4I0CC

The structure of the camelid antibody cabhul5 in complex with human lysozyme
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
VQLQESGGGSVQAGGSLRLSCEASGLSTTVMAWFRQAPGKEREGVAAIYTGDGFPYYADSVKGRFTISQDNAKNRMYLQMNSLEPEDTAMYYCAAKTGAFSYGSLWWMSRAYNHWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title A nanobody binding to non-amyloidogenic regions of the protein human lysozyme enhances partial unfolding but inhibits amyloid fibril formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 34
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i0cC00
2VDKH 1V7MH 1RU9H 4ZFGH 4XPBL 5GJSH 5J6HB 4OD2A 5HD8D 3LV3A 3TJEH 4DN4H 1KNOB 1MCPH 4OQTH 5ITFA 1MCIA 2R69L 4JEGB 1MCHA 5IVZA 1DVFD 1E6JL 1JGVH 3HC0B 2FRGP 1HHHA 4PJ9C 4JFQB 4E9LA 2C7UA 5D1ZC 1KPVA 5J12B 1HXMA 1ZEAL 5HYJA 4NRZA 1P53A 1BQHB 3K8KA 3P11L 2BSED 2Q3AA 3MROB 5CCKH 3CDGB 2IPUG 4XP1L 5E8NA 4LLUA 3HPJA 4F7MA 3KPRE 3RAJL 4RFEA 4NWTL 3GRWA 2EH8H 2WBKA 1MY5A 3F62A 3TN0B 3WHXB 4R2GD 2XN9D 4PG2C 3QDHA 1J18A 4MJ4A 4Y88A 1IC7L 3PL6B 4GQ9H 4RZCA 3FT2B 1U8MA 3HG1B 4MS8D 3DUUB 3GSOA 2H26A 2PW2B 3MYJA 4XGZB 5GQBA 1JRHL 1ERNA 4P23C 3ARZA 5DWUH 4F33A 3LEXA 5FGBA 3NCBB 1G6VK 4JGMA 1MFDL 3AMKA 2C5DC 4WU5B 3WV0A 5I76A 1U36A 2GFBB 4CVWA 5CIPA 3VGGA 1G7LA 4H26A 3PUCA 4YHPB 3UZVB 3PE9A 4JFEB 5GRJL 1ITCA 5FDWB 5EU5A 5HGDB 4LIQE 3VG9B 4ERSH 3EOYG 2HRPH 5IVOA 3ARDD 1NBYA 4BQ6A 4OIIH 1CVRA 5CZXC 4Y4HD 4XP4L 4R4FH 4QLRA 4X5WA 1IM9B 4XBPA 2GJ6D 4I77L 1MCOH 3OSKA 3VD3A 4JZOB 4JFFA 2G75A 5DC0A 3CDCA 1YY8A 1A7OH 1NC4B 1JWSB 3VFPB 1UH4A 5EO9A 1SEQH 1NAKL 4DKFL 1ED3B 1HXYA 4JPVH 1E4XI 4EI6A 1FP5A 2FBOJ 2IJ0C 3N1QC 3U9UA 4HBCH 1MCBA 1NFDE 1NBVH 1TJHH 3FCTA 5HI5C 4RISL 5E1AA 4FG6C 3T2PA 3B4NA 4GRWB 3X3GH 3ZMRA 3VXTA 4IRZH 1S9VB 2ZUTA 4TNWF 4V1DE 4HUWB 3OJDA 4ZUTB 4EI5B 2YA1A 4M4RA 3ZT7A 3VI3F 1XFPA 5IHLB 3ZYJA 5EOCJ 2M2DA 5JPNB 4OZHB 5HHME 1DBBH 1J0ZA 1T0NA 4H0IA 1NBZA 1A6WH 4GFTB 1ZGLP 5ISZE 3LHPL 1KEGL 2VDOH 4AY0A 3JWOH 5F7KC 5E5RB 4Y16C 3BKCH 2EXYC 1IEHA 1H8NA 5L88L 1QFWH 3U6RA 2NY4C 1KGCD 4MAUH 2H1PL 2VXSH 3RTQC 1BECA 4W4OA 5MEOB 5GJTH 3MRMA 1MUJB 2P5WE 4FXGA 5CEYA 3U0WL 2LFGA 4N5UA 1EXUB 3P30H 1XH3B 1R0AH 4KMTH 1F11B 4IIQC 1LO3H 2P44B 1MIEH 5E2VH 3AS3A 4ELKB 4XT1C 1JNLH 1WEJH 1U8PA 2BVPA 1NGYA 2Z8WC 2VLRD 1CFQA 2L7JA 3RVXD 1G6RB 4NZRH 3KPPA 5T33L 4EOWL 5DRNA 3D3VD 1CWVA 3G6JF 4OUUA 1JL8A 1I1AA 3LEVL 2OSLA 4FZEL 4M62L 3UTPD 4M5YL 1KELL 3FN0L 1YJDC 2WBJD 4UMGA 4HAFA 4X4ME 3MV11 5E8DL 4YPGB 3DBXB 2OI9C 4L4TD 1C5BL 2PYEA 4I2XB 1XF2A 1AQKH 5BV7L 5F1IB 4B0MM 2XZAH 1D6EA 4PD4K 1VADA 1KJ3H 3DMMB 4Y2DA 1H15B 3DRTB 5HYIA 4KK8D 5FDYA 3DETD 4YBLB 4MLSA 3P4NB 1X5ZA 1JK8B 4HKJA 4P2RE 1D5BA 3QDME 1MRCH 2NTFB 1J8HD 4UV4H 43CAA 1QSFE 5KTEH 2IADA 2A77L 3W81A 4K7FA 4C83B 4HIIB 4MQXD 1OSZB 1T03L 1LWRA 3U36B 4E0RB 1MELA 2PTVA 2WAHA 1YN6A 4HWNA 2H41A 5FYLL 1T7VA 3UPCA 2VISB 2X4PA 5E70A 4GRLC 3OJ2C 4AENA 3V8OA 2VITB 3KJ6H 4IRSD 1QSEB 4X6DE 2Q6WA 1FYTD 1R5IA 3MR9B 4KK5C 4FFVC 4EN3D 2W9EH 4IEFB 5JW3L 3SGEH 4XWGL 3QNZA 3HUJB 4PJBF 1MI5B 1FHGA 2XZCL 3C6SB 4LPYA 5FGCE 2ID5A 1Q38A 4LF3B 4WTWA 4QOKD 2WIIA 3HZYA 4Z7NE 4ELME 4NQVB 1KJMB 4PJCF 4QHKJ 1KFAL 3LS5H 3CH1B 4YDKL 1E4KC 5CGYC 1F4HA 2IMNA 5E9DB 3MCG1 3RWGA 1JZ6A 4JR9L 2A9ML 4OF0A 3NCJL 2BERA 1LK2A 1DQDH 1CIDA 1MQKH 1BQHG 3CVIL 1X7QB 5IFHH 4X9HA 1ZV5A 2HWZL 4UIMA 4MJID 2BSRB 4YEEA 2ZUQC 4W4NA 1T89C 2AK4E 5DJ0A 2MPAH 1FAIL 1Q9KB 5DFVD 1CLYH 2XXCB 4JM2B 4G8EB 4XVUC 4U6XB 2DQGL 3C09B 4KHTL 4M7ZC 3BWUC 4MB3A 3UEZA 5HY9A 5GRUL 1S7VA 4L4VE 3VFGH 1JZ8A 3EOTH 4MJ6A 3IXTB 5DI8A 2R0LH 4RIRA 1NGXA 3L3HA 1Z9OA 4HV8B 3QIWB 2AKRB 4WEMB 2ARWA 5EZOL 4QXGH 3U7WH 2R0ZH 3MLRH 4RFNB 2VDLL 1UJ3B 2HT2C 4CJ0A 3VD4A 1HHKA 3C9NB 2BHZA 4I0PA 3U7AA 2Y5TA 1CICC 1BEYL 2C9AA 2CDEB 5JXAH 3RBGA 4N9GA 2AXJA 3ARGC 3GMPB 2OQJA 4LSVL 4ZO7A 5ANMA 2G60H 2DTMH 1I8KB 4NNYB 4G8GA 2B1HL 2NMSA 3ULUL 1S7RA 3EYOA 3TYGL 3A0OA 3PP4H 1P4IH 2VH5H 1U3YA 4GW4B 2DQEH 5F6HI 1ADQA 1HSBA 1IGML 4WUUD 4DAGH 1UQSA 5C6TH 1HSAB 3PGDA 4CADA 1U58B 1F02I 4E41A 1RVFL 1U92A 4NFDA 2O26U 2XY1A 5L2KE 4GG8A 5DD5L 5JO5B 1MH5B 1D5IL 1U2HA 1A1MB 4FQ1L 4MXVE 4MMXC 4G6FB 5ACLA 5DJYA 1KIPB 3WN5B 1SVCP 5TQ2H 3PNWA 4KV5E 5C0FB 4WDIA 4CUCA 2ZUUA 2F53B 1TDQA 3LDBC 3RKPA 5I66A 4U1NB 5BS0E 1AJ7L 4H8WC 2VN4A 5I2IA 5FYKH 1FO0A 4BH8A 5GGSA 4LLQA 5J3HC 1YNKH 4MDIB 1A7QL 4HCRH 3MRDA 4G9FD 1D9KB 1SBBA 5DJCB 4OLWL 3QUZD 1JE6A 4UNVA 1QRKA 5DZNA 4N8VA 1JPGB 5F96L 4PJFE 5IM7B 3SO5A 1U8LA 4N1EA 3V0VB 4FQQA 1F00I 4WW2B 5JW4M 3DSFH 3AVEA 5FAAA 3L3GA 2AJSH 2AQ2A 3QEQA 5LXGL 5IVNA 1MCCA 4P3WA 1Q72L 5KS9E 1XCTA 1LE9A 1S5IH 4WI9A 3S96B 2IANB 1IQWH 5CILH 3TZVD 4Q9CA 2YPKB 4H5SA 4C57C 5M7QA 3EUUA 4O58H 2CRMA 3H0TB 4Q2ZA 2HJKA 3MUZ1 1K8IA 1B4JL 4XVTL 2K7PA 2V5RA 1YNLH 1FG2A 5I8CB 1EJOH 5ID1A 4FQXC 1IE5A 3W9EA 3KYOA 4KU1A 2D0FA 4R3SA 1U6AL 4PP2B 3KYKH 4OLXL 2BXZA 3RDTA 4ONFL 5DD6B 4K9EL 1AIFA 4HUUB 1IL1A 3SE8L 5DUML 3ARVA 4PGDB 3ARRA 4CN4A 5KG9B 2PCPA 2VE6B 1I3GL 2BZDA 2QQNH 1N7ML 1S9WA 2IC2A 3RKDD 2D0GA 2BHUA 3CMOL 3RL2A 5ALCH 2UZIH 1IMHC 4KWUA 2DICA 5D7LE 3S35X 4M1CD 