4I0CC

The structure of the camelid antibody cabhul5 in complex with human lysozyme
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
b'VQLQESGGGSVQAGGSLRLSCEASGLSTTVMAWFRQAPGKEREGVAAIYTGDGFPYYADSVKGRFTISQDNAKNRMYLQMNSLEPEDTAMYYCAAKTGAFSYGSLWWMSRAYNHWGQGTQVTVSSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title A nanobody binding to non-amyloidogenic regions of the protein human lysozyme enhances partial unfolding but inhibits amyloid fibril formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 34
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i0cC00
4RX4A 4Z76B 4P2OC 5D93B 1XAUA 3WFCL 3Q5YA 5DS8B 2CO7B 5DYOB 4I0PC 1JZ2A 2VUOA 4D9QE 4P2RD 3T77A 3V4UH 3DBXA 2HJLB 1WTLA 5KN5A 1HDMB 3KXFD 3I6KB 3WIIL 4JHAH 4MCZB 1HHIB 3C5ZD 1IAIH 1HI6B 4EBQH 4XZUA 3MFFB 5D2NC 2GTZB 3TM6A 2IFFH 5LBSL 1H15B 1FNGA 1U6AL 2YOCA 1OLLA 3SJVD 4PJGE 1BQLL 2J8OA 3N0PB 4O9HH 3MUZ1 1A14L 4PJBE 4J7RA 3KPNA 4M7KL 3V0VB 3LY6A 5E99H 4HKXB 1IQWH 1SJHA 2NTFB 3RWHA 4XMLH 2W9DL 4HV8B 3QUZB 3F7YA 1OAQH 2YMXH 4PP2A 1ZA3B 2R0ZL 2ADGB 3D3VD 5JQ6L 4OZHB 3C60C 3MCKA 3U9UB 1R3KA 5FO7A 3GSVA 1UJ3A 3MUHL 2NW3A 4R97C 1KNOB 5DF0A 3QH3A 5CEZL 3EIFA 4OBSA 4OM1L 5DD6A 3MRNA 4M6OH 1V5JA 2VDML 1TITA 1FN4A 2BRRL 3VXOA 1TLKA 4OFDA 1D5XA 2JJSA 1JPTL 3C5ZB 2C26A 4BKLB 4TOYL 1FNSH 1LK2B 2EEAA 2R9HC 1RUAL 4NN6B 3RWCA 5I74B 4XCYA 1JBJA 4HS6B 3OKKA 4U6XB 4DGIH 1J0JA 4F57H 3ME0A 1B4JH 2WNGA 1RIHL 1YYLL 3UX9B 5ERWB 4Y1AA 5BRZA 1UEMA 2E8ZA 1MNUH 3TO4A 1UB6B 1A22B 4G6KH 4X99B 2ZKHL 1Q0YL 4KJYB 5FOBB 5ITBH 1EJ6A 4L4VA 4WJ5B 4WFFE 5IGXH 1QLFA 3SDDA 1OB1B 4NRYB 4CAGA 2IANA 3QCUH 1YEGL 3D3VB 4PLJD 4MJ2A 3UZEA 4LGRB 3U2SB 3LD8C 1TENA 2E7LA 2Y5TA 1PEZA 1RZKC 2F53D 1A7PL 3V52L 4Y88A 5TE7H 3LVEA 43C9A 2DDQH 4M6ML 4NC2B 3RRQA 2YZ1A 1BREA 5D71L 2V17H 1RZJC 1XF3A 3VXSB 1BFOA 2X4SA 4AZ8A 5E8OA 1UWEH 1F8TL 1YZZA 5HGBB 3PL6D 5TQ0L 3QQ9C 3IXTA 5E8PB 4QTIL 3S3JA 3MQIA 3UBXB 1SEQL 4P4RA 3RWFB 4JRXB 3MRCB 1DBKL 1RUMH 2O61B 4MDJB 4X80L 1ZT7A 2L7UA 3I9GH 3IRPX 1JN6A 4GMTH 2G9HB 3WE6B 3BZEA 1MEXH 5CZVH 1I8IA 5CJ8A 1G9ML 1CGYA 4Q97A 2ZCLL 1AE6H 2HWZH 2OBGA 4IOIB 4YFEA 1YEEL 2KDGA 1LO3H 4BYHA 2R4RL 1OM3H 1JPST 4DK3A 2F53B 5DI8B 2J3SA 5EU3A 1NC2D 4OLZH 4P5TC 1JPSH 3WNPA 3AGVA 1ED3A 1OT1A 2X1OA 1DL7L 2VDKH 2JIXA 5AWNL 4WW2C 2P1YA 3PL6B 2Y07H 3SDAB 3ZKNC 3NIFF 3GMMA 4IHOA 3U82B 2B20A 5EUOA 3G6DL 5TE6L 1T7VA 5FYLD 5EORH 4XPTH 3MREA 5E2WL 2HTLD 5HI5D 5C71A 4P59H 3U30C 2ENYA 4HWUA 4TUJA 5D7LA 3CSBA 3QEQA 2VLJA 4M1GH 4Z7UE 3QWOB 2Y25A 4JG0L 5I8CA 3E6FB 4LQFH 1MREH 2NPLX 3R1GH 2OL3A 1NBZB 1QSEE 3OB0K 4ONHA 5CZXD 1H3WM 2QSQA 3HMXL 4MNGB 5EZOH 2BK8A 3ARBB 2BJMH 5I16A 2GSIB 1F4XH 4U3XA 3FB7A 5I71C 3ALPA 1FAIL 5GS1C 4NWTL 4HPYL 1U8LA 1OP3H 3TZVA 4HIHA 4R2GD 2O5XL 3DO7B 2V5SA 2ED8A 2A6JB 3PHQA 3BXNB 2YD8A 1NBVL 3D0LB 3DTXA 4QKXB 1I3GL 2WUBL 3G5VA 4TVPE 3FHQA 2J8UA 2IADA 2XICA 1PSKH 5JOPE 3SCMD 4WTXA 2A6KA 5DJ6A 4OLXH 4M7ZC 4LVHC 3MNVA 5LWYL 2FBJL 4YPJA 1T20A 3VXNA 5E9DA 4NO2A 1DQQB 1MHPL 5JO5B 2F5AH 3CMGA 5L2KA 3TPUA 5C0DB 4DVRL 4OQTA 1UB5A 1N6QL 1MFEL 4WHYH 4OZGF 4JFQB 5FA4A 1AHWB 5MHSE 5TPWH 1F11A 2Y9RT 4JJ5B 4GLRI 3GHBL 3VRIB 3VMOA 4WFGE 1FC2D 3WNLA 3SDXF 2C4FU 3H9HB 3P9LA 5I76A 5GHWH 5GGUB 5FYLL 3HZMB 1QFHA 3MV8D 5DGRA 4DN4H 5JXAL 2CK0L 1XMWA 1RMFL 3EJYD 5HHMD 1EBAA 2DL2A 3T8XA 5J13C 4GFTB 1JFQL 4RMUA 1FL5A 1S8DA 3GSRB 4UOJA 4GOSA 3ARFC 1X9QA 2VDRL 2AQ3A 2VDLH 3DX8A 2AI0H 1CXHA 1FFOA 4O5LL 3UC0H 4PLOB 3S35L 4ZQKA 2PYEB 3MOAL 3V7AG 2J12B 1JPFA 1RU9H 3P0VL 4P3DB 3QB7C 5C0AE 4OT1L 4XCFL 4YFDB 3KWWB 3KYOB 3IJYA 4Q9RH 2V9QA 4GJTB 4G9FE 5HI4D 4EN3A 3UTTE 3OX8A 5CAYB 3IF1A 4PJXF 1G0XA 1S9XA 5HY9A 5TQ2H 5KANI 1QFPA 3LQZB 1X5JA 1QR4A 5F9JB 3WIIH 1BQHG 3HZYA 1RV6X 1U91B 4NFCA 4NWUL 5B4MD 3WEXA 2WLYA 3MJ9A 1CK0L 4OI7A 5C6WH 5GGQH 1JNNH 2H3NA 4OSUL 3PP3H 1U6AH 1FL3B 1T66D 3U6RA 5IJKC 4GKOA 4M7KH 4I48B 5CLTA 4XCNA 4XBGA 3UTPD 1XF4B 1NANH 4APQB 4A6YA 5GSVB 2IH3A 3ZHDA 4FFVD 1P1ZA 3CVIH 1F45A 4F2MA 1T1XA 4TUKH 2BSSB 4BQCA 5JQ6H 1YQ2A 2AK4E 2HT4D 3G6JB 5KN5B 3RL1A 3EBAA 3T4YA 5FM5M 3D39B 4J4PC 5FV1L 1V7ML 4L8SC 5I17B 5D1XB 1XR8A 1OW0C 2OP4L 3I84A 1G6RB 1QRND 1YJDC 3Q6FB 3PDDA 4MXVE 3J8F7 4JHWH 5GGTH 1FNGB 1K8DB 1OAZH 2BRRH 3VD7A 5MEOA 3O0RL 5F9WB 4TOYH 4XP4H 4GG8A 3MBXL 4Y0GA 5CJQL 2FHBA 3L3HA 1YEJL 4YXHL 5HJ3B 2HTKC 2NY5C 1SBSL 3PWPE 5BS0E 4NN5C 1FBIL 2ICWI 5CILH 3X13B 3LPWA 1N5YL 3T2QA 5C6TL 4X4XB 5L6YH 4R96A 4NQVB 1NAMA 5SWSE 3KPPA 4YR6A 3WUWB 1PBYA 2AGJL 2BHUA 4EI5A 1Q0YH 3IJHA 4E5XB 4KI5F 1MCWW 1ZWIB 1IC7L 2B4CC 2XXMB 5I2IB 4LVNC 1G6RL 4EDWH 3V6OE 3WDHA 1CFTB 2E9BA 4Z78B 4QXGL 1XF1A 5F1IB 1RJCA 2DL9A 1ZS8B 2DQIH 1T2JA 5H37G 2DMKA 1QRNB 5EO1A 4NKMA 1A7PH 3V52H 5C0ND 1DEEB 3B6SA 1WSST 4YBQC 8CGTA 1I9JL 2EXYC 4Y1AB 5EZIL 4R0LA 3RUGB 2HKHH 1HQRB 4N5UA 1YY9D 5HHQA 1F8TH 3CZJA 4KPHH 4QTIH 5F6HJ 5GS0D 2EECA 5DZNA 4I0KA 1SEQH 4UDTA 3OTTA 5GXBB 1EHLH 4DVBB 4EVNA 1NBYB 4KI5D 4ETQA 2HJKB 5GZNC 5HGHA 4X80H 1KOAA 2VDQL 4PRPE 1HZHL 4GRWF 4PJFF 1LVEA 5DRZB 4BZ1L 5TF1L 1QTYT 3W39B 3RWGA 1QSFE 1FZKB 4JKWA 3MRJA 4KU1A 5FA3A 1PZUB 3IXAB 