3WCSA 4RAYA 1AX1A 1LE8A 2K27A 1CZTA 4OIPF 4TSVA 3H5NA 3R4SA 2DT6A 1WCKA 2DUPA 4FX4A 1UAAA 4YVSB 1NY72 3WP5A 3VZMA 2HQNA 2A3XA 4MNUA 3POIA 2AYHA 1IAWA 4JZRA 4IV3C 3WUDA 1JW6A 1U5IA 1Z0HA 2HTSA 2W2IA 2K9LA 3MIEA 1UZCA 4XKCA 4HX4A 4P55A 3FBMA 3Q0VA 2A5ZA 4FBFA 2ME6A 3OWTA 1OA3A 4LKDA 5DUWA 3TRSB 2WUHA 1JZ3A 5DUUA 2ZMEA 4CE8A 2VPRA 3ZP5A 5DZFA 2W5FA 2DTRA 1FOKA 2XJSA 2B7EA 4MGZE 3KSCA 1JOBA 4KISA 1SPPA 2VOWA 2DQLA 3S8PA 4DY3A 1CX4A 2Y34A 4S04A 3FHAA 3ISPA 1ITYA 2RJ2A 5DDGA 4XF0A 5FFZA 2OJED 4P5OA 3HOBA 4FT8A 3ES1A 2RM23 5FP4A 2B7YA 4KIBA 1GNHA 3VHNA 1QQP3 4MGKE 4W6YA 4CPBA 1N78A 2VVDA 3HQRA 1GUIA 4Q4X2 2PI0A 4U87A 2QKLB 1IRFA 3AL0B 1D5YA 5FLIA 2L9VA 1RZ4A 3D82A 3HXLA 1ZR2A 2W25A 5DEQA 2ZBKA 5CIRA 1U6GA 1OA4A 1COV2 3BTXA 2F2EA 5L9RA 1WRJA 1MBJA 3KT1A 3CEWA 4IDZA 5IT9Z 2DA5A 1RVF2 3SZTA 2LDUA 3G73A 3D5RC 3X29B 4QAWA 1HJGA 4RGSA 1YI9A 3GCXA 1UNBA 5FZ8A 1GFF2 3VKLA 4ZDPA 2VVEA 3ZXEA 3M4FA 3VYTB 1RTVA 3B7MA 2YYOA 1V70A 4NRMA 4BQNA 2XWJB 2W7NA 1JH5A 3ENRA 4YWAA 3GXOA 2D6LX 4D6RA 4KWLA 4I76A 1TQ5A 2WO3A 2X6XA 3OD4A 1GQPA 4AW7A 3CUQB 1ND3A 4XFAA 2C5DA 4FISA 1PK6A 4A5NA 1XMAA 5J1UA 4HV5A 4TZDA 4BQ3A 1FIPA 2XF7A 1W8FA 1UL9A 4R52A 2DPDA 2QBXA 3DKXA 4GYGA 3TN91 4F7ZA 3URFA 1WCSA 4E70A 3TYJA 1D0YA 3EDPA 2HNHA 1G3WA 1RL3A 2PLV2 1EV11 4LHSA 1RUF1 2DWRA 1R22A 1TEIA 2WT1A 1FV3A 3K3OA 1RUI1 2EH3A 2L54A 2VTXJ 2IPQX 4KBBA 3JSPA 1ULEA 2STTA 1LKXA 4UFMA 3CQZJ 4BQYA 1X1AA 1UPSA 4CU7A 4RMNA 2R7TA 2BE5F 1A78A 1V9U2 1AL0G 4AFAA 4N43A 2D6KA 1FIAA 4OIRF 3H0OA 1Z7S3 2BFUS 2W1QA 2X4HA 1UXXX 4U2AA 4LE4A 4UVAA 2QQKA 2ZZJA 1X33A 3G1MA 1TE1B 4XOGA 2UWAA 2WNUB 1O4YA 2CU5A 4XJZA 1GOFA 2H94A 1ASJ1 1BW5A 1QY4A 2OA4A 1S9HA 