4I0XA

Crystal structure of the mycobacterum abscessus esxef (mab_3112-mab_3113) complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
75
structure length
75
Chain Sequence
b'DEVGALSKFAASLADQMRAGSNSLDRDVQSLFGVWKGSAADAYRSGWDEMQDGATKVWNALTDIASTLGSNAAAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESAT-6-like protein MAB_3112
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Structural genomics, unknown function
total genus 30
structure length 75
sequence length 75
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2012-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4i0xA00
2DE0X 4LWSB 3GWKC 2KG7A 3FAVA 2AZ2A 2VS0A 3O9OA 4LWSA 1WA8B 3GVMA 3ZBHA 3TXQA 4GZRB 3Q4HB 2B9ZA 3TXSA 3OGIB 4I0XB 3G80A 1WA8A 2VRZA 3Q4HA 2AZ0A 3FD9A 2KG7B 3HR0A 3FAVB 4I0XA 4ABMA
chains in the Genus database with same CATH superfamily
3RYHB 1ZUQA 3FFQA 4GKKB 1OJHA 3ABUA 4U7OA 1BT8A 3RYHA 1S5JA 1QVGU 5BR8O 1P49A 2CDYA 4QPKA 3UO3A 2UXBO 1XBLA 4BIUA 3ZHRA 2XHBA 2HVKC 2DYRB 4UCRA 2OTJV 2HVJC 4TUYB 1FXKB 4HNAB 1CXZB 4UVBA 1URFA 4OX9B 3L9DA 4UUJC 3WB1A 3JCUZ 4TUYA 1FXKA 1L8DA 2FB5A 1DTOA 4HNAA 3BRCA 3JYCA 1V54C 2CTRA 4Z1VA 4AQYO 3MHHC 4B3SB 2P5OA 1ZSPA 2W0XA 5HFMA 1K8AW 5GONB 1H8HG 2JEUA 2F95B 5GONA 2CH7B 1AVMA 2GV9A 4X64B 2EILB 1XL6A 4GCZA 2ZT9B 2CH7A 4MT8A 4P9OA 3RT3C 2EJ7A 3QG5A 3AG2C 2UXDB 2RDCA 1YJWV 4LFCO 1JMKC 2X6CA 4NYKA 5J2TB 3ZRVA 4P30A 4JI5B 1IVSA 4FK5C 2ETNA 2QJ1A 4B3TB 5J2TA 1GMGA 4X1YB 4DR1O 2WPDG 5IYZB 1MG1A 5KLVH 4RO2A 3ABMC 1P84F 3E83A 4X1YA 2A7WA 3IFXA 5IYZA 4JI8O 1DGSA 2F93B 1BSMA 2ZIMA 4DUZB 5IDJA 1MSWD 2RMKB 2QKAA 4B3RO 4QE7A 5D5PA 4DR5O 4JI2B 5DN6G 4R7CA 5B66Z 3CWBH 3H01A 1Q43A 4BW5A 3K0GA 3ZBHA 1RM1B 2IU3A 1ZX3A 2EIMC 1EN6A 3JATB 1RFYA 2YIDA 2ARHA 2QWPB 3THOA 1QCEA 3JATA 5LL6Y 3AG3C 1AROP 3H1JH 4JI7B 4DR7B 1L0LH 3DC6A 4UB8Z 3K9SA 2BE3A 3ZHQA 3G71V 1KMIZ 3GVMA 1OCOC 3BFRA 4JI1O 2Q68A 2DQ0A 1YF2A 1N0NA 2XOKG 3VQYA 2N04A 4R50A 1D5NA 4HZ3A 3CRMA 3VQXA 1J5EB 2OTLV 4OGQB 4MTOA 4JAAA 2N74A 2QDOA 4QNHB 1VQ7V 1YI2V 4MVMA 1XHXA 5EBLC 4P2ZA 2WLHA 3PJSK 1W0JG 1GM9A 3G67A 4IIJB 4GX2A 3K5OA 4YXWG 5B1OA 4U3JB 1THZA 4IIJA 1IBKB 3LDCA 1V54B 1NTKH 1MABG 4U3JA 1QR9A 1W2BU 4WBNB 1FS0G 3Q4HB 1YTFB 2ATKC 2EIJC 3JAKB 1IBMB 4WBNA 3JARB 5D5QA 3Q4HA 2WLLB 3JAKA 1JJ2U 1G8MA 2CGNA 4J9YB 4PJ0Z 2CTQA 3JARA 1XMQB 2QM4A 3P30A 1PP9H 2WLLA 4DK1A 4G2KA 3K9AA 3RN4A 4LNUB 1N33B 2UXCO 4JAUA 4IYIA 2BSKB 2LQTA 3AEIA 5KAIZ 2IH1C 2UXXA 2YSUB 2JGDB 4LNUA 2YIBD 3BY6A 5IYBO 3G80A 5BY1A 2ZNJA 2BSKA 1COWG 1SERA 4JYCA 3VOUA 4YHHO 3P3NA 1QU7A 2JGDA 1Y6XA 4NTWA 2E3CA 1M56C 4FZ1A 1FJGO 4WF9V 3OE7G 3ABMB 1VF7A 2K1EA 1GN6A 4JI4O 1I0HA 5JH7B 4LC1A 5IYDO 1XMOB 3TJTA 5KHJA 2EBOA 4RQFA 1MNGA 1AR1B 5JH7A 1ORQC 2HLDG 3JD3A 5FPOA 2EIMB 5IY5C 1KECA 2QKSA 4F6EA 3OMIB 1N4CA 2Y69C 5GTIZ 2P6JA 2IM9A 3BVOA 4FLWA 2YDEA 5H5NA 3AG3B 3K5MA 1QLEC 3RVZA 3APQA 4PV1B 2IH3C 2ZE7A 1YJNV 3FAVB 1VQNV 1ZL8B 4PI2A 3BEHA 1OCOB 2IU0A 4JI3B 4JASA 5LMNO 3FAVA 3X2QB 1HDJA 1JX9A 3C90A 1ZL8A 1QVFU 5A9GA 1T5EA 4AI8A 1HNWO 1WNSA 1BHAA 4J41A 2MK3A 1P7GA 3G4SV 3CMEV 4U3FH 1F51A 4FZ0A 5EC1C 1SQGA 1QLNA 4I5SA 5FNVB 1NH2B 4B3MB 5JQGB 1KQSU 3U0ZA 2UUBO 3MDSA 3K06A 1K4CC 5FNVA 2QTSA 1LNQA 4X88A 5JQGA 