3C60B 5IMOB 5KANG 2EYSA 4KUCF 3MLYL 4NQCA 5DRXA 3ZTJH 3X14B 2RQ8A 3GFUA 4S1DD 2NY5H 3LB6D 1HKFA 4U1JB 1XF3B 1UKTA 3ZO0A 3WUZA 4DVRH 1E27A 5LGKA 1WCBB 2FGWL 3DROA 2X9XA 2VXQH 4HLZH 4YAQB 1T3FA 2J3SA 4HFUH 3ZKXB 4MNQB 5JNYB 2BDNL 1LEGB 2EKSA 4NJ9L 1A4KA 2ESVD 4GT7A 5IB3B 4LARH 2VXVL 3X12B 4XBGA 2ITCA 3N1PC 4HUXA 1JNHA 4OCXH 2A6KB 2RGSA 4Y19B 3EFDL 1KT2A 1EHNA 4UB0H 3GM0A 1PAMA 3T4AA 2KZ1B 3VXUD 3BX7C 2W92A 4P5KA 1A21A 2B4CC 3IJSB 1YA5A 2CRIA 3RVWC 3C8KA 3H9SB 4IIQA 1N64H 1TCMA 2F58L 2FD6H 2OTWA 5GISL 5KSVB 4HUVA 5F21B 5C08B 4S1RL 3ECBA 1BLNA 5EH1A 4UT7H 5C0EA 1Q9WA 3VGAB 2CKBA 4JFOA 3JV6A 4TVPL 4KI5C 1ZT4B 4NO0D 2Q7YA 4Z0XB 3LKRB 1QZ1A 1U8NA 1YY9D 2D3VA 4LAJH 1CK0H 3MRRB 3QIBD 5I0ZA 4OGAC 5KSBB 4KZDH 2Q7NA 1I7UA 4F9PA 3UBXI 4POYA 2EDKA 3HG1E 3RY5A 4XVSL 1UWEL 3RWHB 5IUSA 3QH3B 4H88L 3E2HB 2X4UA 1FAKT 1Y0LB 4KJYA 5E8EA 2HN7B 3U79A 3DO7B 1A7NH 3NFSL 5DMGD 3C6LB 3OAYH 1X5IA 5CBAA 4WW1B 4XPTL 4PG9B 1SMOA 1UA6H 1MWAA 1HQ4B 4JFEE 3V6BR 3FQNA 4CU8A 2H32A 1MFEH 2OCFD 4LFHG 4J8RB 5D7JB 3MRCB 1RZGB 1CL7L 1RUAL 4GKZA 2H3NA 1NEZB 1A14L 1EEQA 5FOBA 1ZK9A 5DO2C 4LP5A 1QRNB 5TGBB 1CBVH 4AEIL 5ESVA 1QHOA 1WTGT 2G2RA 1E28B 3UTOA 1DQMH 3RIFK 2H8PA 3RI5F 3TT1L 3PDOB 4GRLA 1VPOH 1OTUD 1DBAH 1R5WB 2MNUA 1ZHKA 3IU4H 3FQRB 2N1KA 1XGYH 4JVPA 4XNZC 1VFAB 3MUGA 2BRQA 2CRZA 4GQPH 5F7DB 4JM4L 2Z91A 4PLNC 5EU3B 2X89D 3E1F1 1X5GA 4K07A 4YHOH 1QBML 4HUNB 4NKDA 5DVKA 4KI5F 2VL5B 2ORBH 4I9WE 1CFSA 1I85C 2DS4A 4H1LA 4UAOB 4XXCA 5FK9A 4OIBA 5B39B 4D9LH 3OF6A 4DFIA 5CJXA 3NIDE 3PABB 3G6AB 5I18H 3BZEB 5BZDB 4ZYKA 4ALAL 1INQA 3B9KC 3T3PE 4BQCA 4RNRA 1CD0A 4MA8L 5DVOA 1X5XA 2IQAA 2OZ4A 3GDBA 3L5WB 4OZHE 1UZ8B 3SDXB 2JJVA 2IFFL 3QPXH 1W0YT 5F1KC 5FA3A 2DAVA 2Y4SA 3GSUB 1AGFA 5IMKA 1T89A 1ZTXL 5D2NB 4CVXB 4MZ3A 1FIGL 3TA3C 1UWXH 5KVDL 3F5WB 4WHDA 4NKOA 1UVQA 3HS0A 3ARBB 3I75B 5IROC 3G5ZB 4MD5A 1AY1H 2W60B 3L5XL 4M7LT 2MQCA 3QXDB 1K4CB 4PJEF 5CD3B 2BVOB 2IAMB 4YQXL 4GAJH 3WE6B 5DD0L 3JTSB 5H94A 1G7JB 1WK0A 4MD0A 5EOQH 1U93B 3G5XA 4K3JL 3U7YL 4Y5XB 3S98A 3QNYB 1IGFH 3CK0L 4KVCL 1MF2H 4OSUH 4XPFL 5CBEA 1QLRA 2D7TL 1CICA 1U8JB 5BO1H 4UQ2B 1RJZB 3OL2A 5EBGA 2C3VB 3REVA 2FL5B 2Y36H 3ARGA 4FZ8L 5DGQA 5IBLD 3DXAB 4M6OH 1YYML 4BFIB 3DV4A 1MCSA 4LP4A 3SDDC 1WFNA 4IMLB 1MCQA 4WUKH 5EB9A 3RWDB 2I07A 3BKYH 2N7AA 2Q3ZA 2XPGB 3ZHLA 1YZZA 3VFVB 3DX8B 5I17B 4YFLI 3B2VH 4QY8B 3IDMB 5A2KH 3BGMA 1CD1B 3ULVH 1T1WB 4JVUA 4JO2H 2YPLE 1ZLSL 5LCVH 4I2XE 2UUDH 5E6IB 4EBQH 2BSTB 1MCEA 1VEMA 5I6XC 1E6OL 2F54B 3M1BB 3ILPA 4NO2A 3I02B 3WNLA 1MJ8H 4OZGF 1EHAA 4G7VL 4QHKI 3S36H 2GEEA 1KEMH 2A2QT 4PRPA 4LNRA 3HMXL 1UC6A 3Q6GL 2UWEB 1MAMH 3F8UB 4X6CF 4YGVB 4LLVB 3SE4C 3AAZA 1DQLH 2X44D 5AUMB 3SKJL 4ZFZA 1GOFA 1FFOA 1UWGL 3NTCH 4OV5A 5KVFL 1OAQH 4J4PD 5D96B 5J1AB 1CXIA 1RZIA 2R2EB 4BSVB 1QSEE 1W8NA 3PQYA 4NKIL 5DMIH 3OJVC 3VXQB 3CZFA 5EOTA 1R3IL 2P5WD 2BFVL 1TJIH 3HUJE 3HNSH 2VUYA 1MI5E 4XPHL 2VDNH 3PF2A 5KVGL 4NUJB 1JFQH 1WBYA 2A73B 4HJ0C 5CWSA 2JELL 3GSVA 5FOJA 3V4UL 1FZKA 4NDMB 1D5XA 3JSSA 3CVHA 5EC2A 3VRIA 1WWBX 2YD1A 1FN4B 3MOBL 4NUGL 3G04A 4J3OC 5K9JL 1VGEH 4NKQB 5IVXF 2ICWJ 4MJ5A 3MNVA 1G0YR 4R97C 5MEQA 2CK0H 5L7XL 5DJXA 1V3KA 2G5BB 1AGDA 1X44A 3A6CL 1I7TB 2Q8AH 1JHKL 1F6FB 5A3IC 4Y7MA 4OLVH 3DV6A 4G6KH 4FQXA 1I3RB 1VERA 4P99A 3RIFF 5TPWL 4R4BB 3O9WD 4PLJD 5IJVB 1ZS8B 2QHRL 2I9TB 1C7TA 1GAFH 1KCKA 3BQUC 2MOVA 1A9EB 1P7QB 3LPFA 4X7TB 3L3IA 5EN2A 4G8FB 4XNQA 4XNMA 3SDCD 1MHHB 1IC4L 3RPIA 4TUOB 3GZKA 3O81A 1IQDA 2FHCA 2ZSVA 1Z9MA 7CGTA 5F6IB 3TPKA 3G6DL 4EVNB 3L3DB 4NQXB 5DXWA 2IBZY 1DUYB 2YXMA 3AXLA 2R2BA 4FTVA 4BH7B 1T66C 2WV3A 2FZ3B 4JFDE 1FIEA 4LEXH 4HXAL 3OQ3B 3QULB 2B0SH 2FATH 4K7PY 1SBSL 3ZT5A 1P9MC 3D85A 1NEZG 3QWOB 1AKJD 3VXPA 5BZWB 1AR2A 2WZPD 3MV9B 2R29H 1IAOB 3IFLH 4X99B 1T0MA 5DHVA 4IS6A 2EDLA 4NN6B 3O2VH 2AEIT 3L3KA 4XMPL 3GMRB 2GSIB 3SDYH 1XZ0B 2DQCH 4X6EB 1A02N 1J0IA 4OCSH 3QUXA 4ZUSA 3MRFB 4GOSA 3BAEH 4D9QE 4XCNB 5TE6L 5DTFA 3VXSB 3MV7A 4X80H 5E2UH 3RVTC 4POZC 4F15C 2IBBA 3IGAA 1KXVC 2E7HA 2J5LB 1NGPL 2QSCL 4OD2B 1T2XA 3LKQA 1WSST 2EE3A 3FFCD 5B39G 1IBGH 3GSNA 1U8QA 5ITFB 5AG9A 2VQTA 3QG7L 3L7FA 5GGTH 5J1TC 5F44A 2AK4D 5IVZB 4ZTOH 1EEYA 1OW0A 2F53E 2JJWA 1HHHB 2KUTA 1OVZA 1F58H 2C7UB 2VUOA 1BREA 1KPVB 1PSKL 4RX4A 3VDBA 4O2EA 4YIQA 4D94A 1HXMB 2OXHA 1Q0XH 4OLYH 5I19L 5HYJB 2I60H 1I4FA 4NRZB 5FEBA 4L4VD 4OJFL 1KC5L 5E8NB 4LLUB 3HPJB 1MNUL 4F7MB 2PXYD 1OAKL 1YQ2A 1UKQA 4RFEB 3T0DA 2GITA 2GKIA 5F7NC 1MCWW 3FOLA 1P6AB 2Z31D 1HE7A 2ZG2A 3MLSL 5KSAD 5CIPH 4GO6B 2BJMH 3GSQB 1QPXA 3IDGA 4RZCB 1HEZA 1U8MB 4AMKL 5CEZL 2NZ9C 4Y4KD 3D87B 3GSOB 4B41A 2H26B 4TNVK 3MYJB 1KCRL 4QHUA 1IC5H 4NP4H 5JQHC 3N9GH 3HE6C 4PJ7F 4F33B 2HKFH 2EEBA 4KKAC 3LEXB 1GPOL 4HF5H 3GBMH 4PRIA 1T20A 4P48A 3G08A 5CIPB 2X05A 1G7LB 3B8YA 4H26B 4ZUUA 4LSPH 4MAYD 1NMAL 3GI8H 1U8HA 1B4RA 4LRIA 4QNPE 1BX2A 1HCVA 5EU5B 3TC9A 2R2HA 2B8OT 3C5ZA 4BFEA 4L8CA 1KCSL 1X6NA 4R9HA 4RFOL 1NBYB 2X4RA 1OSPH 5L2KD 3UDWA 2E27L 4V2BA 2IPUK 3D2UD 3EYQC 5I1DA 1EPFA 4X5WB 4JHWH 4XBPB 1C5CH 2HH0H 1AO7A 1H5BA 4JFFB 2G75B 4G3YH 3SY0A 1YY8B 3V7MA 1JRHI 