3POYA 4JVAA 2Q0AA 3ZXFA 2ELKA 5IVBA 1E5HA 4HLXA 2P6SA 2YMZA 5FYYA 2K5CA 1E0EA 3RZJA 5LEJA 4YW3A 1RUF3 4ZYDA 4N7UA 1MPXA 2WO1A 1QRYA 2HPMA 1XSRA 1S6LA 3F23A 2QQPA 1U3EM 2A6EF 3RFRA 3J4UH 3SEPA 5KXCA 4RQPC 3PIGA 4QQLA 1ORKA 3S2DJ 4Y26A 4L18B 4BE0A 3SC7X 1YO8A 4CDXA 3NAPC 2JPCA 2JDNA 2I10A 1VTNC 1WMFA 1BIBA 3ZYIB 2HYGD 4Y52J 3TQNA 4ATEA 3TBDA 4FQGA 2HWB2 3VD5A 3H8XA 1W2UA 4TN7A 1YFUA 2XKPA 3KP4A 1AXYA 2VJJA 2CGPA 1K12A 1EH8A 5CKTA 1TL8A 1ASJ3 1MACA 1TQPA 2HEOA 5A70A 2IC1A 4BHCA 5J4VA 2V09A 2QCOA 3HJRA 3V0BB 3WTUC 1DZTA 1EPWA 2X1CA 3AYEA 2VQUA 5FZ4A 1QNYA 1MS3A 2CDOA 5IPAA 3MBWA 2ZGUA 1HKTA 2X1EA 1AYN1 1DDLA 3JRHA 2E7QA 1ZGWA 1PM7A 5BMZA 4RB3C 4LB6B 3PIJA 1DFQA 5CEHA 3T30A 1ULYA 5EQUA 4WZFA 1ETWA 2VQ0A 3SYTA 1D8KA 5EZGA 5TGTA 5GAEJ 3ZYFA 4GYIA 4NROA 2PHRA 3CLPA 1WH7A 5L7OC 4PGGA 3OV8A 2X85A 3ELNA 4O9GA 3FLPA 1QIQA 2DMPA 5B1AH 3P5JA 2E1MB 2JE8A 5J1RA 4MADA 4HZFA 2JX9A 4XXPA 2XAFA 4D9JA 1FPQA 5F0CA 3T0BA 2ESHA 1NG7A 2Q8CA 3V0AB 3MAJA 2HOTA 4AQ6A 4CUCA 2QLZA 3CP8A 3GTGJ 3K4CA 4YW6A 2X09A 1W6OA 4GB31 4LG0A 2LKXA 4M0NA 1BOAA 3CCMI 3UGHA 1U8RA 1KU9A 1YG2A 1AYN3 3A02A 3SH3A 4TTGA 1K4SA 3F6VA 3QYFA 3NAUA 1CVNA 1PZ9A 2O0OA 2MG4A 1HXS2 4Z2AA 5FY0A 2XR4A 2L9RA 4Q0QA 1LKNA 1US2A 2PA7A 2ZX2A 4PJLA 3GYDA 4RS5B 4LBJA 4AGRA 2MSYA 2COBA 1YIJI 4PUSA 2QQMA 3HNBM 1JZ8A 3M1CA 5FRAA 1G59A 2IS1A 3M7GA 2XG3A 4JQRA 2DOAA 4KNYA 4DS0A 1W6PB 5A3MA 2VKEA 1WMXA 3ECQA 2HEYF 4GFBA 4YM2A 5ABJA 5LBFA 4RBOA 4K9SA 3INAA 2QUOA 1JKQC 1FP1D 2BOIA 1VBC3 2XMLA 2JG8C 2EILH 3NO8A 1LU1A 5IJRA 3VBFA 4GB33 4HONA 5CAZA 2UZKA 4WXCA 1FBUA 5FMBA 4ZYEA 4YARA 2W39A 2VCCA 5LCWL 2M3AA 2V5DA 3RZLA 5JI9A 4IHXA 3LOIA 2GALA 4HF1A 1IO2A 5H6QA 