4I0AA

Structure of the mutant catabolite gene activator protein v132a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKAGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0aA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0aA01
3FM5A 1G6NA 4OMZA 3CLPA 2H27A 1U5TC 4UHTA 2V1XA 4G7OF 2EVXA 2G9WA 2CFXA 3I7DA 4LUMA 2D5FA 1QGPA 2ESHA 2HYGD 3K1MA 1U5TB 3RI4A 1SFUA 4WXHA 2F5DA 3LA3A 1T2KA 2L4MA 5JI6A 4L18B 2L4AA 2DAOA 3HTUA 2QQAA 3E5UA 2GZWA 3GFLA 4DINB 3SCHA 3WE3A 4BIFA 2XV4S 3C3VA 4YFXF 5EEHA 2MLKA 2EA7A 5L3CA 4WZCA 5E16A 2E1NA 4UNOA 1FI2A 2NS0A 4EVIA 1RC6A 3PFIA 3DV8A 3E6DA 5BPXA 5JCTA 4FHTA 3M7GA 2DK8A 4RB1A 5L3FA 1ZN2A 1YHFA 2XVCA 1V4RA 4GYGA 2GC0A 4HSJA 4Q0PA 1RL3A 3CF6E 4G7ZF 4HV6A 2Y75A 4UVAA 2D1VA 4A12A 3HSRA 3RYPA 2EJRA 2IXCA 3LA7A 5BXXA 1JGSA 3JTGA 3I59B 5FPXA 1LR5A 5LHGA 3Q9VA 2NYXA 4R79A 3D5LA 3H7YA 3M1EA 2OPKA 5K5OA 2KIUA 4KDPA 1WWXA 3C18A 2Q8KA 3BPXA 4ZZDA 4E70A 2PFBA 5FD6A 2GQQA 3E5QA 3UKNA 4EJUA 4XFHA 5KHGA 2H6CA 4KMUX 4K2EA 1DGRA 2VC1A 1J1LA 2D2WA 2GH2A 1UHMA 1R1VA 2R7DA 4MHGA 2HKOA 1JHHA 1K79A 1ZRDA 1FY7A 4FX0A 4PGGA 2VBZA 2XAQA 3CO6C 2LKPA 4N9HA 2B8MA 5E18F 2PAKA 2WC2A 4IXAA 4M74A 3ZDSA 4P9UA 2XUBA 5J7MA 1STZA 4EMSA 1ONVA 3BP8A 3U1DA 1G3SA 2L3DA 4E2SA 5ILVA 2BNOA 4BQAA 2PTMA 4RGRA 2W84A 2EWNA 4CGZA 1XSDA 4MNUA 3GX4X 1LEBA 4UVCA 2KIMA 3DKWA 3BPZA 1WI9A 2QM3A 1FSEA 3QU6A 2DI3A 2V79A 1F5TA 2M5WA 4XFBA 4MUVA 1RZ4A 3J80K 2V1UA 1K78B 4ZU5A 3FMSA 4JBAA 3C3WA 2A69F 1QY4A 4MQ9F 3PQKA 4IRGA 4L0ZB 3KEOA 1A04A 3IWFA 3H1MA 1O5LA 2XKOA 3CUOA 2HOEA 2E7XA 2VT3A 4FBFA 2ZKLA 1U5TA 1OFNA 4AIJA 2FSWA 4MGIE 4UVBA 4YIFA 3ZMZA 3RKXA 1PDNC 2MC3A 2GWRA 4A0YA 3RJPA 1NE4A 4KL1A 1QNTA 1SFNA 2VN2A 2MLGA 2XLGA 3V4GA 2QBYA 1KU9A 1D8JA 5FPZA 4KIBA 3ZMSA 1UIKA 4M73A 1BC7C 1R58A 2CGPA 4EROA 5E20A 4PDKA 5AIPA 1Y9QA 3G7DA 1HW1A 2QCSB 4ONUA 4XFAA 2QZ8A 2ZCWA 3ES4A 1WSUA 3WW4A 4ASNA 2GC3A 2RGVA 1K7AA 5I8TA 1BOAA 3KP7A 4XLNF 1H1IA 2EV5A 1X8MA 1T39A 3ECOA 3QACA 1IZ1A 2A6EF 4MH0E 5J48A 1RUOA 4D7TA 3P9CA 1ZZ9A 4LA3A 2IVMA 5K5QA 5D5UB 5BPDA 3KLOA 4M9XA 1YW9A 3ISPA 5I0SA 1YFYA 3EO6A 2ZKZA 3JAMZ 3HIFA 5FLXK 4FAHA 5AONA 2ET1A 2ISZA 1KQ0A 1LVAA 3CDHA 3V8LA 1JUHA 4LD5A 3NJZA 5HS8A 3FXQA 1LRHA 2K02A 4RAZA 3SCFA 2IP2A 3U9GA 3BCWA 3SZPA 2NAZA 3TDZC 2IPQX 2P8TA 1TW2A 3HTSB 4YRDA 2L02A 2DLLA 1NE6A 2FMLA 5DCFA 5FGMA 3HSEA 3I59A 4LLGF 5IT3A 2XAJA 4ENJA 3E6BA 4Y15A 1XB4A 1XD7A 3LQRA 1DZRA 1S8NA 5LHHA 3L7WA 2LF8A 4S05A 2ACJA 4MX3A 3JAMK 4XEZA 1Y0UA 5DCMA 3IIAA 4U7DA 2PAEA 4QGNA 2VT2A 4M71A 2ZNYA 1CAVA 5K8SA 1PUEE 3JW4A 3ES1A 1W7PD 1J3RA 1ZZCA 4HAMA 4TLFA 1XCBA 2Z3YA 4XBFA 1XGMA 2IA0A 3BWGA 1KYWA 2QDRA 2NRAC 3CUQC 1TQ5A 1KU2A 1Z9CA 4XFGA 2XASA 4KU8A 1FBQA 5HDGA 2HQRA 3NQOA 3EUHA 4YG2F 3JZVA 4MGKE 4QX5A 2KIFA 2OU2A 4CYDA 3CUQB 4L5JA 2KXLA 1VR3A 4META 3FXRA 1CAUA 5H20A 2VONA 5C6CA 4ZU7A 1P92A 3GO5A 1NHAA 3TOAA 2M45A 2LF7A 4YARA 3F8MA 3EYIA 1B59A 2IRFG 1GQGA 4RGSA 4OIPF 4ENMA 3SXWA 3RKWA 4AD9A 2DT5A 1FWZA 3GEZA 3I64A 5JHUA 2MH9A 3SFZA 2O03A 2PBIA 1EH8A 4Q0UA 2GA2A 1KA8A 2IA2A 3BZ6A 3KSCA 1CX4A 1D3YA 3TO9A 2W25A 1GVJA 1X8EA 5I8YA 1HKQA 3BALA 1TNTA 4HVQA 4P9GA 4IEXA 4PJYA 4U88A 3WTZA 4EJVA 1P2FA 1FXZA 5FLHA 1FNNA 3ZPLA 1LDJA 3KFWX 2ATFA 4MTEA 1BIBA 3KP5A 3R60A 4Q0QA 4PIZA 2GC1A 4EQQA 4KWJA 4XFIA 2FBHA 3TKYA 2H09A 1UCRA 1FZPB 4BHPA 3GLXA 1J0RA 5IT9Z 2WTEA 4BAYA 4O9EA 3FM3A 3H92A 1ULYA 5D1IA 2JT1A 4AQ2A 1WLTA 4KWLA 1PMIA 4HF0A 3ROUA 5CU1A 5L3EA 2GXGA 4OINF 4M9ZA 1Q5OA 2P7VB 2HKXA 1UW8A 2OZUA 1U78A 2M87A 2FNAA 2CG4A 2H94A 4PIXA 1UB9A 3ACLA 2ZMEA 3E6CC 3D0SA 4BNCA 3CEWA 3WTYC 2ZXJA 3CO2A 3KEQA 3OCPA 1R5GA 3IWZA 3H9AA 1DPUA 2RVCA 4FT8A 1B9MA 2YR2A 1LJ9A 2I45A 3ABTA 4XF9A 2ZO4A 2HZTA 3WGGA 3BU7A 2V9VA 2M30A 3T1BA 1J3PA 1BIAA 2K4JA 3H8UA 3EDPA 4HVOA 5KHHA 4AWXB 3SCGA 2UXNA 3WODF 2FXAA 4LG0B 1MGTA 3Q9SA 1ZGJA 4ZZLA 5LGNA 4KIGA 1G3WA 4WXCA 2BNMA 3F6VA 3QRFF 1IRGA 3FX3A 3IRQA 3MFKA 2PHLA 2C6YA 1J58A 3FJSA 4F7ZA 1B1BA 1BC8C 4GXOA 1D8KA 4S04A 2CAUA 2PEXA 1SD4A 4LB6B 3P7NA 2JRTA 3WW2A 3WE2A 1ZAOA 4OOIA 1UCXA 3SHFA 4N0BA 4IEPA 2JZYA 1ZREA 3L9FA 1IN4A 1W5SA 3BB6A 2VPVA 2MH2A 4AVAA 4R1HA 2ETEA 4EV0A 3WGHA 4GCVA 3RPUA 2Y0OA 4KYWA 3ZMDA 1ZZ6A 2OQRA 5LRSA 1FOKA 3L09A 1UFMA 2DQRA 4U0VA 1JHFA 4HW0A 1J3QA 2A68F 2QYOA 3W6JB 4ZYGA 3W6KB 1O3RA 3AAFA 1R5HA 2RQPA 3CJXA 5DCMB 2PYTA 1E2XA 3C7JA 2BV6A 1HXDA 4O9GA 2J5PA 2FRHA 4HZFA 3LWCA 2FE3A 1ZLJA 2VBWA 1FPQA 4LEJA 3RYKA 4EM0B 5LBQA 2FMYA 4LLNA 3MZYA 5LRRA 1RTVA 1FYLA 3CL1A 1R22A 4DQ2A 4A2UA 4Y17A 3WU1B 2VOPA 2XAGA 4L11A 2VOOA 1ZG5A 3KMHA 4AVPA 2A5YB 4AIKA 4A5MA 2FU4A 3O2PE 4PZJA 4E2GA 2A07F 1YIOA 4RB0A 1YFHA 1CAWB 2FQPA 4LA2A 1ZRRA 2M8EA 1VTNC 5ED4A 3NVCA 3IKTA 2NNYA 1W4MA 1LDDA 2YX7A 3DPLC 2A61A 3D82A 2OZ6A 1WGPA 2L54A 3JTHA 4JQFA 1O3TA 4JVAA 2VE9A 4HN0A 4LK1F 4HX4A 1PM7A 1XSVA 1QO0D 3H7JA 3ZMUA 3BROA 4IF4A 2D40A 3J81Z 5DV5A 1MJ9A 2BBYA 1F4KA 3LFKA 4Z82A 1GXQA 2K27A 1USSA 3BY6A 2MBFA 2KKOA 1YS7A 5DYMA 2ZJ2A 5E8IA 2P7CB 3F8FA 2D45A 3ZP5A 2OA4A 4KFCA 4AQ6A 4MTDA 3HRUA 2B5HA 1JE8A 2PN6A 2OD5A 3UKVA 4L9VA 