3BSZH 3SE9L 3ZDYE 4OF3A 5EO9B 4GAFB 5ICZA 2ADJA 1HXYB 4GBXC 4EI6B 1WWAX 3B9KA 2DIBA 3U9UB 2YUVA 3PDDA 4NQDD 2DKUA 4Z5RA 1KJ2A 5ILTL 4DCQA 2VQUA 5E1AB 1OP9A 4C4KT 1TVBA 1V3MA 1GHFL 2A9NL 4MA7H 3VXTB 3LS4L 4MNQE 2NX5D 3UZQA 5E1HB 3TA3A 3OJDB 1P4BL 3CSYA 4X6CA 1DFBH 4HK3N 1N2RA 3EYSL 1DSFH 5IROA 1EBPA 2FCBA 4P5MA 1F3JA 1NFDF 1T0NB 3CNKA 4GKNA 3RWJA 3ROOA 1NBZB 4Y19E 3T8XA 1EMTL 3EJZD 2BNUA 2RCSH 3HE7A 1JZ3A 1DJSA 2V6HA 3U6RB 4S11A 4YDLC 3TV3L 3H9SE 4R4NC 1W72L 5C08E 4KK6D 5HVGB 2HFGL 3PGFL 1AXSA 3MRMB 4FXGB 5CEYB 2F74A 3ZSSA 4HQQH 4L3EA 1LO2L 3SDDA 1S7QA 3Q1SH 1ZEAH 3LIZH 1YEFL 3EHBC 5KSBE 4BZ2H 3LQZA 4K8RD 5I75C 1U8PB 3MODH 1L9NA 2BVPB 1NGYB 1JBJA 1EAPA 4KRPC 2DQDL 4XNUL 2IWGA 1CFQB 2ADFH 2BNRE 1K8DA 3KPPB 5DRNB 4OUUB 5C3LD 1S7TA 1I1AB 2OSLB 2QQLL 1CXKA 3W2DL 4WFFD 4DEPC 4ZAKD 3LH2H 3RP1A 1ZANL 2PYEB 4ACPA 2K3TA 4RMWA 2ZUVA 1XF2B 5J8OA 3SE4A 1FVEA 1MFDH 4JN1L 1D6EB 1VADB 5EUOA 5DK2A 4Y2DB 3H2WA 5B38A 3LMJH 2IPKA 3RGVD 4I3SL 2ENYA 5TF1L 5KANI 4HKJB 3CAFA 2GY7B 1D5BB 4X9IA 43CAB 2NY2B 4CMMA 5EU6A 2IADB 1ZOXA 4K7FB 2JIXD 4GXVL 2EH7L 2JB6A 5I30L 1VCAA 1AXTL 4HWBA 4V2CB 1YN6B 3QEUA 3O6FA 3TBTA 4XH2B 2V17H 1RK0A 1UYWL 2X4PB 1FCGA 4AENB 5JIPA 3UO1L 2Q6WB 3SE3C 1R5IB 4LQFL 3ARSA 4JRXD 3QNZB 4Y4FD 3H42H 3W0WD 4XHJD 4KHXH 4TNVF 4LRNH 1KXQE 2WIIB 3HZYB 3CFIC 3PWNA 3ETBF 4XCYA 2I26N 3QXUA 4QTIH 3VWKC 5CEXA 2P42B 2H2SD 4ZXBD 1VEOA 3HG1D 1OGTA 4OZFH 1RUMH 4X6DF 5JDSA 4Q6IC 4RISH 4XBEL 3RWGB 3MOAL 4JDZA 2JK5A 4PS4L 5D7IA 5D2NE 3GMLA 3LPWA 8CGTA 1LK2B 1FNSH 3BQUA 3PIQA 2XWJA 3EO9H 5IOPA 4Z7NF 2JB5H 4OD3H 5JHLH 4R7DA 2DDQH 4UIMB 4B5EA 5ITBL 1Q9OA 3QWQB 2BX5A 4MWFA 5EORH 3JTTA 5EWIL 4HD9A 5DJ0B 3LHPH 4F7PA 1KEGH 3GI9L 4OBRA 2F5BH 4U6HA 2XKNA 3FB8A 5L88H 3BE1L 1JGDA 2VDRL 5HY9B 1L0XA 3MCKA 1S7VB 3SGDI 4MJ6B 4ZOCA 1IM9D 5DI8B 5FHAL 1RULL 4RIRB 1EO7A 1NGXB 3L3HB 1IGTA 4NM8H 4WTZG 2CO6B 1P9MA 2DMCA 1T5WA 3CGTA 1DUZA 1R3HA 3T0ED 1UCTA 3MXVH 2NY3C 5MP6L 4FOMA 1P4LA 2NQCA 1E0OB 3JBG7 5JHDD 2APWA 3V6OE 1HHKB 3KPRA 4A2LA 4I0PB 4I3GA 1EH9A 3F7PC 2Y5TB 4PJ7A 5K59E 4N9GB 4I9WD 1ADQH 4PV8A 2AGJH 4G6MH 2OQJB 5ANMB 1F45A 1G84A 3O8XC 1Q9LA 4OI7A 4U1GC 2C3HA 5FHBH 1V7NL 3DECA 3MXWL 4G8GB 4JCMA 5IHBA 1S7RB 4EI5D 3EYOB 2F54E 4FZEH 4U0RB 4YFLF 4M62H 4M5YH 1PX3A 5CZKA 3IJHA 3SO3C 1JJUA 3BESR 4LCWD 1HSBB 5F9WC 1UQSB 3ULVE 2N4IA 3PGDB 4CADB 3JXAA 1C5BH 2Z92A 4KJWD 1IEAA 2R4RL 4YBQD 1SYSA 3OBAA 4E41B 1UCBH 1U92B 2CDGA 1CDJA 1YQVL 1FE8L 2ZCLL 4GG8B 1T80A 4P5TC 4M02A 3QUYD 3TIDA 3WSQL 3FB5A 2P49B 1OCWH 1EVUA 4U7SA 5DJYB 1T21A 1EHXA 4XAWL 3PNWB 4MQSB 4WDIB 3RX8A 4PV9A 2C4FU 5I66B 4NBYB 3F6LA 1T04A 2EC9U 3K2UL 4WGVB 2LV4A 5I2IB 1FO0B 4BH8B 5GGSB 4LLQB 5FYLH 2VWEE 3ESVF 1T5XA 3NCCB 1FPTL 1VESA 4FMFA 4QRPB 3MRDB 4RWYL 4MXVF 5K9QG 1EFXA 1QLEL 5D70H 4N8VB 5CJOL 3KLHD 1CDUA 4KV5F 5ENWA 2R9HC 1U8LB 5KJRL 1RIHL 4FQQB 2GJZA 2JJTC 4LLWA 5ELIA 1RIUL 2HFTA 3L5IA 4WV1A 3L3GB 3ARFD 4NGHL 3B43A 2E3VA 3QEQB 4YX2H 4M6NL 5JIHA 2VDMH 5HVHB 1KFAH 1MJUL 3FO0L 2K1MA 1XCTB 1LE9B 3BPLC 1FC1A 5IW3A 4PJFF 3NCJH 1H3VA 2YD6A 2AQ1A 4H5SB 1GJIA 4RGND 4Q2ZB 3DMMD 2HJKB 3B9DA 3BEWA 1K8IB 1LP9A 1FG2B 4KQ4L 2HWZH 4R7NA 1OHQA 5ID1B 3W9EB 3KYOB 1NLDL 3G9AB 5J13C 4R3SB 2YUWA 4OB5H 3WIFA 5KS9F 4K3DL 5FB8A 3E3QE 5D1QA 2X4OA 3NABL 1VENA 1PLGH 2ZUXA 1MAJA 3RDTB 3KJ4C 3RWFA 1AIFB 2QSTA 3WKNA 1IL1B 5F9OL 5H35A 4KHTH 1JV5A 2DL9A 4X7SL 4B7LA 5GRUH 4NHUA 2YD2A 1QSED 3UC0L 4DGVH 1OQXA 3FTGA 5J12C 1BFTA 1S9WB 4RSVA 4Z7OE 1CZ8H 5E4EB 3HI1A 3H3PH 1MRDL 4ODSL 1KSRA 1WWWX 3S8WA 2C3XA 1MI5D 3MV9E 2VZUA 4NQSA 1ORSA 2CLRA 2EYSB 2O61A 4NQCB 5DRXB 2A74A 3ISWA 1OLZA 4OCLC 1BEYH 3RJDA 4LASH 3TN0C 4N8CH 4ZTPH 1E27B 1MJ7L 2NY1B 5E9DD 2CKBL 3DROB 3PL6C 1VSCA 1RZJH 4AK1A 4QCIA 1T3FB 5JQ6H 3ULUH 2EKSB 1FH5H 5FKAA 2CJUH 2ZG1A 3TYGH 1AP2A 5AYUH 1A4KB 5FYLD 4NC2B 4Z7QE 4S2SA 1EHLH 1YJDL 5BJTA 4XBGB 2ITCB 2MCPH 3AMLA 5C0RH 1CFBA 4PJGA 4HUXB 1JNHB 3DARA 1B6DA 4JDTL 2XY2A 1GVIA 1OT1A 2EYTA 1ZAGA 3GK8L 4PYHA 3T4AB 1AD0A 3IDNA 4P5KB 2DMKA 4P2RA 1BOYA 3C8KB 5HYJE 2DTSA 3QDMA 2CPCA 4IIQB 2OTWB 5LGHH 4HUVB 4ENED 1WVZA 4TQEH 4KROD 3ECBB 1BLNB 4PJDA 1MAKA 3QIWD 3QWRD 5C0EB 1Q9WB 2VMFA 5DJDA 2CKBB 4HG4J 4JFOB 2L7UA 3JV6B 2CKNA 1S9XA 5F7HA 3CLEL 4HK0A 1RAMA 2Q7YB 1AJ7H 1WITA 4X6DA 5JW4Q 4XNYH 2RAMA 4EJ1C 1U8NB 3IDYB 4PGBA 1PY9A 1QUNA 3HRZA 3SGJA 4NZTL 1FZMA 5DZOA 1OTSC 2QR0A 2GTZA 3RVUD 3EDFA 1I7UB 2V5MA 4NC0B 5LWYL 4Y8DC 1T6WA 3P4MA 4WI5A 5E99L 4JDVA 2OI9B 2X4UB 4U1KA 5HVFB 4KJYB 5E8EB 4NPYA 5DLML 3GIVA 1LO0L 1K6QH 4ZFFA 1CGSL 5CBAB 1DLFL 1UKSA 5GIRB 5I71B 4LEOA 3MNWA 1MWAB 3QG6A 1Q72H 1QBLH 4OCYH 1XF1A 3FQNB 1M7XA 2H32B 2D03H 3IFPA 4D9QD 4GKZB 2H3NB 5FOBB 2J88H 1H3WM 1T1YA 3QJFA 4XVTH 4QXTA 4R90H 5ESVB 2ICES 2G2RB 2FEEL 3TFKD 3Q2CA 4MNHA 2OXGA 1KB5A 2EIZA 2OZ4L 3ZL4H 2H8PB 3UCRA 1P84J 4G6FD 4Z95L 1E4JA 4GRLB 1N8ZA 5CEZE 1ZHKB 1CLZH 5IK3A 3VA6A 4JFFE 3MUGB 2F53D 4UDUA 5T5NG 3H9YA 1EO8H 5DF0A 3MACL 2Z91B 3ZYOA 3ULUD 5C0AA 3OZ9L 1U2CA 1N26A 5INDA 1UACL 3JWOC 3VWKA 3K80A 4G43A 4NKDB 5ICYA 1CFSB 1N7MH 5HYSA 4WWKD 2EZ0C 4H1LB 2ZZUT 3PHOA 3MRQA 3CMOH 5FK9B 