3CMAV 3JD2A 1XHZA 4TSFG 2GBOA 4DV5O 1W59A 3FB5C 4ASUG 2W0FC 4DV7B 4FLXA 1XNRB 3FD9A 4W4KA 2DW4A 1JOYA 1NVPD 2HG5C 3N27A 3LNMB 3ETGA 2Z3YA 1K9MW 4LFAO 3KCYA 4FVMA 5CBFA 1NR1A 5KHKA 4GX1A 3CCSV 3TCUA 2E74B 3B09A 4GUNA 4YJ2B 4J11A 1GO3F 4YJ2A 2DN9A 4AILC 3BCCH 2R70A 1XNQO 2EZPA 1HP8A 2Q0AA 1R3JC 4DR6B 3ZN1A 3K3WA 1YDXA 3JALB 1VF6C 3TXSA 4J7ZA 1M56B 1S3JA 4LF8O 1VQ6V 3OUSA 1JVMA 4J9ZB 5FLXN 3JALA 3IC7A 2JJ2G 2NLJC 3T1HB 2HHHO 3QNEA 1G1XB 4GT1A 1ZWIC 1UPGA 1UFIA 3QVNA 3SJAC 1R73A 3SDLA 2W6IG 3L71H 2JS5A 3OTFA 5IT9N 2WLKA 1N32B 3RBZA 3SYCA 2JVDA 1HR0B 1SQPH 5BZBA 3SPGA 1OCZC 2F66C 3E8BA 2GTSA 1LR1A 4I4TB 4IGGA 2Y69B 3OUFA 1WAZA 1RPOA 2P4KA 3D3IA 4I4TA 1QLEB 3CRRA 2PI5A 4DV2B 3CYOA 4DV6B 4UB6Z 4NXMO 4D7TA 4GKJB 4LF5O 3CCJV 1GTOA 3AG7A 4WFGA 4NTYA 2Z5UA 1GKFA 3ZRXA 3RVYA 4X65B 1XQ8A 2V7QG 4JI6B 3RGBA 4ZKIA 1F23A 4JAVA 5CA1B 2IJIA 2ZR2A 3LSQA 5H9CA 4H13B 3W7SA 4EFBA 5CA1A 1S77D 5L3CA 2KB1A 2Q6AA 1GM8A 1R3LC 4LF4O 3I55V 3CXHF 3MHSC 2GDSA 5H6RA 3CXCU 1IBLB 1H2KA 2ZR3A 3W7UA 3CJHB 4GX5A 1H2NA 1ZLZA 4DV1B 1YCIA 4PI0A 1XI1A 3BHPA 3CJHA 4BR6A 4JYBA 3CCLV 4JI0B 2GTAA 1R6NA 3UQ8A 4H0LB 4QE9A 2LW7A 3O65A 1VQLV 2AW9A 4U7NA 3OTOB 4MVZA 1VMGA 4QGPA 2VQFO 4FFBB 2D3OW 4K35A 1I5YA 2E5LB 5B1AB 1M5IA 4UV9A 1QR8A 1SZXA 1SA0B 4FFBA 3OMAB 3ZJZA 2LJ2A 4PA9A 1SA0A 1H38A 5E1AC 3P32A 1K5QA 4CS3A 2UUCB 3JD4A 3TETA 2N05A 3G6BA 2ADPA 2IJHA 3CB2A 5JJNB 3OT7A 3S3XA 2HJDA 1KYOF 3TXQA 3WFVA 1VF6A 1TVKB 2UUAO 2QA4V 3T2MA 3NXSA 3L72H 2OYQA 1TVKA 1K73W 2HKOA 2A0LA 1HNXB 4JZGA 4FJCC 5JJEB 3HB3B 2JRIA 4UXNA 2XAGA 1MZFA 2Q7EA 4J10A 4R8CA 1OCZB 2G38A 1WP7A 5FL7G 3B8NA 1VQ4V 2WLJA 4BW9A 4DUYB 4AQYB 3UKMA 4UCTA 4K8XA 1GK9A 2EIKC 3ETEA 3FB7C 1GN2A 4EB6B 2MW2B 5CB4B 4FLVA 1AI7A 2Q7GA 1QHTA 3OGCC 2XAFA 4CZZA 3L74H 4EB6A 5CB4A 2PZSA 2PTMA 4RAIA 1VQKV 3ML0A 3HPLC 4GKKO 2JDIG 2Q67A 4PA4A 2GSMB 1OCCB 1MOFA 4DV0B 3E89A 1B06A 2PUSA 2LGQA 1S5LZ 1Q3EA 4X62O 2XNDG 1NTZH 5C8YB 2AHZA 2HFEC 4TWKA 2X7RB 4JI8B 2ZIOA 4WFEA 5C8YA 2QWRB 4OX9O 2QKCA 4DV3B 4DR2B 1QNMA 5GW7A 4KUMA 1BQZA 1CP9A 4B3SO 3E8HA 1D5AA 1WP8A 1Q8IA 3E35A 1SQBH 2HR3A 4GYCB 4X64O 1O9HA 2P06A 3ZHVA 4CH6A 3M7MX 2Q0OC 4B7KA 3BA9A 3CC2V 1I08A 3CCUV 1P4RA 4NKGB 4Z2WA 3R66A 3LSUA 4MS2A 2UXDO 3JSLA 4LR3A 3A0BZ 5KMGB 3FX7A 4MTXA 5LHHA 1Q90D 4JI5O 2E75B 4E4EA 4O4JB 4KL1A 5KMGA 4B3TO 5EIBD 1N34B 2ZM6B 1OV9A 4O4JA 4CC5A 4JZ2A 1A32A 2WAMA 3R65A 4QJFB 5K1XA 5A2QN 4JF3A 3X2QC 1EM1A 1F4MA 3ASNB 1JFFB 3WB0A 5LGUA 4JI2O 1HWYA 4D7SA 1NU1H 3HKBB 1M90W 3B4SA 3SYQA 2FYUH 1SS3A 1JFFA 3WB2A 1YHQV 4CC6A 4JV5B 3HKBA 3QO7A 1K4DC 2EIKB 3JASB 4TQDA 1BQ0A 4G27B 4FLUA 3QO8A 3JASA 3L73H 2F23A 1H2SB 3ZX6A 4XDKA 4K0KB 1HNZB 4JI7O 4WFAV 4DR7O 2YC0A 2DE0X 1SQXH 1FFTB 2KQXA 2O57A 3E8GA 2VS0A 3ZMSA 2WLNA 4UCOA 2K9PA 1NKDA 1AR4A 3AG4C 1IZ3A 4PELA 2BOBC 1S5HC 1TUEB 1J5EO 4XDLA 3TGUH 4KHPO 2B1IA 5CBHA 4ZHQB 2A9HA 2IW5A 2P7TC 3U11A 3QF7A 4LBEC 2Y48A 1BMFG 2HP8A 4L8JA 4ZHQA 1CPYA 1US6A 2DMXA 5F2VO 2ZE5A 2UXNA 1R6KA 3BAAA 5JCOA 1JR9A 1UJWB 4H37A 3W7XA 4OPHA 5EK0A 2YS8A 3G6EV 2OCHA 1L0NH 1NQTA 2M7WA 4RQEA 1IBKO 4B7EA 3CD6V 4A5UB 2WA4A 4WFFA 1YIJV 4FMTA 2YXHA 2YIAA 3JAWB 1PM9A 2A79B 3T1YB 3F7VC 3CP1A 3AG1C 1KKDA 3K0DA 1IBMO 1ZAUA 2X6AA 4R6ZA 3JAWA 1PKXA 