4I0AA

Structure of the mutant catabolite gene activator protein v132a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKAGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0aA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0aA01
3BJOA 3J7AO 3FZVA 3EYYA 2ZBKA 1U8RA 2XL7A 3G3ZA 4HBLA 2YU3A 1LKNA 1CAUB 2W24A 5KHGA 3I71A 4EJTA 3DL3A 2D5HA 2PAEA 4PJYA 1D8JA 4G7ZF 3RKWA 3GBFA 3F3XA 3PNAA 3KP3A 3M3IA 1YWKA 1XSDA 1ZG3A 2IT0A 5KHKA 4UBHA 1LVAA 4Y15A 3ES1A 2EV5A 4HQMA 1R1VA 1YHFA 1K7AA 4HLTA 4FBFA 2IC1A 3GEZA 5LLQA 4U88A 4J1XA 3GLXA 3KP5A 3MPBA 3I58A 3TDZC 4UVBA 5A2QZ 3JAMZ 3V8LA 4HSJA 2KKOA 5CLSA 4LLNA 4AVPA 3T8RA 1ONVA 4Q5SF 4ZYDA 3SCHA 1WA4A 4LLOA 4RAYA 1GQHA 2QYOA 2VBXA 4MZUA 3H3UA 1LR5A 3NEUA 4J1WA 1XCBA 3C1DA 3H8UA 1ZHFA 2CV6A 1G3SA 2XAHA 4G7HF 2ZO4A 2K7LA 1BI1A 4G8XA 1YTYA 4Q0UA 4QGLA 5FLIA 3CJXA 1ZN2A 2UZKA 2R3SA 1YW8A 1EY2A 1U12A 3N4MA 3MYXA 3KFWX 3QPTA 5HDNA 4YIFA 4PIZA 1Y9QA 2OQRA 3SMHA 4Q48A 4QWQA 3PQJA 1G3WA 2NRAC 2QDRA 1LB2A 1XGMA 4YARA 3FMSA 2V9VA 4P96A 2PG4A 3I5UA 3CUQB 1U5TC 3RYPA 2FMYA 5JCTA 2QZ8A 4LLGF 1DDNA 1BIBA 3GXOA 3LA2A 2DT5A 3HOTA 4A12A 4QXKA 1CAXB 2RQPA 2MH2A 3GX4X 1UIJA 3GW2A 2F5CA 2O61A 4RD7A 2V79A 3QOPA 2PN6A 2P5LC 4P5OA 1DZTA 2ETHA 3K1PA 5FD5A 4IVNA 1H1MA 3B02A 1OPCA 3ZPLA 4M9ZA 4EWDA 4Q4ZF 1XE7A 4TLFA 3IIAA 1ZARA 4P9UA 1UD1A 5BV6A 1XCVA 5FPXA 3SCFA 3DXJF 2XRNA 2WC2A 2BEOA 5CYVA 2XROA 1EV7A 2PI0A 4G6DA 2BNOA 2DFIA 4OMZA 1ZLKA 1MDMA 4WXHA 4EGZA 4MHGA 4IEOA 1ZRCA 2EV6A 1YUDA 4EROA 5AONA 2O1QA 2UXXA 1KQ0A 1QNTA 3TOBA 4CYDA 3J81K 1ZG5A 4Q0QA 3MZYA 1FBQA 3ZDSA 3KGZA 4NVPA 5BXXA 5FLHA 4IEPA 3TO7A 5E8GA 1SFUA 4IXAA 2EFQA 2ZKZA 4EM2A 2ZCWA 4CHUA 1OKRA 3TDUC 3SXWA 1J3QA 4UV9A 4HN0A 1O57A 4B29A 2EFNA 2G7UA 5HDGA 2VOPA 5L3FA 4UXAA 4L18B 1X8MA 1WRJA 1Z05A 2CW0F 3IKVA 4XF0A 4R79A 4A0ZA 3TQNA 3NJZA 3BDDA 4HAMA 5FQ0B 2R7DA 5BPXA 5LHGA 3R4KA 4BYYA 3HSRA 2PAMA 1ZG1A 2QVSB 3MFKA 4L2NA 3EHKA 3KEQA 3VFZA 3SZPA 2PLYA 1TNTA 3FFQA 2FQ3A 2FNAA 3G7DA 4JQFA 1TBXA 2YSRA 3HTUA 2DU9A 3CDHA 4R1HA 3VHRA 2JT1A 4KN4X 5LGNA 1K6OA 1UCXA 3M8FA 4AXOA 2E1CA 2Q30A 2C6YA 5LHHA 5FLXK 1EH6A 2J5OA 2PAKA 1ZRDA 4O5VA 2QQAA 5EEHA 2O8XA 3UKNA 1RUNA 5J48A 3F6VA 2X4HA 1BBYA 4HDVA 2HDCA 2H6CA 2PBIA 1O3QA 2ZKLA 2A6HF 5CVJA 3BALA 1R00A 5HDKA 1HW2A 3F8MA 1YG2A 1HXDA 4I09A 5IT9K 3ELKA 3M70A 2XAFA 1OD5A 1FXZA 3HYIA 4QX5A 1IF1A 3HHHA 2A07F 2K02A 4EQQA 2DO7A 4MGZE 2ACJA 1BI3A 4EM1A 2P17A 1HQCA 3TO9A 4MGIE 2ELHA 2HS5A 2PFBA 4WK8F 1G4DA 1J7KA 1RC6A 4HX8A 2IA1A 3SCGA 2ESHA 3IHUA 2H0VA 2DQLA 4PIYA 2LF8A 4QM9A 2M8EA 2XVCA 1TQIA 2Y48A 5D6EA 4META 2R7FA 4I0BA 2Z5UA 2BBYA 2OAZA 5TRDA 4B09A 1KGSA 2UYAA 2RGVA 2PFWA 3LSTA 1YIOA 4OIOF 1K79A 1J1LA 4KWLA 2L3DA 1V3FA 4QMAA 4LTAA 1BC7C 4AIJA 3FF5A 3KP2A 1MKMA 1IN8A 5DUIA 4RGRA 4YSFA 2ET1A 5L3BA 2QM3A 3JZVA 1RL3A 3MCZA 4ORFA 1NE6A 3U10A 3ZMDA 1CX4A 1X7NA 4HF0A 4XFFA 3OCPA 1KYWA 5A2QK 4LA2A 1XRUA 4XSZF 2OBPA 2VC1A 1O3TA 2VQAA 2K4JA 3ETQA 1CAWA 1MJ9A 2DTRA 2VXZA 3C3WA 4OLLA 3BZ6A 1LJ9A 4LK0F 4ESBA 1NZCA 4K2EA 3F22A 3F8FA 5JVTA 4MQ9F 4IF4A 3H1YA 3IWFA 4GCVA 5HS8A 1IPKA 3EETA 3KCCA 1ON1A 4KIBA 5BQTA 2QVOA 4L9NA 2W25A 2ZNZA 3E6MA 1Z9CA 4OFGA 3TKYA 4UXNA 1JXSA 4LG0A 1XGOA 2W85A 3BPXA 4FAGA 1IN4A 2Y75A 2QCSB 4M6XA 2MLGA 5K5OA 2ET7A 3L00A 4KT5C 2JTVA 1MGTA 3H3ZA 3U11A 2IA2A 2NS0A 2IXJA 4RB3C 1DPUA 1Q43A 2NAZA 1VR3A 3CUOA 3DV8A 2RVCA 3FHZA 3P7NA 1YQAA 1SAXA 4XLPF 1LQ1A 1EYBA 2MC3A 1FP1D 2RN7A 1IAWA 4AWXB 3K2ZA 1JE8A 4ZYEA 1CAVB 2XLFA 1IPJA 4IEXA 2HZTA 2WV0A 1ZGJA 4G94A 3M7GA 2G9WA 1NE4A 1XE8A 3M1EA 3VEPA 1CGPA 4BQAA 5CVUA 3HRMA 5E18F 4IHSA 4LUKA 5DD8A 2WFPA 3OF1A 2MH9A 5I91A 5L3DA 5FB2A 3SZTA 1U78A 3CLOA 2FA5A 4ZYHA 5ILSA 3BU7A 1S7AA 2BE5F 1WGPA 1I6XA 1ZZ6A 3JSOA 3DFGA 1O4TA 2OZ6A 3BROA 3EUHA 4UVCA 5C8WA 3ZMZA 1O5LA 2PA7A 1PMIA 3PVBB 2YX4A 2NNNA 4L5IA 3TOAA 3GO5A 2K86A 2PEXA 3REOA 2KJBA 4MQVA 1TTYA 1IZ1A 3WTWC 3ZMSA 1FOKA 2P7CB 4YNIA 1W4MA 3ELNA 4N9HA 1W5TA 2HWVA 3E3VA 3SFZA 4HF2A 4IESA 3ULQB 6PAXA 2DI3A 4IEWA 2A5YB 4QGNA 3BPZA 2NNYA 2WWYA 3HT2A 1TW2A 4A6DA 2Q4SA 3JTGA 2TDXA 3KZZA 3CO7C 1HKSA 1O3SA 1IN5A 3ML6A 3MZHA 1FP2A 1VP6A 2CO5A 1TQMA 5BS6A 4BAYA 3HRSA 2AXLA 3GWZA 2VODA 1BOAA 1RI7A 1OI6A 3DQVC 3C7JA 3RTRA 4L9JA 2A3SA 1RZ4A 1S8NA 3QACA 4L0YB 2VBZA 4EJWA 2EAAA 1IRFA 4HF1A 3GVAA 4IRHA 4CDGA 1YFUA 4ZU7A 4WZCA 3OV8A 4XSXF 1ZAOA 4WXDA 4ESFA 4H0EA 4O6JA 2FRHA 1MZBA 3S0MA 4KMFA 4I2OA 1SD4A 3GF2A 1QO0D 3E5XA 1T39A 3H50A 1Q1HA 3LQQA 1LRHA 5DYMA 2VECA 2BGCA 3JTHA 1EPZA 1JUHA 4M72A 2JZYA 2PYTA 3IC7A 4KWKA 3BOQA 3ECHA 4MV2A 4EGYA 3KP4A 5ICGA 3EJKA 1RNLA 4R52A 1SD5A 1U5TB 2OA2A 5JI6A 4JTOA 4CO8A 2Z3YA 2DCTA 1DGWA 4UHTA 3J81Z 4I02A 1P4WA 3FM5A 3FXUA 3KLNA 4HMZA 4JVAA 1KQ8A 3EQLF 2HOEA 3E6CC 2W57A 4H7LA 2F5EA 5D1IA 3F8CA 4N9IA 1FBSA 3RI4A 2RNJA 3RKYA 3V8JA 1GXQA 3D0SA 3W6KB 2CSOA 5ICEA 4A2UA 2XUBA 1RGSA 3HHGA 2IJLA 4LULA 1BI2A 1CAVA 2CAVA 1FT9A 1Z7UA 4JBAA 2EFOA 3H9AA 3WW1A 3JSPA 2VONA 4ZU4A 3ZMUA 5DDGA 3ABUA 1IN6A 4LEJA 2D93A 2M1BA 1ZX5A 1V4RA 2XIGA 4ZU5A 1XD7A 2FBKA 3U2RA 5FO5A 2XAQA 2FSWA 2IW5A 