1HDMA 2HT4D 3KR3H 1I9RH 2OL3A 3QEGL 4IMKC 4OLZL 1OP3K 4ZYKB 1INQB 5MHSE 4HJGA 1HILA 3T09A 4RNRB 4FFZL 2IQAB 2X1QA 3MJ8A 5F7WC 3SKUD 2CQVA 2VLKD 1UFUA 1IT9H 2IAND 3CX2A 4NHCL 2YWYA 2FGWH 5FA3B 1AGFB 4U31A 3EGSA 5IMKB 5JW4R 1FQ9C 1NSNH 1FNHA 3BYTA 3NIDF 2HYMA 3JV4A 4IOSD 2PO6D 4NKOB 2NYYD 1UVQB 3HS0B 5BCAA 4M7ZB 2CGRL 1QO3B 1C7SA 1ZWIA 3T3PF 4MD5B 4N8VG 3VXMA 3VXOA 5GS1C 3OG4B 3UP1A 4OZHF 1N6UA 2WINA 1PD6A 2PTTA 5H94B 1MREH 4MD0B 3BRFA 4JREC 5DA4A 2R39A 3G5XB 2XNAA 3OG6B 5CBEB 1QLRB 1BJ1H 2F58H 4QTHA 5GISH 1CICB 1T83C 3REVB 1PBYA 3ARGB 3GSWA 1JNNL 3DV4B 5F88A 4TVPH 3O8XA 1LEIA 1KYOJ 4H8WL 4X6FA 3LSOA 2VLMD 2I07B 4RDQG 1TNMA 4ZPVA 2ENSA 3FO2A 3RWEA 3HPLA 4XVSH 5ESQA 3BJLA 4LU5H 4AL8L 3BGMB 5DD3H 5K9OA 1M7DA 2H9GA 4OFYD 1OP5K 5KVEL 3WXVL 1B3JA 1RURH 4PLKC 12E8L 3INUL 3NFSH 4MNQD 4UNUA 1ACYH 2O5ZL 3H3BC 2XT1B 2ZCHH 1DVFA 3ILPB 4NO2B 3TO4C 1GZQA 3FOMA 3MRNA 2PF6A 4XPTH 3CVHL 2AABL 4PRPB 4P57A 4AH2A 2IG2H 4LNRB 3SCMD 1H3PL 3SKNA 1CL7H 4OCNC 1RUAH 3AAZB 3VXRE 4JJHA 1I1FA 2RBLA 2D4FA 4RMQA 1SJXA 1F4WL 4GAGL 4ZFZB 4OV5B 1FFOB 5AD0A 2BY0A 3HNVH 4C54A 1RZIB 5HBBA 4JM2C 4DGYL 1L9MA 5C08D 3B83A 3PQYB 4PJAA 3WFCL 3C09C 4M00A 5DMJB 3CZFB 5EOTB 5FUZL 2FLRT 1SM3L 2G9HA 5FCSH 4ZNCD 3SJVD 4Z0BH 5MERA 1HHIA 3GHBH 1J1OH 1WBYB 5CWSB 2GAZA 3GSVB 1MPAH 4IOFD 3NH7H 1ZA3A 1FZKB 4TUKH 2XZZA 3L1OL 3FN9A 4RFNC 1D5XB 1QBMH 2CO7B 3ARED 4PJ5A 3CVHB 5EC2B 3VRIB 1QYGL 1UJ3C 1XT5A 5EC1A 4M43H 4L3CA 4M7KL 3DIFA 4N90E 3G04B 4LCIH 3IVKA 2YRLA 5JUEL 4N0FA 4MJ5B 3MNVB 3HUJF 3C6LD 1VFOA 2Q87A 5MEQB 3NA9L 4I48A 5DJXB 1AGDB 3J7HA 4NBZB 2VQ1A 1X3DA 5T1MA 2CK2A 1AGCA 2VKWA 3DV6B 4FQXB 2IFFH 4ZS7H 3JUYA 2QADB 4WI4A 4BA8A 1K3IA 1ZTXH 4WFGD 4Y4HA 3DI2B 4TVPD 1FIGH 1G7HA 1QRND 3L3IB 2XKSA 5EN2B 5GZOC 1A3LH 4XNQB 4XNMB 5IEHB 3NAAH 1CDGA 1ODAA 3O3UN 4MVBD 5EIVA 3RPIB 3CFJA 2IPTL 1CDHA 5LQBH 1IQDB 2ZSVB 3MGTA 3VE0A 4HWZA 5I8OL 4JKPL 3IS1X 2EDQA 3AXLB 2R2BB 1I7RA 1I8LC 4FTVB 5DFWH 2WWMC 4JM2F 3C8HA 5BW7A 4OZ4A 4URTB 5DHVH 2B4CL 2EO9A 3MZGB 5T1DL 3UXFA 3CK0H 1HNFA 4MGXA 3WLWD 3QDGD 1Q1JH 1J88A 3M07A 1SJHA 3D85B 4Z8FL 1YYMH 5ANME 2FDBP 5DR5L 3VXPB 1VA9A 5GSVA 1FV1A 4HMDA 1D9KC 4G8GE 1WT5A 5JOPD 5E6ZA 5DHVB 1T0MB 5FGRA 2W65A 3T2NL 2AJVL 3N0PB 3L3KB 1EJ6A 3QCUH 1E4XL 1OD9A 4WW2C 1TPXC 1AR1C 3OR7A 5E2WL 1ZT1B 1ZLSH 1JMXA 3QUXB 4ZUSB 3IAQA 3BKML 3ZKMD 4E41E 5DTFB 3VD7A 4NZDA 3MV7B 1A64A 3CD4A 4OT1L 3ARBD 4JB9H 2B20A 1WF5A 3IGAB 3VFMA 1JF5A 3LKQB 4H1LG 2X1PA 5IWLA 4CW1A 1DN0A 1JF6A 2J4WL 1LNUA 3GSNB 1NCWL 1CR9L 1U8QB 4LSDA 2VAAA 5FYJH 3DURA 3L7FB 2IAMD 2VXTL 3S97C 3HMXH 4YHKL 3SDAC 3UJIL 1QKZL 1EEYB 4QGTA 4P4RA 5CP3H 1UWGH 3MOQA 3L3OA 4O2EB 4YIQB 1CTNA 5GGRY 5JIKA 5KVFH 2VLRA 1I4FB 3BN9C 3BP5A 3QYCA 3BPOC 3CFKA 4P2OD 4BFGA 3TESA 2FEDC 1Q0YL 3ET9F 3TVMD 2YPVH 4IHOB 3STLA 3DXAD 4GAYA 4AQ1B 4DZ8A 5B3NA 1SY6L 2HMIC 2GITB 3MSPA 2FJFA 2WBJA 3FOLB 1RMFH 3GSRA 1IKNC 2XV6B 4JQIH 2JCCE 5CINH 4K94H 2HKHL 4L8SC 3LQAC 2JELH 4L4TA 1B0GA 1UM5H 4WEBL 4KVNL 3QEQE 3IDGB 4NOFA 5EPMA 1IAII 3C60C 1HEZB 1RJYA 3VXNA 4NO3A 6FABH 5K9JH 4QHUB 4ODVH 4XPGH 1Z9SA 5E6ID 2I27N 3CSGA 3F6IA 5I1HL 4W6XB 4PRIB 1T20B 2F54D 3DX6A 3A6CH 4FP8H 3G08B 4WW2F 1J8HA 4PREA 1UEMA 4Y1AD 4ZUUB 1KJ2L 5AAWA 3UJTL 1U8HB 5IB5A 3VFSA 3STBA 4KAQL 4GH7B 3WUWA 1QP1A 2ZPKH 2CLVA 5TPWH 1BX2B 2NY5C 3HI5H 1UB6A 4JANA 2R2HB 3C5ZB 3F7VA 1FYTA 4L8CB 1LD9A 3K3QA 4EN3A 2X4RB 4XXDA 1VACA 1QVOA 1YPZA 1PDKA 1IC4H 4NOBA 3ORJA 2NPLX 4YHML 4G7YH 1BFOA 1A7PL 5I1DB 4QOKA 5DUPH 1AO7B 4HMCA 5A1AA 3DWTA 1H5BB 4QNPF 1NMCC 1U3HD 2GY5A 3QSKB 4KDWA 5FO8A 4GG6F 3SY0B 1NEUA 1H9VA 1W2KT 1MFCL 2O5XL 4XC3H 4NQCE 3WKML 3VGAC 4U1LA 2MTPA 5ICXA 5ICZB 2ADJB 4YDIL 4P9HH 2EEDA 1Y6MR 4HXAH 2BXYA 3B9KB 4R6UA 2NR6C 1SBSH 1HIML 3MRHA 4Z5RB 2GQHA 1KJ2B 4PY7A 3BPNB 4DCQB 1GIGL 5DT1L 1J12A 2A83A 3MRBA 1UWXK 1WTLA 1TVBB 4QRUA 1KENL 3ROLA 4MJIA 3QFJE 3NIGE 5EDXA 1BGXL 3TA3B 3CSBA 3ZDYF 3E2HC 1QA9A 3CSYB 4X6CB 2YPLA 1N2RB 5T1LD 4PJ8D 2A0LD 5I8KL 1I3UA 4P5MB 5DJAA 1F3JB 3QP3A 5GS1A 4GKNB 4JFPA 3RWJB 1JF1A 3ROOB 1TQBB 1INEL 1FSKC 2WP3O 3T8XB 2HTKD 3Q5YA 4PRHD 2BNUB 1P7QD 1Y6KR 5K9QI 3U0PA 1T22A 4IDJH 1A6VL 3HE7B 1NUFA 3GHEH 5EBWA 3GMQA 2QSCH 5D7JC 4XTRC 1MHCA 5I1CH 4TUJA 3PV7A 1RQ5A 1F8TH 1AXSB 2I24N 4M48L 1I8IA 2OMBA 5MEPA 4NJAL 5AZ2H 2F74B 4DZBA 5E0QA 3SDDB 4L3EB 1S7QB 3TT3H 4IOIA 4K23L 3RUGA 1ITBB 1KIRA 25C8L 1DQQA 3LQZB 3NPSB 1RZFL 2NY0C 1KC5H 3BP7A 1BIHA 1BF2A 1OAKH 3GJFH 4L9LA 3HI6L 3U83A 1EAPB 1KTKE 3MRKA 3SGKC 3CFBA 3U4EA 4ZFOA 3LY6A 4RGMC 3FO1A 1F90H 1L7IH 3MV9D 2FJHA 4FS0A 2D9QB 1K8DB 1IFHH 35C8H 5I16A 4UAOC 1S7TB 2BY3A 4EEEA 4MSWA 3QUML 4LLDA 6CGTA 2VXUL 4MCYA 3TO4A 3IF1A 5KSBF 1YEKL 2BOBA 2VAJA 3SPVA 4JG0H 3S34L 1FL5A 2ATKA 2F19L 2MHAA 4YE4L 3BJ91 1W0WA 2OMNA 3VXSD 3VH8G 1FVEB 2DN7A 2QQQA 5EUOB 1NDGA 5DK2B 1KJVA 5B38B 3N85L 2Q20A 2IPKB 4OI8A 3LN9A 1A47A 3O2DH 3EJYD 1YEHL 2H2PC 1A9BA 3GBLA 3V0WH 2AEQH 2EECA 2X9WA 4Z7UA 4LSRH 4CMMB 5IFAL 5EU6B 1IEBA 1HKLL 5GGVY 4G9FA 2JB6B 3VGFA 1YUHA 4RFOH 4GMSH 2VZ3A 1YEJL 5HYJD 5CKGA 3O6FB 3TBTB 4RA0C 4JO1H 1RK0B 3MFGB 5D5MA 1RUPH 3BXNA 1BAFH 