1FAFA 3OFNG 4K3AA 1PL0A 5TISZ 1S72V 5IWAO 4HYOA 4DR4B 4MVQA 1XMQO 1Y66A 4DR3B 1U97A 2QEXV 1AJPA 2PYJA 1GAXA 2B1GA 3H1LH 4OXSA 2ZKOA 1N33O 1KKCA 1ZTEA 5LMNB 3RWRD 1PV0A 1Q6IA 4UCUA 4LF9B 1FD9A 2F1MA 1QBZA 4Z1MG 4WFBV 1FKAO 4X9QA 5AG2A 2DQ3A 4UCVA 1AI4A 2GUZB 4UV8A 3CCEV 2P4VA 3H1HH 2UUBB 2GUZA 1XMOO 2WLMA 3DGEA 2JK5C 3DSQA 2FL4A 1VQ9V 3LDDA 3VQWA 1M9NA 3LUTB 2KSDA 2QR4A 2YI9A 3UO2A 2C2AA 5IYCO 1DLBA 1NS1A 4CS4A 1WJZA 4MSWC 5J9PC 3JD1A 4FM1A 4AHCA 2ITCC 2H8PC 4JTCB 2X6BA 2X0LA 3RYCB 2QGNA 2Q7HA 4JI3O 5H2FZ 4JYAB 3AG4B 3RYCA 2BOCC 3IC9A 4Q6GA 1Q5OA 3BA8A 5KA5A 1SRYA 5LOVB 1EZJA 2EZOA 2OIGA 2IBZH 3E86A 2Y4TA 1JCHA 5LOVA 4DV4B 5B1AC 3BPZA 3M99B 2VQEB 2WSSG 5BXZA 1Q6HA 3B2EE 2PI4A 4PDMA 1OHHG 2DWDC 3ETDA 2LP7A 4B3MO 2A3QA 4X1KB 4LP8A 4TQFA 4NR1A 2EULA 4DK0A 1AP5A 1Y67A 3L70H 1OCRC 1IURA 3OR6C 2XT9A 4X1KA 2QWQB 2DYSC 2UU9B 1F4NA 4DV7O 2CE4A 1XNRO 4FPPA 1GRJA 3D3QA 2H94A 3RFRA 2DJVA 3AG1B 2NR5A 4JPRA 5KUMA 3LNNA 4I9WA 4PHZA 1KBHA 3APOA 4FFKA 1MSDA 3K79A 3RW0A 4YY3B 1GM7A 2DWEC 1N36O 4LH7A 4I0XB 1NR7A 1M57C 1N0JA 3A2FA 4LF6B 1HW7A 5DECA 5EC2C 4I0XA 1YSCA 3SJBC 3RYFB 3CX5F 3ABTA 2YIBA 3STZC 3A8TA 2Q8VA 4MW8A 2Y0IA 4X66B 3RYFA 1TUBB 1K7DA 5LGNA 2XTAA 3F5WC 4LF7B 1TUBA 1KC8W 3ZIAG 1YVWA 3CRCA 5LA6B 1B3QA 2YICA 2KG7B 1XDCA 3N2KB 1TA8A 2FMLA 1SETA 3HKEB 5LA6A 2KG7A 3N2KA 1Q6UA 1N32O 3HKEA 1VQMV 1KP2A 3CSXA 1HR0O 1OCCC 1CEZA 4EEQA 2Z0AA 2RNBA 5LHIA 1DF5A 1EFRG 5LMUB 1I94B 1OZ0A 4HAMA 1JJOA 2IJKA 1FFXB 4FLYA 2EINC 3JD0A 1YEWA 3J7AU 1E79G 5LYJB 2F4VB 3ZMUA 2JS3A 1FFXA 4DRXB 1AP6A 1WA8B 2NNUA 4JTDB 3STLC 4DV6O 5L3FA 2P22C 4O4HB 5LYJA 2JJ1G 4H33A 4GKJO 3H1KH 4PA3A 1KD1W 1NBMG 4DRXA 1GN3A 1WA8A 4O4HA 1KP3A 1G4YB 1BZKA 4UVCA 3W7TA 4H44B 4X65O 2QWNB 2YXYA 1NT2B 5FPRA 1XOUA 4JI6O 3ZMTA 2XASA 4CS2A 4FLTA 3ICXA 4W4LA 3W7WA 3SJQC 3ZMZA 5ITZB 1JPXA 5KA6A 2ZDIC 1K34A 5ITZA 2UUAB 4BIOA 1IBLO 2QSAA 1VIBA 1FXVA 1AILA 4X8AA 1YJ9V 4K8ZA 4DV1O 4NXNO 3GWOA 1OCRB 3U10A 1QQCA 1H2LA 1VQ8V 2DYSB 4IL6Z 1NVPB 4LFBO 4XBFA 1Z5WA 4JI0O 3TK1A 3OW2U 3K04A 5L3EA 4WFHA 5BR8B 1YZBA 1NZ6A 3FKSG 5JJJB 4QIWF 2UXBB 3SPIA 3KG2A 4UFZA 1K92A 1SQQH 4YIPA 2E5LO 2GHYA 3ABKC 1Y76B 3DXRB 4UVAA 3ZRWB 3K5NA 2PY5A 1KB9F 2P90A 1I5XA 5CBGA 3ASNC 3F7YC 5L3GA 2JGUA 3E22B 1Y76A 3DXRA 2OIEA 4DO2A 1XUQA 1M57B 3ZRWA 2Q4PA 1RP3B 4TT3G 4GZRB 4NVPA 5CA0B 3SYPA 3E22A 3AK1A 1RSOB 3B40A 2UUCO 2Q69A 5CA0A 3S3WA 1AI5A 1RSOA 1IX9A 1VEWA 3SYOA 4GLXA 1YTFD 2R72A 3K5LA 5B1NA 2B9ZA 3CHXA 3KCXA 4PA6A 4X62B 4PDVA 5CN0A 3DC5A 4LFCB 1HNXO 3T1CA 2VWKA 2PYLA 4TV8B 1SESA 3D8CA 1PNKA 3PN1A 4TV8A 5IE9A 1RPRA 4F6RB 1LUWA 2Y4UA 1XREA 1E1RG 1H2GA 4O2AB 2E76B 1PD3A 2L35A 3ZEDA 4F4LA 4F6RA 5JCOC 4DUYO 1AB3A 4MTFA 4DR1B 4O4LB 4O2AA 2ODMA 2EJRA 2EINB 3C3TA 4O4LA 3EFFK 3K58A 2FKXA 2AHYA 2CK3G 4B3RB 4DR5B 3GWKC 5J2UB 4PDLA 1L1FA 3T4DA 5J2UA 2QM8A 4HBNA 1GH6A 4KFMA 3OMNB 2LO1A 4N23A 2P67A 2R9IA 4ABMA 4LCUC 1MZEA 1VF5B 4DV0O 3AK2A 4TOIA 3KZIZ 1SQVH 2ZDIA 3IAYA 4N21A 3HKCB 5JWPA 1NJIW 2VWJA 3CPWU 1F7YA 5EBMC 3HKCA 2HEPA 4JI1B 3SGIA 1KUQA 1JQ0A 1SQFA 4MTGA 4DXWA 3GB7C 1V55C 4DV3O 5E79Z 4DR2O 4GX0A 1FYJA 3JSNA 1DF4A 2AZ2A 4IT5A 4PDRA 3H9VA 3O9OA 1R1BA 1KU9A 1VQ5V 3ABKB 1VARA 3M8AA 4J80A 4DUZO 2ZINA 1VQOV 4B08A 5C93A 1NH2D 