1FYKA 4HLYA 1V70A 2A68F 1A04A 1SFXA 2KJCA 3IL2A 1LDDA 5L3EA 2OZJA 3ERED 5JR3A 4G9YA 1B9MA 5BY5A 4FAHA 2FMLA 3ZP5A 1XGSA 1TNSA 3FX3A 1AWCA 2V6CA 2IVMA 5L3CA 4L11A 1C0WA 1ZZ7A 2D5FA 4KNYA 3QU3A 5FPZA 3FXRA 5ICFA 4P9GA 3RZZA 2FEZA 3WTZA 4ZZLA 2OZUA 1R7JA 4AVAA 3DPLC 1WI9A 2QUFA 4HQEA 3DEUA 1UW8A 3ZN0A 5F64A 5E1RA 3B73A 5HLGA 3T1BA 4HBNA 3TGNA 1YS6A 3T0YA 1YFYA 5KHIA 3F23A 1ZYRF 1EH8A 4B8XA 1RTVA 4Q47A 1PP7U 3FMQA 2XV4S 2J5PA 4GULA 2GXGA 2OPKA 3F8BA 2UXNA 4PZJA 5H6RA 1DUXC 2H09A 1QY4A 1IXRC 2L54A 2HFHA 3ROUA 3LFKA 2LF7A 1LDJA 1TQPA 2V09A 3DKWA 1H9GA 2GU9A 1TLHB 5JSOA 5D4SA 4YRDA 3RIRA 2QWWA 2O03A 1L3JA 3LWFA 4RGSA 3HTSB 1W7PB 4KA4A 3BJ6A 1QXJA 5JR7B 3S7EA 1IW7F 4M9SA 2STTA 2GC1A 1HKTA 5HVQC 2D1VA 2GC0A 3PFIA 4ON0A 1NXMA 3KSCA 1ZLJA 4D7TA 3GFIA 1UIKA 1XGNA 1U3EM 4WCGA 2HTSA 2JPBA 1D8KA 3ECOA 5FQ0A 4RB0A 5FFZA 1ZNPA 4IEZA 5EEGA 3U9GA 3K1NA 5ILVA 3EBRA 4EV0A 5E8IA 5BOXA 2GWRA 3R6SA 1ZZBA 4E2SA 2QLZA 2OQGA 1GHCA 2ZXJA 2O3FA 1J75A 4AQ2A 1QZZA 2FBHA 3BWGA 3HRUA 2EK5A 4I0AA 5E20A 1T98A 2OYZA 2Q1ZB 1SFEA 4Q29A 2VT2A 3I53A 5D8LB 3IDBB 2QQBA 5KHHA 3E5UA 4RGXA 1SEFA 2O0YA 2P8TA 2CFXA 3WGIA 1IUYA 4WVZA 2IPQX 1QXRA 3ZMTA 3IKTA 2HKXA 4EJUA 2PHDA 1I5ZA 1H0MA 4XF1A 2HJIA 1ODDA 2V1DA 4HW0A 4MUVA 4O9EA 4M6YA 2HYGD 1Q3EA 1R36A 2GAUA 4KUMA 3VOEA 3QPHA 3FHIB 2P5KA 4XFGA 3QP6A 4U7DA 2OD5A 3EO6A 3WG9A 1T38A 4BNCA 2RC4A 5KK1A 1YFWA 1MD0A 2VPVA 4I98B 5J8FA 4RGUA 4KYWA 2IXCA 3RYRA 1J3PA 1PM7A 1SQ4A 1P4AA 4BH9A 1B6AA 3KGLA 3H7YA 1O3RA 1S29A 1BN5A 1EH7A 4HV5A 3JAMK 3I0TA 3WE2A 4M9XA 3T8TA 4CICA 4YFXF 4XETA 2XAJA 2HKOA 5JSRA 2GA1A 3LWCA 4JV4A 1PP8F 1ZREA 1FWZA 3ACLA 1KU2A 2F5FA 4ENNA 2ZFWA 1HKQA 3S7IA 3HRTA 1L0OC 2G7HA 3L09A 3MEXA 3BPVA 4N0BA 1UB9A 1X82A 2FNPA 4Z07A 1JGSA 4LGWA 2ISYA 2VBWA 1SMTA 4HX4A 4JK1X 2VC0A 2LDUA 1B9NA 3SHFA 3E6DA 5DCMA 1DZRA 1X8EA 4OINF 4LK1F 4MGKE 4BHCA 4P55A 1UHWA 2MA3A 3H7JA 4BHPA 2CQKA 1Z1DA 2M87A 4HVQA 1FSHA 4ASNA 5AVPA 3NRVA 1R5GA 2QBYB 2COMA 3WU1B 4AVBA 4M73A 2Z9OA 1ZVFA 1YO5C 5ICCA 2PTMA 3E6BA 2YR2A 2VT3A 4AVCA 1SD7A 4UVAA 3K0LA 4E70A 3UKTA 2H27A 3GYHX 2A61A 1CAUA 4I3PA 2P6TA 1R58A 5DCFA 2ETEA 3HOSA 4D7SA 1SFNA 4IRGA 1J2XA 3LAPA 2Z69A 1WQ2A 4RB1A 4Q0PA 2RKHA 4XFHA 2GQQA 3W6JB 3KP6A 3DPTA 5T3NA 1TQ5A 3F72A 5I8TA 2LKPA 4FHTA 1BC8C 3M9AA 3DN7A 2D2WA 2OA4A 5FLXZ 1QZYA 2P7VB 3U0ZA 1FY7A 2B9UA 4HDUA 5DD4A 2XKPA 5BPDA 2ADUA 1KQ9A 1J59A 1T2KA 1P4XA 3ISPA 4EJOA 4XFIA 1L3LA 3DP7A 3HT1A 2IXIA 1HSJA 3KE2A 1J0RA 5L3GA 2CGPA 3FZ3A 4KMUX 1OYIA 2ZNYA 2WTEA 3L2HA 3EDPA 5FLJA 3WTYC 4KU7A 4MNUA 4XBFA 2UY8A 2KIFA 2STWA 1D3YA 3V4GA 3FJSA 4OOIA 3H1MA 4U7BA 3GZ5A 2FQPA 4KU8A 5HS7A 2E1NA 1F5TA 4MX3A 4LA3A 1FLIA 1XDSA 4MEYF 4Q0VA 3I54A 4GO1A 5CADA 1USSA 4E2QA 1FZPB 4PGHA 2X0LA 5FCCA 2MHFA 4ZYGA 4G6QA 3O2PE 1Z6RA 3QRFF 2QNKA 4YFNF 3I59A 2ZJ2A 1XSVA 4KWJA 3L2CA 2PJPA 4PIXA 1O7FA 3E5QA 4O3MA 1JHFA 3K1MA 1CF7A 4OIRF 5ERIA 1TW3A 5KHJA 1OYWA 5J6XA 2M45A 5FDBA 5LHIA 2ATFA 3HQXA 1G3TA 1R1TA 4S05A 5LBQA 1WKMA 3LAGA 3CL1A 5FGMA 3NVCA 2B5HA 2ESNA 5HI0A 2EFWA 3CJNA 3H92A 4YYOA 1K78A 2QQ9A 1E2XA 5HLIA 3Q9VA 5CJ9A 3HSFA 1LEAA 4ENJA 5LEKA 3CF6E 3FMRA 1O5UA 4IPAA 1PUEE 5I8SA 2FBIA 5LRSA 1Z91A 1JHHA 3F8NA 1ON2A 3LAJA 4ZZDA 4MGRA 3ST7A 4PDKA 4HN1A 3WTTC 1S6LA 2Z2SB 2XHKA 4A0XA 2C0ZA 4X6QB 2XL9A 5E16A 5K5RA 1OR7A 3BCWA 5J7MA 3WW4A 3WW3A 5JFRA 5C6CA 4QLCU 3NQOA 3WTVC 3CTAA 2D40A 1SMYF 2BNNA 2IA0A 5K1YA 2H6BA 4MTDA 3RYKA 4LB5A 3WODF 3GZ6A 4WXCA 3PQKA 4ONUA 4LFUA 4QM8A 3KMHA 1QGPA 3KZYA 4XFAA 1QQIA 5LRRA 1P92A 4RB2C 1RUOA 4XEZA 4Q0SA 1B59A 2ZMEB 3IWZA 3BP8A 3WTXC 4MGYE 3DF8A 2H94A 4MTEA 2EB7A 5J3UA 3LQRA 2GC2A 2IRFG 1XDUA 4NHJA 4OIQF 1IXSB 1LDKB 4HA8A 4FT8A 1P6RA 3V7RA 3RNSA 4IEUA 2FF4A 2P6SA 2D1HA 1YFXA 2GXBA 4HVOA 2XAGA 4WBBA 3RKXA 2DK8A 4IHTA 4LJZF 5DV5A 5HLHA 4MH0E 4YIIA 1FPQA 5H20A 3R61A 1I1GA 2Q0AA 4QGMA 4XF3A 3WU0A 3OTFA 1QPMA 1IXCA 2PMUA 4GYGA 1O7LA 1MJAA 1X3UA 4EWAA 3IBMA 4U0YA 3R0AA 4E2GA 3JW4A 1CF7B 5D8KB 4PGGA 2UWMA 5DEQA 1BIAA 1F1ZA 2VE8A 3GYDA 4HLXA 5D5UB 2M5WA 1XMKA 3C3VA 1GXPA 2XKOA 1DPRA 1RIOH 2EJRA 1W7PA 4GGGA 2MBFA 3MWMA 2MPFA 3IRQA 3R60A 4BXUA 1T0FA 3C18A 4XF9A 3ES4A 3HUGA 1YFHA 1FX7A 4BHBA 5LEJA 2F5DA 5D5VB 5D5XB 1ULYA 4LMYA 2P4WA 5FFXA 5AIQA 3CEWA 5E1WA 1YS7A 4L9TA 2MLKA 3S2WA 4AIHA 4UV8A 4A5NA 1YLLA 1CAXA 1HW5A 3CO6C 4MEXF 4M71A 1ZZCA 2VBYA 5JHUA 1BI0A 2Q8KA 3I64A 1SD6A 1F9NA 2DQRA 1J3RA 3FM3A 5FD6A 3N97A 4KDPA 3LZZA 1XSXA 2HGCA 1VTNC 4IEYA 3IRRA 3CUQC 1E17A 4HYEA 5F6FA 1I1SA 3KETA 1WSUA 3J80K 1U2WA 5E1XA 4A0YA 2RV8A 2F2EA 1B4AA 4I01A 4LLLA 1WLTA 2HQNA 3USSA 4RAZA 2IXLA 4Y17A 3KP7A 1W7PD 2HQRA 4LD5A 1R22A 1OYYA 1ZRFA 5IT3A 2AS5F 3RJPA 2ISZA 2QJVA 2XGXA 5LGUA 2I45A 3H1WA 3K9TA 1D5VA 2O8QA 2HTJA 3IDCB 5CU1A 1IRGA 4IJAA 4IEVA 1BM9A 3WGGA 4L0ZB 2XLAA 5JSPA 1Y0UA 1H9TA 2KIUA 1BJAA 4O9GA 4UBGA 2EVXA 2IP2A 4U0VA 2K4BA 1KU3A 2LNBA 2FE3A 3BB6A 4NB5A 5D6FA 1ZH5A 3TNQA 3BY6A 2ZMEA 2FXAA 5I93A 3SHRA 2YX7A 1UHMA 4KIFA 2L01A 2QBYA 4KICA 3T5XA 4UUVA 2JRTA 3G73A 3LA7A 5AIPA 1J5YA 3SQNA 5EZWA 1I27A 1NYWA 2OU2A 3KLOA 1B1BA 1G6NA 