1BWWA 1YMMD 1C1EH 3GMOA 4Y5XC 1U42A 3DYPA 4JFDA 3BRGC 3O0RH 1FVDA 1FRGH 3SE9H 1HINL 4NSKA 4B50A 4R97B 3QRGL 3GMNA 3PWNB 1MCKA 4XCYB 1TVDA 2YWZA 5CEXB 2NY6D 1S8DA 3NCMA 3OXRA 3TZVA 5HYQA 1OGTB 1NCNA 1DBJL 5JDSB 3QCTH 5FM5O 1ZLUH 3RL1A 2A9NH 1WISA 4JDZB 2JK5B 5D7IB 5GRWA 3GMLB 3LS4H 5GS0C 3OAZH 5KVMC 3PWPA 4YXKL 3IKCA 4HK3J 4QXUL 3BQUB 3PIQB 2XWJB 3BUTA 3W82A 3ESUF 2ICWA 2EXWC 2A1WH 5IOPB 1F4YH 2XG5A 4R0LA 2V2TA 3ZDXE 4E42A 4R7DB 3F7RA 5DHYA 1Q9OB 4MXQC 2COQA 4MWFB 5F93C 4KKCC 3JTTB 2LU7A 5C0JB 2YC1A 5ESAA 4F7PB 1J1XL 3I2CL 4WY7L 2R1WA 4LCUA 1CDIA 4U6HB 1VKXA 5GHWH 1CD8A 4TSCL 1I8LA 2XKNB 3FB8B 5IQ9A 3FZUD 3ULVC 1JGDB 3OKDA 1MCDA 1FDLH 4AT6A 3MCKB 5ECJE 2R8SH 3C5JA 5CEZD 1QBAA 2WWKT 4OCRH 4ZG1A 1IGTB 2V9TA 3HB3C 4JGJA 4JFFD 4PTTA 1T5WB 1DUZB 1R3HB 1YEGH 2NTSP 2J7LA 2P8MA 1P4LB 4O02L 2DBLL 1AI1L 5A16A 3TBYB 3QHFL 1JVKA 1YEFH 3KPRB 5AYQA 4TOYL 4PJ7B 4LIQL 3ARTA 2HRLA 5D1XD 4DN3L 4XWOD 4PV8B 5T3ZL 4LGRB 4JFZL 4XNUH 2E7CA 2VWEC 2OBGA 1F6LL 2ESVA 1Q9LB 5DD1L 4YHLL 4Y5VA 2WQRA 5C6PB 4K3EL 1T2QL 4HCRA 3BPCA 5FYKU 3GSXA 3U4BL 1U8OA 5MHSD 2B39A 4CJ1A 4JHBA 4JKLA 2AEPH 1JGUH 3IJHB 4R26H 5K59F 2HJFA 3VXUA 1QPPA 2VTFA 4KK9D 4PRPE 3F7QA 2Z92B 1ZANH 1TETL 2QHLA 2HAZA 4KKBC 1IEAB 1NANH 5JA9A 3BIAX 4PRAA 1SYSB 3SDAA 5I73C 1RZ7L 2DIJA 1AFVH 5JR1L 2HG5A 3BDYL 3BP4A 4S1SH 1L6XA 3TIDB 4GG6A 3FB5B 4UTBL 3PQYE 4U1SA 3GJEA 1T21B 3QPQD 3S4SA 3ULVF 1TTGA 1CD9B 4PV9B 4NQED 3E6HA 4LGPB 2EH7H 1T04B 1AXTH 1IKNA 4LNVA 4L8SA 1T5XB 2DQUL 4QHNA 5BOPA 1PZ5A 4KXZI 4XPAL 3KHOA 5T3XL 2A6IA 5EA0L 3WFDL 1EFXB 1JHLL 3MGOA 4JPWH 5ENWB 3WD5H 1NCCH 1EV2E 3FT3A 3F12A 4S1QH 2GJZB 4M61A 4LLWB 4WV1B 4CVZA 4RMSA 2JJSC 4M1GH 3MOAH 4YZFE 1WZ1H 2PYED 4NN6C 4ZO9A 3K1KC 1DANT 4JZNA 5TFSL 5L9DL 3P0VL 4PGZA 3MLVL 3HZKA 4Y2DD 3BEWB 4HG4K 3MBXL 4IM8A 1LP9B 5DUBA 4R7NB 5ITBH 4ODXB 3MFFA 3IRZA 4U3XA 4N0YH 2X89A 3WIFB 4KKLC 3SOBL 2J5LC 5FB8B 3OR6A 2FJGA 5D1QB 3V4PL 2X4OB 5E5MB 2UV3A 3GI9H 4FQ2L 1CGTA 4FTVE 1PG7L 4OD1L 4U6TA 1WCQA 1NAMH 3RWFB 1OARL 3WLBA 5H35B 4P0DA 1JV5B 4NHUB 4L5FL 3MRJA 3FTGB 5FHAH 5EOCL 4ZSOA 4PBVC 4FNLH 3BOVA 2FB4H 3HI1B 4NCC1 5D2LA 1CU4L 2RHEA 3CFDA 4NQSB 5B38G 1ORSB 2Y6SC 2CLRB 5K33A 2O61B 1UB5A 2A74B 5DRZA 2FHFA 4AG4H 1LK3H 3B5GA 1MFAL 3EKCA 3MLZL 2YA2A 4YUEL 2V9RA 3LKNA 1PEZA 4N90D 4P9ML 3JV0A 4Z7OF 1P84K 3CJJA 1HNGA 3OB0K 3B2UD 3MXWH 4QCIB 3MV7E 3MBEC 2HFEA 1KG0A 5FKAB 1NDMA 3WO3B 1AP2B 3N1GC 1OAUL 3WS6C 3K8MA 5KOMC 5BXFA 1EUTA 4S2SB 4YDLB 5FGBC 2P24A 5BJTB 5HHQA 4LSQL 4XVJH 4PJGB 1FLRH 1EGJH 5BVPH 2OR9H 1U95A 2EYTB 2R4RH 2WANA 3TLRA 1T0PB 3UROR 3IDNB 4KTDL 2VB5A 4UT6L 4OM1H 3VG0H 4P2RB 4I1NB 4EUPA 1F3DH 3QDMB 2R1XA 4TTDC 4P4KC 4Z7QF 3HC4H 4GLRH 5FYJE 4PJDB 1S7WA 1VGKA 4OTXH 5DJDB 4KRPB 2X4QA 5F3BA 5GRXG 1S9XB 3DYOA 4HK0B 5D8JH 3K2UH 4X6DB 1JGLH 1EEZA 5CD5C 3ZKND 3IFOA 4QXWA 3O6ML 4PGBB 3HRZB 1JZ4A 1FZMB 2VDQH 3FO9A 2QR0B 2GTZB 5J06A 4RWYH 3IS0X 3QEHA 1ULVA 3P4MB 1Z5LA 3ZE1E 3BW9A 3WEXA 4JDVB 4HIHA 1CFVH 3GNML 4U1KB 4DEPB 3Q48A 4OGXL 4NPYB 4G6JH 2DQFA 3GIVB 1CVSC 4L29A 4PRIE 4ZFFB 4OM0H 5LVEA 4UZGA 4LEOB 1KB5H 2DOCA 3MNWB 3UJJH 1HWGB 1QFWM 3QG6B 5FKPA 3FO0H 3JVGC 4J4PA 2OTPA 2QQKH 3T08A 3IFPB 5FV1L 2OL3L 2SEBA 1XIWC 2NXZB 3X17A 4OCWL 4LSUH 2AJXL 2Y06H 4PJ9D 3ZE0E 4MA3A 4HGMA 1T1YB 5D1ZD 3U9PL 3QJFB 4QXTB 5TE7H 5KBNC 2CRYA 4KQ4H 4MNHB 4YXLL 2OTUA 1KB5B 2EIZB 4GXUM 1D5MA 1ZGLA 4D9RE 1N8ZB 4UTAH 1NGWA 2AJYL 3P0YL 5IK3B 1AO7E 2OP4L 4UDUB 1WFTA 4W4OC 4W81A 3RWIA 1SJVA 3LEYH 3L6FA 5SX4H 2DQHL 5F9OH 3ZSTA 1AE6H 5C0AB 4CGTA 3BT2H 5L6YH 3DX7A 5INDB 1QBBA 4QRPD 3UC0H 2XXMB 4Q0XL 3VWKB 5TDOA 4G43B 5E2TL 4EQ3A 5ICYB 4HULB 5HYSB 4IRJC 1DLHA 3PHOB 3MRQB 5F97E 1MRDH 1HDMB 2YUXA 1FNEA 1ND0A 3MV8D 4P23D 1EAJA 4KMLB 3FQTA 4LMQE 3FQUA 2VDPH 2OL3B 5E2JA 1GGYA 1U0QA 3RBSA 4XCCH 1EFQA 1Z6JT 4HJGB 1HILB 3RZCC 2XWBA 4FABL 3FB7A 3MJ8B 5MENE 4LHUG 4D0DA 2AXFA 2N56A 5IW1A 4DOHB 1I1AC 3K2MC 2P5EA 1M6OA 3EGSB 1TZGH 2X5PA 5F71A 3DVGA 4JFHD 3THML 5IB2A 4F57H 3O4LA 3WIIH 3IDUA 2XA8L 3JV4B 4G5ZH 4PY8J 4YBHA 5HDBE 4PJHE 2R2CA 5HI3C 1G1CA 4G80A 4RAHA 4HPOH 1YECH 5CZXD 3KG5A 3I3BA 1ZWIB 1P2CA 3QDAA 2QSVA 2XRAL 3VXMB 5D71H 3VXOB 1SJEA 1KN4L 2CR6A 2WINB 3UYRH 5EBLA 3OGCA 5C70A 5CZVL 2PTTB 4F7EA 1CQKA 1I9JH 4M7LH 2AV7A 4L3EE 4Y0GA 2BVQA 5E08L 2XQBL 1QFHA 3CLFL 2XNAB 4HH8A 2NY2C 1WGOA 2AI0L 4QTHB 5ACZA 4XP9H 5HI5D 3GSWB 5F9JA 3EAKA 4FG6D 5J0BA 1QLFA 4OV6F 1M71A 4O51A 5F88B 3BYYA 3O8XB 1HH9A 1CF8H 1FNFA 1LEIB 2ZJSL 5IBUB 4NQCD 3GB7A 4WHTA 4X6FB 3LSOB 4ZPVB 4CL7A 4LLMA 1CQYA 15C8L 5L8KB 3FO2B 5JXEC 3FT4A 1BFVL 3RWEB 3HPLB 4PBWD 2PKDA 3SO3B 2J2ZA 5ESQB 4MLIA 1GGCH 2C1OA 5K9OB 1FNLA 1M7DB 2H9GB 1AQDA 2ADIA 1DDHA 3FFCA 1C8PA 1LO0H 1A2YA 3JZ7A 4Y16D 4TRPH 2EXYD 5T1KA 3QQ9C 5EUOE 1MVUA 1TJGH 2NY4D 1DVFB 1DLFH 4YWGL 1GZQB 3FOMB 3MRNB 3RTQD 1A3RL 5DZLA 3UBXG 2OK0H 1U8KB 3VDCA 4P57B 4AH2B 1I9IH 1X5LA 4YO0A 3U1SL 1WZKA 3SKNB 4M1DL 1N6QH 5I1GL 5EU6E 4XMKH 3SBWA 1ES0A 1YEDA 1I1FB 4S0SD 1MIMH 4LKXA 3KPSE 3DVFA 3CIQA 1BQLL 2PXYA 5AD0B 4YGAB 1RZKC 4YXHH 2BNQD 1A0QH 5C0BA 3UTQA 4PJAB 4R2GB 5F3HA 3U48A 3B9EA 1GGTA 2APVA 