3PVBB 4Q29A 1V70A 3QPTA 2D5HA 4IEVA 1SFEA 2EB7A 1BN5A 3ECHA 1I5ZA 1O57A 2B0LA 1YS6A 4M72A 4HMZA 5I0TA 2WWYA 2CQKA 4J1XA 1J5YA 4HN1A 2UYBA 4GYIA 3ZN0A 3ZN1A 3F23A 3WTUC 2CAVA 3LA2A 1IXCA 3F6OA 3TNPB 1QQIA 2DW4A 5DD4A 2IXHA 1ZYRF 3BJOA 3GZ5A 1NXMA 2L01A 4R52A 3RYRA 2IW5A 3U11A 1FYKA 1K78A 3TO7A 3OF1A 2COMA 4AXOA 5BMZA 1IPJA 5JR7B 5L3DA 1OKRA 1ZRFA 4HX8A 2MHFA 4XF0A 5ICFA 2VBYA 5L3BA 4BYYA 3SMHA 5JSPA 3DPTA 2JPCA 2JSCA 2O8QA 3M70A 1YO5C 2WV0A 3ZQ7A 1LEAA 3GYDA 1ZVFA 1X3UA 5CVRA 3GXOA 3MQ0A 1XRUA 3PQJA 2STTA 2VC0A 1MJBA 2GXBA 5CVUA 3USSA 3MWMA 2GAUA 2K0GA 1T0FA 1VJ2A 3FMRA 2Y0MA 1LB2A 1KU7A 4NHJA 4D0PA 1IN8A 3FXUA 1BM9A 3N4MA 2MNGA 5BUVA 1Z1DA 1YTYA 2W85A 2DCTA 4YFNF 2EA4A 4QLCU 3QOPA 2DTRA 1ZZ7A 2FQ3A 5FFXA 2CW0F 4IRHA 1HQCA 2DK5A 2OZJA 3I53A 3H1YA 1F9NA 4UXNA 4I02A 1XMAA 4A6EA 3FHIB 5E1WA 1LQ1A 2CSOA 1ZZBA 1YLFA 1T98A 1RI7A 1B4AA 3CJNA 2RDPA 2EFOA 4OIQF 1P4XA 4YFKF 5FDBA 1VP6A 4UBHA 1OR7A 3FFQA 5E1ZB 3TDUC 3FMQA 4M9SA 2O0YA 2ET7A 4YIIA 1HKSA 2WFPA 5LEJA 2VECA 4QM8A 3CTAA 4G94A 1V3FA 3DFGA 2RC4A 5JR3A 2QQ9A 1KGSA 1U6GA 1ZGAA 5E1RA 2G7UA 4LULA 3QP5A 1ZNPA 1XMKA 4ZYHA 4IPAA 1XE8A 1ZH5A 1CAWA 2VQAA 2M1BA 3OD0A 2EV0A 2V09A 2KJBA 3IC7A 3WGIA 3HHGA 2IXJA 3LAJA 2XIGA 4IEQA 5A2QZ 4KA4A 1FLIA 5DUKA 4KNYA 2ELHA 5F64A 1TQMA 3RDIA 2EA2A 3RPQA 2IXKA 2PAMA 4B09A 3NEUA 2DPUA 2K7LA 1I27A 1O7FA 5IT9K 4HQMA 4D7SA 4LGWA 1IF1A 5HLIA 5FLJA 1Z6RA 5I91A 1I1GA 1IW7F 1QXJA 5AVPA 1KYZA 3ETQA 4WX9A 1SD7A 3KE2A 4P96A 2VE8A 1DUXC 4IEWA 2ZBKA 5KVRA 1Z7UA 4AVBA 1XN7A 2FOKA 3RKYA 1IUYA 2Q30A 4LB5A 1WKMA 2HTSA 5ICEA 1QXRA 1HSTA 2FBKA 2GIVA 4KT5C 2O1QA 3I71A 5T3NA 4MGZE 2GC2A 4QMAA 2XL9A 5FFZA 1Z91A 3KP4A 2A3SA 4I01A 4FX4A 2P5LC 2O61A 1ZHFA 2QVOA 3H1WA 3U2RA 2XLAA 4HQEA 3F22A 3HUGA 4LG0A 4X6RB 3E97A 1IRFA 1KQ8A 3UKTA 1GXPA 2MPFA 3P9IA 3GUDA 4HF1A 4OIRF 1E17A 4ENNA 4L9TA 1OYIA 3KLNA 3C1DA 2Z99A 4U7BA 2TDXA 4HLTA 4QWQA 5BV6A 3JSPA 4ORFA 4MZUA 1J2XA 4I09A 4MGRA 1W7PB 3TOBA 4HVRA 1B9NA 4KMFA 1J9IA 4U0WA 4I2OA 4JTNA 3N97A 1L3JA 2UYAA 4A6DA 4I7HA 1EH6A 2UY9A 2MA3A 4PIYA 5D8KB 3EQEA 5E1XA 1OD5A 4KUMA 2PJPA 4IEUA 5ICCA 1LKNA 4BHCA 1F1ZA 3B73A 3VFZA 1D5VA 5LEKA 4EJTA 1RIOH 2GA1A 2BE5F 5D4RA 2J5OA 2PA7A 5EZWA 2W57A 3R0JA 2ZNZA 4Q0VA 4KN7X 3FE5A 4PCQA 3KP6A 4OIOF 2LSOA 4WK8F 2FF4A 4OMYA 5D5XB 3KZZA 3QAHA 5J8CA 4KN4X 3BJAA 1BI3A 4L5IA 3HQXA 2DU9A 4IVNA 4JV4A 2JTVA 1T38A 2KRFA 4CXFA 2Z9OA 3M3IA 5CJ9A 3OGJA 4YYOA 2XAFA 5FB2A 1MDMB 4Y13A 2RV8A 4ETSA 4NQWA 3EJKA 1EH7A 4UBGA 5HLHA 2O6GE 4Q0SA 2EV6A 2ETHA 3MZHA 1TNSA 3DEUA 1Z6TA 3O3KA 4B29A 4K8FA 1H1MA 2ISYA 4M6YA 2Z5UA 2JPBA 1DZTA 4ZU4A 3GW2A 4WVZA 5KK1A 3M9AA 3WW3A 3FF5A 4IESA 1FC3A 4AVCA 4BXUA 1FP2A 3HYIA 1SQ4A 5CLSA 1Y3TA 1RUNA 5ICGA 3VHRA 3IKVA 1HW5A 2HR3A 3O14A 5FQ0A 1CAUB 3IRRA 1MZBA 1GHCA 4WBBA 1MDMA 3J81K 4G9YA 4IEZA 3LSTA 1ZX5A 2LNBA 4JK1X 2EFQA 1REPC 4CICA 5BQTA 2D1HA 1DGWA 3GYHX 2DBBA 3DN7A 4RGXA 2AS5F 1YYVA 2XKPA 3MEXA 5I0UA 3COAC 1YW7A 4HF2A 1HBXG 4L9JA 5C8WA 3GFMA 4MQVA 1UPIA 1PP8F 5BY5A 4BH9A 1OMIA 2HWVA 4A0XA 1ZRCA 4IHSA 3K1NA 1Q1HA 4XSZF 2DFIA 5D5VB 5D5WB 3L2CA 1YFUA 3V7CA 3FZVA 4A5NA 3M8EA 3KGZA 5JSRA 3REOA 1H9TA 1FBSA 4WCGA 4L2NA 2R3SA 3CLOA 1TW3A 1HW2A 2O3FA 2OBPA 3R6SA 3MAJA 4O3MA 2F5FA 2G7HA 3R4KA 4KU7A 4HSLA 4XFFA 3SXYA 2P6TA 5JSOA 1PP7U 1B6AA 4Q4ZF 4EM1A 1EY2A 5L3GA 2LDUA 1RGSA 4R8HA 1UHWA 1W5TA 3IBMA 4OU0A 2Q0AA 1WQ2A 2PLYA 1R36A 3KP2A 4RD7A 5CADA 4ZYEA 5KHKA 2STWA 1MKMA 2HDCA 5KHJA 5DEQA 4EGZA 3KETA 2RN7A 3DP7A 1BBYA 5BS6A 2X0LA 2C0ZA 4IHTA 3ML6A 3S0MA 1Q43A 3K0LA 4XFCA 1CAXA 2ESNA 2QQBA 4AIHA 5F1RA 3DXJF 4LUKA 1XDSA 3F3XA 5K5RA 5BOXA 1AWCA 3BDDA 1ZARA 1YG2A 2IT0A 2P6SA 2ZFWA 3GFJA 1JXSA 3Q5FA 2Z69A 2XGXA 2Z2SB 3SQNA 3WG9A 1CGPA 1ODDA 1T6SA 5EEGA 4XF3A 3T8TA 5HLGA 1S7AA 3ZMTA 1KU3A 2VXZA 2FEZA 4WXDA 3E3VA 3VB2A 1OI6A 5J8FA 2XAHA 2VODA 4HBLA 3HT2A 3HHHA 1YUDA 4HOBA 2FNPA 4EJWA 1YQAA 5I93A 4CZZA 3V7SA 5D8LB 1QBJA 2HJIA 4A0ZA 4ZYDA 1XE7A 3QP6A 2OA2A 2XL7A 1FBUA 2RNJA 1UD1A 1BI2A 5ERIA 1TQPA 5H6QA 1R7JA 1K6OA 3KZYA 1J75A 4N9IA 3HT1A 3L2HA 4G7HF 4ZH4F 5DUIA 4XSXF 4UUVA 1EV7A 3LAGA 1S3JA 1EYBA 1P6RA 3ERED 4U0YA 4JTOA 3B02A 3E6MA 2IXIA 1R00A 4HX7A 5CVIA 4WF2A 2PHDA 1S7OA 4RB3C 3IDBB 4EJOA 5JAXA 3M8FA 2P5VA 5D6EA 1CF7B 2H6BA 2OQGA 5LGTA 3IL2A 4QXKA 4E2QA 5I8SA 5FD5A 1CF7A 3PNAA 1O4TA 1SMYF 3ELKA 2A6HF 3DF8A 3CO7C 2CWEA 2Q2EA 3I0TA 3WW1A 3G3ZA 5EFUA 2K86A 1YW8A 3MPBA 2YPRA 3I5UA 1EP0A 2VBXA 3HRTA 1ZZ8A 2QJVA 3K1PA 1FYMA 3NL1A 1IN5A 1QZZA 2QENA 2EFWA 4LK0F 5DDGA 1XGNA 4LFUA 4KIFA 4GGGA 2RKHA 4H0EA 3ST7A 3E5XA 3WU0A 2HTJA 5J6XA 3MDPA 1EPZA 2R7FA 1ZLKA 4B8XA 1LNWA 4XF4A 2E9QA 2NNNA 3I54A 1LDKB 2Y48A 4Q48A 4EWAA 3F8BA 5FCCA 4HV5A 1YWKA 1IXSB 2YSRA 4P5OA 2DPDA 4TV7A 3SZTA 3ULQB 4HLYA 2Q0OA 3S2WA 5LHIA 1FSHA 4CO8A 1G3YA 2O8XA 1BI0A 4GULA 3TNQA 3OOPA 2YX4A 4MEYF 5E8GA 4Z07A 3RIRA 2CYYA 1NZCA 2IC1A 1O3SA 1QWRA 1HSJA 2AXLA 4X6QB 1YFXA 2CO5A 4G6DA 3LAPA 2QNKA 1O3QA 4G8XA 2UWMA 1H0MA 3F8NA 1TQIA 1TTYA 2BGCA 3WTSC 1GQHA 4I3PA 1IAWA 1RNLA 5HS7A 3J80Z 4I0BA 2XROA 1XCVA 1J7KA 3IDCB 3V7RA 