4PJAE 4K9EC 1JZ8A 3QJFB 1YEEH 1ZHLB 2FJFA 2J6EA 3NIGF 5I8OL 3HRZA 1X4XA 4I9WE 2CQVA 4BFIA 2HJFB 3LEXA 2VZVA 5E8OB 4RFNC 5LAXB 1QBLH 3TJHC 3OB8A 1TJGL 1WIOA 4HJGA 4YX2L 3RZWA 4ELMF 1IC1A 4GSDL 3U4EA 4JFOA 5HHPB 4JVPA 2FX8L 1L0YA 2FCBA 1OAUL 4P4RB 1T03L 3D9AL 4N0UA 3MJ8B 5AWNH 1OAKL 2V2TA 5I8KL 4HKZA 5C0BB 1RUPL 3G6DH 3LEYH 1CU4L 5F3BA 4MLIA 2I9LA 1I7ZB 5E2WH 1OGTB 1Z6JT 3MRLA 5CJBA 4NYLA 5DDHB 3UAJD 1D6EA 5D2LB 2X05A 4JG0H 5CJOH 1OF2A 3NOIA 1OTUC 1JF6A 3WHE0 2XIDA 3B8YA 4G80A 3QDGD 4JB9H 4M48L 5EDXA 1JZ3A 1BQHA 1JGDA 3B9KC 3VG9C 5BZDB 2AJZB 2VR9A 1YMMA 4G8GB 4S1SH 5K9KA 1CLOH 4HF5L 1FAIH 2V9RA 3DYOA 4NWTH 3KPLB 2G5BA 4O00A 3S96B 4LPVA 3S7GA 5T5FL 4M8QA 4N0FA 2XWBA 4Y4KB 1KIQB 5D2NE 4AEFA 5GS0L 3I2CH 3ULVE 4L3CB 2NY3D 3E2HB 3MRDA 3LDBB 3GUTB 4YFLI 5H35B 7FABH 3E8UH 2AJVL 5FYJH 3MREB 1NBVH 1KTDA 3AS2A 1FORL 4LCYB 4X7FC 5E94A 3QIBC 1I3GH 2WUBH 1A7QH 4W6XB 2NY1D 2NY0C 2EDJA 3PWNB 1HK6A 5KJRL 4NO5A 5D4QA 1M7IB 4IRJD 4LSRL 2QSVA 1A1MA 3L7EB 2WBJA 4MXQC 3KLSA 4GRWB 4PJFB 2FBJH 2JKXA 3GJFA 1MHPH 3LH2H 1IGJB 2QHRL 3QDGB 5D70L 3M45A 4DVRH 1WFTA 2PO6A 1MFEH 1W2KT 1UM6L 3K7UA 1I8LC 4FABH 2FLRT 4YDJB 3X12A 1AFVH 5MEQB 4ODXA 5DJXA 3GIZH 3GHBH 3S34H 2P5EA 5D8JL 1RURL 3VFTA 3NAAL 5JOFA 1W0VB 3Q48A 1ZTXH 4G6JL 5IQ7L 2NY3B 3PNWA 5ISZB 5JXAH 2CK0H 5JPMB 3MR9A 1YA5A 1I9RH 3IDJA 4OUOA 4L3AA 5B22A 5D7JD 4ZPVB 5DQDH 3CJJA 4X8JB 1UXSB 3TVMA 1NL0L 4IRJB 2VDRH 3GMNA 4JO4L 3U36B 1CE6A 1G7QA 3FB8A 4PP1D 1F11B 3WXVL 3BPNC 1EZVX 1MCSA 1JHKL 1LEGB 3MOAH 1IQDB 3P0VH 4OB5H 3W81A 1E6OL 3WFDH 5I9QC 4OT1H 2ERJB 1IEAA 4XCFH 3BH8B 1BJ1H 4R7DB 3H3KA 2Q3AA 4WI6A 4B7IA 4HQQH 4KRMB 4ZPTB 4IS6A 4WI5A 35C8L 1S9VA 2HN7A 5J9PA 3QQ4B 3HUJF 2BXYA 4OLUL 3RDTD 1FPTL 4PJ5A 1VEOA 4Q0XL 3TNMB 3LMJL 5EOCJ 32C2A 2DTML 3C6SB 3IFLH 4BZ2H 3RIFF 2IAMC 3O2WL 4WDIA 4WU5A 3IAGC 4X6CE 1CK0H 5GSRB 3DX8B 5D7JB 5HPMB 5SX4H 4OSUH 2VITA 1P2CA 1T2QH 2B1AL 4V2CB 3ECBA 2E5EA 1JPFB 2X89A 3AY4C 3DXAB 4L8CA 1J1XH 3Q6GL 3OAZK 1EZVY 3BEVA 5E5MA 2UWEA 1Q9KA 5K33A 2VLRA 1X3DA 4PJ9D 12E8L 4OTXH 4XWOD 2Z35A 2E27H 1KCUL 3MOBH 2ZOLB 3H7BB 5T1MA 4ZDHB 2Z92A 2X4UB 1RZIA 1U3ZA 4X7SL 4RISH 4Y19B 3MV7D 2F54A 4KRPD 1XCTB 2OCFD 5EU6E 1U8NA 1E4XI 1M7DB 5E8DL 1NCTA 5DJCA 4PJ7E 3I02B 2DQEL 3ES6A 4HMDA 4RAVA 1JNLH 4YXLL 3RFZC 1C8PA 3O0RH 5CJQH 5FYKD 3MBXH 1B2WH 1NLBL 3ARUA 1CFVL 1CG9A 1YEJH 4YXHH 5D1ZD 1YNTB 1CWVA 4GRLD 5A3IC 4LCCB 4KDTC 4QHKI 5MEND 1N5YH 3ESVF 1TJIL 3P30L 2RFXA 4OGYH 2AGJH 3BP6B 4KROB 3ZDZF 4N1EA 4ZFFB 3P77B 1Q9WA 2JB6A 4F7MB 3LKNA 4CVXA 2Z93A 1G7MA 1OL0A 3GB7B 4OZFG 5EO9A 3SN6N 5CUSL 4QXGH 1HE7A 5I73B 1FV1B 3VXME 3HUJB 1ITCA 2GJ6B 3MV7B 3VFUA 4J8RA 1H8OA 1YNLL 2BC4B 4S1DD 2QKIA 3BQUD 3VWJD 4KRPB 1J05B 3SE4A 1BECA 4PGJA 2EIZA 1WBZA 1IAKA 3JTSA 4XNMB 4QHMA 4ODWB 4YDLB 4ZG1A 4OF5A 1I9JH 1QHOA 3SGEI 4XB7A 1AR1C 2QADC 1KUMA 3RAJH 1N6UA 1XGYL 5LGJB 3WUZA 1HHJA 5LG1A 2X5PA 4D0BB 4DKEH 4JREC 3UPRA 4DUWA 1NAKL 2DIBA 1KV3A 5HGAA 2DOCA 2J2ZA 3LZFL 3MRKA 1KPRA 4PJGA 3NACL 4ODUA 4M62L 4PJBA 5CJXA 3REWB 1T1WB 1ZK9A 4ONOA 3ROOA 2CUMA 1DN0B 3O4OC 2VDQH 1HZHH 4RGND 1IM9D 1FVDA 5TF1H 4PR5A 1J1OL 1AGEA 3MRPB 5EO1B 1NFDE 1DQML 3SGJA 2LVEA 1CFSB 3EOAA 1UZ8A 1R5VB 2R2CA 3J7HA 3VWJB 4B41A 1TMCB 4U4BA 4IDLA 4JFXA 5DEGA 5J3HD 2ED9A 3CH1B 5HHQB 4PGDA 1D7FA 1TJGH 3L1OL 1AO7B 5J4MA 3IETA 4OGAD 2OSLA 4ZUVA 1DQJA 5T3XL 4EVNB 3QNXA 1OAUH 4R3SA 3BGMA 3D9AH 5HVHB 2Y23A 1AI1H 1RIVL 1OAKH 2X70B 3GGWA 3CPLA 1EEYB 1TZIB 1VEPA 4NP4H 1RUPH 3WO4B 3RZCC 5JNYA 2MCPL 3TIEB 2I9TA 4MJIB 2LU3A 4OIIH 5EBMB 3V8OA 3MO1A 4OCWL 2P5WB 1IM9B 2Y7QB 3OAUL 1BGXH 2XZAL 1OVZA 3SE9H 5I15L 4E0RA 3OR6B 5IQ9B 4BH8B 3QUKB 4ZYKA 1LEIB 3NCCB 3F7RA 3I3DA 3TF7C 1MRDL 4J12A 3RTQA 3CFCH 4JG1H 5CWSB 4EEEA 3UJJL 4CU8A 2B7DT 3BZ4B 3RVVC 3A6CL 5AG8A 5I66A 3FB5B 1WWWX 3LRSB 2R0KL 3OKYA 2NMSA 3BKYL 3FFCE 3QULA 4Y16A 4UT6L 3V5KB 3TA3A 2AJVH 3SO5A 4H1LB 4Z7QE 3C6LA 4TSCL 4ZO8A 2FR4B 5EBWA 1QYGL 4KKCC 1ZE3C 3O6LH 4PJDE 4JQXC 5KJRH 2VWEE 2GY5A 2LU7A 4LSRH 2D31B 1Y18A 3DECA 5JW4M 3UYOD 2MWCA 3E0GA 3W9EA 2EDYA 1JZ7A 1T83A 1ZT1B 1BF2A 5ESQB 3KYNA 2QHRH 2D0HA 3QUYA 5KVDL 4KZEL 3FMGL 5D70H 4EIZC 3JV6B 1BD2E 5J6GB 1UM6H 1HOCA 2GK0B 3GSUB 4UT7H 4PLKC 1ZA6A 3RGVA 5IMKB 1TPXB 3OWEA 1K6QL 2NXZD 1N7ML 1RURH 3NAAH 4U0RB 1B0GA 2FX7L 3CFKB 4G6JH 5IQ7H 2BCKA 3I6LD 1J0KA 3KDMB 2QQKL 2OL3H 1LO0L 4NO5B 3FT3A 1G1CA 5FFLA 3GMPA 3FQTB 4GW4B 4CDGC 4OFYA 2Q6WB 2R4SH 3DRTA 1D9KC 4LKXA 3JWOL 4OGXL 5IFHL 4OZFA 2EE2A 2AVGA 3O8XD 3AB0C 1OTTD 2Q8BL 1NL0H 4ZO7A 3U83A 4JO4H 4NZRH 1N8ZA 5IMOA 4U1GB 2NY7L 4RWYL 2DQHL 4LLUB 4KY1L 4PD4K 1REIA 1CGWA 1CICC 5JOFB 3WKMH 1F3JA 2DQTH 1BJMA 4TNWK 5KSAD 4C56E 2AXFB 3QQ3A 3TBWA 1JK8B 3ZTNL 3P2TA 35C8H 4JN2A 1VERA 1QPPA 4HIEB 2D7PA 1FPTH 4XH2B 3SY0A 5DJZA 4AIZB 4TSBH 3VXRD 3F6LA 4Q0XH 2DTMH 3HFMH 5C9JA 1LNUA 4PRBA 4MQTB 2VTFA 3WD5L 3FB6A 1V7NL 4ZTPH 5MEPA 2R2HA 4OQTH 4FQXC 3X14B 1SYVB 4M6NH 1Q72L 2KUTA 1B6UA 3STZA 1F6LL 4TTDD 2DBJA 4QNPF 1EEZB 1A6VL 1FNFA 3O8XB 5EFIB 2R29L 4F37K 1IMHC 3HI5H 3HRPA 1FVEA 2W0KA 1NEZG 3HC4L 3GRWL 4JDZA 3SDCC 12E8H 4KJPD 1OWRM 1CYGA 1KCUH 5DMIL 5KSAB 