3AK3A 4FM0A 5KHGA 5LP6C 2ITDC 2L6LA 3ZRSA 5GTHZ 2ZCEA 4I50B 4ICGA 4FLZA 2OCCC 3J81N 2QTOA 1XL4A 1G6UA 4PA7A 4I50A 3KKYA 5EIBC 4ZBMA 3FB8C 5BMVB 1Y4MA 4KHPB 1N34O 2ZM6O 5BMVA 4J7KA 5KAFZ 3VBBA 5B1BC 4DW0A 1S0VA 4KP4A 1J95A 3IJ4A 1SKVA 1XEQA 2F43G 4WCEV 1TAEA 4O4IB 2XAQA 3UCSC 2UXCB 3L75H 4O4IA 4LH6A 5JVDB 3CCRV 4FM2A 2AZ0A 4RUFA 1AR5A 4YHHB 4JV5O 4MVSA 4I7ZB 5JVDA 4UCSA 2LGWA 1FJGB 1K5SA 3HKDB 3E2EA 2H3OA 3EHBB 5L3BA 4D6TH 1WB7A 2JEXA 2RN9A 3HKDA 4I55B 4JI4B 3VQVA 1M93A 1DK1A 4K0KO 1HNZO 5IWAB 4YIOA 1N8RW 1MA1A 4I55A 4X1IB 1AJQA 3CCQV 1EN4A 5CA3A 5CMUA 3I5DA 1Z2GA 3AG2B 4LWSB 4X1IA 2D2CB 3QO5A 3T4ZA 5HFLA 4LWSA 1U96A 2ZQMA 3P3PA 3OGIB 1WPXA 3SYAA 1XILA 5EZYB 2IJJA 4MVUA 3D36C 5EZYA 3RYIB 1SF9A 4ZOLB 1BCCH 3RYIA 4ZOLA 3ZHUA 1V55B 2CUGA 2CTWA 2WA3A 1HNWB 5IJ0B 1O9GA 1EBOA 1FPOA 3OR7C 4CH4A 3OEHG 3T1YO 5IJ0A 3QTCA 3ZMVA 1YITV 4RWUA 3CCMV 1VQPV 1EZVH 3B8MA 4KXRA 4EKWA 2W6JG 1BHBA 5DM6V 4DR4O 5KX5B 4DR3O 5LP6B 1K97A 1Q7YW 1I7FA 4DV5B 5KX5A 2ZE6A 4C7UA 5EYPB 1X4TA 4G28B 5LP6A 2OCCB 1B04A 2LW1A 4DYLA 1PNMA 3ZN0A 3J80N 3E8FA 5EYPA 2YXLA 3FYEB 2YEVB 4LF9O 4LFAB 3MAQA 1IDSA 3JAMN 2YEVA 5B1BB 3CC7V 1IXBA 3ASOC 1Q81W 2A06H 2PGGA 3CCVV 3ZHSA 3HR0A 2JIZG 1BS3A 2RCVA 3WG7C 4JYYA 2BTOA 1XNQB 2OT5A 3C3SA 1D2DA 1P7BA 4P9PA 3K57A 4LF8B 1H2MA 3B77A 4CH3A 3LDEA 1PL4A 3ZS8C 2HHHB 1NTMH 2EIJB 3OD4A 1WN7A 5KUKA 2YUAA 1AI6A 1W0KG 4JTAB 3ABLC 1S76D 5EBWC 1WLEA 1N36B 2RJZA 2ZXWC 1K33A 4J42A 5LHGA 3OEEG 4JYAO 3F5TA 2ZNIA 2R9RB 4OPAA 2V4DA 1B6QA 5L3DA 4EFEA 1NI8A 3BABA 5B3SC 4YJ3B 3OAAG 1Y74B 2CTPA 4DV4O 3CE2A 3SR2C 1SZTA 3DTUB 3WU2Z 4YJ3A 4ZIBA 1Y74A 2VQEO 3H1IH 4DW1A 2VRZA 4NXMB 1V9PA 3D36A 1TGOA 2YI8A 4L87A 4LF5B 4PD4F 1BL8A 2KKWA 2FTKA 1K3EA 4I9QA 2LFSA 2HJFC 4DR6O 2UU9O 2XAHA 3N2GB 4MVOA 2CAZC 4J7JA 5IY5B 3ZHTA 3N2GA 3T1HO 3CC4V 2BTQB 4O2BB 4LF4B 1WB8A 3FYIB 4BIZA 4MVRA 1JA8A 4FIPC 2DYRC 3ZCCA 2BTQA 4O2BA 3UM7A 4YY3O 3A0HZ 1FXKC 1GN4A 3SPJA 4JGSA 2M6YA 4MW3A 4LF6O 1Z5VA 1BGYH 2R9AA 3I56V 2V1DA 1WPBA 3JCZA 5LBQA 4IHJB 4X66O 2VQFB 1E1QG 1PPJH 5DEDA 1R3IC 3LSSA 4DV2O 2Q9LA 3ASOB 4IHJA 2EX3A 4LF7O 5IJ9B 1BE3H 5LXTB 2EILC 2RQ6A 1SC5B 4Q20A 1Q82W 4BWAA 4ZI7B 4NB5A 5IJ9A 2B5UA 5LXTA 1M4UA 3FB6C 3WG7B 2ADQB 2WLIB 4ZI7A 4NXNB 5H6QA 1H8EG 4TV9B 4CBCA 2OWOA 2WLIA 3K03A 4TV9A 2AXTZ 4LFBB 2ZD9A 3K59A 2QE7G 1X59A 5LGTA 5LMUO 1ENVA 1FXHA 4RUEA 1I94O 2Q73A 4X20B 1R3KC 3ETQA 2PF4E 1AJNA 2Y0PA 1R6TA 5KHHA 3CEIA 1Q86W 3SPCA 3UT5B 3SPHA 2LFRA 3ABLB 4NTXA 4X20A 4BAYA 2F4VO 3MD0A 1YXBA 2CGOA 1VP7A 4IYHA 2NN4A 2XUMA 2ZXWB 3UT5A 3CS5A 3IGAC 4QPJA 3NR7A 5K1PA 1M1KW 4CH5A 3OTOO 4E2LA 5B3SB 2AGAA 1LUVA 1RM1C 1EN5A 2QM7A 4XDJA 2ZE8A 2QWOB 2Q5ZA 4X89A 3SJCC 3CRAA 1MMMA 2DOSA 5KHIA 3A0RA 1IXMA 2BCCH 3OM3B 3EXAA 3K08A 3EVKA 2ILMA 1PNLA 3CRQA 2WWWA 2XAJA 5B5EZ 1ROPA
chains in the Genus database with same CATH topology
2DE0X 4LWSB 3GWKC 2KG7A 3FAVA 2AZ2A 2VS0A 3O9OA 4LWSA 1WA8B 3GVMA 3ZBHA 3TXQA 4GZRB 3Q4HB 2B9ZA 3TXSA 3OGIB 4I0XB 3G80A 1WA8A 2VRZA 3Q4HA 2AZ0A 3FD9A 2KG7B 3HR0A 3FAVB 4I0XA 4ABMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE0 X;  4LWS B;  3GWK C;  2KG7 A;  3FAV A;  2AZ2 A;  2VS0 A;  3O9O A;  4LWS A;  1WA8 B;  3GVM A;  3ZBH A;  3TXQ A;  4GZR B;  3Q4H B;  2B9Z A;  3TXS A;  3OGI B;  4I0X B;  3G80 A;  1WA8 A;  2VRZ A;  3Q4H A;  2AZ0 A;  3FD9 A;  2KG7 B;  3HR0 A;  3FAV B;  4I0X A;  4ABM A; 