3DL3A 4EWDA 1CAXB 2X4HA 4HDVA 2EFPA 2V6CA 4RGUA 2FA5A 3EETA 1AOYA 2IJLA 4LLOA 3V8JA 1G4DA 3P9KA 1SAXA 4EM2A 3DQVC 4IERA 1FP1D 1U8RA 1IXRC 3WTWC 5FO5A 3BJ6A 4GO1A 2Q4SA 2F2EA 4NB5A 4Q47A 4LLLA 3LOIA 1L0OC 5E17F 3PLQA 3TQNA 3H3ZA 3S7IA 5DD8A 5D4SA 1OPCA 1HKTA 3RZZA 4O6JA 2EK5A 5BPIA 1KQ9A 5D6FA 1SEFA 2PQ8A 4RB2C 4P9FA 4I0AA 2UY8A 4XF1A 3TGNA 5HDNA 2HGCA 2F4PA 2QUFA 3MCZA 4IRIA 2KJCA 3V8KA 1ZG1A 2ZMEB 1ON1A 3K9TA 4HYEA 3FZ3A 4F8AA 3HOTA 1NYWA 4RAYA 5CVVA 5LGUA 2PMHA 4L0YB 2D93A 1UIJA 3HRMA 1QZYA 3ELNA 5HOOA 4OLLA 2PI0A 2FBIA 4ON0A 1QPMA 1R1TA 1O7LA 1IN6A 3F21A 1X7NA 2PFWA 2UZKA 4O5VA 4DNCA 5FLXZ 1H9GA 2Z33A 4NVPA 1BJAA 3T5XA 4RS8A 3RNSA 4BHBA 2DQLA 1U3EM 5K1YA 1SMTA 5H6RA 4KICA 3LQQA 1MD0A 4CHUA 3OTFA 2HYFA 1XSXA 4IJAA 1S6LA 1DP7P 3WTVC 3NKTA 3SHRA 4LTAA 5FQ0B 2P17A 4OFGA 2ADUA 3LZZA 4M6XA 3J7AO 1Q3EA 1ZG3A 4UV8A 3D0JA 1G3TA 1I1SA 3T8RA 1R23A 1O5UA 2GU9A 2Q1ZB 4WWCA 1SD6A 3BOQA 4LJZF 2UXXA 1S29A 3KP3A 4L9NA 4MEXF 2BNNA 4H7LA 1XGOA 4UV9A 2EAAA 3R0AA 4YNIA 3H50A 5HS9A 3OV8A 3I58A 2HEOA 1Z05A 3KGLA 2IA1A 5TJJA 4MV2A 2H0VA 5KBFA 1BI1A 1WA4A 2P4WA 3CUQA 3GVAA 1SD5A 3GBFA 1R1UA 2HS5A 2EFNA 3KCCA 2PMUA 4MGYE 5HI0A 2E7WA 3FHZA 2OYZA 2XHKA 3EBRA 3EYYA 2PG4A 1OYWA 1J59A 1ON2A 3NRVA 5CVJA 4CDGA 5HDKA 5HVQC 3HSFA 3JSOA 4HA8A 4ESJA 3K2ZA 6PAXA 1P4AA 3FWEA 3NW4A 1L3LA 2W24A 1TBXA 3LWFA 1P4WA 3VEPA 4ESBA 2MD5A 1FT9A 2HFHA 2CV6A 3U0ZA 1CAVB 2DO7A 3HOSA 2V1DA 4QGMA 3RTRA 1I6XA 3VODA 3IHUA 1C0WA 4P55A 4LMYA 4HBNA 1U12A 3L00A 4Q5SF 3U10A 3BPVA 3F8CA 4ENKA 5JVTA 1XGSA 2YU3A 1IPKA 3QPHA 2QLZA 5ILSA 5FLIA 4YSFA 2K9ZA 3HRSA 4KWKA 3H3UA 4XLPF 3MYXA 1SFXA 2HQNA 4QM9A 1U2WA 1W7PA 3I4PA 5ILUA 3WTTC 3S7EA 1YFWA 2PQQA 2IXLA 5I0RA 2QWWA 3WTXC 4IETA 3G73A 1WRJA 2F5CA 2B9UA 3GF2A 4PGHA 1TLHB 4I98B 5CYVA 1MJAA 2QVSB 1DPRA 5F6FA 3TO6A 4FAGA 2E1CA 3K69A 4EGYA 4IEOA 2OAZA 1IN7A 4Z2YA 4HLXA 4ESFA 1FX7A 3O6BB 3T0YA 1DDNA 5AIQA 2P5KA 4EWEA 3GWZA 5JFRA 1OYYA 4J1WA 2K4BA 5A2QK 5TRDA 3R61A 4XETA 2BEOA 4XRFA 5LLQA 3F72A 3VOEA 2XLFA 1X82A 4UXAA 3GFIA 3GZ6A 2F5EA 3EQLF 3ZMVA 5KHIA 1USTA 5J3UA 4QGLA 3NSTA 4HDUA 1YLLA 2N7GA 4G6QA 1XDUA 2XRNA 4IEYA 2QBYB 3EHKA 2BYVE 3ABUA 3QU3A
chains in the Genus database with same CATH superfamily
4UUSA 3FM5A 1MACA 2DA3A 1M1EB 4QX1A 2V1XA 5BNNC 2F4OB 3L2RA 3KS7A 2CFXA 2LC2A 1OISA 4RAGA 4ZKTB 4PCRA 4E8DA 4SLIA 3OYDA 3HN1A 3JQWA 3MFAA 3JQXA 1U5TB 1SFUA 4F91B 4WXHA 2F5DA 4DZJA 3CC4I 3OPWA 3HTUA 2QQAA 2NMOA 4AI3A 3E5UA 4DINB 1XPWA 1NCRC 3DXTA 4XMAA 2WWUA 4D6QA 3C3VA 4XZUG 2R4GA 5L3CA 1ND3A 2EA7A 4P5HA 5FIXA 3G6JB 2PJRA 4UNOA 1W03A 2XQXA 3PFIA 1AYM1 3MI8A 5JCTA 3R4UA 2WL1A 4FHTA 2X29A 4QPQA 4G9SB 3DCQA 2VCBA 5F0FA 1GR3A 1OCZH 4HSJA 1YQ8A 4Q0PA 3I3LA 4C3JJ 3IMNA 3PVNA 2R7ZJ 3RYPA 3VHOA 1U5XA 3LA7A 2DXIA 1JODA 1YNAA 1DFQA 1AXYA 5FJHA 4R79A 5A32A 1T6BX 5K5OA 2HZDA 2Q8KA 3WNNA 4QPOA 2LUWA 5FD6A 4AEDC 2DYRH 4Y1XA 4C8DA 2GM4A 2DVAA 1WW6A 4XFHA 5KHGA 2H6CA 1VALA 5F3EA 5E88A 2OJED 4PJNA 5EJCA 3JD72 5EZHA 2GH2A 4XIKA 2QUOA 1LOAA 1SVMA 2ME0A 1J83A 2IWGB 1K79A 2Z1DA 2I2SA 1NOVA 1YEWA 5EJ3A 4FX0A 5F39A 2LKPA 5F3IA 4N9HA 1ZA4A 4AQTA 2VR4A 4UW6A 2QQOA 1ONVA 1LHOA 3U1DA 3I49A 4UW4A 1D4M3 5ILVA 1ENSA 2EWNA 2ZHKA 2QA4I 1LEBA 3VKNA 5JZGA 1JOBA 2WAAA 1HJGA 1ND3B 4PBOA 3FXOA 2ZACA 1RZ4A 2JIJA 3I2KA 2OKXA 3C3WA 3PIJA 3RG0A 2NVQJ 4E9KA 1XS9A 4MQ9F 4Q4W3 1TZLA 4IRGA 4XN0A 1A04A 3IWFA 3H1MA 4LG3A 1OKQA 1E0EA 2ZZQA 4XUPA 4YGDA 2VT3A 4FBFA 2P2KA 1R9TJ 3OYKA 2ZKLA 1U5TA 2A1XA 2LKXA 4UVBA 1WJFA 4FPHA 3AG4H 3ZMZA 4FSJA 4GH4A 4RQPC 3BU0A 1PDNC 1S0FA 1KS4A 4UUSB 3UJQA 3J7YJ 2MGQA 2HBTA 2QBYA 1KU9A 1D8JA 4KIBA 2X5IA 4AAPA 1BC7C 1Z7LA 3OYIA 4J01A 2QCSB 3FISA 1RESA 2IGOA 4XFAA 4W6XA 3ES4A 1N1YA 1WSUA 5AFBA 2L7FP 3S6PA 2ZHMA 3KP7A 4XLNF 2EV5A 1X8MA 5F27A 1JZ6A 4ABZA 3ECOA 3A01A 3WV6A 4MG2A 4XDQA 1ZRIA 3AKTA 5J48A 1PVC3 3P9CA 5JMOA 5A6YA 4A6OA 5K5QA 4YVWA 4KI5M 1JKPC 4XQFA 3OYLA 5J98B 3ISPA 4CDWA 5I0SA 5GLUA 5FLXK 3SZGA 2QF7A 3M1CA 1GNZA 4PSXA 2ISZA 3NAUA 1QEXA 3M3QA 1DP3A 3PM1A 5C71A 4KNCA 1JUHA 4LD5A 4XUOA 1VRBA 1X1DA 2K02A 4Q4V2 3SCFA 2GOXB 3U9GA 3VV1A 2NAZA 3C7OA 1IS4A 2IPQX 4YRVA 4XJUA 4ZXEA 2FMLA 2PMZA 1SANA 3I4MJ 4QKBA 1MIJA 5BNPC 5C4XJ 3I59A 5IT3A 1ETXA 4UOJA 1UZZA 1UWWA 4J6GA 1DZRA 1HLCA 3L7WA 3WNPA 4CP0A 4W4ZA 4MX3A 4QX7A 1AKHB 1N1SA 2XWJB 2B9SA 2A71A 4U7DA 1CPNA 3K3NA 4GB33 5DUVA 1PUEE 1ZA7A 4WM7B 1GOHA 4EN9B 3ES1A 4G4FA 4HL0A 1J3RA 1HB3A 1ULPA 3AMQA 1E3PA 1FOYA 3WP6A 1GYKA 1KITA 2ORXA 4WM7C 1V5EA 4D69A 1S0DA 1DGRM 3VLBB 5HDGA 1RR8C 3NQOA 1WLCA 3JZVA 2AGSA 1HB4A 5LZ6A 4CYDA 4E7JA 3MIHA 1VR3A 2HWD2 4META 1COV3 4JX4A 3FXRA 1CAUA 5H20A 2VONA 4PJMA 3GO5A 1NHAA 2ZXIA 3TOAA 2M45A 4BXXJ 3F8MA 4XUNA 1KRIA 5IYDJ 2NVYJ 4JDMA 1XOYA 2VE1A 5AC93 1SG3A 1SLAA 5FXXA 1YJ9I 4IV3A 3PMEA 2X1CA 3SXWA 1J09A 2I8DA 5CG9A 4QQPA 5JHUA 2MH9A 3SFZA 4IW3A 1UZCA 1EH8A 4E6KG 4HNVA 3ZSEA 2ELJA 2IA2A 3CJIA 1CX4A 1LE8A 2DJIA 4XMIA 1NCQA 3BALA 1TNTA 2JSPA 2HDDA 4B47A 4BPZA 4PJYA 1FXZA 1UY4A 3C2HA 5FLHA 2D3PA 2EIGA 3CF5F 5A7PA 1NA1B 3TYJA 4F52A 3KP5A 3R60A 3QPSA 