3EYIA 4EJRA 3GWZA 4A44A 3AJZA 4ENMA 3LZZA 2E5ZA 5JVTA 1FAYA 4M6XA 2DFBA 3H5AA 2Y2ZA 1UCXA 4O5VA 1AXZA 1AKHA 4EJOA 1W8TA 5KWRA 3IH3A 1L7RA 1SD4A 1NLSA 5GZDA 3ZOIA 4GWNA 3OUHA 5EV7A 2MW8A 2XPVA 4OMZA 1W0TA 3PM1A 4YIRX 1ND2B 3BR2A 2CJJA 4ORFA 3I2GA 5KK1A 4CDQC 5FJ8J 1B1BA 3HT2A 3S1QJ 2YPRA 4AL9A 3S7IA 3AVSA 4JC1A 5TISC 1PVC1 4CICA 2QBYB 1VQ9I 2KDOA 2CYFA 3MFAA 3JRGA 4AIJA 2ICWG 3K2ZA 1I5PA 5HLTA 2GMMA 3J26N 3GLXA 4UFIA 3UV9A 4DZGA 4ETSA 2D6PA 3ZMVA 4LLNA 2Z3YA 1QOSA 1ZX5A 3WTSC 2PYTA 3OR2C 2ZC2A 1NQDA 4QPIA 5A1AA 2FBHA 3ZKYA 5CFCB 4QDQA 1F5TA 1UKGA 2VZ3A 3ACLA 3C1DA 3DPUA 1CJDA 4FTEA 1VQNI 5KHGA 3VFZA 3A0HC 2X9DA 4LOCA 2O14A 4BH9A 5K8SA 5JOYA 4BIOA 3I2OA 2R6QA 3ZXGA 4NOTA 3E6BA 2E32A 4PBOA 1RUH2 4KG8A 3LA7A 5A1FA 1HC8A 3WY6A 1G3SA 1SDWA 1SFKA 1OR7C 1QJX1 3OY8A 3ON7A 4UHTA 1VQPI 1D4M1 1PVC3 3MEPA 3DTKA 1N25A 5DAWA 3WNXA 1C8NA 1W6MB 5IVVA 1UOGA 2VMCA 4EM1A 3RJ2X 4BBSJ 1ONVA 1OPCA 3MW2A 1ZQ3P 1H8VA 4QKFA 5CB7A 4LITA 5FPVA 4M3FA 1W6QB 4JTNA 1TT5B 5B4NA 1XD7A 1AR72 2Q5TA 1CD3G 3ZXKA 3TAYA 3DTEA 1A5JA 5E89A 3FL7A 3BIEA 5BNPC 4Y17A 2QFEA 1C8M3 1GUUA 3T1LA 1RUC2 4LUKA 5LA0A 5M0TA 3LD8A 4A6EA 3THTA 2QZ2A 1FOXA 2X10A 4P00B 4PF5A 2V9KA 4ATFA 4NRQA 4KQ7A 4GH4B 2Y6JA 3G7DA 2AACA 1R4MB 3BDDA 3CUOA 2MHFA 4QX5A 4QGNA 4ZXEA 2CSGA 3HIFA 2RE9A 3K48A 1FATA 5D5XB 4EV0A 1UJ8A 5LBBA 3GTLJ 1F4KA 4QB6A 1WJDA 3VBUB 3UNPA 2EZLA 4IJAA 4MHGA 4BXFA 3GTJJ 2QM3A 1UWWA 3RZHA 2YGMA 4FFFA 3NQOA 2YU2A 4LOSA 4UUVA 4MZUA 1N47A 4Z6YA 3EUHC 2KXLA 2EIMH 1QJU1 3RKXA 5D2AA 1H9WA 4OUSA 2DBBA 5LEKA 4CDGA 1BC8C 3IL2A 3USSA 3PSIA 2WAQA 4QQHA 2VIXA 2VE9A 1IZ3A 3HMYA 2VMGA 5JI7A 4RB2C 4QXCA 2QSFX 4NQWB 3VBHA 4NN0A 1LOCA 3PUQA 1UAIA 