#chains in the Genus database with same CATH topology
 3RYH B;  1ZUQ A;  3FFQ A;  4GKK B;  1OJH A;  3ABU A;  4U7O A;  1BT8 A;  3RYH A;  1S5J A;  1QVG U;  5BR8 O;  1P49 A;  2CDY A;  4QPK A;  3UO3 A;  2UXB O;  1XBL A;  4BIU A;  3ZHR A;  2XHB A;  2HVK C;  2DYR B;  4UCR A;  2OTJ V;  2HVJ C;  4TUY B;  1FXK B;  4HNA B;  1CXZ B;  4UVB A;  1URF A;  4OX9 B;  3L9D A;  4UUJ C;  3WB1 A;  3JCU Z;  4TUY A;  1FXK A;  1L8D A;  2FB5 A;  1DTO A;  4HNA A;  3BRC A;  3JYC A;  1V54 C;  2CTR A;  4Z1V A;  4AQY O;  3MHH C;  4B3S B;  2P5O A;  1ZSP A;  2W0X A;  5HFM A;  1K8A W;  5GON B;  1H8H G;  2JEU A;  2F95 B;  5GON A;  2CH7 B;  1AVM A;  2GV9 A;  4X64 B;  2EIL B;  1XL6 A;  4GCZ A;  2ZT9 B;  2CH7 A;  4MT8 A;  4P9O A;  3RT3 C;  2EJ7 A;  3QG5 A;  3AG2 C;  2UXD B;  2RDC A;  1YJW V;  4LFC O;  1JMK C;  2X6C A;  4NYK A;  5J2T B;  3ZRV A;  4P30 A;  4JI5 B;  1IVS A;  4FK5 C;  2ETN A;  2QJ1 A;  4B3T B;  5J2T A;  1GMG A;  4X1Y B;  4DR1 O;  2WPD G;  5IYZ B;  1MG1 A;  5KLV H;  4RO2 A;  3ABM C;  1P84 F;  3E83 A;  4X1Y A;  2A7W A;  3IFX A;  5IYZ A;  4JI8 O;  1DGS A;  2F93 B;  1BSM A;  2ZIM A;  4DUZ B;  5IDJ A;  1MSW D;  2RMK B;  2QKA A;  4B3R O;  4QE7 A;  5D5P A;  4DR5 O;  4JI2 B;  5DN6 G;  4R7C A;  5B66 Z;  3CWB H;  3H01 A;  1Q43 A;  4BW5 A;  3K0G A;  3ZBH A;  1RM1 B;  2IU3 A;  1ZX3 A;  2EIM C;  1EN6 A;  3JAT B;  1RFY A;  2YID A;  2ARH A;  2QWP B;  3THO A;  1QCE A;  3JAT A;  5LL6 Y;  3AG3 C;  1ARO P;  3H1J H;  4JI7 B;  4DR7 B;  1L0L H;  3DC6 A;  4UB8 Z;  3K9S A;  2BE3 A;  3ZHQ A;  3G71 V;  1KMI Z;  3GVM A;  1OCO C;  3BFR A;  4JI1 O;  2Q68 A;  2DQ0 A;  1YF2 A;  1N0N A;  2XOK G;  3VQY A;  2N04 A;  4R50 A;  1D5N A;  4HZ3 A;  3CRM A;  3VQX A;  1J5E B;  2OTL V;  4OGQ B;  4MTO A;  4JAA A;  2N74 A;  2QDO A;  4QNH B;  1VQ7 V;  1YI2 V;  4MVM A;  1XHX A;  5EBL C;  4P2Z A;  2WLH A;  3PJS K;  1W0J G;  1GM9 A;  3G67 A;  4IIJ B;  4GX2 A;  3K5O A;  4YXW G;  5B1O A;  4U3J B;  1THZ A;  4IIJ A;  1IBK B;  3LDC A;  1V54 B;  1NTK H;  1MAB G;  4U3J A;  1QR9 A;  1W2B U;  4WBN B;  1FS0 G;  3Q4H B;  1YTF B;  2ATK C;  2EIJ C;  3JAK B;  1IBM B;  4WBN A;  3JAR B;  5D5Q A;  3Q4H A;  2WLL B;  3JAK A;  1JJ2 U;  1G8M A;  2CGN A;  4J9Y B;  4PJ0 Z;  2CTQ A;  3JAR A;  1XMQ B;  2QM4 A;  3P30 A;  1PP9 H;  2WLL A;  4DK1 A;  4G2K A;  3K9A A;  3RN4 A;  4LNU B;  1N33 B;  2UXC O;  4JAU A;  4IYI A;  2BSK B;  2LQT A;  3AEI A;  5KAI Z;  2IH1 C;  2UXX A;  2YSU B;  2JGD B;  4LNU A;  2YIB D;  3BY6 A;  5IYB O;  3G80 A;  5BY1 A;  2ZNJ A;  2BSK A;  1COW G;  1SER A;  4JYC A;  3VOU A;  4YHH O;  3P3N A;  1QU7 A;  2JGD A;  1Y6X A;  4NTW A;  2E3C A;  1M56 C;  4FZ1 A;  1FJG O;  4WF9 V;  3OE7 G;  3ABM B;  1VF7 A;  2K1E A;  1GN6 A;  4JI4 O;  1I0H A;  5JH7 B;  4LC1 A;  5IYD O;  1XMO B;  3TJT A;  5KHJ A;  2EBO A;  4RQF A;  1MNG A;  1AR1 B;  5JH7 A;  1ORQ C;  2HLD G;  3JD3 A;  5FPO A;  2EIM B;  5IY5 C;  1KEC A;  2QKS A;  4F6E A;  3OMI B;  1N4C A;  2Y69 C;  5GTI Z;  2P6J A;  2IM9 A;  3BVO A;  4FLW A;  2YDE A;  5H5N A;  3AG3 B;  3K5M A;  1QLE C;  3RVZ A;  3APQ A;  4PV1 