3TKYA 2H09A 4D94A 3RFRA 3LQCA 1SFOJ 1FZPB 3ZLIA 1MMNA 4BHPA 3Q8BA 4G3YC 2Z4FA 2VVFA 2DFBA 1VBB3 3HJEA 1RB8G 1APNA 2KD7A 3VZKA 2Y9YA 3SKJE 1KZHA 5L3EA 2GXGA 4OINF 5DS9A 2JD4A 3K4CA 2I5UA 3ACIA 2DUPA 3LSIA 2P7VB 4QTRA 2HKXA 4A3BJ 4WM8C 1U78A 4AW7A 2M87A 2FNAA 1LU1A 4NIGA 1OQDA 4QXBA 4PIXA 2MEV2 3ACLA 3E6CC 2AEYA 2R5YB 4BNCA 4YPJA 4CU9A 1MMGA 3BT9A 1JH5A 3WTYC 5HNFA 4BXFA 3CCUI 3KEQA 3OCPA 1R5GA 3IWZA 5J3LA 4XXAA 3BR2A 3NJYA 1Z67A 2YFZA 2RVCA 3FHQA 4FT8A 1JXNA 1VBA1 3AP4A 3ABTA 2ZO4A 2HZTA 2XUEA 3WGGA 2G9FA 3DTIA 2M30A 5A33A 2EIKH 3TBIA 3WLUA 1BOBA 3TAYA 1LU2A 5KHHA 2KDOA 3OYEA 1XC5A 5F8PA 3VGIA 3HR9A 2FXAA 3HUGB 5AC92 4KIGA 3RJRA 3OSFA 3QRFF 3FX3A 2P81A 4JRLA 2PHLA 4M3CB 3S30A 1MZFA 1BC8C 3JXSA 2CAUA 4DYQA 2OUMA 1UZVA 3K4JA 3WW2A 3N9PA 4OOIA 4OWRB 3LMMA 2RHPA 1ZREA 4CDXA 2BP6A 2VPVA 5DMYA 1CQTA 4EV0A 3WGHA 2JWTA 3RPUA 2Y0OA 3U4SA 2IXSA 1B35A 1ZZ6A 3RZDJ 4ZYGA 3AG3H 4ASLA 2WYFA 5TSWA 1E2XA 1RUD1 3C7JA 1EV12 1RUG3 3I55I 3GHMA 4O9GA 2FRHA 3VBFB 2BZDA 1ZLJA 3ASOH 2VBWA 1DF0A 4J25A 3OBAA 4EM0B 4LLNA 3MZYA 1FYLA 4H14A 1R22A 4XILA 3WU1B 2XAGA 5LASA 5FROA 2M4GA 1W2UA 3M2MA 4GB31 3VBFC 3W21A 1NT0A 1ZG5A 4AVPA 5IK8A 2E63A 4AIKA 3J8F3 4A5MA 1MS4A 2HWD1 2FU4A 4QPYA 4PZJA 4E2GA 2CV0A 3AMPA 1GV2A 3HAGA 2YC2A 1UOJA 3A0BC 2VQGA 4MVTA 3MKLA 1POV1 4XBNA 2DFCA 1SMVA 5DZGA 4BLJA 1ZRRA 2M8EA 3NVCA 1B8IB 5DDJ3 2CGNA 2YX7A 2OZ6A 3G6EI 5JWPA 2DFHA 2XGCA 4JQFA 5FMCA 3KV9A 2VMIA 5GLWA 4HX4A 1W6NA 2WAFA 3TMOA 3CNAA 3JRDA 5DAVA 3GCMA 2D3SA 4B3AA 5DV5A 1GXQA 1VI0A 2LROA 2MBFA 1P9QC 2NYYA 2KKOA 4HETA 2YUEA 1AUYA 5DYMA 4ITVA 3F8FA 2XBO2 3ZP5A 1JYNA 1UU6A 2IS2A 4AQ6A 5IY5H 3UKVA 1DYOA 2XVKA 3QPTA 5CFDA 2EIJH 2CV1A 2EB7A 3PL0A 1BN5A 4IDZA 1XNTA 1AR92 2B0LA 1YS6A 2E7TA 1WCMJ 4HMZA 5LA2A 4J1XA 1EF4A 4FXKB 3SEZA 3LEIA 3ZN1A 5FYBA 4BJ5C 1PO22 1IXCA 2H8RA 3TNPB 4DYRA 4P00B 1QQIA 3VKFC 2JD9A 2IXHA 1VBB1 1T56A 2W5FA 1NXMA 3TWIA 1ORKA 2HVQA 1K78A 3K4KA 5A1LA 3OF1A 1OCOH 2COMA 3H5AA 4XRSA 1Z7S3 2ZGQA 3CZJA 3HNYM 2L7MP 1ZTRA 1YI2I 1QJX1 3GGLA 2ILMA 3OB8A 3K4BA 2W92A 4QPIB 4B44A 2ZC2A 1SEUA 1XSRA 3GYDA 3EPZA 1XRUA 1TT5B 3O0WA 3KV5A 2STTA 1C8NA 5FYYA 4QPIC 3USSA 3OPZA 1T0FA 1VJ2A 2FCVA 4NHJA 4XLEA 4D0PA 1ETQA 1E5HA 1R49A 3O7OA 3WQ1A 5BUVA 2DCTA 4C9YA 4B43A 5F3CA 1VMFA 2MW8A 3I2DA 3N9LA 3ZFGC 3ILFA 3FXMA 3ZVXA 2DTRA 1A8DA 1ZZ7A 1QU3A 2CW0F 3QH6A 2FBEA 2DK5A 2OZJA 2O8OA 2VBBA 3KB5A 1F9NA 4UXNA 3OEBA 4I02A 1RUC3 4A6EA 1LQ1A 2WO1A 3MKWB 3WG3A 1A6CA 1X2NA 3U07A 1VP6A 3VB9A 3AX4A 1IHMA 1R083 1S5LC 3BGAA 3APBA 4IV3C 3TDUC 1X19A 4PFPA 4A3EJ 1VQ4I 1BVVA 2D6MA 1GSLA 5JR3A 4AEMA 2QQ9A 1KGSA 3WF3A 1WJBA 3SEQA 1BJQA 2YU1A 2WFF1 3W58A 1XMKA 5LB6A 3A23A 4N4NB 1CAWA 1XSQA 2M1BA 3OD0A 4JKMA 2ZJRF 2IXJA 3LAJA 1V9U2 2XIGA 4QPGB 2VM9A 3AZXA 4H3WA 3LSMA 3DYMA 1JTXA 3HKZN 1S55A 4PDWA 1TQMA 3RDIA 3HJRA 3PSIA 1WLDA 1EAH1 1GANA 3OMYA 2HVSA 2K7LA 3DPUA 4ZYAA 5B66C 5C4JJ 4D7SA 5CA6A 1DQ5A 4LGWA 5FLJA 1I1GA 1YJWI 1APLC 1VBC3 1QXJA 3W9AA 3RZJA 1UNBA 1SD7A 3KE2A 3OPTA 5CFCC 4LBQA 1O59A 4P96A 4F3QA 3T3YA 3HPGA 3LFUA 3BI3A 4NPRA 3ILRA 3OOXA 2E35A 3C2BA 1WKMA 2HTSA 1QXRA 1HSTA 2YGLA 2GNDA 2GIVA 2B9VA 5T3NA 1VNDA 4DMIA 4NC7A 1C57A 3BR6A 4MGZE 3ZFFA 1JYVA 5EG0A 4QMAA 3S16J 4LBQD 5G05L 2CS3A 1Z91A 4FX4A 2A3SA 4I01A 2P5LC 1H8TB 2V7FA 3F22A 5FYVA 4GH4C 4RQPA 4QB6A 3EYPA 3I9V2 1GXPA 5A6ZA 4AL9A 2ZEWA 3AKSA 3GLLA 4B4PA 1R4MB 3GTLJ 3GUDA 1JI6A 3CF2A 1OD3A 4S2DA 4YFZA 4ENNA 4IV1A 1KQRA 4Z2AA 2TDXA 5BV6A 3I8TA 4MGRA 5FZBA 2ZX3A 4XK4A 4NHLA 2ZBJA 4HKLA 4GKYA 4EZHA 3MIDA 1L3JA 1YCIA 2RM22 3O1PA 2WT0A 3ZSKA 4BDYA 4CP9A 5A3OA 3EQEA 1PVC1 3UYJA 2W46A 3WNKA 2QKMB 1BYHA 1WCQA 4LQRA 4B3NA 2BV4A 2DMTA 2DU0A 3VBRA 3IB3A 5K7HA 2CTVA 2CUEA 1UYZA 4PF5A 2GA1A 1BK0A 4B7EA 2K3PA 2UWCA 3H0GJ 4A42A 3CZ6A 1O8PA 3M8LA 2J5OA 2VBPA 2W57A 3R0JA 2V5YA 4L97A 4Q0VA 4D3WA 4PCQA 4UW5A 4ITCA 2LSOA 4WK8F 5B4NA 1YXWA 2WLPA 4OMYA 1AYN3 4UF0A 2LMDA 3IDAA 3QAHA 4KN4X 5JPNB 1ETOA 1MS1A 1X4OA 4B3XA 3JUUA 3CP8A 3ZM8A 2XUMA 3BQYA 5FP3A 2CMPA 3OGJA 2XAFA 1MDMB 4AEDA 2RV8A 3W5NA 4UBGA 2O6GE 1UF2C 4Q0SA 2K40A 2J1EA 1FIPA 2W9XA 2EV6A 3CCLI 2ETHA 1H88C 1Z6TA 4AK3A 4YW7A 1RHI1 3LSPA 3K51A 1YYNA 1ETVA 3HBZA 1G9DA 4XNFA 4Q1PA 1FMWA 4B29A 4K8FA 1QJX3 1X1BA 1BBT3 2JPBA 3RQ4A 1DZTA 1BEV2 3WG1A 1PK6C 4LE4A 3WCSA 1AR83 4BXUA 1SQ4A 4RM2A 4RL7A 5IVYA 1SAUA 1Y3TA 2GOMA 2L0KA 1RUNA 2ERFA 4L8QA 3FHAA 5ICGA 1CESA 2HR3A 3Q9OA 1VBC1 5FQ0A 3SDGA 4QB1A 4P02B 3N3HA 3ZX7A 2JA5J 2RS11 4G9YA 5C3RA 3CCJI 2KMUA 3AG1H 1REPC 4CICA 3SH4A 1G9FA 3O1SA 1QZEA 1YYVA 1B72A 1LGCA 1H4GA 1PIV2 3COAC 3WR0A 1PVXA 1HBXG 5C8WA 4NROA 4MQVA 2Y9ZA 5BY5A 4BH9A 3LOBA 1OMIA 1H0BA 1ZRCA 4IHSA 1Q1HA 4A5NA 3M8EA 1OLRA 2A73B 1R081 4EATA 4NIDA 2CQ7A 4KJZA 4QKFA 2R3SA 1HW2A 4Y26A 4O3MA 3THPA 2ZGLA 1WW4A 2XJVA 1R64A 3HNMA 4HSLA 4LR4A 1ND3C 4QXCA 2EZHA 1IV8A 2Q1MA 4FFFA 3IH2A 4XN3A 2RV9A 4HANA 1EY2A 2KZVA 2DVFA 2X1EA 1A5JA 2FDFA 1CR7A 5C4WA 2Y64A 2R7QA 2Q0AA 1WQ2A 1A8MA 3KP2A 4RD7A 5FKMA 3ZR8X 3LPGA 5FKOA 1AL22 4ZYEA 1SACA 4BB3A 2VMGA 5KHKA 2STWA 1VAVA 3ZOIA 2HDCA 4KG8A 