4JBAA 1T6BX 1OQDA 3VDDC 4IEOA 1VQ6I 2GNTA 1RXGA 4W50A 2M4KA 4XJAA 1IS4A 5EGOA 1H0BA 3I2DA 3MW3A 2Y75A 2F5VA 5I0RA 5J1YA 3OYMA 4UW3A 2OVUA 3ZSMA 2MBFA 3JSOA 1VJ2A 2DDBA 3CLOA 4A42A 2R7OA 5IK8A 5E8GA 1F5FA 2OCCH 2WWYA 5C8WA 5T54A 3M8EA 4D7SA 5JI6A 2HEWF 1QJU3 3UK9A 4Y22B 3GZNB 3UGGA 2P5BA 3VPRA 4A12A 3C2UA 4B3XA 1HF0A 1WJFA 3VDBA 2B0LA 1DU6A 2LM3A 5E1RA 1TMF2 4PJNA 2C9AA 3K1MA 2PFBA 2VZUA 4YVWA 3QPTA 2KT0A 1JMUB 1J1TA 1IRZA 2M8GX 3B6CA 5FY9A 4E4HA 1C5HA 1UZ0A 3PVBB 4YW2A 1HIXA 1HN1A 2OPKA 4QHOA 4K40A 3GF2A 3WNOA 4UOJA 1RITA 5C8CA 2OAZA 4CP9B 1QXJA 5I8SA 3ILRA 4ZXKA 2V9PA 3MW4A 1JYNA 3TEDA 1ZLKA 4QDRA 1Y39A 1OLQA 5C3RA 5K5OA 4XKVA 2CU7A 5LA9A 3B5LB 5FPLA 3M3EA 1LOFC 1K5MA 1K6YA 4JX4A 4TYSA 4QKBA 5D6FA 3U4XA 1TME1 4AFCA 5D5VB 1LFUP 2D3SA 1STZA 3RJRA 2XROA 1GBGA 2HOAA 2R7RA 5FZAA 1MMSA 1X4PA 1XJAA 4Z1VA 5HNFA 2CWSA 1LHOA 3HKZN 4O3MA 4A6DA 2GM4A 5LY2A 3K4JA 5KC6A 3DGTA 2J22A 4YG2F 2VZOA 1JYTA 2XKOA 1G2HA 4W1UA 4W6WA 2P37A 3HPHA 3WHCA 3WG1A 4CEWB 4DZJA 3NWTA 1W04A 3AZXA 2XBO3 3ZYJB 2GBYA 2VBWA 2PX9A 5FMDA 3NL1A 3ABLH 2HBTA 4XLPF 1XU2A 3T2PA 4QHZA 1VBB2 2VY0A 3BLYA 2X6OA 4Y1VA 2XF5A 2H09A 1VF9A 2R043 3H36A 2OW4A 3OY9A 5JIAA 4F55A 2JUGA 2VOKA 3VHRA 1TWFJ 2D6NA 4M9XA 2EQRA 4CZZA 3E6DA 2G0EA 1MQTA 4M0HA 4AEDB 3ZXSA 5JMOA 1QXRA 1SANA 2FNAA 1TME3 3MMYB 3CO7C 2RQQA 1W8NA 3HVDA 2QEXI 2Q30A 3LNQA 4JDNA 2HXIA 3FIWA 4LPLA 1AYM1 4D1QA 3U11A 5FRNA 4AR2A 2E31A 2WNVC 4OYUA 2ET1A 1AX2A 5T5JA 3DPLC 3D8CA 4I3PA 5ICGA 5DG2A 1JE8A 1O5UA 1DP3A 4DXTA 4PQQA 5I0UA 1PNGA 4CYDA 1G8XA 3P9KA 2O3FA 3BTJA 3NEUA 4N9HA 3FFZA 1POV1 3I71A 3WF2A 3POJA 3J81K 1Y8RB 5FZ0A 1T6GC 4PDWC 2H6BA 1MEC2 4MO3M 2FDJA 3OGSA 4BLJA 2FDFA 