B;  2IH3 C;  2ZE7 A;  1YJN V;  3FAV B;  1VQN V;  1ZL8 B;  4PI2 A;  3BEH A;  1OCO B;  2IU0 A;  4JI3 B;  4JAS A;  5LMN O;  3FAV A;  3X2Q B;  1HDJ A;  1JX9 A;  3C90 A;  1ZL8 A;  1QVF U;  5A9G A;  1T5E A;  4AI8 A;  1HNW O;  1WNS A;  1BHA A;  4J41 A;  2MK3 A;  1P7G A;  3G4S V;  3CME V;  4U3F H;  1F51 A;  4FZ0 A;  5EC1 C;  1SQG A;  1QLN A;  4I5S A;  5FNV B;  1NH2 B;  4B3M B;  5JQG B;  1KQS U;  3U0Z A;  2UUB O;  3MDS A;  3K06 A;  1K4C C;  5FNV A;  2QTS A;  1LNQ A;  4X88 A;  5JQG A;  3CMA V;  3JD2 A;  1XHZ A;  4TSF G;  2GBO A;  4DV5 O;  1W59 A;  3FB5 C;  4ASU G;  2W0F C;  4DV7 B;  4FLX A;  1XNR B;  3FD9 A;  4W4K A;  2DW4 A;  1JOY A;  1NVP D;  2HG5 C;  3N27 A;  3LNM B;  3ETG A;  2Z3Y A;  1K9M W;  4LFA O;  3KCY A;  4FVM A;  5CBF A;  1NR1 A;  5KHK A;  4GX1 A;  3CCS V;  3TCU A;  2E74 B;  3B09 A;  4GUN A;  4YJ2 B;  4J11 A;  1GO3 F;  4YJ2 A;  2DN9 A;  4AIL C;  3BCC H;  2R70 A;  1XNQ O;  2EZP A;  1HP8 A;  2Q0A A;  1R3J C;  4DR6 B;  3ZN1 A;  3K3W A;  1YDX A;  3JAL B;  1VF6 C;  3TXS A;  4J7Z A;  1M56 B;  1S3J A;  4LF8 O;  1VQ6 V;  3OUS A;  1JVM A;  4J9Z B;  5FLX N;  3JAL A;  3IC7 A;  2JJ2 G;  2NLJ C;  3T1H B;  2HHH O;  3QNE A;  1G1X B;  4GT1 A;  1ZWI C;  1UPG A;  1UFI A;  3QVN A;  3SJA C;  1R73 A;  3SDL A;  2W6I G;  3L71 H;  2JS5 A;  3OTF A;  5IT9 N;  2WLK A;  1N32 B;  3RBZ A;  3SYC A;  2JVD A;  1HR0 B;  1SQP H;  5BZB A;  3SPG A;  1OCZ C;  2F66 C;  3E8B A;  2GTS A;  1LR1 A;  4I4T B;  4IGG A;  2Y69 B;  3OUF A;  1WAZ A;  1RPO A;  2P4K A;  3D3I A;  4I4T A;  1QLE B;  3CRR A;  2PI5 A;  4DV2 B;  3CYO A;  4DV6 B;  4UB6 Z;  4NXM O;  4D7T A;  4GKJ B;  4LF5 O;  3CCJ V;  1GTO A;  3AG7 A;  4WFG A;  4NTY A;  2Z5U A;  1GKF A;  3ZRX A;  3RVY A;  4X65 B;  1XQ8 A;  2V7Q G;  4JI6 B;  3RGB A;  4ZKI A;  1F23 A;  4JAV A;  5CA1 B;  2IJI A;  2ZR2 A;  3LSQ A;  5H9C A;  4H13 B;  3W7S A;  4EFB A;  5CA1 A;  1S77 D;  5L3C A;  2KB1 A;  2Q6A A;  1GM8 A;  1R3L C;  4LF4 O;  3I55 V;  3CXH F;  3MHS C;  2GDS A;  5H6R A;  3CXC U;  1IBL B;  1H2K A;  2ZR3 A;  3W7U A;  3CJH B;  4GX5 A;  1H2N A;  1ZLZ A;  4DV1 B;  1YCI A;  4PI0 A;  1XI1 A;  3BHP A;  3CJH A;  4BR6 A;  4JYB A;  3CCL V;  4JI0 B;  2GTA A;  1R6N A;  3UQ8 A;  4H0L B;  4QE9 A;  2LW7 A;  3O65 A;  1VQL V;  2AW9 A;  4U7N A;  3OTO B;  4MVZ A;  1VMG A;  4QGP A;  2VQF O;  4FFB B;  2D3O W;  4K35 A;  1I5Y A;  2E5L B;  5B1A B;  1M5I A;  4UV9 A;  1QR8 A;  1SZX A;  1SA0 B;  4FFB A;  3OMA B;  3ZJZ A;  2LJ2 A;  4PA9 A;  1SA0 A;  1H38 A;  5E1A C;  3P32 A;  1K5Q A;  4CS3 A;  2UUC B;  3JD4 A;  3TET A;  2N05 A;  3G6B A;  2ADP A;  2IJH A;  3CB2 A;  5JJN B;  3OT7 A;  3S3X A;  2HJD A;  1KYO F;  3TXQ A;  3WFV A;  1VF6 A;  1TVK B;  2UUA O;  2QA4 V;  3T2M A;  3NXS A;  3L72 H;  2OYQ A;  1TVK A;  1K73 W;  2HKO A;  2A0L A;  1HNX B;  4JZG A;  4FJC C;  5JJE B;  3HB3 B;  2JRI A;  4UXN A;  2XAG A;  1MZF A;  2Q7E A;  4J10 A;  4R8C A;  1OCZ B;  2G38 A;  1WP7 A;  5FL7 G;  3B8N A;  1VQ4 V;  2WLJ A;  4BW9 A;  4DUY B;  4AQY B;  3UKM A;  4UCT A;  4K8X A;  1GK9 A;  2EIK C;  3ETE A;  3FB7 C;  1GN2 A;  4EB6 B;  2MW2 B;  5CB4 B;  4FLV A;  1AI7 A;  2Q7G A;  1QHT A;  3OGC C;  2XAF A;  4CZZ A;  3L74 H;  4EB6 A;  5CB4 A;  2PZS A;  2PTM A;  4RAI A;  1VQK