5B1BH 4EGZA 2RN7A 5C33A 4N8MA 1F15A 4AVSA 3AK0A 1CAXA 4AEKA 1JZ8A 2CQNA 2VD7A 2ESNA 4AIHA 4NR1A 4CCNA 3DXJF 3A7QA 2WSUA 2WAOA 1D1AA 1VBA2 2ZMLA 1YG2A 1DQ1A 1W5CC 1DQ6A 3NNJA 2Z69A 4ZTFA 4IZZA 2Z2SB 3IV5A 2ARBA 3M3EA 4BQXA 3EMRA 1S7AA 2ZGTA 3ZMTA 1ULCA 1KU3A 2VXZA 2FEZA 2M4KA 1X2MA 2JA6J 4N43B 5CFCA 1UPSA 1BW6A 2XAHA 2VODA 3HHHA 1YUDA 5KC6A 4HOBA 1OH4A 3VBOC 1JYCA 4Y52J 2Y6LA 2VQTA 4EJWA 1YQAA 4DY5A 1JZ7A 4PHZA 5C3QA 3WVJA 3OGVA 3OYWA 4EN8B 4QHOA 2DMNA 1UD1A 1VF9A 1TQPA 2VZQA 4PDWC 1W6OB 3KZYA 1YI7A 1YIJI 4N9IA 1S0GA 3PO2J 3HOYJ 1OF4A 1W90A 3VDDC 2WA3A 5LA0A 3L2HA 4XSXF 5KXCA 1RUH1 4RLFA 3CCSI 2GXAA 4FETA 1V6OA 1Y6IA 2GSYA 4YWAA 4NAOA 1P6RA 2PELA 4XHXA 3B02A 3E6MA 1R00A 1OVSA 2Y31A 4HX7A 2OUJA 5KC5A 4WF2A 2PHDA 4MSVA 4RB3C 2RR13 3M8FA 5EWSA 2P5VA 2IFWA 1BBT2 1W2OA 2BDRA 1BEV3 5LGTA 3IL2A 3ETPA 5FZMA 4BCUA 3KF5A 2DN0A 4NOTA 1U5YA 3ONQA 3WDXA 2VQLA 1SHWB 2P3YA 3NJVA 2C1FA 2CSGA 4XCAA 1O4TA 5A3MA 1D0GA 1SMYF 2A6HF 1A31A 4Y3OA 1F5FA 2BW8A 3WT3A 3LSDA 2ARCA 5EFUA 1LOEA 5F7UA 2DCKA 1TVGA 3MPBA 4JRAA 5HCAA 3K1PA 1ODNA 4EN0A 5DDGA 2WNVB 5CB7A 1XC6A 2NM1A 1MBEA 4JGZC 4Q4X2 4CCKA 1EPZA 2J1RA 4BE1A 1ZLKA 4Y20B 3ZFGA 2UWBA 3MICA 4XF4A 2E9QA 4L92A 3I54A 5LY1A 4EWAA 3B69A 3BTXA 4BLIA 4LITA 1IG3A 3ZPYA 4GRIA 2DPDA 4TV7A 5LBCA 3ULQB 3SNMA 4NHKA 4HLYA 2CUFA 2MC4A 5LHIA 1LULA 4HOOA 1BI0A 3TNQA 2QZ2A 2YX4A 4MEYF 4E7HA 4Z07A 1MH4A 2F17A 2CYYA 2LR8A 2IC1A 1O3SA 2VMDA 3VBSB 3P3PA 2ADEA 2RS53 1YQCA 1FX5A 1C3HA 3BR0A 4G8XA 1TTYA 3WTSC 2DURA 4XC9A 4QU1A 2BVVA 2AXTC 2FZ2A 1RUJ3 4Q4W2 4EWDA 2X4HA 4RGUA 1X1AA 2IS1A 4CCEA 3M3YJ 2M2EA 1AJKA 4HPQA 2NVXJ 3PMSA 3DQVC 4ZC3A 4IERA 2ECBA 5ABJA 1LCLA 4XABA 2Q4SA 2F2EA 4NB5A 5KXEA 1O8SA 4LLLA 3PLQA 5DD8A 3S1NJ 5D6FA 2P3IA 2PQ8A 5J4VA 2IAIA 3J7AY 3HGGA 3ZYPA 4CDUC 3W5MA 4IRIA 1KS5A 3V8KA 2WBKA 1ZG1A 1W1WE 2ZMEB 1ON1A 3K9TA 4Q4V1 2VW2A 3HOTA 1NYWA 3AZYA 4QB2A 1S2BA 3ZFEC 4L0YB 4TXWA 2OPTA 1QZYA 1D0HA 5FP8A 2BZTA 3LSJA 2DBNA 4FPGA 1CPMA 5KAFC 5IYYA 4IHWA 2VOTA 3QD6A 4Y33A 2MD0A 2E53A 1O7LA 1TMF3 1S0CA 1X7NA 1U9NA 3ACGA 1ENXA 1Z7S2 3K48A 4DNCA 1ACIA 5FLXZ 4NVPA 3K4MA 2WSVA 4DFSA 1DQ4A 1C8M2 2L9SA 5DAWA 1KEXA 2MFZA 1U3EM 2D3RA 3OBRA 4K20A 4NPLA 4KICA 2E2HJ 5C8CA 5K7FA 2HYFA 2VC9A 1S6LA 1X58A 3ERMA 4B1MA 1DP7P 5FZCA 3CCYA 4UT5A 3DKXA 5FJ8J 1PUFB 1TME3 3ZQCA 4OFGA 1W9SA 5FZ6A 4YM1A 4FISA 1VQ9I 3J7AO 1Q3EA 4K8RB 4UV8A 3D0JA 1G3TA 1I1SA 2LS6A 1AR93 3WEZA 2GMEA 2GU9A 3IAPA 4CCCA 5D8AA 5A3TA 1SD6A 5F9TA 3BOQA 4DXTA 4LJZF 3OGRA 2NP0A 2WQZC 4H7LA 1OOPB 5FZ1A 4UV9A 2ZFUA 4W50A 4CDQC 2YBKA 3H50A 5HS9A 1G8WA 3I58A 4RBOA 1Y9MA 3S2HJ 2W47A 4HG6B 2GP5A 1R4NB 2IA1A 5TJJA 2H0VA 5C9AA 3OJBA 3LDKA 3NMBA 3MW3A 2EFNA 4QXHA 3DCFA 1WHUA 3FHZA 2VXJA 2VNRA 3EYYA 1PGL1 3H8XA 1ON2A 4AU7A 5CVJA 3K70D 2P34A 4LBLA 1EAH3 3HSFA 4OZOA 3OOUA 1YI9A 2IGMA 6PAXA 4RMNA 2FUG2 3LD8A 2W24A 3LWFA 1Z0HA 3BZCA 4UAPA 4XTMA 1FT9A 3HOSA 1FOD1 3IKWA 5DG1A 3VODA 3D3AA 5A7QA 3NO8A 4IQPA 3SH5A 4HBNA 3U10A 2BY0A 5E6HA 1KGYA 3ZQFA 2W1UA 2VOVA 5KXBA 5FUIA 2ZSHB 3C7HA 2WY8Q 3KEYA 5FLIA 4YSFA 3V0AB 3ZQLA 4I6ZA 3KVAA 3HG9A 3BG3A 1SFXA 3O1VA 4A6SA 1U2WA 3B93A 2HWC1 1FNYA 1LHWA 4X6AJ 2EICA 4QDSA 1MS0A 5B3SH 3WP3A 5E79C 3WTXC 5C8CC 3L9JT 1Y0NA 4PGHA 1TLHB 4I98B 1WWYA 3TO6A 3K69A 1MQTB 2DCEA 4IEOA 1O4XA 3QYBA 2JKXA 3H5RA 2YBSA 3RWKX 1BEV1 2WZ8A 3O6BB 5AIQA 1MQTC 4M0HA 1MNDA 4EWEA 5JFRA 1OYYA 4J1WA 3WX5A 5A2QK 2GNMA 2NOGA 1X33A 2BEOA 4N7IA 4XRFA 3BPSA 4OVEA 3MO4A 4FO9A 2XLFA 4UXAA 3GFIA 3GZ6A 4D0QA 2P3JA 3ZMVA 4V2VA 5FZIA 3I3DA 5KHIA 5FY8A 3LPFA 2E33A 3A22A 2HWB3 1AYM3 4IOCF 4JQRA 1VQLI 3QU3A 1AR63 1X4PA 1UYPA 2H27A 1VIWB 2DT6A 1GZWA 3RZKA 2G9WA 5JUVA 4V2WA 1JW6A 4QQHA 5IT6A 3NAPA 4AHZA 4AGGA 2ESHA 3K1MA 1F9KA 1RUE1 1C4RA 2QQWA 3ACHA 4V1PA 5A7NA 2L4MA 1O6UA 4L18B 1U5IA 3L2UA 4MYEA 4KGQA 2OC6A 3SCHA 4YVSB 3WE3A 3UJOA 4BIFA 2XV4S 1GICA 3UT0A 4YFXF 4LHNA 5EEHA 4KMQA 4J00A 5E16A 2WO7A 2NS0A 1LHVA 1RC6A 5BPXA 2MEV1 2OX0A 3DKYA 1V6LA 4KWUA 4KG0A 3GCWA 3I56I 2GC0A 3PVOA 2EXIA 1RL3A 1XU2A 2XMLA 4LHKA 2WN2A 3WUCA 1VQ5I 3J4UH 5E3NA 3HSRA 4U36A 1SC7A 1JGSA 3JTGA 3S5QA 5FPXA 5JHFA 1LR5A 1YX5A 5LHGA 3Q9VA 3WNLA 2OPKA 1RPWA 1TC3C 1MS3A 3C18A 5C3SA 1SBFA 1ITYA 1UN1A 3S3NA 2GQQA 3E5QA 1FPN1 3UKNA 4QU2A 4NWWA 4CA9A 2VQHA 4K2EA 4P9LA 1J1LA 2LBFA 1MMSA 2ZEXA 2FDIA 4CYCB 2HKOA 4RM3A 1W9YA 1FY7A 2VBZA 3CO6C 4FVVA 2ECCA 3RPUD 1RUF2 5E18F 3ZDSA 4N4OB 2V1NA 1XYNA 5A3LA 2VASA 1X50A 3BP8A 3JCUC 3KCXA 4XIOA 1MEC3 5EJ1B 1YJNI 1LOGA 2VIXA 2BNOA 4BQAA 4CGZA 1LTEA 4BA6A 1UOBA 4IL6C 3IM0A 4UVCA 2KIMA 1HN0A 3DKWA 1JUPA 1NAEA 4LJHA 3OUJA 2QM3A 3QU6A 4MLOA 1MZEA 2ZAHA 1SPPA 2M5WA 1LOBA 4MUVA 3QQAA 2V1UA 1RUH2 3RJ2X 3HWJA 1QY4A 4BK5A 3PQKA 1F2NA 4L0ZB 3KEOA 3R4DB 1K6YA 3PJYA 3K70C 1ENRA 1FV2A 2ZA9A 3CUOA 2BOIA 5GTIC 2LK2A 1OFNA 4MGIE 1U0JA 1MZ6A 4V2FA 4YIFA 4BZ4A 3KQRA 3RKXA 2MC3A 3Q8FA 2FCTA 2WT1A 3UGGA 2GWRA 3RJPA 4KL1A 3HOUJ 2E1MC 1PZ8A 2HQ5A 1SFNA 4PSWA 2LW8A 4RHV1 2VN2A 3ZR6A 4D5CA 4RFT0 2MLGA 4WM8B 2XLGA 3K3OA 4GKXA 1UIKA 4XBQA 4M73A 2WB1A 2RDQA 1E5SA 4N53B 3PUBA 4XURA 