3CNAA 3UKNA 4WVMB 3PNTA 3E97A 5JZGA 1BEV3 1RMU3 4INDA 1F2NA 2XRLA 2EFPA 2YPJA 5FJHA 2FU4A 1B09A 4BDZA 1REFA 4HPKA 4ZYAA 5IK7A 5A6QA 2VQGA 3OR1C 4C2TA 3R6SA 3JB4C 1FNZA 3N9LA 2LC2A 2PAEA 3OBRA 1FYKA 2JZYA 1WZXA 2A69F 3BZCA 1G9DA 3OYFA 3WDUA 1T33A 4XCBA 3RI4A 2EA2A 4E4ZA 2VW0A 3LDKA 2LR8A 3ZVXA 1PGW1 5CFDB 5H20A 3ECHA 3QU6A 1UW8A 5FQ0B 4AGGA 2CO5A 2EXIA 1QDCA 4IEXA 4EMSA 3P3PA 3D6EA 3VD7A 2NPIA 4RB0A 2G1MA 1UYYA 5F0HA 1SAXA 5IYBJ 1RUD3 4FSJA 1Q1VA 3JBG3 3W5NA 5JMCA 5FZOA 3BTCA 3WHTA 2WQZC 3JAMZ 4ZU5A 1YQ5A 5JUVA 1TC3C 1WD3A 3IRQA 1HKQA 3GUDA 4XIKA 2KR2A 3MF6A 3EYYA 1MZBA 5HBAA 3BG6A 4L8QA 1BJAA 4OQ8A 3OS0A 2PMZA 3I97A 4HOBA 1RYYA 1GLHA 4Q4X1 3M4OJ 1BI1A 5A2QK 3T0DA 2IXCA 2R7FA 2F4PA 2PMHA 4YFXF 2RJKA 2F6CA 1Y0NA 2J5OA 5FKOA 3DKQA 3OYGA 5T3NA 1COV1 1I5ZA 3Q8EA 3GALA 2Q8DA 3TNPB 2HDDA 1SLIA 3MF9A 1XGSA 4FPGA 4RS8A 1RVF1 5DM7F 2JG9B 2GIZA 3NRVA 2R7DA 2VO5A 3W59A 4COYA 4GD4A 5IOYA 2XAGA 4IEVA 4RGAA 3CJIC 1R7JA 3DN7A 3MKZA 1YJKA 2MLGA 1KGSA 1W99A 1MBFA 1GR3A 3VD3A 4F52A 1DGWX 3WTYC 3R60A 5FMCA 4UY8I 4PCRA 4LQRA 2RS32 1GMMA 4ZS3A 2Q1FA 2IJLA 1WMDA 3AXDA 3SNMA 4RYDA 5E16A 5FD6A 4UNOA 3KD4A 1JXNA 4EEFG 4ET7A 1A6IA 2WO7A 1HN0A 3FBYA 2XAQA 2RV8A 1QH6A 2E5NA 3LSJA 1LFBA 1DF0A 2Q8EA 3ZRGA 4YYOA 5HLIA 1JHHA 1CZSA 5A3NA 3EO6A 4ZZDA 1COV3 4MGIE 4N7IA 1KFXL 2PLV1 3VB2A 2AENA 1ZZCA 5CQEA 4Q4W2 3WINE 2XJTA 2OA2A 3K9TA 2IRFG 1RVF3 4C0HA 3KLSA 3BWGA 2FJ1A 3SDGA 1WJAA 2Z5WA 2KMUA 4M74A 2YX4A 4BQAA 3F8BA 3KF5A 4DIQA 3L9FA 1V9U1 1XNKA 2JRMA 3SXWA 4YLZA 1WPKA 2BJSA 5HCHA 1Z1DA 3H1WA 1JU4A 4JOMA 1TQIA 2DJIA 4UF0A 2PN5A 4V2VA 3OB8A 1ON2A 3TEZA 3TDUC 4E2GA 3IKWA 1PMHX 3I3EA 3O8GA 3PFIA 4JDMA 5FDBA 3VUOA 1CIYA 