5KSAA 1HZHL 2G9HB 4OFPA 3LD8C 2X7LA 2YKLH 5MERB 1HHIB 4YLQT 4BSWA 4BUGA 1B88A 5JOEA 2DBJA 3ZYZA 3D9AH 1INDL 2GAZB 4P2QE 1ZA3B 2WM0A 4BZ1H 3M8OH 3D6GA 4PJ5B 4IDLA 2VDKL 5EC1B 1V7ML 4NC1E 1RU9L 4L3CB 3QI9C 4I0PC 3BPLB 3DIFB 2EDRA 3TJEL 5D7IE 3IVKB 4N0FB 4XMLL 1ZHBA 4OQTL 5I1EH 1NGQH 4I48B 1A4JA 1JGVL 2VQ1B 1DEEA 4OFDA 5T1MB 4HSQA 1AGCB 3VMPA 2QKIA 4OFIA 1YEIH 4NHCH 3ES6A 3B9VA 2YD4A 4U0RC 1T4KA 2BRRH 3VFNA 4Y4HB 2GCYA 5CJBA 1G7HB 5FF6A 3D2UA 4HEPG 3KJ4B 2EH8L 1GC1C 1U91A 3CFJB 4GRLD 4YFEA 1VFBA 4KK5D 4X9FA 2VSCA 2V7NA 3MGTB 4FFVD 3VE0B 5ETUA 2ZKHH 4HWZB 3HCVA 3EW3B 1I7RB 4F58H 4ETYA 4OZ4B 2EKJA 5IP4A 5GGTA 2I9LA 5MI0C 4PJ7E 3O2WH 5GZNC 1QHPA 3REWA 1X5JA 5DFTA 2V5SA 4DUXA 2NX5A 2DKSA 3IDXH 5CGYD 1SJHB 3OHXA 5GSVB 1CIUA 1FV1B 3QJHA 1O0VA 3BRDA 1LMKA 5SWZE 3R8QA 3MBEA 3GO1H 4AEEA 2W65B 3MLUH 3WS6A 3D25A 4ERSL 2HRPL 3LAFA 4H25B 2EDYA 5F8QC 4YDVA 4MHHG 4X9GA 1PY4A 3OR7B 3RU8H 3WXVH 2VZVA 1R3JA 1TITA 5HVHC 12E8H 3E8UH 3INUH 5HGAA 4R4FL 4MMZC 4FQCH 3ZDZE 1MCOL 4XVUD 2J6EH 3VFMB 5T5NF 5HYSG 4YFDB 5CMAA 4CW1B 4P4KA 1DN0B 1LNUB 1M7IA 3S9DB 2VAAB 4FFYL 3DURB 5T3ZE 1H3PH 1C16A 4JPVL 1CGXA 5FCUL 1OM3H 5BMFH 2YD8A 3ZKSD 2YD3A 3L3OB 2HT2D 5GRZA 2FR4A 2VLRB 4M3JA 1CICD 3BP5B 4UOW1 4IRZL 3CFKB 3RDTC 3AM8A 4N1CA 3ARGD 2ZG3A 4UIKL 3STLB 1GCFA 4GAYB 5TJWK 4DZ8B 2FGZA 5DMKA 2APXA 1W0VA 2FWOA 3BO8A 3QFDA 2DF3A 2FJFB 2WBJB 4HGKC 1O7VA 2X4SA 3PWVA 1DBBL 5EZIL 4HWUA 5E4EC 1A6WL 4L4TB 4ZAKA 1B0GB 1G9MH 1U41A 3QQNA 2VDOL 5EPMB 3ARWA 3JWOL 2ADGA 5C0NC 1RJYB 3VXNB 4NO3B 1QFWL 3JVGA 4MAUL 4M9PA 2VXSL 3RGVA 4WFED 3UTTE 3U4AA 4KY1H 4DVBA 1XIWA 4LLAA 3LN5A 1DR9A 2NY1C 3FN3A 3A6OA 2JCCF 3DX6B 4LAQL 4EQ2A 4BKLA 1LP9E 1RJLA 1J8HB 4PREB 3L95A 1CE1H 1G6RL 3P30L 4UBDC 2JIXA 1BD2D 5KW9L 2X6MA 5IB5B 2FO4A 3VFSB 3H3KA 3S35H 5T3XE 4KMTL 4ZD3H 3WUWB 1LO3L 2CLVB 1MIEL 5E2VL 1UB6B 3CXDH 4JANB 2D31A 3HAEH 3F7VB 4WJ5A 1FYTB 1LD9B 2BMKA 3NFPA 4EN3B 4XXDB 1VACB 1QVOB 1YPZB 5J3HD 4JRXA 1GH7A 1RZJC 4Y4FA 4KGJA 3W0WA 2EIEA 3PQYD 1ETZA 4NZRL 1BFOB 4KUCD 4RDQF 5EU7C 4TSAH 4QEGA 4OUOA 4QOKB 5D9SA 5HI4C 4NO5A 1BFSA 2GUOA 4IRJA 1ZVSA 3VFRA 1MSPA 4HLJA 4N0CC 5FO8B 3D5OF 2Z8RA 1AGEA 4ZXBA 1LE5A 1YEEL 3HNTL 1YC7A 2FX8H 4U1LB 5ICXB 1DP0A 3TPUA 3KXFA 5AZEL 2ZCKH 1F97A 1T1ZA 2WLYA 3MRHB 3I9GL 3RZCA 3ABZA 4PY7B 4JHZA 4Z8FH 3IDYC 5HJ3A 3MRBB 2A83B 5HHPA 5DR5H 1KUMA 4HX1A 4QRUB 3ROLB 3L3JA 4EDXA 4MJIB 4F9PC 1NFKA 3TH4T 2VLJD 1FYHB 4LMQI 2P4AB 2E6JA 1MRCL 1QA9B 3T2NH 5KTEL 2AJVH 2YPLB 2DQJL 4P46C 4FQXD 5C0CE 5DJAB 1GYAA 4PJGE 5GS1B 4PJXA 4JFPB 1JF1B 4I13B 4MXWH 5I74B 5I71C 3DGGA 3BKMH 3EZJB 1CYGA 2VN7A 2DIAA 7FABL 3U0PB 3NIGF 2FIKA 4JREB 5EBWB 1H3XA 3GMQB 4HWEL 1MHCB 4XI5C 3T0EA 3RVVC 2HLFC 4TUJB 3VXRA 4PJDE 4K2UH 2IMMA 5JHDA 5F70A 3DX9A 1FFNA 1I8IB 4YHKH 4X98A 5MEPB 4NQTA 4DZBB 2JLLA 1QFOA 4IOIB 3W39A 2WIMA 4LSSH 3ARQA 3RUGB 1KIRB 2PTUA 1DQQB 2Y1VA 1OGAA 5D7KE 1DQDL 1MQKL 3BP7B 5JXEA 4HJJH 4L9LB 4CDGC 3MRKB 3CFBB 3T3ME 3U4EB 2R23A 4KH2A 3FO1B 4TPRL 2FJHB 4ODTL 5JA8B 3ILQC 1FFRA 4QRSA 4LCWA 5CUSH 4CMHB 3U30B 5I16B 1NC2A 1NCBH 2BOCB 3D0VA 4XXCC 4MSWB 4LLDB 3D48R 5CJXC 4MCYB 3TO4B 3IF1B 2BOBB 3T0BA 1U3JA 3L5HA 3SPVB 1FL5B 2ATKB 2MHAB 3UPAA 5DQDH 3RJQB 1W0WB 3QUYA 3VFGL 5IBTH 4LOUC 3EOTL 3MV7D 1F42A 2R0LL 3VWJC 1HYRC 4OZFA 5C92A 5HPMA 1NDGB 4ZDHA 3JWDH 1KJVB 1E4WH 3RVWD 2R4SH 4QXGL 3U7WL 2PN5A 1ZLWH 3MLRL 2C1PA 2FH6A 3LRSA 2DQTH 1KLGA 4MDJA 1A9BB 1UM4L 4WVRA 4Z7UB 1I7ZA 2LAAA 2HT3C 2W0KA 2V9QA 1IEBB 5AEAA 3GBNL 4G9FB 4KI5D 4J6RH 5IQ7H 3KPOA 4RX4D 4PY8I 4DFHA 1YUHB 4XAKE 5C0AE 2ZSWA 4Z9KB 2DTML 3OKOA 3RPKA 4RQQA 4OGAD 1A7PH 1TENA 5D5MB 4QRRD 1UEYA 3BXNB 1MCRA 5H37H 3GMOB 3PP4L 4JFDB 3UYPA 3V79C 1ZVHA 3B5TA 5BQ7A 3QI9A 1P4IL 2HVKA 2VH5L 3ARFA 5E7FA 2BY2A 2MKLC 4KRMB 5GXBB 2DQEL 3TBWA 4BSJA 2DLFH 5TF0A 1FVDB 4DAGL 1MFCH 1M05A 2KPNA 3GIZL 5I9QC 2DLHA 4NSKB 3WKMH 4JFYA 3WS3A 1I3VA 3HC3H 4F3FA 3GMNB 2R0WH 2EDOA 4Q9RL 3BIKA 1S8DB 3OXRB 5HYQB 3TZVB 1HIMH 2OR8A 4UQ3A 2YS4A 1YN7A 2IQ9L 3VGHA 3BEVA 4DOHE 3ZTNL 5GSRA 3RL1B 1BZ9A 1BJMA 3MJ6A 3KLAA 1RFDL 3HR5A 3PWPB 4PRID 5LG1A 3IKCB 4CNIA 5DO2D 3H9HA 5TQ2L 3TBSA 1JYVA 2GT9A 2ICWB 3VRJA 4R0LB 2V2TB 1NL0H 4E42B 5DHYB 4YHYC 3VXME 1GGBL 2GJJA 1BM3L 5FYKL 1KN2H 3VGBA 1ZMYA 1CE6A 1N4XH 3A6BH 1KACB 5DK0A 1YNKL 5C09D 2YC1B 5ESAB 4HCRL 2R1WB 4LCUB 4PIRF 1VKXB 1AD9A 3KLDA 5IQ9B 5JTWA 3OKDB 4FQIL 4ZMAT 1XR9A 4AT6B 4WO4C 1OAZL 3MUHL 3ZDXF 4D3CH 4D9RD 3C5JB 5CHNA 3VD5A 3RI5K 3D39D 3DSFL 3S3PA 2XZQH 3WFBH 3I50L 1AGBA 4PTTB 5TQ0H 2OLDA 5GS2D 3LKOA 5T5FH 3BHBA 1CGVA 2P8MB 1S5IL 3OKNA 5A16B 4DGIL 4Z76A 3B9KD 1IQWL 2M8XA 1JTOA 5CILL 5TDPA 3WUWG 1RZFH 2JKXA 2XTJE 3I6LE 4HAGA 4O58L 1PKQA 2JCCA 3KDMA 5FUCC 2LU4A 1YNLL 5DA0B 1TPXB 2ESVB 1EJOL 5HGGS 2OYPA 5CFHA 3KWWA 3BPCB 3GSXB 3O3DA 3TA3D 3GKWH 3MLWH 1U8OB 3LQAL 1TXKA 2VXUH 1PVHA 3KYKL 2GK0A 2HJFB 3VXUB 1HWHB 4G8EA 1WIUA 3I6KA 3S34H 3PG2A 3T0XA 2XQYG 4PRAB 2FO1A 3LN4A 3SDAB 2APFA 3I6GA 2QQNL 2QADC 4PRNA 3HFMH 2HG5B 3BP4B 3OPZL 1EUUA 2X10A 3HR6A 3MJ9L 2UZIL 5LBSH 4GG6B 4N5EC 3CC5A 4U1SB 4BZYA 4PJAE 4WFHE 4I8DA 3BPOB 3GJEB 4N9OB 2Q76A 1NGZA 