1IKPA 2JDNA 5SV8A 5GALA 3BTZA 4ASNA 1K7AA 3KIOA 4IQ4A 2J1VA 3PVEA 5T54A 3ZFEB 5FYZA 1IZ1A 3NNMA 4BKXA 1N75A 2YYOA 4AFCA 3FUOA 4EE2A 1AX0A 1UG0A 2HPMA 4HXCA 2K5CA 2IVMA 1VQ8I 5CKMA 5BPDA 3GZEA 5GLTA 4M9XA 3J9SA 1YW9A 4OHVA 2OCCH 5FYIA 1URXA 1YFYA 1OCRH 1W39A 1Y1VJ 5T5LA 2ZKZA 3JAMZ 2J22A 5J1XA 2DUOA 4FAHA 3OBZA 1VQKI 2XJUA 2R16A 3HB9A 1LVAA 3CDHA 3V8LA 1US3A 1WLWA 1MMAA 5GADJ 1RUE3 3UKGA 1N47A 5FZ8A 3PSFA 1RVF1 3B5LB 3RCOA 1RITA 4YGEA 4YRDA 2X53S 4BQ4A 1BK1A 5DCFA 4LBOA 3AL6A 1JGGA 4UB8C 2DMQA 4FFIA 4Z6YA 3E6BA 3GTOJ 1GP6A 4S2FA 3LQRA 5ACA2 3NNGA 3F9KA 5GTHC 4S05A 1Y7BA 3ZGKA 3S1RJ 3N9NA 1GV5A 4AOCA 3JAMK 2FD5A 4E7ZA 4E4DX 4CUGA 4M71A 5K8SA 2VUDA 3AXDA 1CVNA 4D7NA 2QQLA 3LDBA 4OCTA 2FDGA 1ASJ2 4HAMA 4TLFA 4PJJA 5ANNA 2WZEA 4OI2A 2AHQA 2IA0A 4P9YA 3VZOA 4IL7A 2QDRA 3BCAA 3PJRA 2I74A 2NPIA 1X1PA 3EUHA 5IW0A 2W68A 5KAIC 4MGKE 1X36A 4QX5A 3CUQB 4L5JA 3D1NI 3PNTA 2KXLA 2XF5A 4AWDA 3HC7A 5C6CA 4CDQA 4ZU7A 4PLMA 2VJ5A 1BMV2 1V6JA 2DA6A 4CZSA 3RQIA 3EYIA 3OEAA 2CGOA 1PNGA 2IRFG 1GQGA 4OIPF 1ZBE1 4ENMA 3N35A 4LBNA 2WNUB 4LOTA 2WAEA 1FWZA 3GEZA 3I64A 2NXNB 2VBDA 3PU8A 3KV4A 2CDOA 1NTCA 2GA2A 3V42A 1GV9A 1QJU2 3TP0A 5HODA 1D3YA 1FYUA 1X8EA 4HPKB 3PUIA 3OGSA 4HVQA 2RQQA 4N7UA 4IEXA 4NBQA 4EJVA 2BUKA 2H1LA 2RDNA 2LFBA 4RHV3 1T6GC 1LDJA 1K5MA 3KFWX 4MTEA 1S0JA 1VRH3 3RSNA 2JENA 2OQ7A 1W8OA 4O7XA 4PIZA 2RE9A 2FBHA 5L73A 1GU3A 5DZEA 3THTA 1UJ8A 2R071 3GLXA 1EA3A 4WVMA 5GZCA 4PFOA 2WTEA 4O9EA 1O4ZA 3FM3A 2E71A 3DUIA 3QH7A 2GMMA 4E7IA 3S15J 1TZOA 2Q8OA 2JA8J 1Q5OA 2B7YA 5EGOA 2WNOA 4M3GA 5C3PA 3Q0UA 2NZ9A 3WD5A 2CG4A 2H94A 2Y69H 1A6IA 3ABMH 3LSRA 4BQ1A 4X1EA 3MEPA 4Y7NJ 5FJKA 3D0SA 3AKPA 1AR81 3CEWA 1VQOI 5IVBA 3WP4A 2BW3B 5FR3A 2Y0SN 1IS3A 3H9AA 2KZGA 2NQYA 5CIRA 1AA7A 3POBA 1B9MA 1LJ9A 2I45A 2R7XA 1QF3A 1VE0A 2JG9B 2R041 5E89A 4UW3A 3T1BA 1D2SA 3THCA 3WOGA 3H8UA 3SCGA 2UXNA 2X05A 4Q4X1 4C2TA 1MGTA 3Q9SA 1ZGJA 4ZZLA 3BCBA 4BQ3A 1WCKA 1LEMA 3IRQA 1G9AA 3MFKA 1J58A 3FJSA 3B6CA 1HXS1 3W2AA 4GXOA 3FMGA 4QX3A 2VUJA 2JRTA 1N1VA 1UCXA 3SHFA 4IEPA 3CCVI 1VAMA 3L9FA 1IN4A 1W5SA 2MH2A 4R1HA 2ETEA 3DEMA 1PJRA 2BY1A 3IH4A 1N77A 4DOUA 2BBAA 5LRSA 1UFMA 3W6JB 4DY3A 1KDMA 4A45A 3O1RA 3CJXA 5DCMB 4CXWA 5E8AA 1ZYBA 5FYTA 2W1SA 1FPQA 1S7EA 3WDVA 2X1DA 3M8JA 2ZPXA 4M3CF 2FMYA 5F3GA 3H35A 5LRRA 1RTVA 2QBXA 3WDTA 3HPNA 3QCWA 3BZKA 3OSGA 1HB2A 3ZSMA 2AYHA 3KZ4C 1OLME 1SBDA 1OURA 1YIOA 1WJEA 4KITB 3PUHA 1QNYA 2M8GX 1QVUA 2A6WA 4KISA 4LA2A 5FAXA 2VZUA 3DBRB 1UMZA 3TEWA 1LECA 1NKGA 2M9HA 1LDDA 3DPLC 1JJ6C 3VBOA 3ZXJA 2L54A 4JVAA 2BFUS 3LE0A 3N9MA 4QKNA 2VE9A 3M1HA 3RGBA 2R92J 1XSVA 4EEFG 5A3WA 1YQ6A 1CIWA 4B7KA 2D40A 3UGHA 2LOOA 3J81Z 2P6CA 5EP9A 4S2HA 3MUZ1 2L9VA 2R7OA 3RZHA 4LOCA 5TGTA 4XACA 1VBE1 1WZXA 3Q8CA 3ZYJB 3WG4A 1ZQ3P 1AR82 2V73A 3DXUA 1XNKA 4K21A 2HNHA 2NVUB 3HRUA 2B5HA 2PN6A 2OD5A 2BXZA 5T5OA 2EH3A 4FPFA 3OS2A 1JUSA 3NNLA 4JKKA 4XICA 3ECHA 1UMHA 4FFGA 5I0TA 2CQKA 4P9XA 2QCOA 1FMD3 2HLEA 4RR3B 3V64A 3F23A 1D0YA 3F6OA 3VL8A 4ZDPA 4LHSA 2E1OA 1SLBA 3BJOA 5FPAA 3CESA 2JQ7A 1ODMA 3U11A 3PNYA 1FYKA 4XRSG 5GAEJ 5BMZA 1IPJA 5L3DA 1OKRA 1ZRFA 2VZTA 4HX8A 5ICFA 2QQVA 4YG0A 3VN4A 5L3BA 2ZMEC 4NN0A 5FOJB 3VBUA 3BG7A 2PMZN 4C0HA 2JSCA 3AVSA 2EZKA 1YO5C 1LEAA 5H2FC 2VY0A 1ND2A 5JOYA 3MQ0A 4QDQA 1MPXA 1YRZA 3T09A 2VC0A 1OPOA 4ET7A 9ANTA 3VSLA 2GAUA 2B4KA 1LB2A 1GMMA 3FXUA 2Y30A 2R7VA 1FATA 2OF7A 1FPN2 2W7NA 1XG1A 1Z1DA 1YTYA 3NJXA 2W85A 1UKRA 2RNGA 2IVIB 2DBIA 2YGMA 3OG2A 1HOMA 4GWIA 3I53A 3NNFA 1DG6A 5A6QA 1YO8A 3CU7A 3IAM2 4JZRA 1S0EA 1B4AA 1UU5A 3PIGA 1Y39A 2RDPA 3F0CA 3ZKUA 4HKWA 4OIQF 2R1BA 1H6XA 1P4XA 4YFKF 1IQAA 2W39A 2KL4A 1OR7A 4UFJA 3LSGA 1AHSA 1V6NA 1IRXA 4FQ4A 1GZCA 5E1ZB 5FOBB 1FIAA 4M9SA 2CQXA 2CU7A 5M5XJ 4YIIA 1HKSA 4DEQA 5LEJA 4MIMA 1S2EA 4KGGA 5HV4A 3QOEA 5CEHA 5DUUA 4DRRA 3QP5A 1PGW2 3U1KA 1XBFA 4XUQA 2JECA 2LP0A 5IVCA 3O8HA 3UNGC 2XF7A 1T2XA 3CIHA 5J36A 3KM5A 5A3UA 4GJYA 5A2QZ 3SC7X 4ARXA 1E3HA 1JYIA 4MHUA 4CCOA 2VNVA 4XKWA 5F64A 2QKDA 2E34A 2WNUC 1OLTA 2IXKA 4B09A 4NHXA 2YU9J 4XBLA 2DPUA 1BL0A 5FMOS 2JE7A 1O7FA 5BNQA 3B00A 3K77A 3H1CA 2G0EA 3ZO0B 1RJ8A 4M4PA 1HRV3 5HLIA 4BQNA 1UQXA 3G1LA 1IW7F 5AVPA 1KYZA 3ETQA 4WX9A 4RS5B 2E5NA 2OIIA 4C2UA 2XPUA 1XNCA 2HWE3 3RKYA 3PL8A 4LB5A 4NC8A 1JHNA 1V54H 4KT5C 1Y9GA 2Z42A 2GC2A 1TL8A 5FFZA 4URTA 3WDWA 3H1WA 2XLAA 1W6MB 4LG0A 2ARXA 1DLLA 5IATA 4Y1UA 4X6RB 3IAS2 2EQRA 1IRFA 2L9LA 5FO9B 2R93J 3POYA 1W0UA 4LO5B 2MPFA 1TWCJ 3P9IA 4GALA 1UX7A 1DZQA 5F5AA 1SLCA 4HF1A 4OIRF 1AXZA 5CNAA 5FYMA 4K6BA 4L9TA 1H9WA 2HWC2 3DYPA 2Z99A 5K7ZA 4U7BA 5JOWA 4QWQA 4OHXA 3S5AA 3NKGA 1W7PB 3TOBA 1DQUA 2OTJI 4U0WA 3PHMA 3MMYB 1FMD1 4CE8A 1HF0A 1E3OC 1WH5A 2MA3A 5JR2A 4PIYA 4Q2FA 2RR11 2EINH 4NUBA 1W8TA 1JUMA 5K0UA 4BHCA 1QHGA 3VKOA 3C2UA 1D5VA 1UX6A 1RIOH 4A7ZA 2Y6GA 5FY7A 4Q4Y2 2BE5F 3AL0B 5D4RA 3J8F1 3DBLB 4AEJA 3VZJA 4P9JA 1F43A 4Y22A 1D0XA 4XJZA 2JG8B 5IAXA 1ULOA 1NUKA 1QOSA 1OUXA 2FF4A 3ABZA 2ARAA 4ANJA 3BJAA 2WAQN 4L5IA 2ME6A 1ST8A 2HU9A 1OCPA 1C1LA 1T38A 3JBG2 4P5YA 3CCQI 3CKHA 1RUD3 3M3IA 