1IC5H 2A1WL 2ZZUT 4Z5RB 3O3DB 1FO0A 4WU5B 1BIIA 4BSVA 4RAUB 5M7QA 1S9WB 1HCFX 5IB5B 3O3BB 4G3YL 4OLYH 5IVXF 3EHBD 3P9MB 4D2NA 5DUBB 5E8DH 3ZYZA 1I4FA 3EDEA 2DQEH 2VLLB 2JCCE 3WMSA 3VXQA 3WS3A 2IPTH 1NLBH 2EXWD 5J1AB 2H6PA 3OKEA 1CFVH 4KKBD 4P9HL 1T21A 4PRHE 1U8OB 1LK3L 2VQTA 2MQ3A 3HE6A 2VMFA 2BNQD 4TNVF 1QEWB 1TJIH 4BSJA 5IBLC 5EU5B 3U4BH 5C2BL 2BDNL 3U1SL 2KQMA 2P8LA 4FQ1H 3HG1D 3EOBB 4HCRL 4IMLA 4X4ME 3D2UD 3RWEA 3OJDA 4K55A 3MJ9H 1GGTA 3P73A 2FL5B 3GMRA 1K5NB 4QRPD 5CP3H 5KS9E 4ZUTB 5D93C 5C0AA 1SMOA 3OGCA 1MI5D 2BOBA 3SDYL 1JHLL 2C1OA 4G9FA 2N1KA 3ZL4H 3HTLX 3QFJD 5F7YC 1T1ZB 4I18A 3UTTA 3RWDA 3FO9A 1ZHNA 3KNBB 2N56A 1G6VK 5EU4B 2YEZA 5C3TA 1QSZA 2NW2B 4X6BA 3P4MA 2FD6H 5JW4Q 3IVKA 5IF0A 1A2YB 3SKNA 3QXTA 5F88A 3A6OA 5L0QB 4YDKL 1NAKH 1ZHBA 2BNQB 2R2BB 2CLVA 3U0WL 4GH7B 2WWKO 3QDMD 2PTTA 2VQ1B 1CLCA 3QUZC 4M62H 3UYRL 3ARQA 5DEFA 4HG4K 3TN0B 4WV1B 3TIDB 4RQQA 3PP4L 5INCA 3VFUB 1KG0A 2W1NA 2NY2D 1J1OH 3UTQA 4QRPB 2EDTA 2PW1B 3CX5K 1N5AA 1S7SA 3MLZL 4KDWA 1WWAX 3FQWA 2AK4A 1MI5B 3KVQA 3PIQA 1PKQE 4H8WL 3CXDH 1ODAA 2ADJB 4Z7VB 3D18A 4P9ML 4QHNB 3PGCA 1K3ZA 2K3TA 3QFJB 3QNYB 1NJ9A 4G9DB 4WCYL 3LS5L 5DUPL 1M1SA 1NDMA 4G6MH 1HYRC 1Z9OA 5BJTA 1HHJB 4CN4A 2CKBB 1CD8A 4JKMA 4M5ZH 3L1OH 3WNKA 5HYFA 1ZSDA 3DURB 2EDWA 5T3XH 1AH1A 4PTUB 2M8XA 4HLJA 4Y2DD 1T22A 3ROOB 5E5UB 3HS0A 5BS0A 3TYFA 1OAYL 5J12B 2QBWA 4L9DA 3QDMB 3M1BB 3NPSB 1B0RA 2MCPH 5KTEL 4MAYA 5IB1A 3ZHKA 5SWSA 5IK3B 5IB4A 4P4KD 4LPCA 3VFWA 3WV0A 2EICA 5JPNA 3BPOB 3V4VL 3KAAA 5HGDA 3BP5A 2XZAH 2VYRE 4MVBC 4KV5F 2NY2B 1HINL 4LF3B 4W4NA 5I15H 5DVMA 5I6XC 2VDNL 4NJ9H 2E9WA 1MJ7L 3V6OA 2CKBL 2FJHA 3TH4T 2HRPH 4LRNL 3L5WB 2QLVB 1AC0A 3CFBB 3JXAA 5D72H 3NPZB 4PGCA 3LRGA 4FQLH 5T3ZE 1VKXB 2OSLB 3L3JA 4XTRD 3UJJH 1KLGA 4JZJA 4N5EC 1YEIH 5GRYA 2PYFA 5EUKB 4EZMA 1J5OL 1C7SA 3Q0HA 3T0EB 4Z7NF 5LXGL 4NZTL 2XTJD 5EIIA 4AG4H 4GAGL 4WUUE 1MRCL 3AMKA 3K4DA 1U93B 2UVEA 1PAMA 3LKRB 2HMID 2BVQB 4Z6AT 1VFOA 1NEZA 5GGSB 2HFFB 4Y2DB 1H3GA 2I27N 4TSCH 3MUY1 1J10A 2DRUA 1QYGH 3QI9A 1WC7A 3QIWD 5CZKA 5GPRA 1S7UA 4NQSA 1CTNA 4MD0A 5JW5B 4CNIB 2VRAA 3UTOA 1RPQA 4RNRA 5KZCD 4PYHA 5DVOA 3RWJB 5I18L 3G08A 3MV11 4I4WA 3HNTH 4PRPA 3F7VA 1U58A 2BRQA 3CC5A 3DX6A 1FZMB 5KVGH 3WKNA 4KZEH 3FMGH 5CIPA 2YXMA 3T09A 4FXGB 1D5MB 1Z5LA 1QSFA 1JGEA 3CLFL 5E03A 4PJAA 4D0CA 5FGBC 4XGZB 1K6QH 3DYPA 1N7MH 2CH8A 3MRQA 1DLHA 5DJDA 3T65A 1RFDH 2DYPD 4FXLA 4XP1H 1XGQB 3MNZB 3L3IA 4J3OC 4ODVH 5KOMC 3SDAC 2FWOB 5C07E 3FONA 2X9YA 5CSBA 1KPVA 4NUGL 3QXWA 2YRPA 5EZLB 4OGXH 3JWOH 5IFHH 1D3CA 1B90A 3ZDXF 3JV0A 1RK1B 4PJCE 3O4LD 3TT3L 1UFUA 1NGWB 2AERT 5GJSL 2BMKB 5MI0C 2BNRD 2AV7A 2NY6B 3LKOB 4R8WL 5KZCB 4X9FA 1DJSA 1HHHB 4YBLC 1BWWA 4MD4B 3ARBC 1LO2L 1D5ZB 1JRHH 4P2OA 2AEPL 2YRLA 2DQDL 1JGVL 1MCDA 4I0PA 2CXKA 4AJ0A 1NCWH 2Q87A 1IEBA 5IW1A 1LP9E 1DE4B 3O6KH 1I9IL 4Z0XA 3QZWG 5KAQG 3FQNB 4HLZH 3OAZH 4DKAA 3NCYS 5I1IL 3CSYB 3VD4A 3CFDA 2GUOB 5D2NA 1V7NH 3RVWD 1OSPL 4NQCD 4F15C 4ZTOL 1F3DJ 1S9YB 1Q72H 2EDDA 3RWIA 1R3JB 2XPGB 1BF8A 1AD9A 2H8PA 1A6VH 1INQA 1E6JL 4LEOB 5DK2A 4NKOB 4Z7UB 1DVFA 1CD1A 2R29H 3BKJL 3HE7D 4HKBA 3W2DL 1QSEB 3BEWB 2V5RA 4E41D 1AXSB 4NZDA 4ZUWA 4DGVL 2B1HL 3EO9L 1TVHB 1KEML 3GRWH 5A16A 4U1JB 1LE9A 1F6FB 1ZXQA 1N59A 1AHWC 3B2UC 3HZVB 3MLUH 4X8XA 3S9DB 3GK8L 3PQYD 2P7TA 3WLWD 3L7FA 2A1WH 1WZLA 1A6ZA 4AIOA 1XT5A 3PWJA 5AG9A 1Y6KR 4HDIB 1ZLWK 2FECL 2ITDB 4V1DE 4U1MA 3L3OA 4H88H 7CGTA 1T5WB 4K2UL 5GS3A 4NQCB 1R3HA 5KG9B 2F5BL 4I2XE 4TYUA 5K9OB 1OARH 4QOKD 3C8KB 5EC1A 3TLRA 3WYRA 4D3CL 1LK3H 4LDLB 3ARGB 1FL6A 1EAPB 5DVLA 4JDZB 3P4OA 2BY3A 1A3LL 3MJ7B 4N90D 4HUKB 5C2BH 2BDNH 1KLUB 1X5HA 4RX4D 1A6AA 4L4TE 2WIIA 2F74A 3P9WB 4E41B 4LLWA 1WAAF 3H9SE 2K9UA 1WT5C 1LGVA 1OAXH 1BIIB 1NCCL 4XT1C 3QG6B 4L9LA 4TN9A 2JE8A 2R23B 3H8NA 4JN1H 5DK3A 3MV9D 4FFYL 4K8RD 1MLCA 2H26A 3T3PF 1FNEB 1ERNA 3O41B 3SDYH 1YDPA 3CLEL 5KSBF 3I75A 3L3GB 3RI5F 2CLRA 2B5IB 4LSPH 3TGXA 1NCDL 4CU6A 5IR1A 4DJMA 2V6HA 4JCLA 1IARB 5D6CB 2DAVA 2MKLC 4LAJH 1UG9A 5F21B 2DWEB 2H2SC 3MOQA 4RFOH 4UTAL 2R1WB 2Q86A 1ZANL 5ESAB 15C8L 2OK0L 1PZ5A 4X6CA 1CLYH 1EGJA 4XMPH 3U7YL 2DKMA 3U0WH 4QXUL 4APQC 4BUGA 3QIUB 3RPIB 4XPGH 3UYRH 3JBG7 4WHTA 3RY6C 2PN5A 5F96H 3KPMA 3PWUB 5HDQL 3T4AB 3PP4H 3FAWA 3GHEH 1MIML 4YO0A 4G9FB 3ARDB 3D69B 1SEBA 3MACL 4LDEB 3MV9B 4OCYL 4P48A 2R0LH 1NKRA 3BP7A 5D1XC 3WL9B 3RHWF 2CO6B 2EC9U 1LDSA 4WO4A 1T2XA 1FYTB 4NNPL 4P9MH 4F8QA 4ZS7L 4WCYH 3B4NA 4XX1E 4L8DA 3LS5H 1A6TA 3BH9B 5D5ME 4HXBH 4QXTA 5DMYA 1WITA 5EU6A 1CT8B 1KJMB 5JIPA 4YUEH 1Q9LA 4FQQB 4ZUUB 2GITB 4PJ7A 2I60L 4WW2A 5C0JA 1NGYA 1X4YA 2PTTB 3F58L 3BUYA 3STLB 1G9EA 5DO2C 3DLQR 2VUYA 3ZE1F 1AC6A 1OAYH 3TV3L 1BZ9B 3DETD 1UJ3C 1JL8A 5KTEH 3C09B 3MGOB 4K8RL 4R4FL 5F7FA 4Y89A 3V4VH 2OZ4L 3DMMA 1AGBB 2NR6C 3MMEB 2A77L 4QHUB 3QZWA 1HINH 5JLZA 3MRBA 3GSNB 1VB9A 2R39A 1MJ7H 2W9EL 2CKBH 1B4RA 3W0WE 4LRNH 3N85H 2DD8L 1DUZB 5E2UL 1JWUA 4FZ8L 3QDJB 4WY7H 2QQQA 2V2XB 4KQ3L 3WFBL 5KSBB 3VXMA 4MX7B 4HFWA 1KCSL 4GBXB 4NQDE 4NT6A 2XZCL 2RGSA 1K2DA 2W9LA 4Z77B 5LXGH 2HT3D 3EOTL 4NZTH 1XGTB 5TH2A 5EUOF 3TO4C 