3UKVA 2KXLA 1ZZ8A 4HOBA 2HYFA 2W84A 3VODA 4S04A 5DUKA 3MAJA 4LB6B 1FSEA 5DCMB 4DNCA 2PQ8A 5D4RA 2KIMA 1CAWB 3EYIA 2BV6A 2YPRA 2K0GA 3RPUA 3NW4A 2VOOA 1P2FA 4YFKF 4JTNA 3P9CA 4HZFA 1FI2A 4FX4A 3KEOA 2HEOA 4CZZA 1GVJA 4F7ZA 3ABTA 3QAHA 2DLLA 4GXOA 3WE3A 3F6OA 5E1ZB 4Z2YA 1XMAA 2A6EF 4L9VA 3J80Z 3WTSC 3NSTA 3OD0A 3OGJA 4OU0A 1R1UA 1PDNC 1H1IA 4KFCA 1VJ2A 2V1UA 2IXHA 4Z82A 4IEQA 1ZGAA 3L7WA 4ETSA 2GZWA 4TV7A 4HSLA 5ILUA 2EA7A 1LNWA 2N7GA 3OOPA 5K5QA 3ZMVA 4KN7X 4HV6A 5I0SA 1Y3TA 2FU4A 2DPDA 2IXKA 3FWEA 2B8MA 4L5JA 3O14A 2CAUA 3RDIA 5I0TA 2F4PA 4A6EA 4UNOA 4AD9A 1KYZA 4OMYA 4HVRA 5I8YA 2D45A 2B0LA 2M30A 2QENA 2EA4A 4KIGA 1FYLA 2XASA 4D0PA 4XRFA 3BJAA 5HOOA 3MDPA 3ZQ7A 4F8AA 1WWXA 3QP5A 4IETA 3WGHA 3HSEA 5CVVA 4ENKA 3FE5A 2BNMA 4M74A 4EM0B 3O3KA 4XFBA 3ZN1A 5KVRA 4CGZA 1QWRA 1S3JA 2GC3A 1YW7A 4EMSA 1DGRA 1Q5OA 4NQWA 1HBXG 1S7OA 1XN7A 3D82A 2DK5A 5CVIA 3WW2A 3COAC 1Z6TA 3GFMA 1NHAA 2GA2A 1OMIA 5JAXA 3I59B 5HS9A 1FC3A 2Y0MA 1J58A 1R5HA 2E7XA 3FXQA 2L4AA 3TNPB 5J8CA 3P9IA 3SXYA 2EWNA 1T6SA 1QBJA 1G3YA 2Z33A 2FOKA 2PMHA 1DP7P 3P9KA 5EFUA 2DAOA 1EP0A 2P5VA 3M8EA 5BMZA 1U5TA 1HSTA 4EWEA 4X6RB 3PLQA 3GFLA 4AIKA 3Q5FA 1YW9A 1KU9A 3D5LA 2PQQA 3F21A 4IERA 3R0JA 5F1RA 4LG0B 2Q0OA 2Z99A 3NL1A 3VB2A 3L9FA 4Y13A 1FYMA 3CUQA 1FBUA 2PHLA 4GYIA 2GH2A 2VE9A 4CXFA 2DPUA 5I0RA 2L02A 1HW1A 2O6GE 4EVIA 1ZZ9A 2V1XA 2MD5A 3V8KA 1ZRRA 2EA2A 4ESJA 2CG4A 1LEBA 2Y0OA 5KBFA 3WTUC 3NKTA 4I7HA 3V7SA 2EV0A 2UY9A 3RPQA 1UCRA 1MDMB 4BIFA 2LSOA 1YLFA 4PCQA 2MNGA 2A69F 4OIPF 5ED4A 2K27A 1W5SA 2DW4A 4AQ6A 2HR3A 4ENMA 2EFPA 4U0WA 4HX7A 3I4PA 1KU7A 5CVRA 4FX0A 2E9QA 2E7WA 1UFMA 1MJBA 4YG2F 1OFNA 2NYXA 2RDPA 3LOIA 2CWEA 1K78B 3HIFA 3LA3A 5D5WB 1XB4A 5E17F 4RS8A 4ZH4F 4DQ2A 4K8FA 3D0JA 4WF2A 5IT9Z 3QU6A 4A5MA 4WWCA 1UPIA 2K9ZA 4XLNF 4XFCA 2VN2A 4WX9A 3I7DA 1GQGA 2CYYA 2XLGA 1J9IA 4LUMA 3O6BB 1USTA 2KRFA 3TO6A 4EJVA 1IN7A 1U6GA 1YYVA 2JPCA 4R8HA 1AOYA 3GUDA 4DINB 5I0UA 2L4MA 5TJJA 1REPC 3AAFA 2Q2EA 4G7OF 3K69A 3Q9SA 1FNNA 5K8SA 4P9FA 3CO2A 4XF4A 4IRIA 2DBBA 3E97A 3U1DA 3EQEA 2JSCA 1R23A 1STZA 2UYBA 5H6QA 2GIVA 3CLPA 1F4KA 4KL1A 1KA8A 5BUVA 5LGTA 3GFJA 3MQ0A 2BYVE 5BPIA 3V7CA
chains in the Genus database with same CATH superfamily
3ZQHA 5J47A 3S1QJ 1R1A2 3J7AO 3BR0A 3FZVA 2ZBKA 2XBO3 5C9AA 2XL7A 3HG9A 3G3ZA 3QYFA 1K45A 2VMDA 1D2QA 2CMPA 5KHGA 3I71A 1SACA 3N7LA 1Y1VJ 3OYWA 4PJYA 4A4AA 5FLVA 4XBQA 4G7ZF 3RKWA 3WT3A 3GBFA 1XSDA 3VSKA 3L9JT 4EEFG 1YHFA 2EALA 4GALA 4OCTA 1K7AA 5DG1A 2RDQA 5LLQA 1VQMI 4J1XA 2E53A 1ZBE3 3TDZC 4UVBA 5A2QZ 3FXMA 4HSJA 5A3NA 5EG0B 4AVPA 1BLZA 5KR7A 2IGMA 4ZYDA 3SCHA 1AZDA 1LU1A 4LLOA 4PI2A 4OAYA 1VI0A 1UU4A 5F3EA 5FZLA 1XCBA 3WV6A 3ZXAC 2ZO4A 1AR91 2K7LA 2VUJA 4M3BA 1BI1A 3RJRA 1FMWA 4G8XA 1H0BA 4QGLA 3PSFA 3HOVJ 1MEC2 2R3SA 5F0FA 2OIIA 4CTEA 1YW8A 3KFWX 3QPTA 4AK3A 5HDNA 4WVVA 1Y9QA 3OYLA 3A0NA 4QQOA 1BQPA 1LB2A 1XGMA 3T4VA 3FMSA 2XPWA 1APLC 2QZ8A 1KEXA 2WFF2 4LLGF 1GOGA 1BIBA 1WJBA 4DEVA 3BUCA 3O0XA 1CAXB 3OUHA 2MH2A 3OMYA 2A3XA 5LASA 3TEYA 3AK0A 3K1PA 1RHI1 2UURA 1UXZA 1Q8VA 2LMDA 1XS9A 4M9ZA 1QNYA 1X2NA 4EWDA 4QX3A 1DYKA 4Q4ZF 2B42B 1Z78A 1LE8A 3AYAA 5HCFA 1UD1A 1XCVA 4F52A 4G6DA 2PI0A 3C7OA 2BNOA 2DFIA 3E1F1 1POQA 3CJIB 4MHGA 1DGRN 1AR93 2KLOA 2EV6A 4EROA 3H9JA 1KQ0A 5IY5H 4CDQC 3HQUA 4Q0QA 1IUFA 5I0DA 2Y6JA 4NVPA 4IEPA 3ASNH 5E8GA 5ABJC 3S3OA 1TMF3 5C8CA 2EFQA 3CCLI 4XXPA 5A7WB 3T2OA 2BTVC 1E5RA 3LOCA 4BE3A 2VIXA 3A0BC 2R7EB 1V6OA 4RYDA 5JLXA 4A3FJ 4B29A 5HDGA 5L3FA 2WO3A 4L18B 1WRJA 2CW0F 1K12A 1TEIA 3GTKJ 5M0TA 1QKQA 1R1A3 3S3MA 2R7DA 2VMEA 3CBNA 2EINH 4CP9B 5C3OA 4TN7A 4AHYA 3MFKA 2QZ3A 4CH7A 2PLYA 3OIOA 1J09A 1G9AA 4RA2A 4UUTA 1S0FA 3FFQA 2FNAA 2VU9A 4IOCF 1TBXA 2YSRA 3VZOA 2DU9A 4GRIA 4ITCA 1OLTA 3B94A 2JT1A 4QSHA 5LGNA 4PBPA 4A7KA 1K6OA 3WF0A 3M8FA 1GNZA 3CDLA 4AXOA 2E1CA 2Q30A 5EJZB 2R063 4DW6A 3ZLIA 4YM1A 2PAKA 1ZRDA 2JIJA 3FBYA 3VBFC 5EEHA 1F5JA 1OA3A 1UQXA 3G6JB 5J48A 3F6VA 2VQUA 1TE1B 1BBYA 2PBIA 4NIHA 2ZKLA 4PI0A 3VKNA 4LBMA 4PK4A 1R00A 1I1EA 3K77A 3DF0A 2VUCA 3F8MA 4BBRJ 4Y1ZA 1HXDA 1IHMA 1OD5A 4QX5A 1WW6A 2B9SA 1BI3A 1UO9A 3OUJA 2P17A 1HQCA 3TO9A 4JDNA 2W52A 4MGIE 1S0DA 1G4DA 2RR11 3DTEA 1RC6A 2FMDA 3ASOH 2QQOA 2VTXJ 2DQLA 2LF8A 4ZJZA 4NRQA 1U5YA 1MBJA 2Y48A 4Q4X1 4WZFA 1ULDA 2Y6HA 5A3PA 3NV4A 4AQTA 4ABZA 4DS0A 2BVVA 2DV9A 5TRDA 4B09A 2UYAA 3JQWA 3LSTA 1YIOA 4OIOF 1J1LA 3JR9A 2EXHA 2BW3A 4QPIC 1C57A 3KLSA 2AQFA 1ZBA3 4OZXA 4K40A 2VAUA 2YS9A 2HZDA 5L3BA 2QM3A 4NC6A 1QH7A 2CQNA 3VBOA 4A42A 4HF0A 1GANA 1GVDA 5KWRA 3G1MA 2DOEA 1O3TA 2VQAA 2K4JA 2JWPA 4QPYA 2UUZA 3J7AY 2VXZA 5M5WJ 1R6RA 4H14A 4ESBA 1NZCA 1JOBA 3CF5F 2CH0A 3N35A 2QQ8A 1WLDA 1FNZA 4MQ9F 2A6WA 3GBWA 1VBD3 2YC2A 2Y6FA 1W0PA 1ZKGA 2ZX0A 3EETA 3FK7A 1HCRA 3PUHA 3WNKA 3VZJA 1HLCA 2ID4A 3GTQJ 5AC92 4L9NA 2E33A 3GTMJ 4FOWA 1ITYA 5E79C 5FZ0A 1PYVA 4UXNA 1ASJ1 5FAXA 2LRDA 3ZFFC 1XGOA 2W85A 1LFPA 2DA6A 4YZ2A 1GZ9A 5E6HA 3L00A 2LKSA 2ID3A 5K7ZA 3ZQFA 2ZXQA 5GALA 3S30A 1H88C 1KS4A 5IUQA 4K8RB 1SAXA 4GH4B 1EYBA 2MC3A 1FP1D 1NG7A 4QKNA 4ZXKA 