3EJKA 3Q8AA 2VG9A 1DGWX 5HLHA 1BR1A 5FY1A 3UNPA 2WWSA 5LW9A 4B1LA 4CP1A 1AU7A 2DYSH 3B01A 2K9NA 1RUJ2 4BQWA 4D7MA 2CNAA 4RGKA 5BNPB 4Q8LA 4BDZA 1H1MA 1I5PA 4D6SA 5JXJA 4LOSA 4M6YA 3ZYGA 1BBT1 4ZU4A 3GW2A 4A3ZA 5KK1A 3M9AA 3B94A 1COV2 2XH6A 2ZOEB 3KLSA 3OS1A 1XNBA 2C4XA 3VUOA 1FP2A 3DWLE 4A41A 3IKVA 1RRJA 1HW5A 2UV1A 1W6QA 4AHXA 1A36A 1OQ1A 1WZ2A 5B4XA 4CH7A 1QJY1 4IEZA 3WQBA 3LSTA 4PJ0C 4N90A 2V9KA 3OUIA 3ATGA 4ZHNA 3DN7A 1DLCA 3L2YA 3WHCA 2XKPA 3HVDA 3RQ0A 5I0UA 3OYHA 2EIBA 5GZFA 2FX0A 3KPHA 5C3EJ 3WHBA 1PP8F 1VAKA 3GTJJ 4A0XA 5C3OA 4TTGA 3K1NA 2VKDA 2DFIA 3AFKA 5D5WB 3L2CA 5A7SA 1YFUA 3V7CA 2RM23 3REOA 4DGWB 3V65A 1FBSA 2EIEA 2LALA 3UL2A 4BM8A 4MXWB 2M34A 2O3FA 3R6SA 3MAJA 5A7WA 5DXDA 4YW3A 2F5FA 2G7HA 1FTZA 5JLWA 4XXPA 4YM3A 3DEWA 5JSOA 2O5RA 3AFHA 4YM0A 2PLV1 4EM1A 3BOWA 2LDUA 1RGSA 1UHWA 3K7AJ 4OULA 3S57A 1C28A 4FTSA 5FKCA 2VB6A 5KHJA 2WUHA 3DP7A 1GVDA 3N7JA 3PU3A 3GZAA 1L7QA 1ONAA 5L9RA 2C0ZA 3ML6A 4HNUA 2PHXA 5A1FA 1LHNA 1OCCH 1BLZA 2DOFA 4D1QA 1GP5A 1OBNA 1G59A 2GIZA 3HOBA 1AX1A 3G2BA 1FAYA 4LUKA 4AQSA 1XDSA 3F3XA 5K5RA 3ZQGA 1VBD1 2IT0A 2BGPA 2D7FA 5JXHA 2I10A 4BOWA 3SQNA 4WVWA 3WG9A 1RIRA 5EEGA 4XF3A 3T8TA 3N7LA 2A3WA 2AACA 1VB4A 3H36A 4WXDA 1DU3D 3E3VA 3W2VA 5T50A 4XKCA 4HBLA 5GLZA 4IHXA 1RUD2 3AMHA 5ANQA 3V0BA 3A0KA 5D8LB 1QBJA 3X2QH 2LRPA 4AVVA 1VBB2 3LSEA 3ABKH 4MFEA 1VFCA 1L7RA 3WSOA 2ZJQF 1LOFA 2BVLA 2RNJA 1F4HA 3T1LA 3VBHB 5H6QA 2Q8DA 4GMP0 3ZIXA 5L9VA 1YX3A 3OGGA 1CD3G 2R0QC 3UK9A 1QNWA 3HT1A 4Q1RA 2KDZA 4ZH4F 5DUIA 4H4KC 4UUVA 1EV7A 3E1SA 3LAGA 1EYBA 1VBA3 4JX0A 5F32A 4U0YA 4JTOA 2XBO1 4LBJA 3K10A 1S7OA 4UFMA 3ZXEA 2OV7A 3IDBB 2XJPA 3USUB 3AMNA 5D6EA 1VPHA 5F37A 3J26N 1H9PA 4Y4YA 4QXKA 4E2QA 1GWMA 1X3WB 5J1UA 1TP4A 4AC0A 2HYJA 5EDNA 3USUA 4ZZ5A 4IE4A 5FO7B 4E8CA 3PUQA 2K3FA 1HA8A 3INAA 3U21A 2Q2EA 3WW1A 3IUOA 3G3ZA 1OR7C 1DYPA 3CD6I 4OYUA 2WY7Q 1EP0A 3HRTA 3E0JB 3OYNA 2QJVA 3ILNA 1JT0A 2QSGX 2LD5A 1QZZA 2EFWA 4LK0F 4CXYA 1XGNA 5IP9J 3LCPA 4KIFA 4GGGA 2RKHA 1WKYA 3ST7A 4C30A 1I3HA 2XPWA 4IHVA 3VBHA 2NOJB 5H9PA 3ZQIA 4NHMA 1OXCA 2ZX4A 2RJKA 2R5ZB 1K45A 5HPOA 3SJMA 2C6SA 2NNNA 3S14J 2K9MA 3F8BA 5FCCA 3V0BB 5E3OA 4D5FA 1YWKA 3QBQA 3K4LA 1OF3A 4Q5OA 3SH3A 1W6PB 1OQYA 3BQZA 2Q0OA 4NWVA 3S2WA 2PXJA 4HRIA 5FPBA 2JA7J 2VTXA 4CO8A 1G3YA 4XOGA 5CYYA 1F35A 2R7UA 2A5ZA 3ZN6A 1QWRA 4ES8A 2AXLA 4X6QB 3QYFA 1G9BA 2ELKA 2JUCA 1ZBE2 1YFXA 3RRDA 2HOSA 2JMWA 5LFAA 4K1YA 4I3PA 4GMP3 2PLV3 3POFA 3C2GA 4OMDA 2LTNA 2ZMNA 1JKRC 4CUBA 3A1YA 3FXLA 2VXRA 3DL3A 4HDVA 2V6CA 2VVEA 4IGOA 1D2QA 5F04A 2XHNA 4RR3A 4BMEA 4FE7A 4LLOA 4LO7A 5T5PA 3DU6A 2ZXHA 3P9KA 3FXKA 3JB8A 3WTWC 4Q4W1 4GO1A 4ZXKA 3OBTA 3X29B 1L0OC 2CUJA 4LKFA 3TQNA 5BNNA 2BWAA 5D4SA 2DVDA 3RZZA 2YROA 4O6JA 4IQJA 2DUQA 1A35A 3VZMA 2WO2A 1SEFA 4P9FA 5FWEA 4XF1A 5HDNA 2EXKA 1IJWC 3HN3A 2F4PA 5J96B 4K9SA 2KJCA 2KRCA 3ZYIB 2J1AA 3FZ3A 2UU8A 4MXWA 3I4NJ 5CVVA 2XSDC 4NC6A 3RZLA 1UIJA 5EXOA 5LBEA 3ELNA 2VCCA 3N05A 2PI0A 3MIEA 3VBOB 5LBBA 2FBIA 4NMIA 1G9CA 2V72A 4Y1ZA 1QPMA 4XZPA 3A0NA 4KBBA 2OPWA 3H8OA 3FL7A 4CRQA 2VXDA 1VRH1 3F21A 2BHZA 2UZKA 4C90A 3ZYBA 2DWRA 2Z33A 2W94A 3T0AA 1H1AA 4RS8A 3VDAA 1SDWA 4DS0A 4FASD 1SMTA 1NCQC 2R063 1K61A 4AI8A 5FZ3A 3MLLA 3OTFA 2Y0IA 5FK7A 1XSXA 1QJEA 2VKHA 4MOAA 4F83A 3WTVC 2P17A 1REFA 2OUHA 1ZG3A 1EJ9A 1R23A 1O5UA 2FQ4A 3SYTA 2R7WA 4AE2A 4CPBA 2L5QA 2XVLA 1V6MA 4XR6A 3KP3A 4MEXF 3IP4B 1H8AC 2R7EB 1W3XA 3R0AA 4ZZ8A 5BNPA 3OL4A 1ZBA1 1PNFA 2NVTJ 3B9IA 4AZZA 1ERDA 5C5UA 1QIQA 1VQNI 3KGLA 4MV2A 5BNOA 2ZJPF 4XDOA 5KBFA 1BI1A 3GVAA 4ARYA 4UFHA 1R1UA 2HS5A 1PO13 3KCCA 2PMUA 3N7KA 4DB5A 3EBRA 1AR72 2VO5A 1A3KA 1J59A 3NRVA 2ZXWH 1BQPA 5HDKA 1QOTA 3PUSA 5HVQC 5FPUA 2JG8A 4QD2A 3FLRA 3ZXLA 3NW4A 1L3LA 1TBXA 3D5SC 2NS8A 5IFTA 3VEPA 4M0NA 3FKIJ 5GJ6A 2HFHA 1CAVB 1TG7A 4DUVA 1JKOC 1GT0C 1PMHX 2DV9A 2GP3A 4OAYA 4UI9L 4ENKA 5JVTA 1NQJA 3IDEA 3MUY1 4K1ZA 4INDA 1IPKA 2QLZA 2K9ZA 3HRSA 1ZBA2 3H3UA 1UG2A 2X9DA 4MADA 4QM9A 1W7PA 1Q8OA 4DRVA 1REEA 1JMUB 3WTTC 3I2HA 1YFWA 3K4ZA 1YC61 2MYSA 3TW6A 1G2HA 4O61A 2PHTA 2IXLA 5I0RA 2ZSIB 4IETA 4FTBA 3DPRC 2YMZA 2ZX2A 1WRJA 1UY1A 3RVHA 1WMDA 2E19A 1RKWA 5CYVA 3K75B 4YVWC 4XHBA 1MW7A 3KZIC 3FFZA 2HWB2 4YZ4A 2Q8CA 3ZYRA 1Y8RB 4N53C 3GWZA 3JRBA 2B39A 2K4BA 4HPKA 4Z92B 4BU2A 5TRDA 1K5MC 1LGBA 4TYSA 2LREA 3F72A 3OIOA 4A69C 1T8IA 2O14A 3POGA 1GWLA 4FPCA 2F5EA 3EQLF 4DW6A 5FZDA 3WHUA 2EAKA 1JTYA 1BR2A 5BNNB 4DYCA 2N7GA 3J7HA 4G6QA 1XDUA 2WNUA 4IEYA 2DCJA 4IHYA 3ABUA 1UZYA 1S9HA 1R1A2 3DTKA 3CLPA 1U5TC 1QJZA 2BPA2 2JICA 4G7OF 2EVXA 2LY9A 1MVQA 5ACA3 4AGRA 3I7DA 4IO9F 4GIQA 1QGPA 5F2WA 2HI3A 2CDPA 1WCUA 5J47A 1IG0A 3RI4A 1XB9A 3NQHA 1XTAA 5KHDA 4BY1J 3MV01 3LA3A 2D6KA 5JI6A 2L4AA 2B7EA 2EZIA 4C0BA 4XE9A 4OHZA 3BUCA 3PO3J 2K85A 1HRI3 4PK4A 2WINB 4ASKA 4C2MJ 4IE5A 5A1AA 2E1NA 1FI2A 3ZN6B 4EVIA 3E6DA 3OR2C 4U2AA 3DLAA 1NCRB 4FOWA 2DK8A 4RB1A 1GFF2 1ZN2A 1IGOA 1V4RA 1JHJA 4GYGA 1RXFA 2Y75A 1SFPA 1W6PA 2D1VA 2VVDA 4A12A 5C5TA 3KT1A 4W65A 2EJRA 1QRYA 1PK6B 5IPAA 2J1SA 2R7SA 4QHZA 1BKZA 2ZGKA 2YB7A 1IV6A 