5F9AC 3PWPB 4GAGH 1MRCH 2W60A 2IBZX 4X5WA 3GMLA 3SDDC 2V5TA 1F2XK 3K1DA 2GKIA 4U7MA 4JZNA 3IFPB 5HYQB 1QFOA 3GSNL 3DIFA 2DKSA 3S5LB 3RBSA 1E28A 1BZ7A 3T08A 1WBXB 2XZZA 2IALB 3LKPA 4I77L 1P5VA 5I18H 4GG6E 4PTTA 1KIRA 1UM5L 3CFEB 1YPZF 4RZCB 5AYUL 5F7DA 2GHWB 2DB8A 3MXWH 3CLFH 1G7PA 1TFHA 1AGCA 1HILB 4MJ4A 2QR0B 2VXSL 3AAZA 5CD3A 4QTHA 2RCSL 1QZ1A 2F9BT 2J8UF 4U6YB 4UILL 4JKLA 1G9NL 4P5KA 5DVKA 4DKFL 4B0MM 1U8IA 2IBZY 1UCTA 4MQXD 1C12B 3IGAA 1R0AH 3PWVB 2C3GA 3C9NA 1CXIA 3QEQD 5CMAA 4NUGH 1MJJA 3FFDB 3ARFA 4NHCH 3UZQA 1MAML 4HJJL 4TUOA 4DCQB 1BX2A 3QSKB 2YUVA 3R4DA 4JFFE 4FA8A 1P84K 2CLZB 3S8WA 1R6VA 2VXUL 1RJYA 4YHNA 5SV4A 1KB5B 1U92A 4KQ4H 4U1KA 4F7TB 4EQ3A 4H26A 4RDQG 3EYQC 3KLAB 3RU8L 2AJ3B 5IHBA 1OTSD 1JI2A 2DQDH 3BMVA 3S37L 4QYOA 3AS3A 4WHCA 1TCRB 1A4JA 3NFPB 3O6FD 4Y4KC 5CEZE 1CDJA 1I9IH 5A2FA 3E2HC 3QXUA 3T2NL 3LDBC 5E6IB 5IB2A 3WIFA 1TVBB 4D0DA 3QWRD 5DJYA 3FOMB 1NMBL 2ZP0T 3IB4A 1MCQA 4NJAL 5EZJB 1GC1L 4KJWD 3CDYA 4P2QD 3EO1A 5B8CB 4ZTOH 1WIUA 3PABB 5FB8B 5E9DD 5E2JA 3TWCL 2A73A 1KEGL 4PGBB 2ID5A 1KB5L 3QUMB 1E6JH 4LRIA 4U1LA 4OZHE 5T1KB 1IGTA 4PV9A 3BGAA 3GM0A 1S7TA 4EDXA 2DLFL 3NIDE 2BNUA 4Q7DA 1CDYA 3TBTA 1V05A 4DGVH 3DROA 2EE6A 1YEKL 2A0LD 1ORSB 1YPZB 3HNVL 3QEUB 4G5ZL 3FO1A 1MCRA 1D5BA 3KXFE 2XG4A 4L8SA 2NX5D 2VLKD 4MHHI 4CVUA 4YIQB 4OZFH 4L5FH 1OW0A 4X5LA 1BD2A 3CFDB 2Q7YA 3O6FB 3CCHA 5C0RL 1FFPA 4XP5H 2YHGA 4M02A 1G7LA 2RQ8A 3VI4E 3T0XA 5JXEC 3QUML 3SJVE 1AD9B 4K2UH 3SE3C 3P4NB 2VDPL 4P2QB 2AK1L 4HC1A 1CGTA 4F58L 4M8VA 4PB9L 4UU9A 1AGDA 2VXQL 4YE4H 5GGRA 4IRJC 2V7HA 1J1PH 3D3VE 3IDNB 5J57B 4HIJB 4YNYB 1A3LH 2HKFH 1A1NB 1Y0LB 1UA6L 2JB5L 5C0IA 5ID0B 4IBLT 5DHVB 1CE1L 1YY8B 4EN3D 1M71A 5ADPH 3ULSA 3ULVL 3I3EA 5IIEB 1JGLL 5C0CB 1NCCH 3FQUA 4DN3L 5ITFA 4Z7WF 1CGXA 4M4RA 1BLNB 4IEFB 2B2XH 2NX5B 2VLKB 4FFYH 4TVPH 2GJJA 4HGWB 4C56A 2A74A 5FV2A 3FN3A 3GSWB 1U8HA 4XPAL 3RNQB 3V7MA 3H42H 3E3QC 3VXSE 5IJVB 1NCDH 2ZUSA 1MJ8L 3R8QA 4PJ8B 4R7NA 2H2PC 4JE4B 5EPMB 5TDNB 5HVFB 4XNZB 3ILPA 4P0DA 15C8H 1OPGL 4JRXE 1QR1B 3Q2CA 3S4SB 4J2XA 2OK0H 1HYSC 5DK0B 4OIAA 4LPWA 4KKNA 1P7HL 1S7RB 4KKLC 3H6JA 1IM3A 4AH2B 1KJVB 1RK0A 4G7VH 4UV7H 3SQOL 4YH6A 5GISH 4PV8A 4YAQB 4PBWD 1UYWH 1QQDA 1IGYA 1RI8A 1MIMH 2YC1A 1S7QA 1C5DA 3HAEB 2F53E 2E9IA 3L3DB 4Q2ZA 2ZSVB 4X6FA 4ZXBB 3MACH 4OCYH 2ICWB 2Z9TA 4QCIA 1S7WA 1CF8L 4NNPH 3MNWA 3JZ7A 1QNZH 4PREA 1SVZA 5HHOB 2ATKB 4MB5A 1Z9LA 4OD1L 4ISVB 1A8JH 3SGKA 3K0WA 2BOCB 4EI5D 2IGFH 2X4TA 2QTEA 5E7FA 4HX1B 4LCCC 5FUOL 1RZFL 5EO0B 5AEAA 2COQA 2CRZA 1YEFH 1X5XA 1T80A 4PRHA 5DQ9B 1J8HA 4KROC 1X5GA 1G7IB 4MNGE 2MKWA 4XVTH 2A77H 2Z4QA 3C5SB 5DJ2B 4Z7WB 1FJ1B 1PY4A 5E8EB 4LOUC 4P5MA 4PJIF 4MJ5A 2W9EH 4N0CC 1IT9L 4LNRA 4WWKA 3BPCB 4W6WB 4FZ8H 5KS9A 4X6EA 4A6YL 3WFBH 3EFFA 5CD5C 4L8BB 3OXRB 3FT4A 1NGYB 1WLHA 2X4PB 5HI3D 2K1MA 3EYOA 2FZ3A 4FG6D 1HWHB 3LB6D 3KPOB 5FYLE 2D3VA 3CIQA 1QUNA 4HJ0D 3FCTB 1EDQA 2FX9L 1ZT4B 2B8OT 1YQVL 5F7UA 1BOYA 1P6AB 3UTZA 1KJ2B 3L3KA 3GSNH 3OV6A 1WGOA 3HLAB 1X6NA 2FEDD 4WW1A 1MAKA 1RJZA 2ZUYA 3ULUF 1DSFL 3I50H 4Y5XB 4ZNEE 3BO8B 3O9WD 2Z31D 4EOWL 4H20H 4QRQB 5HHNA 2ATPB 3H0TA 4LCIL 5L9DL 1QHPA 2D0GA 1I8LA 1K2DB 3AXLB 1X5KA 4CJ1A 1UENA 2IH1B 4N8VB 5AYUH 4F7EA 5IFAL 1MCLA 5FCUL 4R0LC 4G7YH 2NXYD 1F02I 1YMHA 3BDBA 2VZOA 1A3RL 2VXSH 1AP2B 1PKQA 2BY2A 5KOVC 2RCSH 3NIFE 3M17B 4AT6A 1A6UH 3IU3B 1BFVH 3A67H 1KJ2L 4W81A 4LEXL 4DKFH 2Q1EA 1MCOL 1TZHB 5D1QA 1TZGL 3OPZL 3TJEL 4U6HB 4EIGB 5HVHC 4M00A 4QHLA 4XI5C 5FO9A 3WO4C 1MAMH 5ETUB 1KGCD 4UQ2A 3HB3C 3BN9C 4FQ2L 2PYEE 3DSNA 5IFJB 5DR5H 5EOTB 1T7XA 1YECL 1YMMD 3BGFB 3ULUD 5E6ZA 1K4DA 1H0DA 1NFDB 4YJZL 2VXUH 3IDMB 2Z31B 2HLAA 3FO0L 1AGFB 1ETZB 3FO2B 2JK5A 4PJIB 2VZ1A 3QCVH 2XWJB 1W72A 5TDOA 2ORBL 3OKOA 1U8MB 3RU8H 5TJWK 3KPRD 3S37H 3BKMH 3V0WL 1XGUA 4RMWA 5HHME 1ZV5A 4BFGA 4MJ6A 3IAQA 2IAMA 1HWGB 1JP5A 1D5IL 1V3KA 2JTDA 2LQRA 4TUOB 5J89A 4HD9A 3D25A 3HKFA 1IFHL 4LHJB 4XXDA 5CIPH 3HPLB 4JPIB 2WBJD 2GIYA 5C7XH 4WUUA 5ESVB 2WWMC 4LP4A 4OM0L 4OZ4B 4GT7A 3K2MC 5C0FB 3TWCH 4O51A 1KEGH 2B39A 2CUHA 1KB5H 3BHBB 3AY4A 4YHNB 3MROA 1ZLWH 4XBPB 4F9LC 4OZIB 4IOFC 4O2EA 3D6GA 4OZGE 2FRGP 3G6JE 3JWOC 1N0LA 4KTEL 2DLFH 1T0NB 3MCLL 2FYYA 4HWBA 5DRNA 1A02N 3D39E 3U0PB 2P5ED 2UVFA 4FRWA 4OKVA 1K8IB 5GS2D 1MLBB 3IFOA 4V2BA 1YEKH 2MPAL 1KCRH 4G5ZH 1NGZA 2BVUA 4LSVL 5IW6B 4QLRA 1LD9A 2C3VA 4HS3A 4HKJB 4N8CH 1TPXC 3KPRB 4FQIH 4WVRA 1JZ6A 4HH9B 3LAFA 4U0RC 3FFCB 5DFTA 3OKDB 5C0RH 1MVUA 4NNXB 4GLRH 5EWIH 1T6VN 5J6HA 4ORGA 3K81A 4MZ2A 3V8CA 3FZUC 3MJ6A 4NRXA 4JAMA 4MMZC 2DKUA 1URLA 2VDPH 3ULUL 3UTPE 3MRFA 4PJDB 1KFAL 2GEEA 3RP1A 3CAFA 5C07A 2VXQH 4F8TA 1ORQA 2UWEF 4XPFL 4XX1G 2XZQL 2PO6C 4O58L 2AJSH 4U1GC 1S5IL 1UA6H 4PY7A 1I8KB 4C83B 4PJCA 3OSKA 2M1KA 1YUHA 5DD5L 2OQJB 5DJ0B 3ULVH 1JGLH 2H1PL 1ND0B 4PJXE 2Q7YB 4KMTH 1KN2L 1QRNE 3VCLA 3B5TA 3V6FB 1F4WL 4LVOB 3UEZA 4DQOL 1JZ4A 3PDOA 4PJEF 1TXKA 1H9VA 3MLYL 4OCSH 4XPAH 4N9GB 5HDBF 4JO2L 4NKDB 4UU9B 1LP9A 3IJSA 2VB5A 3TVMC 1VDGA 2NYYD 3CK0H 2JJWA 3MRMB 3TNNB 1PLGH 4UDUB 1MCPL 3THMH 1BFTA 2VE6B 3MLXL 1F5WA 1G7JB 2X89D 5INDA 4P3CL 