1AHDP 2PLV1 3NQHA 5IAXA 3OBAA 1Y8QB 1JU3A 4AWXB 4CRQA 3BN6A 2WSUA 4LNVA 3T08A 2WV0A 2CU5A 3DLAA 4CCMA 3IT8A 3CZ6A 4EZ4A 2G9WA 1NE4A 1W8ZA 2RJKA 4XQFA 5J1UA 4FPHA 1HB4A 2L9SA 2MH9A 1ENSA 4A45A 3SZTA 4CU6A 1JHJA 4G6TB 1D4M1 3RJ2X 1MVEA 1I6XA 3DFGA 4P5HA 3ZMZA 2VO5A 1TG7A 2PA7A 1B35C 4NPRA 4NAOA 5FR3A 2NNNA 3GNEA 1LGCA 5KXBA 1BK0A 2IFRA 3REOA 4MQVA 5LA9A 5FMDA 4CE8A 3WQBA 4N9HA 4OUSA 2HWVA 5IK4A 4I76A 1US3A 1D7PM 4HF2A 4IESA 3TN91 2DI3A 4F91B 2VPLA 2A5YB 4QGNA 3ZQQA 1TW2A 3MV01 4A6DA 4LBNA 2VG9A 4AGVA 2TDXA 2BXZA 1LFBA 1IN5A 1V54H 1GWMA 4NC8A 1FP2A 1GLNA 3KB5A 4PSXA 3AZZA 5CKTA 2E5ZA 2VVFA 3V0AA 1W9FA 2HWB2 2QEXI 2QGUA 2R92J 2RDRA 3RTRA 4L9JA 2A3SA 1RZ4A 3QACA 1GP6A 4L0YB 4ES9A 2LVSA 1B09A 4WZCA 2O14A 3OV8A 4WXDA 4ESFA 4LO6B 2FRHA 1MZBA 3JRCA 5LBBA 1H9PA 4KMFA 2VULA 2DBNA 1QO0D 2H0BA 3U21A 3H50A 3PUAA 2VECA 1XU2A 5G05L 2Y2ZA 2VQ0A 4M0NA 1MIJA 1HJGA 3HAGA 5CG8A 3I4NJ 4KWKA 4RM3A 2E6VA 4CUCA 3ECHA 4HG6B 1DGRM 4LBLA 2CL2A 1W9WA 5IK8A 2OA2A 1U5TB 3Q8AA 4JTOA 4CO8A 4QTRA 2Z3YA 2DCTA 1LFUP 3NRUA 4DNYA 1O4ZA 3CCEI 1LULA 1NT0A 3FXUA 4OVEA 3KLNA 4HMZA 2WYFA 2WNUA 2CUFA 1T2XA 3WQ1A 5DAVA 3UNGC 2RNJA 3MIGA 3WP6A 4BEHB 3V65A 1IGNA 1LCLA 1LUJB 2CSOA 4E7ZA 4KBBA 5ICEA 4HEA2 4A2UA 1RGSA 3HHGA 1BI2A 5JZGB 2EFOA 4HPKA 3WW1A 3ZMUA 2AEYA 2QQKA 3IH3A 1IN6A 3PUFA 5JHFA 3FHAA 2M1BA 3MKZA 4D3WA 4DYQA 2XIGA 4ZU5A 4DYCA 4UB6C 4F3QA 3CJIC 1QDOA 2FSWA 4D94A 3AKZA 4LBJA 1F15A 1BCXA 1SFXA 2KJCA 1YX3A 3ZQGA 4Y1YA 2OZJA 5FO7B 3CMAI 1X36A 3W3CA 1SHWB 3LSMA 4NHYA 1JZ3A 1PGSA 4QAWA 2P6CA 2IVMA 2OUJA 4PQQA 1Z7S2 1IS3A 5B4XA 2CW7A 1C8M2 2Y33A 3O5SA 3VSLA 5ICFA 1L7RA 3EMRA 1BW5A 4E4HA 2OZUA 3TP0A 2M9HA 1JZ7A 3Q8FA 3K4JA 4MSVA 3ALQA 3ZN0A 5KCMA 3B73A 2JA2A 4IE6A 3DU5A 2O9LA 5HV0A 1R9TJ 2J1VA 3CMEI 1W0NA 3TGNA 1P7IA 2Q5TA 4CDWB 3ZSKA 3UL2A 1ZYRF 4YG0A 5E3MA 3DWLE 3AXDA 3DEWA 3OGRA 4CCLA 2OPKA 3R4SA 4XTPA 5EWSA 3LSGA 3MF9A 5FP9A 2L54A 3LFKA 1ETKA 1XU1A 4OUMA 1YIPA 4N7IA 5L7OA 4XKBA 3NJYA 4KI5M 4Y5TA 3ZFFB 1AR81 3W5MA 1EAH2 3HTSB 1W7PB 4KA4A 3WDVA 1IW7F 2ZEXA 1HKTA 3RFRA 1QU3A 2GMMA 3MIDA 1IS6A 4ON0A 2WKKA 2JKBA 1LENA 3GCXA 4GKYA 4CUAA 2D44A 2OUMA 1VQPI 2WDBA 3A22A 3EBRA 3BIEA 1CJDA 1V6NA 4RN5A 4Q8KA 5E8IA 2GWRA 2JB8A 2E34A 2JG8A 2WJSA 2OQGA 1ASJ3 1ENQA 1DGWY 4LHLA 4HKOA 3DBLB 1J75A 5ACA1 1HF0A 1SBEA 2HWC2 3KV9A 2P0WA 1T98A 2OYZA 2Q1ZB 1AYN1 1NA1B 1H4HA 3I53A 4RGKA 4RGXA 2CDOA 3CD6I 2JQ7A 1S7EA 5F7UA 1Y7BA 3LEGA 5IFPA 4WVZA 1IUYA 3IKTA 4KGGA 3HEFA 1UWWA 2FCTA 2ZZQA 5FTTC 1AR72 1H0MA 1ODDA 4XUOA 4HW0A 1X58A 1JT0A 1HXS3 4QXCA 4O9EA 5KXCA 1RKWA 3QPHA 2UU8A 4WM8B 2AH2A 4U7DA 2OD5A 4AZZA 2X29A 5FFOC 1T38A 5KK1A 2LM3A 3VZLA 1NZIA 2VPVA 2WNOA 2FD5A 2ZAHA 4P9JA 4A6SA 5J8FA 1BKZA 2IXCA 2WLPA 3UNPA 4B43A 3T3YA 2ECCA 3PO3J 3H7YA 3AP6A 1HQNA 1BYHA 4HV5A 3FXJA 4FPJA 4NIIA 4YFXF 4LQRA 4B1LA 2XJSA 4JV4A 5LY2A 1FWZA 4JGYB 4AR2A 3GDBA 1EV13 1KU2A 2Y34A 2VKEA 2D6KA 2QCOA 5K4LA 3BPVA 3KVAA 4LK7A 1POV1 4FI9A 1WD3A 4XICA 4LGWA 1YI9A 2RS53 4DGWB 3AXEA 4YG6A 1VBE2 2H1KA 4XUTA 1X8EA 4QXBA 1HJFA 5LA0A 2HPIA 3RWKX 4BHPA 4N8MA 2CQKA 4Q5OA 2QQLA 4HPKB 2ZFUA 4XL9A 1FSHA 4ASNA 3ORJA 3NRVA 2YU9J 1Y8RB 2QBYB 4AVBA 3KQ4B 4E4SA 5HODA 5JZGA 2JKXA 5JMCA 3S17J 1ZTRA 4C30A 2HVQA 2YR2A 1MBEA 4XZUG 2W2IA 1NAEA 4IZZA 1KXGA 2HQ5A 4UVAA 3K0LA 2UV1A 4E70A 2Y9YA 3UKTA 5C3RA 1CAUA 5LCWL 2WN3A 2JXAA 4BMEA 4I3PA 2P6TA 1R58A 3DTKA 5CKNA 4D7SA 3OJBA 3MICA 1JYTA 1NLQA 4IRGA 2PQSA 1YIJI 1W39A 2DMQA 4Y20A 3KP6A 2XPUA 1K6YA 5F3IA 5T3NA 4BQ4A 1Z7S3 3F72A 2EZHA 2AEZA 2B39A 4YW5A 2LKPA 2ZMKA 2DJNA 3FK6A 1AR82 1QZYA 4GB33 3TEZA 1W6OB 3U0ZA 1QJZA 5DD4A 3AKSA 1UY0A 1KQ9A 4F55A 2BOIA 1E5SA 1LHWA 3DECA 1HSJA 3LD8A 3KE2A 5L3GA 4PQ9A 1F9KA 2YC4A 1IGOA 3IAPA 1ZQ3P 5FLJA 5M5XJ 4LOSA 2OUHA 4KU7A 4MNUA 2JJ7A 1WCUA 3WHTA 3KHBA 3V4GA 3H1MA 3HGYA 4D5FA 4COYA 4NDLA 3GZ5A 1QJU3 2FQPA 4IKFA 4C3JJ 1S9HA 3QQAA 2E1NA 5K7PA 1TT5B 3RI8A 4LA3A 4B3NA 2A6YA 3ACGA 2VVEA 3K46A 4A3IJ 1KJRA 2FDHA 4AI2A 4PLMA 1FZPB 2W95A 2XUEA 1W3XA 1Z7S1 2M8GX 2X0LA 4FETA 3WCRA 5A6ZA 2MHFA 3URFA 1Z6RA 4BXSV 3S2DJ 2R7XA 1IZ3A 2L7MP 2HPMA 1REEA 2PJPA 2D3RA 4PIXA 1O7FA 3E5QA 1JHFA 3K1MA 1HDPA 2HYKA 5J40A 4Q4V3 4RAGA 2M45A 1QF3A 1H6YA 1BBT3 4G12A 1WCKA 1REFA 3EYPA 1WKMA 3LAGA 1G9BA 3H5RA 5GAEJ 2HBUA 3H92A 4YYOA 3T0DA 4YW3A 3WINE 2FDFA 5CA6A 3HQRA 2W94A 2XPJA 5HLIA 5G04L 2XB0X 2ORXA 3LSDA 1SBDA 3CF6E 3AMMA 1POV0 1PUEE 4Y22A 3AL0C 2WO2A 5D21A 5LRSA 1W9YA 3K7AJ 1Z91A 3MHZA 4BKXA 2EXIA 1ON2A 1HDKA 3ST7A 5D2AA 2HOSA 3BTZA 5FKOA 4HT1T 2Z2SB 1HLVA 1MZEA 1RC9A 3HOXJ 2JG9C 2C0ZA 1TZLA 1HB3A 3POEA 5E16A 2OT7A 2V73A 4UFIA 1OR7A 3BCWA 5FZIA 1BBT1 1ODMA 4TSVA 2E51A 3WW3A 4DZJA 2VUMJ 4GJZA 3NQOA 2R0QC 3OYEA 4UT5A 3CTAA 3ZYBA 1SMYF 4L9BA 2BNNA 3WP5A 4F92B 3K4NA 4WXCA 2R5ZA 4RGGA 3IMMA 4ONUA 5A1LA 4QM8A 4AAXA 2DVDA 1QQIA 4WM8C 4E7HA 3THDA 1EF4A 4XEZA 5T52A 2VJ4A 5EYRA 2ZMEB 4Q4V2 4BS9A 1OPOA 4OHXA 1JKOC 2WAFA 4BY7J 1Y0NA 5J3UA 2GC2A 4B3XA 2IRFG 2EH3A 4OIQF 2FD8A 4HA8A 2CV0A 4KQ7A 4AI9A 5GLUA 3RNSA 3RZOJ 4IEUA 2VXDA 1YFXA 3H8RA 5C4WB 4B4RA 2JMWA 1GWLA 