3D5LA 4DZGA 2R5ZA 3H7YA 2RS32 3M1EA 3GZNB 5IOZA 4W6WA 3LSHA 2KIUA 4KDPA 3CDZB 3BPXA 4YG3A 3ZDVA 4ZZDA 1HLVA 3ABLH 2PFBA 4L9BA 5HCHA 4YZ1A 4QQ2A 4EJUA 3C7FA 3AZVA 2E7AA 3I3BA 1DGRA 5FKKA 1FOWA 5GPCA 3PJQA 1S1AA 1SLIA 1WI3A 4LO4B 2FJ1A 1Q8SA 1XU1A 2R7DA 4DQAA 1HQNA 1A78A 2C26A 1PK6A 4Q8KA 1O91A 1R091 2PAKA 4M74A 5FUNA 1S72I 1ND2B 4EMSA 4XPVA 1NK2P 3VD7A 5HCFA 2L3DA 5EYXA 3A4CA 4MNUA 4R9BA 3NWTA 3AZZA 1NCRA 2A3XA 5HXMA 4AFMA 1FSEA 3M4FA 2V79A 2WABA 3BVCA 2KIQA 4ZU5A 3FMSA 2XB6C 4EYUA 1OLMA 1JYTA 1W8WA 2XJQA 2XKOA 2OCEA 3FHNA 3AFGA 1YHQI 2QQJA 2HOEA 2E7XA 4IV1C 1NQDA 4DUXA 1CWPA 1OVPA 3K4NA 4AIJA 1IC8A 2FSWA 4PT6A 1MS9A 3BIEA 4QQLA 1S4CA 4A0YA 5F5QA 1QNTA 4O65A 3V4GA 5FBZA 1POQA 1RUI2 3ZMSA 2D43A 1SCRA 3UV9A 2QTWB 2ZGRA 2CGPA 3GJBA 2KT0A 4EROA 2E2JJ 4FOYA 5AIPA 1Y9QA 1UMQA 2DA2A 1RUH3 3I2JA 1JZ5A 1W8HA 4JDOA 3WW4A 2RGVA 2CRGA 1BOAA 1YIFA 4HONA 1H2NA 1T39A 3QACA 2Y6JA 2A6EF 4Q4X3 4MH0E 1RUOA 4D7TA 3AJYA 1OFSA 5CISA 3VDBA 4DZPA 5D5UB 3W6VA 1NK3P 1XMXA 3KLOA 1UOGA 2R1DA 2RS51 5DAPA 1PO11 3ZMNA 3H9QA 1HQWA 2LBFB 3M7AA 3EO6A 1WUVA 3ZXDA 3HIFA 2ET1A 2HYKA 1AR61 2DCYA 1KQ0A 3U37A 2M3AA 1WMFA 1PGL2 3BOPA 2EPFA 2HWB1 2VOWA 3NJZA 5JXGA 2RS12 3TN92 3FN9A 4RAZA 3VZNA 2XPJA 1DDLA 2X09A 2P8TA 1TW2A 2EILH 4XM3A 1NE6A 2XPVA 4YZ2A 3Q0WA 4AVZA 3ZMOA 5L36A 4AFAA 5A7WB 3HSEA 1K12A 2XAJA 1NZIA 2VW0A 3RZOJ 2F48A 1XD7A 1S8NA 1RMU1 1MSFC 5LHHA 1WCSA 3TRSB 2ACJA 4QQOA 1Y0UA 5DCMA 4AYBA 1LAJA 2VT2A 1CAVA 2JDKA 3P3NA 1VBE3 4FCAA 4Y5TA 3VDXA 1XCBA 5A80A 4OUMA 2Z3YA 4XBFA 1KXGA 3ENRA 1V5FA 1IQDC 1FOXA 1KYWA 1L7LA 4FPYA 2NRAC 1KU2A 4C1XA 4XFGA 2YY1A 1OSGA 5FY0A 4E4HA 2OXBA 5BNOC 4AHYA 3AP9A 2VULA 2MABA 4YG2F 5FBJA 1GZTA 2KIFA 4L5EA 2OU2A 1GKBA 5LWBA 4LE3A 4CCMA 2WNVC 1W6QB 4XKVA 1P92A 5BNOB 4ES9A 4YARA 4AF9A 3ZN4A 1W0PA 2FMDA 4AAXA 2EXJA 3HZJA 3S3OA 1TWHJ 2HDWA 3RKWA 4AD9A 1VMHA 3VHNA 1W28A 2O03A 2PBIA 4JX6A 3I97A 3L2WA 3BZ6A 1LOCA 3KSCA 3JRGA 1AYN1 3TO9A 1QJX2 1GVJA 2WS92 5I8YA 4LKEA 4A44A 2KLOA 1NX9A 4P9GA 3HOWJ 4U88A 4U87A 2IEKA 2ZGNA 1W8UA 3HQRA 1FNNA 3ZPLA 3N9QA 2WR9A 1BIBA 5F0CA 2E32A 4C91A 2OTLI 3MIGA 4Q0QA 5T55A 2F4MB 4EQQA 4KWJA 4XFIA 2WKKA 5KNLA 3AC0A 2JRMA 2HOTA 2WO3A 4GB32 2JKBA 5IT9Z 3CDIA 1JBCA 4BAYA 2P5BA 3H92A 5CQGA 4AQ2A 4KWLA 1PMIA 2YBPA 5FZ0A 4FPOB 1UY2A 3H3LA 3VSKA 3BR3A 3IIIA 5CU1A 2QQNA 2HWF2 4ZDOA 5AFEA 4AYUA 5BYNA 3CDLA 1PIV3 2OZUA 3FUQA 4XL9A 1K5MB 5G04L 1XYOA 2V6EA 2RMU3 4XOTA 1LHUA 1UU4A 5IVVA 2X6XA 2VZOA 4YZ5A 3DECA 1VRH2 4PI0A 3LEMA 2ZXJA 5K0UC 1OA2A 1VMJA 3BIWE 1UHSA 3ZQHA 1DPUA 2YR2A 4CA0A 4E7KA 4COZA 4IE6A 2R043 3BU7A 3DYOA 2BU9A 1J3PA 1C8M1 3OIPA 2VMCA 5LD2C 2K4JA 3EDPA 3IZOA 4CCJA 1TEIA 1SCSA 5LA9A 4LG0B 5FPLA 1W6MA 3HM5A 5LGNA 1G3WA 4WXCA 2BNMA 3F6VA 1GBGA 2IVJA 2VU9A 4W1UA 2NN8A 1B1BA 1R6RA 1D8KA 5CFDC 1FMVA 4S04A 1OKOA 2PEXA 1SD4A 4LB6B 2O9LA 3NV3A 1STMA 4DOZA 3FK7A 3WE2A 3JBG3 4N0BA 4DBRA 2IZWA 2JZYA 3WG7H 3BB6A 4BACA 4B48A 4GCVA 4KYWA 3ZMDA 2RDRA 1RVF3 1POV3 1FOKA 5HCBA 1C5HA 4LNVA 2DQRA 4U0VA 1JHFA 1J3QA 2A68F 2QYOA 1AYN2 2WS91 3W6KB 4CSWA 2Y2ZA 1R5HA 3LIGA 2PYTA 4YM2A 5JDBA 1HXDA 5D8AB 2J5PA 3PIOF 2DA5A 4AFBA 4UUTA 2ENRA 2VL4A 2L7KA 1VBD2 3PNVA 3ASIA 4LEJA 2R062 2ZGMA 5FP9A 4RHV2 3VYSB 3D8CA 4DQ2A 2ZEZA 2VOPA 3SQOA 3OL3A 3H9GA 3GZUC 1DIWA 3HGYA 3CCRI 2W08A 2K46A 3HKZA 3O2PE 3SEEA 4OMCA 1YFHA 1ULEA 1HXS2 3T0BA 5FZFA 1LOFC 2ZTNA 4OI1A 2FQPA 1W3VA 2LLKA 5IJRA 2O0OA 2R0HA 1VTNC 4GQ7A 3IKTA 2QQ8A 4ISRA 4LBKA 2BOJA 2WS93 1OCTC 1LESA 2Q2EB 2A61A 2A70A 2UWAA 1LFPA 4NDLA 3Q8EA 3JTHA 2AR6A 3T0DA 3CBNA 3DTEA 4TWTA 3H7JA 3BROA 1RHI3 2GALA 1MJ9A 4XLAA 1F4KA 3LFKA 1AR73 1USSA 3CHXA 3RZGA 2V26A 2ZJ2A 2YPDA 3ZR5A 2D45A 4PJLA 4CEWC 1UOFA 4KFCA 4MTDA 3VD4A 3GBWA 4L9VA 5JVVA 3PVBB 2D5HA 4C1WA 4IEVA 1SFEA 4WM8A 3OYFA 5K7PA 3I3QA 2MG4A 2ZABA 3P6BA 1I5ZA 1MBGA 3LSKA 1O57A 2CL2A 1HQLA 5DM7F 2WWYA 1J5YA 4HN1A 2UYBA 3ZN0A 1BJZA 5ABJC 1CQ9A 1OLQA 3AB0A 1I39A 2IS6A 2BQPA 3VL9A 2DW4A 1HV0A 4H2AA 3GZ5A 1GOGA 5M5YJ 4Y5SA 2L01A 4R52A 2IW5A 3TO7A 1NH3A 1SPPB 4KH9A 2K9SA 1QMJA 4XF0A 3EUKL 4Y1YA 4CTEA 4RSUA 4BYYA 1PZ7A 5CPRB 3H9JA 1WJAA 1V6IA 3G4SI 4A3MJ 2BWCA 3J7NA 3NWKA 2JB4A 3M70A 2BGOA 1ZVFA 1X3UA 2ZGPA 4Q4V3 3GXOA 4A3XA 3PQJA 4N43C 3RMYA 3C7EA 5A3NA 1MJBA 2GXBA 1MH3A 4RA2A 1IUFA 4GWJA 3ZFGB 3FMRA 3S1QJ 4W97A 4ZTJA 3MIFA 4XORA 3N4MA 2MNGA 4QX2A 4S2GA 2HYXA 2WNVA 1HC8A 1PO23 1HJFA 3QOPA 1LPQA 3MKZA 1F36A 1V9U1 1HRI1 5FFXA 4IRHA 3VD9A 5KXDA 3H1YA 2VLAA 5CG8A 1BA5A 3FHIB 2CSOA 1YLFA 1T98A 2JE9A 4I76A 1N3QA 2LY2A 3CJNA 5F08A 5FLVA 3OYCA 3LFMA 2RREA 5FDBA 3FFQA 4AI0A 1TE1B 1H89C 3O1UA 1Q56A 2O0YA 3EUAA 1QOOA 2WFPA 2VECA 4G94A 3DFGA 3RS6A 3HL2A 1ZGAA 5E1RA 1W2NA 3U4XA 4LULA 3KT4A 4P14A 3T2PA 2W52A 4ZYHA 2HEWF 4IPAA 1LJ7A 1ZH5A 2OW4A 3MV11 1AXKA 1KJRA 3O1MA 5FXWA 2VQAA 4JDNA 4JC1A 1W6OA 4MO3M 1W0TA 1JOJA 3IC7A 2A75A 2H8WA 3GXUA 3Q0VA 2CQQA 5DAQA 3OYMA 1XNDA 5DUKA 4KNYA 1MMDA 1Z3YA 2ELHA 4FE4A 2DA4A 2A6XA 2EA2A 3RPQA 1X9PA 1GZWB 2DOAA 2OT7A 3VYUB 3FBIB 5CKTA 1JOPA 1X3ZB 1ZR4A 1UAIA 1VB2A 5F5CA 3H8RA 1N78A 2QQMA 5FPVA