5DHVH 4WI3A 1LMKA 4WHYG 3DI3B 5F3HB 3VFNA 4C4KO 4PJHF 4F9PA 5EOQH 3S3PA 2GFBA 4KJQD 2D7MA 5E1AB 2ZUTA 3MRHB 2WINA 3VDCA 3SQOH 2VAAA 2X4RA 2F54D 1EHXA 1QBBA 1FGNL 2KPNA 5A2JH 4KZDL 5I1AA 5FGSA 2DLTA 5L7XH 4JKKA 1YC8A 5FM5O 1R24A 2VDOL 1CFBA 1I85C 3N9GL 2QQLH 4KXZI 3FAXA 2X1QA 2W59A 2V7NA 1O7SA 3G04A 1RD6A 1YN7A 3VG0L 1DLFL 2OI9B 3PV6B 1RY7B 1LWRA 4V1DA 3ZLQC 4OD1H 3U48A 1LQSR 2EZ0D 3EFDL 1RULL 3HR6A 1E4XL 4NO3A 4G8IB 5FUOH 5L2JB 1RZFH 4I5BA 3DV4A 1RUKH 4XMKH 5HTSA 3RZCA 3DX9A 5D2LE 1K85A 2OXHA 2W0FA 5EA0L 5C0EA 2OTUA 3BP4B 3HAEH 4NPYA 2FB4H 3G6AA 5IHZB 4LPUA 2B0SH 3WN5B 1RHHA 4G8GE 4KVCL 1JMZA 4HUWB 2AXGB 4L4TA 5FDYA 3DUUA 3Q3GA 3H9SA 4HIIB 3G5ZB 2C5DC 3HR5B 1HXYA 3KJ4B 3EYVB 1WZKA 2HVJB 1U8KB 4S2SB 4PJEB 3RJDA 2YN5A 3QEHA 1A1OB 1GZPA 2W0LA 2JCCB 1I1YA 2Y36L 3F12B 3RVXC 1ADQL 4NKIL 5CCKL 2VAJA 1DDHB 5GRWA 1BZQK 5IOPB 4KKBC 4U31A 4K3EH 5ICXA 1Q0XH 1YEDA 2P24A 3HPJA 5L0QC 1PX4A 5F9OH 2R56H 2YS4A 4PJHB 2ZUUA 4GRWE 1U8JB 4PJFE 1YQVH 5L8LB 1NBQA 4JQXA 3BAEL 2M2DA 4POUB 5CBAA 1KIUA 1N0XH 4R4ND 3QDGE 1O7VA 5AUMB 1XH3A 2XA8L 3TN0C 2Y72A 4WV1C 2DQFB 4WWKB 4MS8C 3NIGE 4P99A 1BVKA 4UINH 1DQLL 2AKRB 2ILLA 3QCTH 4HK3J 4U3CA 5A2LH 2EDBA 2IMNA 5L9DH 3QUXD 1P9MA 4HIXL 4UTBL 1T5XB 4ELME 3HCVB 1W0WB 2VQUA 1A4KB 5ISZE 4P49A 5EC2A 4GUPA 1QP1A 2A83B 3G5YB 5IMMB 1MFBL 4UV4L 3SKOA 1MCWM 1SJEB 4XAWL 1X6LA 4O2FA 4AM0B 1GIGL 4DZ8A 4UIKL 2Z8WC 4XVSL 1I7UA 5DJAB 3VGFA 1A9EB 3VXUD 5JORB 3EGSB 1F90L 5J12C 1QKZL 1KT2B 3FTGB 4XWGH 3HC3L 2PXYB 3NPSC 1CFNB 5SWZD 4JCMA 3X17A 4GW1B 3SGJC 1YECH 2AJXH 1P7KB 1SHMA 5JHDA 4NCC1 4K7FA 3BPOC 3Q1SH 3QO1B 3RTQD 1VFBA 1I3VA 3LRHA 2Z8RA 1JTTA 5FIEA 1C1EL 3KGRA 2YBRA 3QUXB 3N50A 3VD5A 2YD2A 3PGDB 2ORBH 4OF6A 3E3QE 2FH8A 4BFEA 3BRFA 3W0WA 4M93B 4QF1B 1YN6B 2VC2L 3FQXB 5I0DA 3MBED 3T0EC 3C6LD 1TQCB 1EXUA 2XG5A 1T6WA 3NCYP 1CBVH 3CFJA 4NQDA 1D5IH 3O3EA 1P7QD 4I1NB 4FQXA 1MH5A 4B53A 4E42B 4Z7OE 3UMTA 1CDCA 5LCVL 2Y4SA 1R3LA 4X98A 3VWKD 2J5LB 1PD6A 3VXUB 3DXAE 3ZYOA 1GGCL 3IDIA 1K4DB 4YPGA 5DRWB 5SWZB 1YYMH 4XCEA 4OQ1A 3QUYD 3LV3B 2DJUA 1VESA 1CQKA 2GI7A 5ICZA 2YD7A 3CVHB 1RIUH 3I6GB 1SM3H 1RUQH 2DS4A 3BKCL 4J23A 3BX7C 1HSBA 3GSXB 3UBXG 2BSTA 3SDCA 4Y19E 1JI1A 3PJSB 1R3IL 3KPTA 5IEKA 1HCVA 1JWSA 4NQED 4GG6A 1NGQL 4Y16C 1Y6MR 4LSVH 2XY1A 1B88A 2ZJSL 3TA3C 3MLTB 4LDOB 4DEPB 3VRLF 5IV2A 5F97E 1GGIL 3MBEB 4HUXB 4OFYD 3F7QA 4C54A 1ZHKA 4MA3A 5MERA 5ABDE 1DUYA 1NH6A 2G2RA 1N26A 1P7QB 1O0VA 1QFUH 5C09B 4K7PL 2VZSA 4JO3L 2IQAB 2WBKA 3MROB 3CVHL 4JZOA 3WJJA 3KPQB 2W65A 3KR3L 4Y4FB 3RNKB 3VWKB 1WCBA 5EBLA 2HRLA 3BESR 5CSZA 1KFAH 4Y4HD 1AXTH 5HD8D 4FTVB 3AREA 1U3HA 5L8JB 4R4BB 1MRFH 4OUUA 4IRSD 2XZQH 1CR9L 1OQOA 4RAHA 5T3ZL 4O58H 5IBTL 1S5IH 4U1IA 4JFFA 2NY6C 4J3SA 3B3IA 3HUJE 3RGVC 2GJ6E 3MV7E 4DAGH 4NM8L 4RWHA 4Z76A 3OHXB 4NQEB 5DS8A 3FN0H 1U8QB 5DYOA 4JVWA 2DJ4A 3ARWA 4WWID 2HJLA 1HDMA 4DQOH 3I6KA 5GZOC 1G7HB 4F33B 1BIHA 1HHIA 4MCZA 3MUGB 1LO4L 3IDYB 1TETL 1HI6A 4JO2H 3MFFA 2GTZA 5DD3H 1BVZA 4OD3L 5JOPD 1H15A 5JA9A 5DMGC 1MCPH 2ZCKL 3MLXH 5DLMH 1GXEA 3VH8B 4P46D 3V0VA 5C8JB 4G8FA 4HPOH 5T3XE 1GVIA 4HKXA 4KRLB 1U0QA 4Y4HB 4PJCB 4J1UB 2NTFA 3OJMB 4I3RH 1VACB 4HV8A 3QUZA 4IRSB 3LKSB 5IM7B 5HDLA 1FG9C 2PTVA 5TDPB 1ZA3A 1KN4H 2ADGA 3TYGH 3LHPH 4OZHA 3KHQA 4YHPB 5MHSD 3U9UA 1FGNH 3WFEH 1S7VB 2EE3A 3GMOB 4HC1H 3MYJB 4LSQL 1C16B 4KZDH 2VXTH 4RFEB 4WFGD 5EH1A 3IJSB 2VDOH 2ZUXA 4ODTH 3N9GH 3KXFA 1AO7E 1Z3GL 1NGXB 3C5ZA 4BKLA 1LK2A 1S3KL 2YD9A 1OD9A 3TO2B 2BY1A 3HE6D 2DICA 5I1EL 1GGBH 2FATL 3ESUF 1XF2B 4HS6A 3V95A 2ADFH 4U6XA 3SJVA 1N2RB 4KGLA 3ZDZE 1E4XH 4ZSOB 4HK0B 5ERWA 4P46B 4MJIE 3ARGC 3GSOA 2JELL 1UB6A 1KPUB 1QO3B 25C8L 1B6DA 3LIZH 4X99A 2EYTB 3SKMB 1BM3L 5FOBA 1PG7W 4WJ5A 4JM2B 1OB1A 4NRYA 3RGHA 4ZAKD 3D3VA 5C0AD 1UWGL 2AEQL 1HXMB 3ARTA 5DSCB 2XI9A 4KVCH 4ODHL 5JA8B 2OM5A 3UTTD 4MA1B 3U2SA 2W38A 4GQPH 5F1SA 4JFPB 3WLBB 1GH7A 2WBWB 1FAKT 4MHHG 3BFOA 2FBOJ 3QAZC 1MIEL 2B5IC 4HAFA 3BYYA 1JPGB 4XXCA 2Y36H 4Z0BL 3DV4B 3VXSA 4I2XB 4XNUH 3AVEA 1IKNA 3L6FB 1DFBL 4NKIH 3VXTB 5CCKH 5HGBA 1Q94B 1T4KB 2W0FB 4NNYB 9CGTA 3O2VL 4AIXA 5E8PA 1OQXA 3DO3A 3UBXA 5DQJB 5JW4R 1ZLSL 1KB9J 4JRXA 4MD5B 3SGEH 2I25N 3MRCA 3BAEH 5GGRY 3QIUC 2O61A 1N6VA 2EDKA 2Z91B 1MY7A 3FQRB 2G9HA 4KTDH 3X11B 3WE6A 2ZUVA 5ADOL 3ARDC 4IOIA 4I18C 3P0YL 4NRZB 1CL7I 5H94B 4OBRA 3JUYA 1FCCA 4HIXH 2YPLD 3MLWL 4DOHB 5FGBA 2F53A 5DI8A 4W70A 2VXVL 5MP6L 3HMXA 5T5NG 2W92A 1EFXD 1MFBH 5BS0D 4UV4H 5F93C 3EYFA 3GKZA 3PL6A 3SDAA 4QWWC 4XAWH 4P23B 5JZ7D 1GIGH 4UIKH 4KC3B 3HZKB 4XVSH 4XNXH 2XNAB 2A9NL 3L5IA 1P69B 1IZKA 1F90H 2ED7A 2HFEB 2EDEA 4FZEH 3QP3A 3CUPB 3QWOA 4P57B 3QHZL 4D9LL 3E6FA 2Y6SD 5D9SB 4YHYB 3CGTA 3AMLA 1NBZA 4MNGA 3WUWG 5TFSH 2I5YL 1MWAB 3KPSD 4NDMB 4OLEA 2GSIA 2EKJA 5GRUH 1HH6A 1RVFL 1HIMH 4LLMB 5DT1L 4IIQB 3VFGL 4I3SH 1BFSA 2QQNH 3PGFL 5D7KD 4MCYB 3I6LE 3R0NA 5D5MB 4GBXC 4MWFB 4GQ9L 4JHZA 2VC2H 3DO7A 1CS6A 3ZDYF 3N1FC 1AKJD 1EFXB 5ALCH 2A6JA 1XIWB 3CX2A 1I1AB 3BXNA 3QI9D 5I1JH 3D0LA 3DVFA 1NDGB 1IBGH 4MAYC 5GRZA 5HVGB 5KVFL 5JMRA 2ARWA 5AZEL 1VGEL 5LCVH 4KFZC 4TPRL 5IW3A 3C2AL 3U7AA 4ZFGL 