1ZE3C 4J3TA 2NY5L 1HKLH 5TH2A 3E6HB 3SDDD 4L3ED 5I1IL 4P49A 5C07A 4X6BA 1NANI 4DVRL 3V52H 1YEJH 4L8SB 4QHNB 2VZ1A 2B2XL 4PJ5E 1RIVL 1PZ5B 1OQOA 2W38A 3GMMA 5BRZA 1J5OH 1NKRA 2A6IB 2R0KH 2Z4QA 3R0NA 1MLBA 3MGOB 4LARL 4U3HA 2NW2A 2Y25A 3FT3B 3F12B 4X5LA 5E8OA 4M61B 1HINH 1TZHA 4AIZA 3PHQA 3U2SA 3RA7L 4OCXL 5IHUH 3H7BA 4CVZB 1A7RH 3QFJA 4M7JH 5HXMA 5HDLA 5HHVH 4NRYA 1N64L 2FD6L 3C8DA 4FQJH 4JZNB 1BVKA 3BFOA 1KCVH 4YXKH 3HZKB 1VHPA 4UT7L 3WHE1 4A6YH 4JQVA 3QUXC 5DUBB 5IESH 4PJIA 1XGRA 3MFFB 4FRWA 5C8JA 1IAIM 1CK0L 3OR6B 4ISVA 2FJGB 4YZFF 4KZDL 2R56L 2YN5A 1NMCB 4JG1H 2E9BA 5SWSD 3WLBB 4WWKA 5IJKC 5A2IH 4C59B 1A6TA 4HJ0D 1SMAA 1OW0C 3BISA 1A5FH 3MRJB 3B6SA 4GMTH 1KXTB 3C5SA 4ZSOB 5C0DA 1XGTA 4LPUA 3RNKB 3SKMA 5D2LB 3C87A 3AGVA 4OBSA 2YRZA 1UA6L 2NXYC 3CFDB 4UINL 2DBLH 4JRYA 2VLKA 4O9HH 4RGOH 2DRUA 4BFBD 1JYXA 1UB5B 5F7EL 4GUPA 5DRZB 3KYMA 1BF8A 4TOYH 4LIQH 2EC8A 4M03A 4BUHA 5A3ID 2EE2A 1BZQK 4P46A 2BNRB 1FNGA 4EXPX 2QV2A 3QUKA 1CBVL 1D3CA 2PO6A 4JFZH 3LKNB 1KGCE 2B5IB 1DQML 5DD1H 1FSKB 1JPST 1VPOL 4DKEL 3CCHA 1DBAL 3BQUD 2HFEB 2XYCA 2UZXB 3U4BH 1NDMB 1XGYL 3F58H 4EUPH 4X8JA 2D7QA 4P3CH 1SYVA 5BXFB 1B90A 2P24B 4ETQA 1XEDA 4K94C 3OB8A 4LHJB 4JO4L 4OIAA 1MCFA 1U95B 4L8DA 4M5ZH 4U1MA 2IBGA 4HXBH 4Y5YA 1AH1A 32C2A 2ORBL 1T66D 4PB0L 1J7VR 4LRIC 3BDYH 3O41A 2VLRE 4EUPB 4XP6L 1IAMA 1YDPA 2R1XB 5TE4L 4D9LL 5C7XH 3C5ZC 3SQOH 2NY0B 2CXKA 3UDWC 1S7WB 5I0DA 1VGKB 4PR5A 3NZHL 8FABA 5F3BB 2X4QB 4KJPC 3UTPE 1NH6A 1J05A 4RGMB 4YNYA 5F89A 1EEZB 3QPXL 3IFOB 3KPRD 4L4TE 1H5BC 1J9CT 4P2YA 3A67H 3FO9B 4XPAH 5FO9A 3QEHB 5JNYA 1MEXH 3OWEA 2EDFA 3WFDH 3GUTA 1Z5LB 1EX0A 3SHSA 3BW9B 4GLRI 3WEXB 2EDNA 4HIHB 1D6VL 1XCQA 1AY1L 4NM4H 2DQFB 3PWUA 3T65A 3BPNC 3RVTD 1N5AA 4L29B 3D69A 4POZD 5DURB 3VWJA 3KAAA 3SCMA 4GAJL 1II4E 1J8HE 1X5KA 2C3GA 4W6WB 3MQIA 3R0MA 5C71A 2D7MA 3KGRA 5FKPB 5DS8A 1RUKH 1N3NA 3C08H 4P9HC 4X9BA 3ZE1F 4E5XA 1IGFL 1MF2L 4DJMA 5L9DH 2SEBB 3LOWA 5GS0L 4MQTB 3MLVH 1FYTE 4MA3B 1GRWA 2Y36L 1TQBC 4M6OL 3MBXH 1YPZE 2OTUB 3FHAA 3SJVA 1D5MB 2KZWA 4WUKL 4ODHH 1ZGLB 3HE7C 5T3ZD 4LVOC 4QOKE 1NGWB 3BKYL 1UXWA 2IGFL 3S88L 3V4PH 4LHUD 4HC1L 2WQ8A 4JPIB 3B2VL 3RWIB 3L6FB 3AREA 1PG7H 4OD1H 1OARH 3ZE0F 2YK1H 3ULVL 1N5YH 4MHHI 3RGHA 4JO2L 2IH1A 4F9LC 5JZ7C 3VGEA 3BDXA 3DX7B 4MA1B 2B1AH 3NACL 4L5FH 4EBQL 3DO7A 5TDOB 2AJ3A 1FCCA 2J8UA 2NZ9D 3OAZK 2AK1H 1DLHB 3OKKA 1DCLA 1OTTC 1FNEB 1MJ8L 1ND0B 3NPSC 1Z2KA 3HE6D 4MJIE 5EUKA 3S36L 1MOEA 3FQTB 1KEML 3FQUB 4KKAD 2LE9A 4L3AA 3HRPA 1I75A 3EFFA 5GGVH 1MAML 2A6DA 1MFAH 4M6AA 2XWBB 3FB7B 4JHAL 4V1DD 4D0DB 2AXFB 2KQMA 4YUEH 4JO3H 5IW1B 1OAQL 2P5EB 1M6OB 4OGYL 1NBQA 5IB2B 3DVGB 1S9YA 4UV7H 2VSDA 3O4LB 3FMGH 5IV2A 5HHMD 1JPFA 1YC8A 1GXEA 3KPTA 4OQ1A 4C4KO 1OAUH 4G80B 5F7LB 4G8IA 3MLPA 1J10A 4G42A 1LQSR 3HNSL 5ISZD 1P2CB 4S0TD 5HYFA 4WO4A 2VDNL 4LSQH 3FRPA 5T3XD 3EYQD 1SJEB 1JWUA 3T0AA 5EBLB 3OGCB 2I5YL 3DI3B 1HI6A 4WI3A 4HZAA 4XP5H 3QDGA 4F7EB 2AV7B 2EE9A 4KTDH 2BVQB 3P9WB 2GI7A 1B2WH 5HDBF 4PJHF 3RUGE 4GBXD 4X4YA 5JW5A 3ZTJG 5ACZB 2W1NA 1AHWC 3MX0A 5HHXH 5F9JB 4KC3B 5IW6A 3O6FC 2Q8AL 1QLFB 1M71B 2IF7A 4KTEH 4O51B 1HH9B 1B6UA 1UZ6E 4G6KL 4HLZG 1A3QA 4WHTB 1URLA 1FZOA 1PKOA 5SV3A 1TZIA 4LLMB 4CBPA 4GJTB 3FT4B 2EDBA 1P1ZA 1Y18A 3VFOA 5HYEA 2C1OB 3GNMH 1AQDB 2ADIB 3WJLA 4A2MA 3FFCB 1HHGA 3TWCH 5B4MC 4L8BA 1A2YB 3MLXH 5I73B 4NC1C 5T1KB 1MVUB 4PGCA 3DHJA 1ONQA 4I18A 4R4ND 4KTYA 1NLBH 4YO0B 3IAGC 4Z7UE 1LO5A 1XGUA 4GS7B 2DQIL 1ES0B 1YEDB 2B0SL 3WNOA 1TVHA 1J0YA 4G9FE 4P2OA 4LKXB 2CMRH 4OCWH 2AJXH 2P43B 1JZ2A 1NPUA 3TVMA 4P2RD 1R24A 2PXYB 4D2NA 5EUOF 3QDMD 4OLUH 4YXLH 1QSFD 2AXGA 1OPGH 3EHBD 2O5YH 4RBPK 2M1KA 5M95B 2R29L 5D5ME 5C0BB 1GOHA 1I1CA 3UTQB 1F4XL 5F3HB 3DUHA 5KSAB 2GSGA 4JPKL 2OP4H 4KRPD 5IHZA 2DQCL 5DYOA 2DQHH 2X7LB 3Q3GA 4D0CA 4BSWB 3KNBA 3GM8A 3LCYA 3CFCH 4MNGA 4OCSL 2HTLC 5IGXH 3QO0A 3WJJC 1EBAA 4ZNEE 4X80L 5E2UL 1TLKA 5F7MC 4ZS6C 3I02A 1PX4A 1TMCB 1C5DA 4Y1AA 4UUJA 1LDPH 1ZHBB 1UG9A 3PWPE 1IBGL 1A4JB 4ZTOL 3GRWL 3MCLH 1DEEB 3P77A 1NKOA 1F58L 1NCDL 1QFUH 2QKIB 2DI8A 3B5HA 2BP3A 3ES6B 2E6QA 1IAIL 4RMUA 3IFNH 2I60L 1LDSA 1T4KB 4UILH 3VFNB 2GCYB 3LV3B 3OGOE 5D7IF 5FF6B 3D2UB 4OZIA 4ZO6A 1GGIH 1X4XA 5IJKA 1V8HA 1U91B 1U3HA 1PYWA 2PETA 4HS3A 3HKFA 1KN4H 1VFBB 2V7NB 3QQ3A 2BJML 5ETUB 3F7YA 2DYPD 5CZVH 3VGDA 4R96A 4O00A 3HCVB 2EDJA 4HT1H 5F6HJ 3CLFH 1CXEA 3HZMA 1G9EA 1IC5L 2I9LB 3HMXA 1DN2A 3N9GL 2MKWA 2HKFL 3REWB 3VWKD 4XC1L 4RA3A 5FYJU 5CP3A 2EDWA 3TNNA 3GBML 2NX5B 4XCEA 1J87A 5FYKE 3TF7C 1G7IA 3OHXB 2ESVE 1F3RB 2PNDA 5T1LA 3B3IA 3QJHB 4PJ8A 5E8PA 1FJ1A 1QQDA 4APQC 4HGWA 5BVJA 3T77A 3MBEB 2OM5A 3IRPX 4QWWC 2QL1A 5ACMA 1K5NA 1FL6A 3D25B 1RI8A 4PRHA 3VXUE 1N0LA 4YHNA 1T1XA 5I76B 4TSBH 1OSPL 4YDVB 4WV1C 4PP1C 3DJ9A 1R3JB 2W0LA 3DO3A 4K8RH 5HGAB 3DVNA 3R1GL 5EIQA 4LCCA 4HUMB 1C5CL 3BD5A 2HH0L 2W0FA 5CMAB 4G3YL 2P7TA 4GG6E 3VXMD 4P4KB 4KPHH 2VNCA 1M7IB 3DYMA 2WUBH 3U1SH 1OAXH 2ITDA 4HIJA 1C16B 4NQUA 4N0UA 5I1GH 1QFPA 2OS7A 4I5BA 3P9LA 2NY3D 3G5VA 1BQLH 4TVSa 4BM7A 2OJZH 4NZUH 1JZ7A 3ZDZF 2FR4B 5D1QC 5BZWA 3TJHC 2ICEA 2B7DT 4MA7L 