V;  3ML0 A;  3HPL C;  4GKK O;  2JDI G;  2Q67 A;  4PA4 A;  2GSM B;  1OCC B;  1MOF A;  4DV0 B;  3E89 A;  1B06 A;  2PUS A;  2LGQ A;  1S5L Z;  1Q3E A;  4X62 O;  2XND G;  1NTZ H;  5C8Y B;  2AHZ A;  2HFE C;  4TWK A;  2X7R B;  4JI8 B;  2ZIO A;  4WFE A;  5C8Y A;  2QWR B;  4OX9 O;  2QKC A;  4DV3 B;  4DR2 B;  1QNM A;  5GW7 A;  4KUM A;  1BQZ A;  1CP9 A;  4B3S O;  3E8H A;  1D5A A;  1WP8 A;  1Q8I A;  3E35 A;  1SQB H;  2HR3 A;  4GYC B;  4X64 O;  1O9H A;  2P06 A;  3ZHV A;  4CH6 A;  3M7M X;  2Q0O C;  4B7K A;  3BA9 A;  3CC2 V;  1I08 A;  3CCU V;  1P4R A;  4NKG B;  4Z2W A;  3R66 A;  3LSU A;  4MS2 A;  2UXD O;  3JSL A;  4LR3 A;  3A0B Z;  5KMG B;  3FX7 A;  4MTX A;  5LHH A;  1Q90 D;  4JI5 O;  2E75 B;  4E4E A;  4O4J B;  4KL1 A;  5KMG A;  4B3T O;  5EIB D;  1N34 B;  2ZM6 B;  1OV9 A;  4O4J A;  4CC5 A;  4JZ2 A;  1A32 A;  2WAM A;  3R65 A;  4QJF B;  5K1X A;  5A2Q N;  4JF3 A;  3X2Q C;  1EM1 A;  1F4M A;  3ASN B;  1JFF B;  3WB0 A;  5LGU A;  4JI2 O;  1HWY A;  4D7S A;  1NU1 H;  3HKB B;  1M90 W;  3B4S A;  3SYQ A;  2FYU H;  1SS3 A;  1JFF A;  3WB2 A;  1YHQ V;  4CC6 A;  4JV5 B;  3HKB A;  3QO7 A;  1K4D C;  2EIK B;  3JAS B;  4TQD A;  1BQ0 A;  4G27 B;  4FLU A;  3QO8 A;  3JAS A;  3L73 H;  2F23 A;  1H2S B;  3ZX6 A;  4XDK A;  4K0K B;  1HNZ B;  4JI7 O;  4WFA V;  4DR7 O;  2YC0 A;  2DE0 X;  1SQX H;  1FFT B;  2KQX A;  2O57 A;  3E8G A;  2VS0 A;  3ZMS A;  2WLN A;  4UCO A;  2K9P A;  1NKD A;  1AR4 A;  3AG4 C;  1IZ3 A;  4PEL A;  2BOB C;  1S5H C;  1TUE B;  1J5E O;  4XDL A;  3TGU H;  4KHP O;  2B1I A;  5CBH A;  4ZHQ B;  2A9H A;  2IW5 A;  2P7T C;  3U11 A;  3QF7 A;  4LBE C;  2Y48 A;  1BMF G;  2HP8 A;  4L8J A;  4ZHQ A;  1CPY A;  1US6 A;  2DMX A;  5F2V O;  2ZE5 A;  2UXN A;  1R6K A;  3BAA A;  5JCO A;  1JR9 A;  1UJW B;  4H37 A;  3W7X A;  4OPH A;  5EK0 A;  2YS8 A;  3G6E V;  2OCH A;  1L0N H;  1NQT A;  2M7W A;  4RQE A;  1IBK O;  4B7E A;  3CD6 V;  4A5U B;  2WA4 A;  4WFF A;  1YIJ V;  4FMT A;  2YXH A;  2YIA A;  3JAW B;  1PM9 A;  2A79 B;  3T1Y B;  3F7V C;  3CP1 A;  3AG1 C;  1KKD A;  3K0D A;  1IBM O;  1ZAU A;  2X6A A;  4R6Z A;  3JAW A;  1PKX A;  1FAF A;  3OFN G;  4K3A A;  1PL0 A;  5TIS Z;  1S72 V;  5IWA O;  4HYO A;  4DR4 B;  4MVQ A;  1XMQ O;  1Y66 A;  4DR3 B;  1U97 A;  2QEX V;  1AJP A;  2PYJ A;  1GAX A;  2B1G A;  3H1L H;  4OXS A;  2ZKO A;  1N33 O;  1KKC A;  1ZTE A;  5LMN B;  3RWR D;  1PV0 A;  1Q6I A;  4UCU A;  4LF9 B;  1FD9 A;  2F1M A;  1QBZ A;  4Z1M G;  4WFB V;  1FKA O;  4X9Q A;  5AG2 A;  2DQ3 A;  4UCV A;  1AI4 A;  2GUZ B;  4UV8 A;  3CCE V;  2P4V A;  3H1H H;  2UUB B;  2GUZ A;  1XMO O;  2WLM A;  3DGE A;  2JK5 C;  3DSQ A;  2FL4 A;  1VQ9 V;  3LDD A;  3VQW A;  1M9N A;  3LUT B;  2KSD A;  2QR4 A;  2YI9 A;  3UO2 A;  2C2A A;  5IYC O;  1DLB A;  1NS1 A;  4CS4 A;  1WJZ A;  4MSW C;  5J9P C;  3JD1 A;  4FM1 A;  4AHC A;  2ITC C;  2H8P C;  4JTC B;  2X6B A;  2X0L A;  3RYC B;  2QGN A;  2Q7H A;  4JI3 O;  5H2F Z;  4JYA B;  3AG4 B;  3RYC A;  2BOC C;  3IC9 A;  4Q6G A;  1Q5O A;  3BA8 A;  5KA5 A;  1SRY A;  5LOV B;  1EZJ A;  2EZO A;  2OIG A;  2IBZ H;  3E86 A;  2Y4T A;  1JCH A;  5LOV A;  4DV4 B;  5B1A C;  3BPZ A;  3M99 B;  2VQE B;  2WSS G;  5BXZ A;  1Q6H A;  3B2E E;  2PI4 A;  4PDM A;  1OHH G;  2DWD C;  3ETD