2UV3A 1GGCH 4OV5B 3ZKSD 4KK9C 1A7RL 4WFHD 1MWAL 4PRPD 3ZTJG 3BYTA 3LSOB 5GJTL 4G6FD 5HYJD 1DQQA 4YEEA 5JO5A 3QRGL 3VGGA 5C0DA 3BKCH 4TQEL 5TGBB 3QPQD 4EUPB 2XXCB 1JNJA 4JFQA 4G43B 1AHWA 3K2UL 4JZJC 1IZJA 3DX7B 4LBEB 4UBDC 3LQAH 3KPSB 1C5BL 3NZ8B 4JJ5A 1R3IH 1UVQB 4HWEL 3HC0B 3VRIA 4LMQI 2CKNA 2C9AA 3H9HA 1NSNH 5GGUA 3HZMA 4FQPA 3O11B 1AKJB 3L9RB 4HBCL 2P42B 1XFPA 3Q5OA 3VFSB 4XCEB 3RX5A 3KYKH 3GSRA 1DQDH 1W72H 2VZ3A 3QRFM 3CVHH 3JWDL 4YHOL 3LN5B 4Y5YB 1A9BB 5E6YA 2NY4B 3DVNB 5T1LB 5CKAA 2G60H 3RIAK 2XYCA 5T3ZH 5HYJB 3VGEA 2LU4A 4P2OD 5IBTH 2PYEA 1E27B 3WXWL 1I7TB 4I0PD 2A2QT 3KWWA 3KYOA 1KELH 3LS4H 3NN8B 5BV7B 2X4NA 5LVEA 5MERB 1H3PL 3MRGB 3H3BC 5DHYB 3LQZA 1FFNB 2ZG2A 4J3XA 3VJ6B 5F9JA 1EUTA 4I8DA 1INEL 5CSGA 1U91A 5E6IC 2L4OA 2CIKB 4ALAH 1JV5B 1WCBB 1TETH 4QNPE 5F7MC 4OD3H 4FNLL 2BNQE 5B8CC 4EI6B 1QBMH 1XCQB 1FL3A 4ZOAA 2C3XA 3OL2A 3ILQC 4I48A 2C4XA 4MMXC 1XF4A 3C60D 4APQA 3MX0A 5GSVA 5D96B 1UCBL 5BV7L 1MJUL 4JY5L 4YHML 1FE8L 3RY6A 3NZHL 4QRPE 1KJ3L 2BSSA 1WK0A 2APFA 5FHBH 4N0YH 1MI5E 3G6JA 3IDGB 1DBMH 3WS6C 4Z7VE 1AXIB 5EIVA 1L6XA 3D39A 3QFJE 4PD4J 4JPWL 4FN0A 4RMQA 5I17A 5D1XA 1G6RA 2R9HD 3Q6FA 4BK5A 3ULVC 1CGVA 1Z0MA 3BN3B 5DFWH 1CXKA 1K8DA 2UUDK 1TNNA 2BVPB 5E2VL 2P48B 4X6CF 4NO0D 1S3KH 1FG2B 1MQKL 1ZGLB 4G8FB 1LILA 4AEHH 2ICES 5I1EH 3S98A 4IRZH 5HJ3A 3BI9X 1DVFC 1OGAB 1U42A 2ESVD 3QDME 5CP7B 3X13A 4X4XA 3V5DB 4NQVA 3GJEB 2R0WL 3WUWA 1VADB 4JRYD 2XRAL 3C60B 4RA0C 25C8H 1JUFB 4E5XA 1BM3H 1ZWIA 1GZQB 2YKLH 2AXHA 5I2IA 4J3VA 2HT2C 1CFTA 2CR3A 3DI2B 1UWGH 3T2PA 4U1SB 2AEQH 4Z78A 4P2RB 4ODHH 1L7IL 1P4LB 4GKZA 4LU5H 4MYWB 3KXFB 5F1IA 4HBQA 1ZS8A 3UJIL 3IYLW 4XC1L 4PJXA 3T0EE 4WI8A 1QRNA 1VPOH 2X4QB 1KIPB 2CDEB 3ARVA 3OKLB 2XQYG 4K23H 1IILE 3WJLA 1DEEA 5HSFA 3QQ9D 4WW2F 3SJVB 1FH5L 3UDWC 4PJ8C 3L5JA 3QG7L 4NO0B 3GSOB 3RUGA 3L5XL 1HQRA 4U1HB 1OCWH 4XNZC 4K71C 1F4YH 2ESVB 3BOVA 4U6VL 2VNCA 4FFWC 4KMLB 5IMLB 4JRYB 4DVBA 1NBYA 3V4PL 3U9PH 4HEPG 4A2MA 3T1FB 3CDGB 4P2YA 4L9LC 2HJKA 5KAQF 1GHFH 4BQ6A 4YQXL 1VGKB 5DRZA 4LVEA 1GPOL 5IB3B 4YZFF 2PUQT 2WANA 2D4FA 4BJLA 3W39A 1FZKA 3A6BL 3DSFL 3LEVH 3VA6A 3IXAA 5ADOH 3MXVL 4ZXBC 2EO9A 1ZHLA 3QJFA 4P5TD 1D6VH 4I3GA 5EU6D 4WFED 2XTJE 3MLWH 3OBAA 2HJFA 1ACYL 4YBHA 1T1YB 2ZNXA 5LAXA 5MP6H 4YK4C 4YC2C 1MOEA 3ZKND 3MGTB 3CXHJ 1W8NA 2CGRH 1J9CT 5AAMA 5HHPA 3FHAA 1F00I 3TBYB 4XRCB 1LDPL 3BE1H 3MJ8A 4NZUL 1EFQA 3QT2A 1KSRA 4OCXL 5JR1L 5C0BA 3X3GL 2XN9D 4XHJC 1IC4L 4DGYL 1RZKL 1N3NB 4Z9KB 4M61B 1I7ZA 5B39B 1OGTA 3O3AB 4KV5E 2X09A 4LMQE 5DDHA 3D0VB 5D2LA 3HI6L 4KWUA 2YK1H 1EVUA 1RZ7H 3ZE0F 4HG4J 4WO4C 5E8NB 3O81A 2WMPA 1H3VA 3AUVA 5BZDA 4M7JL 1PEWA 2AJZA 4G8GA 4P5TB 2RJMA 4CW1B 3CX5J 5IHLB 3PHOB 1RVFH 4UT9L 5H8DA 4LSUL 3MODL 3VFGH 3GM8A 4PRNB 3S96A 3KPLA 1QPXA 4LASL 3EYFB 4JFED 4Y4KA 1KIQA 3SPVB 4Q9QL 4L3CA 2O93L 3GUTA 1PQZB 4LKCB 5H35A 5D6DC 5E24E 2ARJB 1GAFL 4LCYA 3U30B 1ONQB 4HXAL 5GIRB 3GSQB 2XN9B 1X7QB 5AZEH 3PWNA 3NMEA 4TPRH 2UYLB 1BBDL 1M7IA 3DMMC 4UQ3B 3P3YA 3L7EA 1MWAH 1L7TL 3UTSD 4PJFA 5GJTH 5KSVB 2VISB 4M1DL 3U4AA 1HH6B 1IGJA 1OWWA 3V9FA 3QDGA 5GS1B 4HFUH 4J6RL 4WEMB 4TQEH 5KVEL 1NC2B 3K2UH 1TQBB 4YDJA 4NCC2 1YEHL 4MXWL 5MEQA 3EUUA 1BMGA 4JFEB 3N1QC 4ENEC 1W0VA 1OSZB 1CDUA 3EDFA 3MZGB 3VFPB 1DANT 4NQCE 4PG9B 5ISZA 3ARFD 5JXEA 5JPMA 4KK8C 3LB6C 3SE3A 4HBCH 1A21A 5EOCL 2SEBB 4M7ZB 3ZDXE 4LVHB 4ZPVA 4Y5VB 2GSGB 4X8JA 1UXSA 3JWDH 3S88L 4HH8A 1A0QL 4IRJA 4EUPH 1NCAL 4ZFOB 4E41E 4LGSB 3MJGX 3U36A 3UTSB 4QRRD 1U95B 3PUCA 1LEGA 2VSCA 1IQDA 1KTKE 3WXWH 5CINH 3BIAX 3BH8A 4R7DA 4ZPTA 4CVZA 4R2GB 2I07B 3REVB 5BCAA 1U9KA 3QQ4A 4HS8L 5EB9A 4LLQB 3P0GB 1H3PH 5J13B 1PDKA 3TNMA 4YHZH 2JJVA 3C6SA 1B3JA 2HFGH 3SCMB 1INEH 3QFDB 3DGGB 4QOKE 4ZFOL 1EV2E 3NA4A 4CU7A 5GSRA 1I1FB 5INDB 5D7JA 5HPMA 4JY4B 4N90E 2ENSA 1H3TA 3SOBH 4JY6B 4HSQA 1QOKA 4TRPL 3DXAA 4LK4A 4QRRB 4UAOC 5JUEL 5BV7H 3MRRB 4H1LG 1FE8H 3V79C 4J4PD 5I1KL 4ZUSB 3NZHH 4O02L 2X4NB 3WFCH 1KJ3H 2DI9A 1PW3A 3MV9E 1KYOK 1C5CL 2ZOLA 3H7BA 4ZDHA 1QA9A 2X4UA 1FYTE 3MV8B 4Y19A 1G84A 4YXKL 3FRUB 3O45B 5HHMB 1BAFL 1XCTA 4OF3A 2X1PA 3AS1A 2EIDA 2A6IB 5LBSH 2HTKD 4WEUD 1I9EA 2GJZB 1M7DA 5CP3A 2YD4A 5A43C 3I02A 1BQLH 5IEHB 3E1F1 2G75B 1A14H 1L4IA 1VCAA 2NNAA 1MQKH 3FT2B 2HLFC 1WJ3A 1CFQB 4LRIC 1YNTA 4XPBL 3MA7B 2W9DH 4LCCA 2F19L 2EDLA 1P53A 3CU1A 2VWEC 2R0WH 2R0ZH 2FIRT 1WAAE 3BP6A 4OZGB 4ZFFA 2ADIB 3P77A 3NCJL 4J3UA 4F7MA 3BZDA 2XQYK 5CEYB 4PRAB 5CEZH 4FQHB 3KG5A 3NFSL 5HDOA 4HLZG 1IL1B 3DV6B 4OM1H 3GB7A 4EKXA 4K3JL 3SDXB 3T3PE 3QDJE 2VDMH 2D03L 1L7IH 2Q3ZA 2YSSB 5KSBE 5FCSH 1FV1A 4YBQD 3HUJA 4LVOC 5CGTA 2GJ6A 3MV7A 4XP9L 1JPTH 2BC4A 5FUCE 2EXYD 3UJIH 1J05A 4WRLA 3OJ2C 2EH7L 5SWQB 3MLPA 1RUAH 3QEGL 4XNMA 4MQ7B 4ODWA 4NN5B 1RIHH 1YYLH 1CDIA 1N4XL 3QG7H 2IC2A 4KKAC 4RRPG 3LPGA 1NUFA 2ZKHH 5LGJA 1XF5B 5GZND 4D0BA 4RDQF 3OKMB 4PB0L 3BWAB 4RGOL 1PX3A 1YEGH 1DP0A 1J8KA 4LIQL 1AD0B 2WK2A 5I1LB 3REWA 1T1WA 3MLVL 4NN7B 2F8VA 1NUNB 4GKZB 4LSSL 5GGVL 1DN0A 1R5IA 2ZOKB 4POZC 1NFKA 2BSRA 4OLVL 4PJXB 2NY5L 3C5JB 3MRPA 4M1CC 4HWZA 2A6DB 5AAWA 1CFSA 43CAB 5ICYB 1CD9B 1V3MA 4X9HA 