3O11A 5GGSY 4OAWA 4KRNA 5BS0D 1BHGA 3WIHH 4U49A 3WYRA 1H8OA 1DFBL 3EDDA 5DMKB 1HZHH 3FFDA 1W0VB 2ARJA 3O8XD 4ODUA 5KAQG 2FWOB 3QFDB 3X13A 1G9NH 5GGUA 5AG8A 2X4SB 2E8ZA 3PWVB 1XGQA 3FCTB 3FRUA 4O5LL 2CR3A 4XCFH 3D0LA 2DLIA 4ZAKB 2F5AH 1S7UA 4P59L 1WBXA 4NNPH 2DD8H 2ADGB 2PW1A 1HK6A 2AAVA 4W6YB 2RCSL 3DOSA 1OAYH 1H3UA 1SVZA 2HVJA 4YDJA 2Y72A 4UT9L 1PG7X 3J8F7 3RGVB 4XMLH 4DVBB 1XIWB 1B0RA 5MENA 1IILE 3LN5B 1IGCH 4HKBA 4LVHB 3OMZA 4BKLB 1RJLB 3CFEA 3L95B 4P5TD 4H0GA 2JIXB 4HQQL 2Y7QA 4YHZH 5GRYA 2FO4B 3W11C 3Q1SL 3LIZL 4XPBH 3BMVA 4PJHA 1BVLA 5L2JA 1NMBL 4BZ2L 2D31B 2MFNA 3QHTC 5HHOA 4H0HB 5CLWA 2X70A 1OOAA 3MODL 4WJ5B 2BMKB 3NFPB 3EOBA 1YMMA 2R69H 4OGZA 1E6JH 4HZLA 1G7QA 4JRXB 2ADFL 1LP9F 4F9LA 4Y4FB 5D72L 3W0WB 4MD4A 1ETZB 4WFHD 3QXAA 4Z7WA 4ZSOE 5D9SB 5I1JL 4IBLT 3UAJC 4NO5B 2GUOB 4IRJB 3GSQA 5D2LE 3U0TA 3VD9A 1ZVSB 3VFRB 1QFWI 2R9HD 3P11H 1LE5B 1AGEB 5EZJA 4ZXBB 4U1IA 4XP1H 3RAJH 2AQ3A 3LH2L 4NWTH 3W9DA 3TPUB 3KXFB 4PJ5D 3UTSA 4WTZA 1T1ZB 5D7LD 3RZCB 2FLBT 3MZTA 3V7AE 2ZP0T 4L9DA 5HJ3B 4F2MA 5HHPB 3SGJC 2D9CA 1P7HL 4JZJA 4HX1B 4DK6A 3C2AL 4F8TA 3LMJL 4ZOAA 1IC7H 4LSTL 3L3JB 4EDXB 3I85A 3PJSA 4G6AC 3RY6A 3GJFA 2NW3A 5CGTA 1WAAA 5FA4A 1JRHH 1IGIL 2EDDA 2MWCA 3QO1A 4PJXB 3DGGB 2V17L 4K3HA 4KJQC 5C0IA 2FIKB 3FKUS 3CZJA 2MJWA 5GRJH 4GRWH 4DUVA 3P9MA 3WO4B 4CAGA 3T0EB 2NXZC 3H42L 4O4YL 3VXRB 2RR3A 4KHXL 3KPSA 4LRNL 4FFYH 5EZLA 4PJGF 1ZHNA 5JHDB 3G5YA 1AHWA 5HGHA 5FCUH 3DX9B 1FFNB 4X98B 5FM5M 4QTIL 2MSPA 4XP4H 1FG9C 5D1XA 1RUML 3O2DA 2E6PA 3N06B 4I77H 5ADOL 3W39B 3LRGA 3T0WA 4MQ7A 1RZKL 1OGAB 5KZCB 3TN0D 2XA3A 1FNSL 3KHQA 4UIKH 4AIOA 2AVGA 3EO9L 4PJDF 1NAKH 2JB5L 4OD3L 4DKFH 5JHLL 5F1NA 1J86A 2R23B 3FQXA 3PL6D 4X83A 2DDQL 3RWCA 4P2QA 1KBGL 4QRSB 4LCWB 5EZIH 5EORL 1NC2B 1A6ZA 3D0VB 5JPMA 2F5BL 1QNZL 1EVTC 3SGEI 4HS8L 4RRPA 1PQZA 4ZOEA 4FFWC 1HYSC 3T3MF 3NFNA 3QUYB 5CGMA 1K4DA 3ARPA 4OZFB 4JFED 3T2OA 3ZE2E 4GW5A 4NM8L 5HPMB 4ZDHB 4LAQH 4M6ML 3NIFE 2JJUA 3MREA 1G6RH 5HHNA 4NQEA 3MXVL 2C1PB 5KW9H 2RFXA 2VJXA 2EYRA 3LRSB 5CP7A 1ZLVK 1UT9A 3BZ4A 1IKFL 1KLGB 4MDJB 4Y89A 4EXKA 1ZKAA 1BMGA 1MHEA 1I7ZB 3MA9L 2H1PH 5E6YA 4PRDA 3ALXA 3V0AC 3LD8B 1ADQL 4S10A 3KPOB 2AGJL 5FXCH 4G6ML 5IR1A 2ZSWB 3OTTA 3QIUC 1PGRB 3ALWA 3CDFA 1GC1L 3OKOB 4RQQB 5FHBL 3U0WH 4QYOA 5BOZG 1OTSD 3WJJA 2EO1A 1NC4D 3T2QA 1JI2A 3IETA 5E5UB 5BQ7B 3QI9B 4LPXA 3UMTA 2HVKB 3ARFB 5IMMA 4JJ5A 3TBWB 1YEEH 1W72A 1M05B 1S78C 3HNTH 3KYAA 4JFYB 3BIBX 3WS3B 4F3FB 2DWDA 3BH8A 5AZEH 3BIKB 5JW4N 4BYHA 4UQ3B 3I9GH 1UCBL 1IGJA 1YN7B 4RGNB 5T33H 5SWZA 4EOWH 1FO0L 3BEVB 4GRMA 5F7YC 1FL3A 4XHQA 4Z7VA 2P5EE 5DJ6A 5GSRB 3LEVH 1BZ9B 3V6FA 4RAUA 1KELH 3CUPA 3FN0H 4NFBA 5E8DH 2XTJC 3KLAB 3O4LE 1OCWL 3DPBA 3HR5B 4CNIB 3VFTA 3H9HB 5E95B 4P2CG 2VZOA 3TBSB 2GT9B 3VRJB 5HD8C 2DQJH 2IEPA 2ICWI 2IALA 2V5YA 5BV7H 3AY4A 4NYLA 4YR6A 1CE6B 1DVFC 5DK0B 4XH2A 5A2FA 2XICA 4X7DC 3OV6A 1AD9B 1R3KA 7FABH 1P69B 1KLUA 5D70L 4HWEH 1P6FA 1XR9B 5MI0B 1HH6A 2A77H 5BV7B 5CHNB 3HA0A 1T03H 2EZ0D 1FGNL 1AGBB 2LQRA 4OF7A 3LKOB 2CUMA 5GPRA 4YX2L 1W8OA 2VDML 3BHBB 4R2GC 4APQA 2LVCA 3OKNB 4ORGA 5CSZA 4Z76B 3SEPA 2LVEA 5JW3H 5TDPB 2KL6A 1J0HA 4XWGH 3EDJA 3QDJA 4MS8C 2XZCH 1NJ9A 1RHFA 1PKQB 2JCCB 3KDMB 4PB9L 4BQBA 3SGDH 5IFJA 3K7UA 4TPRH 3IU3A 4ODTH 3FFCE 3VA2C 3KWWB 3O3DB 1OP3H 5KN5A 3E6FA 4YDKH 4OB5L 1BJ8A 2YPLD 4LKCA 1JPSL 4JR9H 3OKMA 2A9MH 2FX7L 1PLGL 2J8OA 2EDXA 1BOGA 2GK0B 4F37K 3UTTA 2CIKA 4Q9QL 3I6KB 4LL9A 1JIBA 3AS1A 1KCLA 3CVIH 5F1SA 4PLOB 4FXKA 2WMPA 1OF2A 3RHWK 3LN4B 4DGVL 3EJJX 3TO2A 3I6GB 3ARDC 4PRNB 4KROB 4N0RA 1CZ8L 4JFXA 3GEWB 5C9JA 3H3PL 5JORA 4Y4HC 1FAIH 5JOFA 4FQLL 3CC5B 5C0BE 1JGEA 5L0QB 1UM4H 2Q76B 1NGZB 2DQGH 3TBVA 4LASL 3AU1A 5TH2B 3DRQA 3GBNH 2EEAA 3U82B 1G7MA 2PCPB 5C07B 4X6BB 4N8CL 1TTUA 4ZTPL 1C12A 4TYUA 4Y2OA 3N1FC 1NFIA 3RL2B 2ZUYA 3PDGA 5EZOH 1RZJL 2W07A 1LVEA 3WFZA 5JQ6L 1AXIB 1CG9A 2VDLH 5BW7C 3GMMB 5BRZB 1FH5L 2G5RA 1NAMA 2CJUL 4PJAF 4KZEL 3PWJA 2C4FT 3RNQA 5AYUL 2DM2A 2Z4QB 1MLBB 2EC9T 1EHLL 4PLKD 2NW2B 2MCPL 5C0RL 3GIZH 1N6VA 5E8OB 1TZHB 4AIZB 3PHQB 3U2SB 4MZ2A 4LSVH 1MVFA 4Q9RH 3TO4D 3H7BB 1WIOA 1WT5C 3QFJB 4PJ9A 2B1HH 1OP5H 5D1ZA 2IQ9H 1R6VA 3ZTNH 4DTGL 2XQYK 2CDFA 4NRYB 5LGHL 1RFDH 1BVKB 4IJ3B 4TQEL 5C0CA 1IGMH 2FNBA 1CGWA 1CDCA 5C3TA 3MYZA 1TQCC 3KPMA 4PJIB 1KT2B 3HTLX 1XGRB 1GGBH 1MQ8A 1RVFH 2DLTA 1JWMA 4JM2D 5HVWA 4XNYL 1BM3H 5C8JB 4PG2A 3V2AR 4ISVB 4KUZL 5DD5H 1DTUA 2UY6A 3T1FA 4QRPA 1D5IH 1S7XA 4NQDE 5IWLC 4FQ1H 1MWAL 5F9AC 2Y07L 3OKLA 5IIEA 4WWKB 43C9A 4FQIH 4C56A 1A6TB 1EGJA 3MV8A 4P23A 1OAZH 1BVZA 3B6SB 1XAUA 2NX5E 3O3AA 4LFHD 3C5SB 1K6QL 5C0DB 1XGTB 4JFDD 3I50H 5DJ8A 3P73A 4OZFG 3SKMB 1UXSA 3RVXC 3QCVL 5J57B 1A7QH 1QBLL 4OCYL 1Q8MA 2ATPA 2VLKB 4JRYB 4OLWH 5JMRA 4DGIH 4GUPB 1H3TA 3KYMB 2D03L 5F96H 2X4NA 2WBJC 4JY4A 4ZUVA 4P46B 2J88L 4X7CC 1FNGB 3QUKB 3TEUA 2PO6B 1XF4A 4R90L 5D93B 5GGQL 5HSFA 3ZL4L 4HHAA 5LXGH 3PWPD 3CCHB 1U3ZA 1CLZL 3STZA 2X40A 3LQAH 4XZUA 5GZOD 4X8JB 4KK8C 1SYVB 3DETC 1EO8L 4ETQB 1LILA 3UTZA 1B4JH 5LGJA 1G9MC 2HP4A 4L8DB 4U1MB 4Y5YB 4MQXC 32C2B 2WWMD 3G6JA 3TNMA 4KQ3L