4WBBA 5J4VA 1OOPB 4IW3A 4QQLA 4IHTA 4LJZF 3O12A 3PNTA 2WZR1 5HLHA 4YIIA 4PSWA 2Q0AA 2YBSA 3WU0A 4XE9A 4YW2A 1KONA 4H55A 3OYNA 4BQ5A 4XOGA 3WEZA 3MEPA 1SVMA 2VE8A 1F1ZA 3GYDA 4HLXA 2M5WA 3C3VA 2XKOA 1DPRA 3ILFA 2EJRA 3GZNB 1K5MA 4CP0A 1DCSA 1PIV3 2VZ1A 4GMP0 3LPGA 2A6XA 1LOEA 1E3PA 3ES4A 1UN1A 1PZ7A 2MW8A 4BHBA 1T8IA 5D5VB 5D5XB 1VIWB 4LMYA 4C3HJ 1TT0A 3MMYB 4BM8A 4GB32 1XG1A 3CEWA 4LPLA 1A6IA 2VZVA 4AIHA 4UV8A 1CWPA 4J6GA 1HW5A 1ZR4A 2QQMA 1RPWA 5JHUA 1BI0A 2Q8KA 3I64A 2G4IA 2XSJC 3MPPG 5CAZA 1R082 3K70C 5A32A 3QBQA 1GMMA 3H3LA 4UF0A 2NLRA 3LDKA 4KDPA 3QPLA 2E31A 1XSXA 5EXOA 4XHXA 1XPXA 5GADJ 3I2FA 4BY1J 1E17A 4JC1A 4HYEA 3B00A 4W6YA 4Q1RA 2A5WA 5BNNA 3HJEA 3O8GA 1UX7A 3USSA 3ZFEB 3GZEA 1VRH2 1W7PD 1UY3A 2TBVA 1M4WA 2AS5F 1BJQA 2HWB3 3H36A 2VJXA 2XGXA 1ASJ2 3O0WA 3K9TA 3MLJA 3AP7A 2J1SA 3DEMA 1QHGA 4L0ZB 5JSPA 1Y0UA 4U87A 1BJAA 5FYYA 2DTZA 1RKTA 1KU3A 5L36A 4FPGA 3GCMA 1BMV2 4FCYA 3BY6A 2ZMEA 1YI2I 4RQPC 4PUSA 1NCRB 3MIBA 3FUOA 4CPBD 2PHUA 2QBYA 4IUGA 2B7EA 2VOTA 3H0OA 1JKPC 5AIPA 1J5YA 4DUVA 1PVEA 1NYWA 1X2MA 4GWIA 4GB31 5DAWA 2XSDC 2W84A 4QX2A 3WF1A 3RQ4A 2NYYA 3MAJA 4MADA 2F48A 1WJAA 4D5CA 2K0GA 4HSTA 1KQRA 3P9CA 3A2KA 2A75A 4FX4A 1O8SA 1IS5A 4F7ZA 5EDNA 2CU7A 3B3QE 2DLLA 1UY1A 4GXOA 4Q4X2 1POV3 1XMAA 2W1UA 4NIDA 2A6EF 4EN0A 4ZY9A 3HJRA 1IG3A 2JA7J 4MYEA 4XK4A 3OD0A 1YHQI 1OSGA 4OU0A 2OTLI 3VBUA 5GLVA 4KFCA 3C2UA 2PJRA 1VJ2A 2BXYA 2WZR2 3AVRA 2IXHA 1ND3B 4BXFA 1SMVA 1OXCA 1R083 4URAA 5HCAA 2GZWA 1LNWA 3TMOA 4CPBA 1W6NA 1CPMA 1Y3TA 2FU4A 3FWEA 5FZKA 3O14A 2CAUA 4AG4A 1OVSA 3RDIA 5I0TA 4OI1A 3BR5A 4P9LA 4OMYA 5CIRA 4HVRA 5I8YA 4RGAA 2HXIA 4R9BA 3VDXA 2PHFA 1FYLA 2HWB1 9ANTA 5A3UA 4D0PA 2VL4A 3MDPA 1OOPA 3KM5A 2KIQA 3ZQ7A 5FUIA 2WB1N 2EIJH 5CVVA 4ENKA 3FE5A 2BNMA 4EM0B 3RZGA 2HQAA 1RUC3 2L0KA 4CGZA 2X09A 3T09A 1UAIA 3M4OJ 1XYPA 3OYJA 3GTJJ 3HOWJ 2DK5A 3GFMA 1T0FC 3A01B 1NHAA 3N7KA 2GA2A 4A6OA 5JAXA 2WZ8A 1VNDA 3JD73 2L4AA 2FCVA 3BZCA 1XC6A 4Z6YA 3WF3A 2QE3A 3VBSA 3GZAA 4ISQA 2IUWA 2PMHA 3I2HA 3H5AA 1OJLA 4IHXA 3JRGA 1SBFA 4EWEA 4X6RB 3D5LA 3VL9A 1WH7A 2VMIA 2VCBA 4IGPA 4LG0B 4B7EA 2A7AA 3U1KA 1D4M2 1QRYA 2W1OA 5TISC 1FYMA 1EA3A 5GPAA 4C2TA 1KD7A 4KBZA 3VYRB 2R072 2AQEA 1ST8A 4AC0A 4XJZA 3FHQA 4MXWA 4CXFA 5I0RA 4FFFA 1LHVA 3I49A 3EXUA 2DA4A 1ETXA 5ANQA 2CQQA 3WU2C 2XGCA 2LYCA 4FE4A 3NKTA 5A7SA 4I7HA 5HXVA 3RPQA 2P3JA 4PCQA 2E1OA 1LOBA 2DW4A 2E2JJ 3M1CA 2WWSA 4U0WA 1KU7A 2WL1A 1AKHB 2E9QA 5FWEA 3I2GA 2FZ1A 3MUZ1 1OFNA 2NYXA 2K2SA 2BQPA 1ZR2A 2RJ2A 1MNDA 2RDPA 2KZGA 3OYFA 3HIFA 3OY8A 1XB4A 3FLPA 4RS8A 4K8FA 4I3GA 3D0JA 1PGL2 2XWBB 4M3FA 4A3ZA 4AEMA 2K9ZA 1MEC1 4Z2AA 4PJ0C 1GQGA 2QFEA 2CYYA 4LG3A 2X1CA 4FPEA 4QPGA 3PUIA 4W8JA 1RVF3 2VXJA 5GLWA 1MNEA 5F3GA 4PLNA 2E71A 1JJ6C 4EJVA 3ZXDA 1W8FA 2DF7A 3RQIA 1YYVA 2RR13 2ELJA 2IVIB 4XUPA 2BWCA 4DINB 2YUEA 4ZDLA 1DF0A 2RE9A 2ZGMA 3I2KA 4LBQD 1REPC 1Q8QA 2Q2EA 3PM1A 4G7OF 3K69A 3HR9A 3HM5A 2Z1DA 4P9FA 2XJVA 2JDZA 4BK4A 4XBNA 3ZN6B 5A1AA 4CDWA 2XJUA 1SZBA 4LKSA 3D6EA 2MGQA 1I5PA 5H6QA 2ARXA 3ZIXA 1UL9A 1F4KA 5BUVA 5C70A 3GFJA 3MQ0A 3ZXSA 3VBUC 4YGEA 1U9OA 3V7CA 3NKGA 3NARA 3WUCA 2AZ5A 5FUPA 4ZHNA 4HBLA 1APNA 3B6CA 1CAUB 2WZR3 3OPTA 4LHSA 3BC8A 1LOCA 4QXHA 4W1UA 5C9AC 2LFBA 5LA2A 1C3HA 1W8TA 4AYBN 2GH8A 3F3XA 2JVHA 3CCQI 2LREA 2QBXA 5KHKA 4Y15A 4J19A 1JTZX 3ILRA 2HWE3 4FBFA 4U88A 3P5JA 3OS1A 3KP5A 2AGSA 3LE0A 3MPBA 1OLQA 2RR12 3JAMZ 4LLNA 2P5BA 5L7OC 1XNDA 1ONVA 1W3VA 5JXGA 1Y43B 1WA4A 5LBEA 2QYOA 3GHMA 3H3UA 1YITI 3NEUA 3C1DA 3H8UA 1IPSA 5M3FJ 3THCA 4CCKA 3AG1H 3L2WA 2WFF3 4F3JA 3CJXA 4YZ1A 4EQVA 1ZN2A 1HIXA 5JOZA 3MYXA 3SZGA 2WN2A 2RDNA 1HOMA 5J3LA 4AYBA 2ZEZA 1MMDA 2O8OA 3SMHA 1C8NA 4QWQA 3PQJA 5FZ6A 3S1RJ 2NRAC 4YARA 1RVF1 2PG4A 2WABA 4FPOB 4PDWA 2ZMEC 2OQ6A 2FMYA 3VZMA 2ME6A 3GXOA 4CA9A 2BRTA 2DT5A 4A12A 4QXKA 2RQPA 1ONAA 2WY7Q 1UJ8A 5A6QA 1UIJA 3CCSI 4AM3A 2O61A 5F5AA 2V79A 1UYXA 2P5LC 4XACA 2YROA 3J26N 3OY8B 1DZTA 1UZCA 2I10A 2IWGB 2AUYA 4MGQA 4BISA 5FD5A 4IVNA 5A33A 1H1MA 3JRIA 3ZMNA 3M3EA 1WLCA 1XE7A 1SG3A 1BBT2 1ZARA 4P9UA 1MSFC 3JRFA 1L7QA 1CJPA 2VCAA 2BEOA 3OPWA 1ULEA 4OMZA 3A01A 2FOWA 4WXHA 4EGZA 4IL7A 2PMWB 2GN7A 1F4AA 4YW4A 1WD4A 3I9V2 2YGLA 3TOBA 4RHV2 3J81K 1OQ1A 1YJNI 1FBQA 3ZDSA 2CV1A 2JD4A 5FY9A 2WY8Q 1SFUA 1FYUA 3BYWA 2ZKZA 4EM2A 3BZKA 2NS7A 3EUKL 3SXWA 1J3QA 4PFPA 4HN0A 1OCPA 2VOPA 2CHHA 4UXAA 1X8MA 3GJAA 3JD72 1DU0A 2CRGA 5E88A 5JUVA 3W58A 4A0ZA 5FMCA 5FYVA 5BPXA 5L9BA 4BMBA 1CIWA 2ARCA 1HRI2 4YLZA 2R32A 4FQZA 4XZPA 2W68A 2PAMA 1ZG1A 1PIV1 5BNPC 1VMHA 4Y1UA 2CYFA 1STMA 5C71A 4Y22B 5F8PA 2OPTA 1TNTA 2KPMA 2E35A 1W2UA 1OQYA 4JQFA 1QPIA 2KT0A 2KFDA 3VHRA 5C9AB 5IT6A 5FYUA 4ZKTB 1W1WE 1SCSA 5FLXK 1NCQC 4DO0A 4Q2FA 1W6PB 5GAGJ 3J7HA 2X4HA 2PLV3 2HDCA 3DYMA 2EIGA 3Q8EA 2A6HF 1MMGA 1RUH2 5CVJA 3BALA 2RNGA 4EJRA 2NOGA 1VFCA 3VBFB 3K51A 3ELKA 1QJX1 3NWKA 4W50A 1FXZA 3THPA 3HYIA 2P81A 4FTBA 4EQQA 2DO7A 1S0CA 3BQYA 2XBO1 2V4AA 4EM1A 2JDNA 5A70A 1EAH1 2ELHA 1GZTA 3QYEA 1GZCA 3NWTA 1A78A 1JHNA 2KR2A 4L5EA 3SCGA 3MVPA 2ESHA 3IHUA 2ARBA 3FC0A 