2BW8A 5IVYA 1J3RA 3ALQA 1IGNA 2PXJA 5C44J 5D5UB 3K10A 4Z07A 2YHJA 2YX7A 1GXQA 3V64A 3RNSA 3CMGA 2PQ8A 5L3CA 2EB7A 1GWKA 2PLV3 4OQ9A 3B6AA 2FUG2 3GMEA 4Q0VA 2FF4A 2CRGA 1WCDJ 2G9WA 4QWQA 1ULCA 4I7HA 1EAH3 5FK8A 3A7QA 2CW7A 3RZKA 3IP4B 5D5WB 2AHQA 2KDZA 3K7AJ 1YCIA 2ZABA 1D0HA 3H3LA 2IVJA 2DXIA 2HWB1 5FYHA 3O1SA 3CD6I 1OF4A 4NRPA 1HW1A 2PQSA 1RESA 4GWJA 4KN4X 4ONUA 3AKTA 4JKMA 2L7MP 4S2GA 4XQDA 4FPYA 2V6EA 4AEJA 4S2HA 2O0YA 2VXZA 3WX5A 4E4DX 2O8KA 2PBIA 1XG1A 4HVOA 3GZ6A 4IEJA 4GDFA 1W9WA 4P9LA 2VNGA 4DBQA 2MD0A 2RN7A 4X0GA 3A0KA 5FZ7A 1QA6A 1B35B 5F3IA 1QU3A 1F9KA 5A7NA 2B39A 3QD6A 4P5HA 5AVAA 5AIPA 1OF3A 3ILFA 2NVXJ 4CUAA 5K0UB 4GWMA 4M6VA 1RUNA 3AK0A 5C3EJ 3ZM8A 4NB5A 1TZLA 4OZXA 4BJ6C 4MTEA 4U88A 5A3LA 1VQMI 2RDPA 3WQ7A 5E17F 3HL2A 2JDHA 1IUYA 3GEZA 1HQWA 2K86A 5CVIA 1GZWA 4W97A 3DPRC 5IW0A 5A32A 3HG9A 4UAPA 4V19K 3POEA 3NNLA 3S1RJ 2QSHX 3KZYA 1WFXA 2C24A 1FEXA 1AA7A 3PL8A 2Z5UA 1ZZBA 1LJ7A 5FP7A 4H14A 1E3PA 1JHFA 2R5ZA 1LEAA 2W1OA 1ENQA 2WT0A 5BNOC 2IGNA 3WF0A 2IFWA 4E7LA 2KQRA 1OFCX 4GGGA 3TP0A 3BI3A 3ONQA 2VONA 5FMOS 5ACA2 1UB9A 1LGNA 2W1WA 4XVHA 3JRBA 5A7PA 1M4WA 1HXS1 3FXQA 3O1VA 1IN8A 3V65A 2FDKA 2VB6A 2WO2A 1B6AA 3VKFC 2HZTA 3OSFA 1S2EA 3LFKA 2K9NA 3H5RA 1HXDA 4PIXA 4DYQA 1Z67A 1WZ2A 1S3JA 1XB4A 2BW3A 4C2UA 2KKOA 3I2IA 2OUJA 3I3MA 3O12A 4CDWA 1OCZH 1WW6A 3I3BA 4XURA 2M8EA 3KS7A 3HOWJ 3KV5A 3QYBA 1UO9A 4JTOA 3PNVA 5A1LA 5DM6F 2DCTA 1DGLA 4N53A 3LEKA 2GC3A 3TO9A 1X1BA 2OPWA 3FJSA 3NNMA 4RAGA 3PQJA 4E4SA 2Y9ZA 3V7SA 2ACJA 2AR6A 2UXXA 1ODMA 4NWWA 1QJZA 1CPNA 1C4RA 3HYIA 3HB9A 1U0JA 1ST8A 5IK5A 2D3RA 5JSRA 3OPWA 2Y0MA 3R0JA 4A6OA 2BHZA 1HXS3 3WR0A 3QWLA 1ZZ6A 1W8UA 4GAZA 3OL4A 