4M6MH 1R5VA 3TJHD 1TTUA 1F2QA 5D71H 3VWJA 4X5XB 3QXAB 1VA9A 1JYNA 3CH1A 1MPAL 2B4CL 2EIEA 5TQ0H 2IPKB 5DA0B 3O2DL 4MDIB 2E3VA 1RHFA 5IKCA 1AO7A 2VR5A 1BVLB 4Z8FL 3ZE1E 1EAJA 1JGUL 1J8HD 3MV01 5EULV 3VFMB 4NZUH 1DBKH 4GKNB 1NFIB 2X70A 2WP3T 1EEYA 1TZIA 1KBGL 5B3JE 1AQDB 1OTUD 3ARXA 2LAAA 3TIEA 3LN4B 4HMCA 4DGYH 1MCNA 4MJIA 1FP5A 3B9KD 5EBMA 2OYPA 2ZSWB 1G9MH 2ZCLH 3QXDB 2P5WA 1IM9A 2Y7QA 5E4EB 3W11C 1PG7L 5DZLA 2R4RH 3RA7L 4ZFZA 2EYSB 3OR6A 3ARYA 2LVCA 5IQ9A 4QT5B 4BH8A 5E95B 1SMAA 3NH7L 3QUKA 1LEIA 2R69L 3JV4B 5FGCB 3RBGA 3FL7A 5BVJB 4YDIL 2HYMA 3BZFB 3KJ4C 2YWYA 5CWSA 1NLDL 1MHEB 3BZ4A 3SGKC 1T04B 1DL7H 2E7BA 1V3LA 3IS1X 2PETA 4JPKL 2PTUA 3FB5A 3QIBD 3LRSA 1XEDA 5T33L 2NY0D 2ZPKL 5TE6H 2R15A 3QEQE 5T1DL 3V5KA 4I0CC 4OAWB 4GAJL 4U05A 4H1LA 1GAFH 4AMKL 4GAYB 2YZ8A 4MXQD 4OJFL 2FR4A 4HXAH 5DRXB 2OR9L 4KK5C 1QG3A 2J88L 2D31A 3B9KB 3HMXH 4F9LA 2IQ9L 5F7EL 1DBAL 3C08L 1YPZE 4WWKC 5IWLA 1ZT1A 3EO0B 3ZKMC 5ESQA 4OFPA 5I8EA 4J6RH 3GFUA 4PUBL 3JV6A 2DWDB 1EIBA 4HPYH 4RA3A 5HYSA 5KVEH 1HSAB 5J6GA 2GK0A 3GSUA 2XFXB 2O5XH 5HHXL 4MXWH 5DUML 3GIVB 5IMKA 2K7QA 2MHAB 4GXVL 3BIKA 3CFKA 5I1GL 5IP4A 3AU1B 3KDMA 4AY0A 4P2QE 2NY0B 1A7NL 5K93A 5BOZG 1PGRB 5CEXA 4JFDD 4HHAB 5EOCH 3FQTA 4GW4A 3CNKA 2Q6WA 4RMRA 3QYCA 5LWYH 3NVQA 2X40A 1T0MB 2GTWB 4K94L 1KC5L 2RB8A 4MZ3A 2PXYC 3M8OL 1A0QH 1CD0A 3LKQB 1IKFL 1WEJL 1FLTX 1N6QH 4QRUB 5C0CE 4XNYL 4LLUA 3CMOL 4D8PB 2NX5E 2VLKE 4HW6A 3WFHB 2H32B 1G0DA 4ELMB 2X7LB 2AXFA 4RRPA 5FYLH 1JK8A 2IAMD 2R8SL 3EJZC 1Q9OB 4JDTL 1RMFH 4YDVB 4HIEA 3GRWA 4YGAB 1CQYA 4XH2A 5D1QC 4AIZA 2MSPA 1JFQH 1BWMA 5CGMA 1TQCC 3LQAC 3BT2L 5ID1B 3NFNB 4MAUL 2NY1B 3T0BA 1EMTL 1MFAL 4I13B 5JIKA 4L3ED 4X4YB 4QRSB 3X14A 4BUHA 1SYVA 2C4FT 1GOFA 1S78C 1DBBL 4LCUB 1S5HB 2EKSB 3R06B 1EEZA 2GQHA 4TULL 1K4CB 3BPNB 2PCPB 3O8XA 4O5LH 3S35H 1LEKB 1DR9A 5EFIA 3WIHL 4TRPH 3GBML 5JUEH 4KHXL 4M7LL 2RR3A 2A9ML 4CVZB 2NLJB 2UUDH 4R90L 2YUWA 4XBEL 1P84J 3F7PC 5AZ2L 1JHTB 2BHZA 2NQCA 1HQ4B 1A47A 5KSAA 5FECB 2UZIL 4ZD3L 4Z5RA 2Q7NA 3O3DA 5D7IF 4HCRA 3F6IA 3QA3B 3IS0X 4NWUH 4RAUA 1S9WA 5HHOE 1BAFH 1I85A 3F62A 5IB5A 4DEPC 1XGPB 3O3BA 1HH9B 1NCUA 2GT9B 4WTZG 3P9MA 3ALWA 5A3ID 5DUBA 3S35X 2VLLA 3DHMA 2BVYA 2PW2B 5J1AA 5DMKB 1U8OA 2GK2A 4XPBH 4Y4FC 1IGIL 3LQMA 3VI3F 1QEWA 5FDWB 5EU5A 1SY6L 1QA9B 1NC4D 1U8PB 3EOBA 2ICCA 3NCJH 4Z7WE 1RZGB 2YRZA 3CFIC 1QFWM 1V7MH 2FL5A 4IJ3B 3RDTB 2OP4H 1K5NA 1WZ1L 1INDL 1CI5A 4ZUTA 4K07A 4XP9H 2NNAB 1AR1D 2QADD 4OCRL 1T1ZA 1SBSH 5BQ7B 3KNBA 1UM4L 5EU4A 2UY6A 1FBIH 2NW2A 5FF6B 2BERA 3R8BB 5C6TH 4E9LA 2Z0BA 1CTOA 5IVZA 1A2YA 2LTQC 3V0AC 2X4OB 4OFKA 3A0OA 5DJ8B 1IC7H 1WBYB 3F65A 3P11L 4XAKD 2BNQA 4PB0H 2AV1B 1G6RH 2R2BA 4PJ9B 4RGOH 3ROLB 4LHQB 1CGSL 3G5XB 2VQ1A 4JQIL 2BXZA 4CKVX 3V5HA 3ETBF 5BXFB 5ENWA 2RAMA 1NC4B 2FSEB 2XKNB 3TN0A 4WV1A 3TIDA 2XWTB 3VXPB 3BVNB 4IMKC 1EUUA 3KLDA 2FIKB 4JDVB 4QRPA 1CDBA 2PW1A 4Y7MA 3NABL 5D7IB 1MI5A 4EBQL 1HHGB 2ADJA 4V1DD 4Z7VA 5EZIH 4QHNA 3QFJA 3QNYA 1DZBA 4G9DA 5B38B 5E70A 5F6IB 5D1ZB 5FYKU 1HKFA 3OG4B 4GRLB 5IG7B 4O9HL 2J8HA 2CKBA 2DQCL 5C0GB 1GRWA 3O2DH 1IGFL 2UZYB 5MENB 1GYAA 1IQWL 4FQJL 1UH3A 4F9PC 4AK1A 3DURA 4XMLL 3RZCD 1M4KA 1EK3A 3EYUL 4Z8FH 3DYMA 4PTUA 1OAQL 2EYRB 2FJGB 2YMXL 3QHTC 3QDAA 1R5IB 4XVUC 4YGVB 4BZ1H 3QDMA 2BSRB 3M1BA 2N7BA 3WFZA 4JM2C 4HWZB 5IK3A 3H9SD 3U0TA 2WUCL 4BH7B 4PJIE 4WNQB 5FYKL 1LO5B 4GS7C 4XHQA 2ITCB 1ZVHA 3ZTJH 3BQUB 3RVUC 4M6OL 4H25B 5I8OH 1ZGLP 4FOMA 4LF3A 2DJSA 4BFBD 3NH7H 5CHNB 5I75C 2IJ0C 5F1NB 3RVVD 4MA1C 3L5WA 3VE0B 1FNSL 1KTLB 2ZUWA 3CFBA 4YDIH 2VR4A 4YX2H 5IKCB 4GSDH 1VKXA 2EDFA 1NLDH 2FX8H 4XCCL 1T03H 4DGIL 4F57L 4YHLL 5EUKA 1B4JL 4LLDB 3T0EA 3GI9L 2N4IA 4AEEA 4WU7A 5I8KH 2ZPKH 4KKCD 4GW5B 2OJEB 1CU4H 1SQ2N 1U93A 3LKRA 5FO8B 3K4ZA 5ITBL 4O2CB 3EOYG 3INUL 2BVQA 5IGXL 4JLRB 5GGSA 1KGCE 2HFFA 4Y2DA 4RMSA 3QCUL 4AMKH 1UQSB 4OJFH 2BVOB 3AFLA 4RGNB 4UOW1 4X6DF 4OZIE 1FNHA 3ULUE 4ZFZB 3TBVB 4M48H 2OR9H 3DPBA 2FHCA 3FOLB 2J88H 4CNIA 5JW5A 2H45A 2IQ9H 5F7EH 2DTSA 4KH2A 1NKOA 4PLKD 2NZ9C 3RWJA 4WTZA 5TE7L 1FZMA 4HF5H 2DDQL 1IEHA 4PUBH 1F3RB 5T5FH 4FXGA 1D5MA 3KPRE 3S97C 5GS0H 1NQBA 3TCLB 5E7BA 3EDDA 1FRGL 4ODBD 4G42B 5HHXH 4XGZA 3PWLB 4RIRB 4GXVH 3BW9B 1Y6NR 4M5YL 1FORH 1M05B 5FM8A 1D9KD 3JSSA 1XGQA 3MNZA 1A7NH 2OTWB 3ZYJA 5C2UB 4LPYA 2FWOA 4P23C 3I9GL 3ELAT 4TNVK 3KLHC 5EZLA 3DNKA 5JHDD 4GMTL 4K94H 4NBXB 1KC5H 3WHXB 1RK1A 1MEXL 3M8OH 5CZVL 5I8EB 2HWZL 1WEJH 3OXSB 1CICD 3RKDC 1LO3L 1NGWA 5HYSB 2CUIA 2BMKA 1P9MC 4YHYC 3LKOA 1HHHA 4MNQD 1LE5B 2KBGA 3IKKA 1X5FA 4MD4A 5CFHA 3W0WD 5D8JH 4LHUD 4X0KB 5F89B 1A6WL 3BIKB 1D5ZA 3HI1B 1JPSL 4OLZL 2O5YL 3VFRB 2R8SH 3UYPA 5JDSB 4NQDD 2VDKL 1RZ8B 1CIDA 5E00B 2Y07L 3VDAA 5CEXB 1DE4A 4FQXD 1ULVA 3BWUC 4GRWH 3SBWC 3FQNA 1H8NA 1D9KB 2YR3A 3CSYA 5JMOC 2YUZA 5ACZB 4MAUH 4XPTL 1XIWC 1EMTH 1I1AC 2GUOA 3EDKA 4LARL 3AB0B 1S9YA 1FHGA 4MNHB 1DBBH 4QGYA 4PRDB 1R3JA 4X6DB 2XPGA 2CJUL 3CDCA 1RJLB 3R1GL 3WXVH 4TULH 4LEOA 4NKOA 4Z7UA 1JHKH 4M7LT 5EZOL 3SDCD 2BJML 3WIHH 4UB0L 1E6OH 1QSEA 3BEWA 3GBMH 4KHXH 1AXSA 4M7LH 4AEIL 3JWDC 4MNQB 2X9WA 1TVHA 1QFWI 1PY9A 