2H0VA 2OS2A 1YRNB 4QM9A 2M8EA 3HWJA 3ME2A 3UT0A 3OYGA 1K3IA 1TQIA 1ZBA2 4I0BA 1OQDA 3TAYA 1QJU2 4N53B 1YQ5A 3LPFA 1KGSA 2YMZA 2PFWA 5A3OA 1QJU1 5FZDA 4BGDA 1K4TA 4DBRA 4AIJA 4XJUA 2AREA 1X19A 3FFZA 1FMD2 1OVPA 1S5LC 2HYXA 1W2AX 1TL8A 3NV2A 4RGRA 1DQ6A 3UGFA 1OF3A 3MCZA 1NE6A 1C8M3 2VQCA 1RR7A 4BJ5C 3ONQA 5GLZA 4JQRA 3T1MA 4LA2A 4ZDPA 4W6WA 2JDMA 4ZYAA 2E1MC 3ETQA 1CAWA 2OCEA 1C8M1 3CJRB 4OLLA 1LJ9A 1DZQA 3POSA 1RUH1 3SEEA 3WUDA 5JVTA 1XE0A 3P5BA 5HS8A 2PJRB 4Y4RA 4A3GJ 3IH2A 1RITA 4RR3B 5GM0A 4KIBA 3PIGA 2AYHA 2RS12 1FOXA 1DHKB 1Z9CA 4OFGA 5H9SA 5IPAA 4B47A 2KZVA 1Z0HA 4FAGA 1IN4A 5GJ6A 1J83A 3VD9A 2ET7A 3H3ZA 4XQ4A 2CWSA 2IXJA 1E5IA 4AFDA 2GDFA 5L9VA 1YQ8A 5HNHA 3P7NA 1CN1A 1YQAA 1IO2A 4GZ9A 3JD71 3VLBB 1UKRA 3HKZN 2QQWA 1BVVA 5DQ0A 1UPSA 2GOXB 3R4DB 3WSOA 3C7FA 5ABJA 2ZXHA 4D69A 4FQGA 2G19A 4RR3C 3ABKH 2A73B 1MZ5A 5DG2A 2XLFA 1IPJA 2Z5WA 5LB6A 1GSLA 2HZTA 1JTXA 3VWBA 3NMBA 4HK8A 4V2FA 1AXKA 1XE8A 3M1EA 3VEPA 1VQLI 1CGPA 2HEVF 1QZEA 3HRMA 2XF6A 1JZ6A 4BOWA 4FFIA 5E18F 3LNQA 4AHXA 3OF1A 4YVWB 5FB2A 4B4QA 2D6MA 1U78A 1NK3P 2FA5A 2P2KA 2I8DA 1O4TA 2M2EA 1UMHA 4EN7B 5D8AC 1MACA 4Y26A 3EUHA 3O1TA 1UU5A 1OLRA 3SEPA 4D6RA 4RM2A 3V0BB 5F5IA 2YX4A 4L5IA 3TOAA 2K86A 2PEXA 1LOGA 1MMSA 1AR71 2BJSA 4IE5A 4YNIA 1B35A 1I3QJ 1OFCX 1W5TA 5EPAA 3MLKA 4CXYA 6PAXA 5DN2A 1UYZA 3ZR6A 4IEWA 4JCKA 5FXVA 3MGUA 1I39A 3HGGA 2QQIA 3G2BA 4S2GA 5B4NA 3PTRB 2HWD2 4CDXB 1OH4A 4NC7A 5FYZA 4M3CE 3DPRB 1K4SA 1FEXA 4FFGA 1D1AA 1TQMA 2LS6A 3HRSA 3IH4A 2HWC3 2HWE2 2AXLA 3HVDA 5C4WA 3CLQA 1S8NA 4EJWA 1GV9A 1IRFA 5KAIC 1NLRA 3O1OA 2BHYA 3AG3H 4IRHA 1MS3A 4ZU7A 1JJ8C 4UFHA 2GOMA 5B1BH 1MQTB 1ZAOA 4OAZA 4CVUA 4FE7A 4COVA 4CZSA 2OCCH 2ZOEB 3LCPA 1SD4A 3ZYRA 1W06A 3LSHA 5DYMA 3N9NA 5C44J 3JTHA 2BGPA 2R5ZB 4DRVA 1XYNA 1JUHA 1IKPA 3TOJA 2JZYA 2PYTA 4MGTA 3IC7A 4TXWA 3QPSA 3OYCA 3ZDVA 3D3AA 2CW8A 4I99C 4Y20B 2BFUL 5EJCA 3KX2A 1SVOA 4Y33A 1H2LA 1PZ9A 1IC8A 2K46A 3GJBA 2VKHA 1IDYA 5E8AA 3J81Z 4I02A 3UV9A 1MS9A 2PLV2 3WP3A 4JVAA 2YY1A 5FRMA 4Y24A 4XMIA 1S0GA 2ZPXA 4CEYC 2F5EA 5D1IA 3F8CA 1FBSA 3RI4A 2WZPP 3MN2A 3V8JA 1KDMA 1SLTA 3D0SA 5FYTA 2QDNA 4BQYA 3WNNA 2XUBA 3QLQA 3VYSB 3GHNA 2N8GA 2CAVA 3K48A 2HLEA 1Z7UA 3K4MA 4CEYB 1JGGA 4XN0A 4QPGC 4UAPA 4P02B 1QGLA 5DDGA 2ZTNA 5FZMA 3PHMA 2W3JA 5IYDJ 4FPKA 3IPVB 1V4RA 3T2QA 1VRH1 3OIPA 2WQZC 4A3CJ 1EKEA 2BU9A 1A5JA 3U2RA 2Y0SN 5FO5A 1P8JA 1B72A 2IW5A 3MKLA 1SFKA 4WVWA 3AKQA 1GV2A 1A04A 1AR63 1UYPA 4F83A 1FAYA 1HB2A 4B3AA 2DA5A 4M3CF 1X1AA 3PVNA 2X1EA 1RINA 1TNSA 3FX3A 2V9PA 1RXFA 1QXPA 5L3CA 4IHYA 2IS1A 5F5QA 4BDVB 4LE3A 5FPZA 2NMOA 3DCQA 2JWTA 3VHPA 1K83J 4MFEA 3CESA 3PTYA 3V56A 3ASIA 1R7JA 2XAUA 5F64A 4QPIB 5HLGA 3RKQA 2K3FA 4HPQA 3G4SI 2PHTA 1PZ8A 3KPHA 2WT1A 3A4CA 2TCTA 1WZ2A 4A41A 4LXLA 2X51A 2E2IJ 1EH8A 1YO8A 4ISRA 4B8XA 2HOAA 1O59A 2A5ZA 1IRZA 4AEDB 2XV4S 5IYBJ 3P1IA 4EN8B 4GULA 2GXGA 4P5YA 2UXNA 5EYXA 1S2EA 4PZJA 4FVVA 1DUXC 2H09A 1QY4A 1TP4A 5JLVA 2HFHA 2LF7A 1TQPA 4XBLA 2V09A 3DKWA 2BFUS 3VD4A 1TLHB 1X1CA 4YRDA 3RIRA 1VBA2 3RG0A 1VQ9I 2RAEA 3LWFA 3QD6A 3FDYA 5H9PA 2Y31A 5JR7B 4M9SA 3J8F2 1W28A 4UYBA 3PFIA 1NXMA 2VW1A 3KSCA 1RUC2 3LIGA 4UW3A 1VZ0A 4D7TA 1UIKA 2ZGOA 4WCGA 1FMD3 4BQWA 3N7MA 1GDTA 1D8KA 5FQ0A 1IV8A 2DMTA 1ZNPA 5DDJ3 4IEZA 5EEGA 5IOYA 3KYDB 4LKFA 5BOXA 1NXD1 3R6SA 1ZZBA 2YHJA 1KS5A 1LOFC 5F6KA 1LAJA 4AQ2A 1CVNA 1D4M3 1DGLA 5HBAA 3CDZB 1SFEA 2B9VA 1PUFB 5DAPA 2QQBA 5KHHA 1TC3C 4W97A 3E5UA 1VBD1 5EEAA 2XF7A 5H9QA 1V5EA 4GA9A 1U5ZA 3J8F1 5FWJA 2CFXA 1ND2B 3MW3A 3ACIA 2BPA2 1VLNA 2ERFA 1VBA1 2VTXA 4CDQA 2HJIA 1D0YA 4U2AA 4AAPA 4MUVA 3AL0B 1R36A 5IVCA 2R1BA 1OCRH 3QP6A 4XN3A 4GKXA 4S2FA 3RZJA 3JRAA 3NAPC 4RGUA 4KYWA 2BHZA 3RYRA 1F36A 3PVEA 1J3PA 1SQ4A 5C3SA 4BIOA 5FIXA 1O91A 3O7OA 1XSQA 2Z4FA 3UJOA 3T8TA 4CICA 5J4YA 2HKOA 1Y1WJ 2DFCA 2GA1A 1MS1A 1EAH3 2VD7A 5J1XA 1OLMA 2F5FA 2ZFWA 1HKQA 5FKBA 5JOXA 3HRTA 3VN4A 1JUSA 1L0OC 3NNFA 4R9DA 2ZGTA 4N43A 2FNPA 2ISYA 2VBWA 1SMTA 2VQHA 5FP7A 4AE2A 1OURA 2YU2A 2E26A 5DCMA 1OR7C 1DZRA 4OINF 3RI9A 3I3MA 4LK1F 2COBA 4MGKE 1XBFA 4BHCA 4J01A 2MA3A 4ZTJA 3MIFA 3U75A 4E7SA 3POBA 1WUVA 3BG6A 3CP8A 3R4UA 4HVQA 4BQOA 4XR6A 1C5HA 3WQ7A 2COMA 3WU1B 1YQCA 4M73A 4AI1A 1YO5C 4QHBA 1VMFA 3GYHX 5FK8A 1GR3A 3M3OA 2DT6A 2FDJA 4CZCA 3SEQA 4XLAA 3AKRA 4DMIA 3LAPA 1NQJA 4F93B 5A7NA 4XFHA 1U0JA 3DPTA 2Q2EB 2ZGNA 1DLCA 1TQ5A 2C1FA 3WZ1A 4DQAA 1WPKA 2ENRA 2V5YA 1BC8C 1SVLA 2RG4A 3WHCA 1PUFA 3RMYA 4LMFA 1R1A1 2VKVA 3T0AA 3ERMA 2OQ7A 1J59A 4FTSA 5FPBA 1P4XA 4JZRA 3DP7A 4LOCA 1R71A 5K0UA 5SV5A 5CBLA 1J0RA 4KMUX 1I3AA 2WTEA 4E27A 3FHNA 2HWF3 2VOWA 3OS2A 3WTYC 1J84A 3A21A 1CONA 3VBOB 5FRNA 3TBDA 2ZA9A 1D3YA 5IFTA 5FUNA 3N3HA 5EGOA 5IHRA 4IO9F 3C2HA 3BGAA 2JG8C 4U36A 5HCBA 3TBIA 3I3DA 5CKQA 5HS7A 3SQOA 4HG2A 2XDVA 2HWE1 2XHNA 3HOBA 4Q0VA 4GO1A 5CADA 1FOD2 1QHDA 1USSA 3CJQB 3DKQA 4PGHA 5FCCA 3SITA 4ZYGA 3ZQLA 3H1CA 4FPYA 2VUDA 2OKXA 3W2AA 2HWD1 4BLJA 3I59A 5FKMA 5JMOA 3NV3A 2YFZA 1T08B 2MEV2 2VNRA 1CF7A 1UYYA 4P1WA 1KFUL 1V6JA 1TW3A 2JDKA 1O4YA 2ZX4A 1N25A 5FDBA 3OUIA 