2FBKA 3RI8A 2OTJI 3I49A 4JQFA 4RGGA 3QU3A 1XE0A 2PJRA 2HQRA 3H3UA 1AKHB 5D8AC 2DU0A 1Z05A 2A3WA 4C90A 2FHRA 1LAJA 2Z16A 1SFOJ 2E71A 5FZMA 1J58A 1G9FA 4PIYA 5F6KA 1AR62 2NRAC 1DU3D 3HSEA 2WAQN 2EFWA 1LOFA 3WNNA 2WADA 1RIRA 2ZHNA 1YX3A 2HZDA 5F6FA 5J37A 1RUJ3 2CQQA 3QLQA 5HODA 3TOAA 3HOXJ 4QDSA 3G1OA 5B2GB 4RB1A 2XH6A 1HDDC 4N8MA 3H9JA 3KEYA 1TG7A 1UN1A 3LL7A 5BNNB 1DGRM 1OYYA 1DGRA 4CUBA 2ET7A 2RDNA 4ZPIA 1KITA 3T3YA 1ZGAA 3QQAA 1E3HA 5DN2A 2VUAA 2PFWA 1ULFA 1NUKA 1SLTA 4HVRA 4QPIB 3AYCA 2NXNB 4C91A 2DTYA 5I8YA 1F43A 4XUQA 1UYXA 1KYWA 1R6RA 2WN3A 5FGMA 3QCWA 5C4WB 4MXWA 4Y5TA 4XKBA 5FKBA 1FNNA 1Q43A 3MUZ1 3DKYA 5L3GA 4MSVA 3Q5FA 2V1NA 1I6HJ 1T0FA 2JJ7A 3B9CA 2EZIA 4Y20A 5KHHA 3N36A 3LSKA 1E5RA 1R9TJ 1OPOA 4V2GA 1PMJX 3RG0A 3OY8B 1NTCA 1YFWA 4AG4A 4K3UA 3H8OA 5K1YA 2Q0OA 2ZEWA 4H4KC 3RVHA 5DG1A 3Q8AA 2E35A 1TNFA 4QX1A 1FSHA 4BAYA 1HKDA 2UWMA 2FDIA 1DQ2A 1AR71 1WGPA 1F35A 2F6BA 4YZ5A 2LY9A 4XUPA 3FXLA 3VBOB 1KU7A 4XF4A 3FMRA 5FLMJ 4HF0A 3CCYA 5F08A 2DVAA 3OOUA 3HSRA 4CVUA 4BQ5A 1D0GA 3J7LA 1JYCA 1UY2A 1PP7U 3CF6E 1QMJA 5FWEA 2AREA 1RUH3 1RUC1 2OTLI 3WDVA 2OS2A 4IRHA 1UU6A 1JZ6A 4MXVA 3PTYA 4EQQA 4LA2A 2JA2A 3QPHA 4JKLA 1FX7A 2ZGPA 2VZQA 3PVNA 2HOSA 1O59A 3UJOA 2ZA9A 2A70A 5FZBA 4BLIA 1QQIA 2B46X 4EWDA 5IVCA 5F1RA 4NIAA 3GZEA 1U5TC 4XTMA 3BKZA 3LWFA 1Z77A 1EPZA 3ZFEC 1TNTA 3DKWA 3HQXA 2YSRA 1OQYA 3K4BA 4BISA 3BPZA 3QPLA 1R23A 4IV3B 4RGUA 2LNBA 1AR73 3CCVI 5IAXA 3FM5A 1YJ9I 1W9FA 5JLVA 2WAAA 2WBMA 2OT7A 2DI3A 4AWDA 1GQGA 3WGHA 5ILUA 5GLZA 2XV4S 3FUQA 4SLIA 2YFUA 3JCUC 2XVGA 2Y6FA 4D5FA 4L9BA 3AKRA 5ICCA 5LB6A 3MDPA 1AJKA 3BTZA 3HC7A 2IA1A 3ZPLA 5EEGA 3LCPA 1N1YA 1L7QA 5DCMB 1PO21 3LF7A