5AZ2H 4OLUH 4U1JA 1H5BB 3HZVA 4LHUB 5DMJB 2NXZB 3QO0B 4CN6A 3LMJH 5BVPL 2VL4A 3S5LG 4ZD3H 3O2WH 3QR2A 3UROR 4PRID 4HDIA 4F3FB 2ITDA 4KK6C 2E6QA 4OIBA 4ERSL 1S9KC 3DWTA 1T5WA 4OLXL 2B1AH 4HZLB 4PGEB 2QL1A 4NQCA 2UWEE 5IBLD 1I3RA 5KG9A 5K9OA 4D94A 3C8KA 1BOGB 4JFHD 1YNKL 3Q6GH 1EPFA 2VABB 4CADB 5I0ZA 1IGIH 2F5AL 3ARGA 1EAPA 2NY4C 3GEWB 4OZHF 3MJ7A 1KLUA 3DUSB 2BY0A 5JDJA 4JFZL 5CGYC 1T3FB 1SY6H 3VU2A 4E41A 1OHQA 1OP9A 4X7SH 3GI8L 3QG6A 2R23A 1WZ1H 3QISA 3VXRB 4PG2A 2E7HA 5BV7C 1BQUA 4PJEE 1BP3B 3WO3B 1FNEA 1P5UA 3O41A 4PRIB 5HDBE 4YXLH 1JTPA 4BSWB 3L3GA 4OCRH 3VI4F 3WJJC 2VKXA 5D6CA 4JANB 1FZJB 1UM4H 2DWEA 2R1WA 3VFVB 3P30H 3OKNB 2YA2A 1U3HC 2AI0L 3AREC 5ESAA 4PJHE 5J06A 4F7CB 4QOKA 4N8PA 3QUZD 4NUJB 5DZOA 3UC0L 3WBDA 3QNZB 3P11H 4X7TB 1RU9L 4JEGB 1CGSH 3QIUA 3RPIA 4Q9RL 4JQIH 1BBJB 5E1HB 4Q6IA 5CUSH 3PWUA 1IAOB 1E4WL 5DC4B 1M6OB 2XV6B 3T4AA 3RVTC 1SBBA 2V2WB 4NSKA 1MFNA 1YNLH 5TQ2L 2RIKA 5DFVC 3ARDA 1J86A 3D69A 4DK6A 5AD0B 1T89A 3MV9A 2EDNA 4F80A 3TFKC 4W4OC 3NABH 5BZWB 3WL9A 4NQTA 5GGQL 1FYTA 1JNNL 1ZLVK 2OZ4A 3T0VA 4ZS6C 2BX5A 5IVZB 4AL8L 2Q76B 3DRQB 1XGYH 3BH9A 5DTFB 5C08D 2BHYA 1F6AB 2D7TL 2DQCH 2WV3A 1CT8A 1KJMA 1IGFH 4FQQA 4ZUUA 2GITA 4FQJH 4KDVA 3LZFH 2HG5B 2CRMA 3AM8A 4KXZH 3EYUH 3NACH 2WSKA 2J4WL 3V5HB 3CVIL 1UGNA 2R1XA 5ENWB 3STLA 1ZGLM 3HG1B 3JTTB 5ANMB 4TUKL 3D2UB 5BW7A 3UXFA 4MVBD 1BZ9A 3ZE2F 1GOHA 3MGOA 1DQMH 1WAAA 1HEZB 2W07A 2GCYB 2WUCH 2BP3A 5FYKH 1AGBA 3MMEA 4QHUA 4FXKB 3C87A 4JHWL 5GGTL 3DVIA 1OAZL 3GSNA 4N5ED 3OG6B 5IVXB 1NPUA 3OJVC 3C5ZC 1DUZA 4PLNC 5KANG 4XP4L 3QDJA 2APBA 2V2XA 4NQXB 5KSBA 4NN6C 3VXSD 5I74C 3ZSTA 4DFIA 1MELA 3T3MF 4MX7A 2XOTA 3ZKXB 4GBXA 4XCCH 1QLRB 4YHLH 4R9HA 5CILL 3D85D 5C08B 1VFAB 3C8HA 4Z77A 3GI9H 1XGTA 1RIVH 5L6YL 1CVRA 3PWPA 4GRMB 4JRXD 3VXUE 8FABB 4UUJB 4BQBA 5B21A 3INUH 5SWZE 3U0TB 4EDWL 4OCWH 3IFPA 4LP5A 3RIAF 4HT1L 1VFUA 3OAUH 5HYQA 1HKLL 3S5LA 1XR9B 5I6XB 3ZT5A 2VL5A 3VGHA 4DW2L 2DQIL 3S4SG 1WBXA 1MRDH 2IALA 3VGAB 4OD2B 1SYSB 1WQVT 2XQBL 3GBLA 3BISA 5CBEA 3SE8L 4JJHA 2P4AB 1P6FA 3CFEA 4LLYB 4RZCA 1G9MC 3A6CH 1ES0B 3L95B 2F15A 3IRZA 4WU7B 2R0KH 4XXCC 2HKHL 3OF6A 3BKYH 4UT6H 3U46B 3FJTA 1FRGH 1HILA 1IKNC 2QR0A 2IF7A 3SDAD 1CL7L 5C09E 3D85B 1SJXA 4L29B 4FP8L 4O4YL 1JNHB 4KPHL 4M5YH 4PYGA 1QACA 4QY8B 4U6YA 1FZOB 3CDFA 3HAEG 1EHLL 2K7PA 3IKCA 4FFZL 3CSGA 1C12A 5FYJD 1ZAGA 2LAGB 3PWVA 5I1DB 1C08B 1MHCB 1I8MB 4HUVB 4FTVE 4WGVB 1IVLA 4P4KB 3FFDA 1J87A 2CK2A 4DCQA 2OMNA 4PLJC 2CIIB 4MSWB 4F7PB 3P40A 1F3DH 5KVDH 3ARBD 3NCEB 3DVGB 3IDUA 4GKSB 2CLZA 2R2EB 4Z95L 4U7SA 4NQEE 1KB5A 5F72S 1E4KA 4H1LH 4F7TA 1QBLL 1ITBB 1A6WH 5DVNA 2O5YH 2XTJB 2FX7H 3KLAA 4JHBA 4HK3N 2AJ3A 3RI5K 2QQKH 3WSQL 1LO0H 3RY5A 1TCRA 3NFPA 3PL6C 1UXWB 5J56B 4JO1L 5E6IA 4MA8L 1TVBA 3LEYL 3FOMA 5SX5K 4UIMB 5EZJA 3QIWB 4HUUB 4LARH 2H9GB 1UJTA 2Q8BH 2AXJA 2WP3O 5B8CA 2GAZB 5FYJU 3BDXA 3PABA 5FB8A 5CJOL 5DGQA 3QBTB 4LPTA 2CJUH 4PGBA 1QVOB 5MI0B 4JB9L 2NY7H 3QUMA 4RWYH 4YBLB 2X1XR 4LCWD 2DQHH 4KY1H 5T1KA 3B2UD 2VN7A 4UB0H 4W6YB 4S1SL 4OI9A 1CLOL 1PJ9A 5FK9B 2XA3A 4AEIH 3ZTNH 1WUNT 1MUJB 1ORSA 1YPZA 3QEUA 3WS6A 1CZ8L 1TQBC 3I2CL 3RHWK 3VRLE 1JF1B 4M3KB 2DN7A 5BVPH 4YIQA 2DYPB 7FABL 3E8UL 3CZFB 5FYJL 2VZUA 3WD5H 4XNQB 3O6FA 3H3PL 1A7QL 4WGWB 4F15B 2OMBA 3OZ9L 4ERSH 4LGPB 3QWRA 4QRTB 4ZSOE 4N8VG 3P4NA 2HTLC 2VIRB 5HI5C 4P2QA 1KCKA 4YLQT 3O4LB 4Y5VC 3B9DA 1N64L 1YNKH 3G9AB 3LH2L 2C1PB 2BNRB 3VRJB 2PYED 2HVKB 5CZXC 2CDGB 3HC4H 4LCWB 3IDNA 4WTWA 4HIJA 4YNYA 1A1NA 1Y0LA 5T5NF 4CMHB 5FAAA 4FABL 3G6JF 5ID0A 1AFVL 4JFZH 4YHKL 5DHVA 5DMIH 4ELKB 1YY8A 1F4HA 5CS7A 3GIZL 1XGRB 3S34L 3GI8H 5IIEA 3I3BA 5C0CA 1MHHA 1KXQE 3V6ZB 1ZTXL 1JYXA 4H5SB 1BLNA 4G3YH 4R2GC 5E0QA 2NX5A 2VLKA 3VFOB 1IGCL 2FNBA 2OTPA 1I9RL 3K46A 2QEJA 4HGWA 2H2SD 5HBBA 3DGCR 4QGTA 3GSWA 1I3RB 5DQDL 3RNQA 4DKDC 5IJVA 3H2WA 4P9HH 3SCMC 1JTOA 3UDWA 5F6HI 4LLVA 4PJ8A 1WVZA 5EPMA 5TDNA 2LFGA 4PY8J 4APQD 2WWKT 4JFYB 1QR1A 2YWZA 3S4SA 3HE7B 1PYWB 5DK0A 3U1SH 2DLHA 4ONGL 2D7NA 4HCRH 3OAYK 4OB5L 4OCMC 1S7RA 3WFDL 3E6HB 2CDFB 4AH2A 1KJVA 5FGRA 4HQQL 1JE6A 2FGWL 3PQYB 3D39D 4YAQA 5EN2A 5FKPB 1E4WH 1FVCB 5D1XD 2XACC 3MRIB 2X41A 1JHLH 4U2ZA 3TBSB 4BZ2L 3IFLL 4DOHE 2EDQA 3HAEA 4NHUB 3W9DB 4ZXBA 3L3DA 2ZSVA 2EEDA 2ICWA 3EJYC 4JR9L 3RUGF 4AL8H 4QOKB 1NCNA 1T2QL 2ATKA 5HHOA 3H7LA 2D7TH 5DO2D 2DMBA 4ISVA 3QHFL 3IU4L 4YDKH 2BOCA 1J1XL 4HX1A 4HGMA 5EO0A 1F42A 2J4WH 5C9KA 4Q6IB 4Q58C 5DQ9A 2AJUL 4OTXL 2NR6D 4NSKB 4D9RD 4FQCL 1G7IA 2E27L 3MOBL 2XT1B 3T77B 3DBXB 4RISL 1BEYL 3MLZH 1ZMYA 3IFNL 5HI4C 4TTGA 4K3HA 4XZUB 3C5SA 5DJ2A 4Z7WA 1FJ1A 4H8WH 2YPLE 5E8EA 5JQHC 5DUPH 4JPVL 5B4MC 1JNLL 3BPCA 5BRZD 4Y1AD 5F9WC 3KPNB 1B2WL 3TO4D 1SJHB 2AW2A 1I1RA 4L8BA 3RWHB 3OXRA 5BOPA 4L4VD 4OF0A 3F7YB 1T66C 3SDDD 2X4PA 2R1XB 2IAND 2ARJQ 4PP2B 2FEEI 2DLGA 3BD4A 4OGYL 3KPOA 5C6PB 5D6DA 3MCKB 3FCTA 1R3KB 5C92A 1X5YA 3GSVB 1UJ3B 5FO7B 1ZT4A 4FFVC 2NW3B 3QH3B 5D2LF 2YXFA 3W5MA 3QJHA 1X5AA 4MA7L 4HT1H 5DD6B 2MJWA 1KJ2A 2Z8VC 3MRNB 3M07A 2HT4C 4NN7C 2AJYL 3HLAA 1FN4B 1HKLH 3VXOB 2VDNH 3PXHA 5F1OB 4DW2H 1O5DT 1D5XB 4PPTA</