2ATFA 3PIOF 5HLTA 3NVCA 2HWF2 2ESNA 5HI0A 2EFWA 3CJNA 1XPWA 1UY2A 4YIRX 4IV1B 3ZSJA 3OYDA 1W6MB 5FZCA 2DOAA 1EUTA 2RS33 4H2AA 2WT0A 3NNJA 5A7OA 4YW1A 5LEKA 3ENRA 4KITB 3N9MA 4PDWC 4CYCB 2XVLA 5AC93 3BPSA 3FUQA 4RS5C 3VL8A 3O1VA 3I2JA 3E7LA 4YVSA 2FBIA 2GALA 1JHHA 4ZZDA 4JQTA 5KHDA 4LIUA 5DAQA 4HN1A 1W2TA 3KQRA 2KP6A 2Y6GA 4A0XA 4BE1A 1WKYA 1JYNA 3CC7I 5JFRA 3A23A 2R7QA 2A70A 4OULA 4PCRA 4LO8A 4WM7B 3FXKA 1VBC1 1H8AC 1F31A 2RJLA 4XILA 2D40A 2IA0A 1V6IA 4IQPA 1NCRC 2P3YA 5FY5A 1AYN2 3BIWE 4DJAA 4LFUA 2XJQA 5IW0A 2D6OX 2FCUA 3C8XA 1WJDA 2HBTA 3KYCB 3IWZA 2RS11 1X1BA 4CDUA 2H94A 4MTEA 1ZM1A 3LQRA 2V26A 3PMEA 4NHJA 2ARAA 4K21A 5FZ3A 1P6RA 4YRVA 3V7RA 2L9RA 3BTAA 2D98A 2FF4A 2VL8A 2P6SA 1WMEA 2D1HA 2VGDA 2GXBA 3DYOA 1OA4A 2NOJB 2BERA 4DZPA 4DEQA 5DZGA 5EQUA 4ANJA 3UGGA 1UOJA 4N53A 4FOYA 5EZHA 3R61A 3ILNA 3VBHC 3QCWA 4NHXA 1OOPC 1QPMA 2PMUA 1OBNA 1AJOA 4EWAA 1FMD1 3HEIA 3R0AA 3JW4A 4JGZC 5ERLA 4PGGA 5DEQA 2WBKA 3OYBA 4GGGA 1W36C 2CGNA 5KNLA 2MPFA 1Y6IA 3R60A 2DCYA 4JHZA 2WSVA 1PJRA 4V2GA 4BQQA 2KDZA 1H89C 3LIHA 2E19A 3PJRA 3OSFA 4PBOA 1FX7A 2XJRA 2UWCA 4FOQA 3HDDA 1HXS2 5AIQA 2DUQA 2VNVA 3MF6A 5E1WA 3M8JA 2AC1A 4L9TA 3K10A 4YVWC 4OYUA 2XBO2 1YLLA 1CAXA 1AA7A 5HCHA 1ZZCA 4G4FA 2VBYA 2VB6A 1OKOA 1B8IA 3LMMA 2ZGSA 4CDXA 4NROA 3TL4X 5A6YA 1J3RA 3Q8BA 3FM3A 1KRIA 2NZ9A 1H8TA 3N97A 4AEJA 2L7ZA 1P7JA 2DMNA 4KWUA 4ZXEA 1D1CA 1R5ID 5FPUA 1VQKI 1MVQA 3W2VA 4B48A 2JDUA 2OW4A 1I1SA 3KETA 1WSUA 1HX6A 4QPOA 1U2WA 2LH9A 1QVUA 2XB6C 4LLLA 5L9RA 1OFSA 1MH4A 4QB1A 1OYYA 2XXZA 3FIWA 2LK2A 3VDDB 1PNFA 3OEAA 1MS0A 3J8F3 3TRSB 3N9LA 1US2A 2DCJA 1VBE1 2D3SA 1OPMA 2XB5A 1IRGA 3WGGA 3F9KA 1H9TA 4OHWA 4RQPA 1Z77A 4UBGA 1BOBA 3FBMA 2IP2A 4ZZ5A 3BB6A 4NB5A 1W2NA 5D6FA 5T5LA 1ZH5A 4RAFA 5B66C 1ND3A 1CESA 2D6LX 3TNQA 2VBDA 2FXAA 2M7BA 4A7YA 3SHRA 1IS4A 2YX7A 1UHMA 4KIFA 2E60A 2FDIA 1ENHA 3T5XA 3QODA 2JRTA 2OTJI 3G73A 1DP0A 1LVKA 3IAQA 4TWTA 1V9U1 3MLLA 3SQNA 1WWYA 1I27A 1K61A 2D6PA 1Z3XA 3N36A 4HOBA 1JUIA 1D0GA 3WNLA 3GTLJ 4RQPB 3CJTB 3A0KA 4DNCA 1V9U3 4XPVA 5H9RA 4DY3A 3RMXA 3AP9A 2X5IC 3DBHB 2YBKA 2OJED 5CFCB 3NW4A 1NY72 3KS7A 2YU1A 4XHBA 2HEOA 4HL0A 3CC4I 1GVJA 1W0TA 2WR9A 4E7IA 1SLCA 4RR3A 1UZ0A 2OVUA 1LPQA 3N9PA 3RZDJ 3M4FA 3HB9A 5E1ZB 3U14A 2DYCA 5F32A 3EPZA 3WTSC 2VJIA 3POJA 2ADDA 2JB4A 3OGJA 5ABJB 1H1IA 2ZSIB 2IEKA 3APBA 5L19A 2BDRA 2V1UA 1EV12 3GM8A 4M00A 3L7WA 5FZ7A 2EA7A 2N7GA 1MH3A 3ZMVA 1JKRC 2QUOA 5I0SA 1UZVA 2QQNA 2DPDA 4A3BJ 3AMHA 4A6EA 4UNOA 3GCWA 2HWC1 5BNPA 2VZTA 1WI3A 5FJKA 1ULCA 4XMAA 3ETPA 3OPZA 2B0LA 4KIGA 4M01A 2XASA 4JKKA 2F6BA 1I6HJ 3KD4A 3K4ZA 2JDHA 3ATGA 2C6SA 3WGHA 3HSEA 2P37A 5IVVA 2JA5J 3ZN1A 3VHOA 5BNOC 3PO2J 1DGRA 4AIDA 4NQWA 1S7OA 1SFPA 3B5LB 1BW6A 3D82A 3NNMA 2W46A 1WA6X 1Z6TA 1SAUA 2YDEA 2UWBA 5HPOA 1OMIA 5HS9A 2E63A 1FC3A 1MSEC 2A05A 1RUD2 2AR6A 5F3CA 3TNPB 2W1WA 5J8CA 3H5NA 5FPLA 3SXYA 2DVGA 1T6SA 2FJ1A 2Z33A 4Z8BA 4UFJA 4Y1VA 1B8IB 2FOKA 1DP7P 3JUUA 1OCTC 3M8EA 1YC61 5C4WC 3PLQA 2NVQJ 2RHPA 4AIKA 5EHDA 3Q5FA 3ZFGA 1KU9A 1E3OC 3R0JA 5F1RA 3MW2A 3NL1A 1PVC2 4BL0B 4Y13A 1WCMJ 1JZ2A 5T5OA 3WNPA 1ZBE2 2PHLA 2W9XA 1ZRIA 2NVTJ 2DPUA 2J7MA 1Y9GA 1HW1A 3KF5A 1ZZ9A 4GAZA 3RRDA 1MS5A 4BDYA 3VZKA 2EA2A 2CG4A 1LEBA 2Y0OA 5KBFA 3WTUC 4XIDA 2Q8DA 1ODNA 1W6QA 2NS8A 4OI2A 3PFYA 1LNSA 2DWRA 2LSOA 3WR0A 5L73A 4URTA 2NVYJ 2NP0A 3CMYA 1W5SA 4AQ6A 2CUZA 1UY4A 4ENMA 4HX7A 1RUF3 3NAUA 3WX5A 2KDOA 1FTTA 3RCOA 4XRSG 2E7WA 1GUUA 2R5YA 1MJBA 3RQ0A 5AC91 2RQQA 2YV8A 5EIYB 3O1SA 4FP3A 4DQ2A 1DU6A 1A36A 1QJEA 3IPVA 2JUCA 1UPIA 4A5MA 2K3PA 5DABA 5LY1A 1J9IA 1LHNA 5DZEA 2KRFA 5FZOA 3VBRC 1QJX3 4BJ6C 3AMNA 5L7OB 2EIMH 1IN7A 1YI7A 1F8VA 4XKVA 4NR1A 5A7PA 4SLIA 2RMU1 1AOYA 4G3YC 2L9LA 2C9KA 2L4MA 1GT0C 5TJJA 2VJ5A 4HNTA 3AAFA 4R4XA 1FNNA 2RMU3 2R071 2DBBA 3E97A 1S1AA 1E0EA 3B9CA 1STZA 4JKLA 1LESA 2K9QA 4KT6A 1S55A 3MKWB 5LGTA 4CU8A 2W7NA 1COV1 1URXA 1S0EA 1RETA 1IOAA 3VV1A 5C33A 2XGEA 1Z21A 1U8RA 1G8WA 1UG0A 1JH5A 3M1HA 1LKNA 3AB0A 3HOZJ 4XJWA 2W24A 4EJTA 3DL3A 2D5HA 2PAEA 5KAFC 3DPUA 1RUJ1 1CZVA 3RS6A 4FFHA 5F6LB 4B4CA 1WVRA 3KP3A 3M3IA 1YWKA 3CQOA 5C4JJ 1UOGA 2EV5A 4HQMA 1R1VA 2M0CA 4B1RA 4HLTA 3GLXA 4C0BA 1JBCA 3I58A 2ZJQF 1RRJA 2HNHA 3OOUA 4WVMA 3I3QA 4Q5SF 3SH3A 1F4HA 2YBPA 3C2GA 4JX4A 3ZYIB 4MZUA 1LR5A 4AFAA 1ZHFA 3D1NI 2CV6A 4R9AA 4C2UA 1G3SA 2XAHA 4G7HF 5F27A 4NIGA 1YTYA 3FN9A 3K4LA 2UZKA 4BK5A 3JBG3 2V72A 4JGYA 4LBOA 5T50A 4Q4Y3 2DA7A 5GZEA 1LGBA 2Z42A 2VQTA 4YIFA 2OQRA 1N47A 4A3MJ 2G1MA 1B35B 2G9FA 4ATEA 2KRCA 1SLIA 1V5FA 3TP3A 4AEDA 1AU7A 1X33A 3KZ4C 1ERDA 5JCTA 4XDQA 1W5CC 3OSGA 3HOTA 3Q0WA 2EF6A 3GW2A 4UOJA 3S57A 4RD7A 3QOPA 4LKEA 3THTA 4AQSA 3BU0A 4CEWB 4E6KG 2VTFA 4WM7C 1DLLA 3LSEA 3WG2A 3VKOA 2VC9A 4IE0A 2WQ8A 4CCDA 2Y6LA 3FXOA 5FPXA 3SCFA 4HFSA 5FZOB 3DXJF 2XRNA 2WC2A 2XROA 3NAPB 3MD2A 1EV7A 5IVEA 2Y38A 4AUXA 3U4SA 3DYPA 2Y69H 1MDMA 4PFOA 2GXAA 2BY0A 4IEOA 1ZRCA 2O1QA 2UXXA 1R49A 1QNTA 2BW8A 4CYDA 4QHZA 1MS4A 1AYM3 1JN2P 2W48A 5B3SH 2WLQA 3KGZA 5FLHA 3TO7A 4IXAA 4BLIA 5J1YA 5F37A 4CHUA 1OKRA 4IGQA 1RMU2 4UV9A 3PNYA 2DXIA 1O57A 2EFNA 2G7UA 1F5FA 3J7YJ 1IG0A 3OB8A 5DZFA 4KMQA 2X48A 1Z05A 2V6EA 1BR1A 2WNUC 3TQNA 3NJZA 3BDDA 4OZOA 2ZABA 2Y30A 5FQ0B 4NMIA 5LHGA 1ND2A 3HSRA 2JE9A 2ZKNA 3AZXA 4BB3A 4CUGA 4IV3A 4L2NA 3EHKA 5HXMA 3KEQA 1AX1A 2P34A 3W5NA 3L2YA 5BYNA 3WHBA 3G7DA 1XQNA 1VPHA 3CDHA 2V1NA 1YX5A 1SANA 5GLTA 4ATFA 1NA1A 4KN4X 1UCXA 5F2SA 2P3IA 4Q4Y1 2DJIA 2C6YA 2ECBA 4IXLA 5LHHA 1DIWA 1GFF2 1EH6A 2J5OA 5FXWA 4HOOA 3SKVA 4O5VA 2QQAA 2WNVA 2O8XA 2R7TA 3UKNA 4PHZA 3WF2A 4UUSB 1PK6B 3ZVXA 2RM22 4HDVA 2H6CA 2ZJPF 1AR73 2P6HA 5FKCA 4NO4A 3D5RC 2O7OA 4NBQA 5IOZA 1AHSA 3ABLH 1SPPA 4I09A 2E5NA 1PMHX 5IT9K 2XPVA 3FLRA 5CEHA 4OQ9A 3HXLA 2XAFA 2BW3B 1C5IA 1XNBA 1IF1A 3HHHA 2A07F 2K02A 3AFKA 5IP9J 5HV4A 2PFBA 4WK8F 1J7KA 2VMCA 1FNYA 3S6PA 4PIYA 2NPIA 5BNGA 2XVCA 2DCEA 5JXHA 2VXRA 1MS8A 5D6EA 1RYYA 2HYJA 2R7FA 4META 2Z5UA 1WMXA 2OAZA 4AWDA 1VBE3 3ABMH 2RGVA 4DXZA 3QH7A 1D4VB 1XJAA 3AYCA 4KWLA 1OT5A 2L3DA 2JDYA 1V3FA 3GGLA 3VBOC 1BC7C 2CQXA 3SH5A 4GMP3 5FBZA 1IN8A 4YSFA 2ET1A 4OQ8A 4ORFA 2Y60A 3U10A 3ZMDA 3Q9OA 5T5PA 3P3PA 1DQ2A 1X7NA 3CQZJ 4XIKA 4IGOA 1XRUA 4XSZF 2VC1A 5LATA 3VBUB 2JE7A 1MJ9A 1OCOH 3C3WA 3BZ6A 4LK0F 3F8FA 2R7VA 5D8AB 4DPNA 2A3WA 2IGKA 1CR7A 4X0GA 2ZAAA 4PJJA 4IF4A 3H1YA 1MEC3 3TEWA 2F4OB 4GCVA 1IPKA 1U5XA 1Z67A 3WOGA 1OC1A 4NQWB 1ON1A 2R49A 1D2SA 1NG0A 1AXYA 4DBQA 5BQTA 3ZGKA 2ZX2A 2OV7A 4XKCA 5A32B 3TKYA 2ZEWA 2JICA 4XCBA 3B7MA 1JXSA 5GKAC 1COV3 4YWAA 2DUPA 2AENA 2VMGA 3BPXA 4M6VA 2MFZA 2Y75A 1QOSA 1WW7A 2WNUB 3PL0A 4RS5B 4AFBA 5K5OA 4UB8C 4II3A 2B7YA 2Y0IA 3FKJA 3PIPF 4QU1A 1MGTA 1DQUA 3U11A 2NS0A 4RB3C 1Q43A 4BQ2A 2NAZA 3DXUA 3DV8A 2RVCA 3FHZA 3F2ZA 1ENRA 5J96B 4XLPF 4XM3A 4WV8A 2K9SA 4XOTA 3PVOA 3I55I 5EJ1B 5C8CC 2RN7A 5JPMB 3CP2A 4ZYEA 1CAVB 2F4IA 1DGWX 1LTEA 5JVGF 4X1EA 3M7GA 2ZXWH 1Y56A 3GZUC 5FOJB 4K1ZA 4BQAA 5CVUA 2PX9A 4IEJA 1YQ6A 3OGVA 2G9ZA 4C2MJ 4LUKA 2WFPA 1WLWA 2RV9A 1BEV1 2WA4A 5I91A 3WLUA 3WDTA 3EUHC 5TGTA 2E2HJ 3LFUA 2HVRA 1VF9A 1R091 1RUI1 3C2BA 3CLOA 4IV1A 3PUSA 5ILSA 4A3JJ 3BU7A 2A1XA 1YCIA 4KG0A 1ZZ6A 3JSOA 1NQDA 2O8KA 2OZ6A 2R0HA 3BROA 3GTGJ 1HQWA 4XJ8A 3OL3A 4YVSC 5DDJ1 1PMIA 3PVBB 2AHQA 1N1TA 3NNGA 2A71A 5ACA3 1VBC3 1SLAA 2KJBA 3CCRI 2WFF1 4YGDA 2P7CB 3ZMSA 5EV7A 2B63J 4NIAA 1W4MA 3GLLA 2H8RA 1HQLA 3BG7A 1AR83 5E3OA 1JYVA 2YXSA 3E3VA 2O0OA 2PELA 4BJ0A 1E5HA 5JOWA 4KJZA 2WWYA 3HT2A 2BVMA 1LOAA 1W9SA 4I0WB 3JTGA 3HZJA 3AG2H 3CO7C 1HKSA 2IS4A 3ZKYA 1O3SA 3ZPOA 3ML6A 1AL23 3OR2C 2GN3A 1FIPA 1AR92 1VP6A 2RM21 3KT4A 5CYYA 3BOWA 2E36A 4OI4A 3HNYM 2CO5A 1HRV2 3VBSC 3VB9A 4EN6B 5JIUA 5BS6A 3ZOBA 2VODA 1RI7A 1OI6A 2DTWA 1RUJ3 2IAIA 1RESA 3ZFGC 4ET7A 1OKQA 1KDKA 4CDGA 1YFUA 2L2OA 1K5MB 4XSXF 2DU1A 4LR4A 4QPIA 1DG6A 2HWD3 4O6JA 4XLEA 3G71I 5K9YA 4B4PA 4FPLA 3Q3SA 1H8VA 4I2OA 2BUKA 3ZSMA 4JX5A 4K6BA 3OS0A 5JI7A 1Q1HA 3LQQA 1LRHA 1CPNA 2BGCA 4IE4A 3M7AA 3BG9A 1CQTA 2QKLB 4NHKA 2I2SA 4M72A 2R042 1IDZA 3FKIJ 3O1MA 4MV2A 1ULPA 1D0ZA 1W6PA 5J37A 3JBG1 3KP4A 5ICGA 4A3DJ 4R52A 1SD5A 2DOFA 5JI6A 1IRXA 1BK1A 2VJJA 2FX0A 3VBSB 4DUXA 2RS51 1P4WA 4JX0A 2ILMA 1KQ8A 3EQLF 3E6CC 2Y6KA 4E4ZA 4QKFA 4LK6A 4N9IA 3LSIA 4QDRA 3RKYA 1GXQA 3W6KB 1QQP2 4P9XA 5B1AH 5CNAA 2IJLA 2QSFX 5A3WA 3SKJE 5LBFA 1JS9A 3M8LA 3H9AA 3JSPA 1NA1C 3ACHA 3ABUA 3V42A 4LEJA 1ZX5A 2W87A 3PJYA 5JPNB 4DUWA 3SNMA 4BQXA 3GZTB 1ETQA 1XD7A 4Q4W2 2GNTA 2XAQA 2VY0A 3ZXLA 2XONA 2JIGA 4HLYA 1ETWA 1JKQC 3S1NJ 1V70A 2A68F 4H7MA 2FHRA 3D8CA 2JECA 2K9MA 2E1MB 5JR3A 2YYOA 1N1VA 2ZX3A 4DZGA 2ZGKA 1AUYA 3U4XA 3LEIA 3ZP5A 3LEMA 3C7EA 1XGSA 3OOXA 2V6CA 2VNOA 2VVDA 4L11A 5CG9A 4PT6A 1WW4A 5FROA 3S16J 2D5FA 4KNYA 3AKTA 5FREA 4P9GA 3RZZA 2FEZA 3UKGA 3U37A 1WMFA 3RSNA 2EZKA 2LTPA 4XYXA 5LA1A 1WI9A 1DDLA 1RUF2 2X9DA 3DEUA 3TW7A 2RS13 3UK9A 3DXTA 5E1RA 2Q8OA 3T1BA 3DKXA 2XC7A 4HBNA 5IATA 1YS6A 4L0PA 3W21A 2PMZN 3T0YA 4CP9A 1YFYA 2O5RA 5KHIA 3F23A 3WVJA 4XDOA 4XQWA 3BG3A 4BE0A 5FPAA 5FRAA 1RTVA 3FMQA 1UG2A 3BKZA 4M4RA 2J5PA 1AYN3 3TW6A 4D7YA 2VZPA 4XDPA 2WINB 4QQ2A 5H6RA 3ZX7A 1NX9A 1LDJA 4D9JA 1H9GA 2GU9A 5JSOA 2EIKH 3HKZA 1COV2 4C1WA 3IIIA 4DY5A 2J1RA 3MW4A 1C1FA 2YB7A 3BJ6A 1QXJA 3S7EA 1HC8A 2FBEA 2STTA 2GC1A 3S5QA 1BA5A 2D1VA 1QU0A 1YJKA 4RA0A 4PLOA 4AYUA 2BY2A 3LFIA 3GFIA 1XGNA 1U3EM 2HTSA 3IP4B 3ZMOA 4RB0A 5FFZA 2DA2A 1ORKA 2CQ7A 4K20A 1RB8G 3U9GA 1R4NB 3K1NA 4D8MA 2NXNB 1M1EB 3IN9A 4EV0A 3VKFC 2R7UA 3WG7H 2GP3A 2BY3A 2BWAA 1OQEA 4QB2A 4E2SA 3QOEA 1TNRA 4OHVA 4QHOA 3I3LA 2ZXJA 2YPJA 5FY1A 2R7RA 1YNAA 2EICA 3HRUA 3BWGA 3D5SC 3GXUA 5C3PA 2HDWA 2X6OA 2DMUA 2VBPA 2VT2A 3IDBB 2MSYA 2X53S 4C90A 3H3VK 4R9CA 1SEFA 2B45X 2QKMB 2O0YA 4UF0B 2IPQX 1QXRA 3KV5A 1Q8PA 3A0HC 2PHDA 4BBSJ 4GXLA 4XF1A 4X6AJ 4P9IA 2V1DA 2XQXA 4LOTA 4FASD 2HYGD 2GAUA 2ME0A 4KUMA 1RUG1 5CZKA 2X05A 2R062 2Q8EA 3FHIB 2GM4A 4XABA 4XFGA 1KJLA 2VKDA 2K9NA 3OBRA 2VW0A 1LGNA 2LG4A 3W20A 2TEPA 1UHSA 2RC4A 4GWMA 3DUIA 1ACCA 1F2NA 2WZEA 3IDEA 4I98B 2MC4A 2BY1A 1CQ9A 3IB3A 3IZOA 3KHCA 4V19K 1B6AA 1N78A 2GNDA 3KGLA 4D6QA 5D8AA 1O3RA 3HN3A 1S29A 1BN5A 3POYA 1EH7A 5FBJA 4NUBA 4AI8A 3JAMK