A;  2LP7 A;  4B3M O;  2A3Q A;  4X1K B;  4LP8 A;  4TQF A;  4NR1 A;  2EUL A;  4DK0 A;  1AP5 A;  1Y67 A;  3L70 H;  1OCR C;  1IUR A;  3OR6 C;  2XT9 A;  4X1K A;  2QWQ B;  2DYS C;  2UU9 B;  1F4N A;  4DV7 O;  2CE4 A;  1XNR O;  4FPP A;  1GRJ A;  3D3Q A;  2H94 A;  3RFR A;  2DJV A;  3AG1 B;  2NR5 A;  4JPR A;  5KUM A;  3LNN A;  4I9W A;  4PHZ A;  1KBH A;  3APO A;  4FFK A;  1MSD A;  3K79 A;  3RW0 A;  4YY3 B;  1GM7 A;  2DWE C;  1N36 O;  4LH7 A;  4I0X B;  1NR7 A;  1M57 C;  1N0J A;  3A2F A;  4LF6 B;  1HW7 A;  5DEC A;  5EC2 C;  4I0X A;  1YSC A;  3SJB C;  3RYF B;  3CX5 F;  3ABT A;  2YIB A;  3STZ C;  3A8T A;  2Q8V A;  4MW8 A;  2Y0I A;  4X66 B;  3RYF A;  1TUB B;  1K7D A;  5LGN A;  2XTA A;  3F5W C;  4LF7 B;  1TUB A;  1KC8 W;  3ZIA G;  1YVW A;  3CRC A;  5LA6 B;  1B3Q A;  2YIC A;  2KG7 B;  1XDC A;  3N2K B;  1TA8 A;  2FML A;  1SET A;  3HKE B;  5LA6 A;  2KG7 A;  3N2K A;  1Q6U A;  1N32 O;  3HKE A;  1VQM V;  1KP2 A;  3CSX A;  1HR0 O;  1OCC C;  1CEZ A;  4EEQ A;  2Z0A A;  2RNB A;  5LHI A;  1DF5 A;  1EFR G;  5LMU B;  1I94 B;  1OZ0 A;  4HAM A;  1JJO A;  2IJK A;  1FFX B;  4FLY A;  2EIN C;  3JD0 A;  1YEW A;  3J7A U;  1E79 G;  5LYJ B;  2F4V B;  3ZMU A;  2JS3 A;  1FFX A;  4DRX B;  1AP6 A;  1WA8 B;  2NNU A;  4JTD B;  3STL C;  4DV6 O;  5L3F A;  2P22 C;  4O4H B;  5LYJ A;  2JJ1 G;  4H33 A;  4GKJ O;  3H1K H;  4PA3 A;  1KD1 W;  1NBM G;  4DRX A;  1GN3 A;  1WA8 A;  4O4H A;  1KP3 A;  1G4Y B;  1BZK A;  4UVC A;  3W7T A;  4H44 B;  4X65 O;  2QWN B;  2YXY A;  1NT2 B;  5FPR A;  1XOU A;  4JI6 O;  3ZMT A;  2XAS A;  4CS2 A;  4FLT A;  3ICX A;  4W4L A;  3W7W A;  3SJQ C;  3ZMZ A;  5ITZ B;  1JPX A;  5KA6 A;  2ZDI C;  1K34 A;  5ITZ A;  2UUA B;  4BIO A;  1IBL O;  2QSA A;  1VIB A;  1FXV A;  1AIL A;  4X8A A;  1YJ9 V;  4K8Z A;  4DV1 O;  4NXN O;  3GWO A;  1OCR B;  3U10 A;  1QQC A;  1H2L A;  1VQ8 V;  2DYS B;  4IL6 Z;  1NVP B;  4LFB O;  4XBF A;  1Z5W A;  4JI0 O;  3TK1 A;  3OW2 U;  3K04 A;  5L3E A;  4WFH A;  5BR8 B;  1YZB A;  1NZ6 A;  3FKS G;  5JJJ B;  4QIW F;  2UXB B;  3SPI A;  3KG2 A;  4UFZ A;  1K92 A;  1SQQ H;  4YIP A;  2E5L O;  2GHY A;  3ABK C;  1Y76 B;  3DXR B;  4UVA A;  3ZRW B;  3K5N A;  2PY5 A;  1KB9 F;  2P90 A;  1I5X A;  5CBG A;  3ASN C;  3F7Y C;  5L3G A;  2JGU A;  3E22 B;  1Y76 A;  3DXR A;  2OIE A;  4DO2 A;  1XUQ A;  1M57 B;  3ZRW A;  2Q4P A;  1RP3 B;  4TT3 G;  4GZR B;  4NVP A;  5CA0 B;  3SYP A;  3E22 A;  3AK1 A;  1RSO B;  3B40 A;  2UUC O;  2Q69 A;  5CA0 A;  3S3W A;  1AI5 A;  1RSO A;  1IX9 A;  1VEW A;  3SYO A;  4GLX A;  1YTF D;  2R72 A;  3K5L A;  5B1N A;  2B9Z A;  3CHX A;  3KCX A;  4PA6 A;  4X62 B;  4PDV A;  5CN0 A;  3DC5 A;  4LFC B;  1HNX O;  3T1C A;  2VWK A;  2PYL A;  4TV8 B;  1SES A;  3D8C A;  1PNK A;  3PN1 A;  4TV8 A;  5IE9 A;  1RPR A;  4F6R B;  1LUW A;  2Y4U A;  1XRE A;  1E1R G;  1H2G A;  4O2A B;  2E76 B;  1PD3 A;  2L35 A;  3ZED A;  4F4L A;  4F6R A;  5JCO C;  4DUY O;  1AB3 A;  4MTF A;  4DR1 B;  4O4L B;  4O2A A;  2ODM A;  2EJR A;  2EIN B;  3C3T A;  4O4L A;  3EFF K;  3K58 A;  2FKX A;  2AHY A;  2CK3 G;  4B3R B;  4DR5 B;  3GWK C;  5J2U B;  4PDL A;  1L1F A;  3T4D A;  5J2U A;  2QM8 A;  4HBN A;  1GH6 A;  4KFM A;  3OMN B;  2LO1 A;  4N23 A;  2P67 A;  2R9I A;  4ABM A;  4LCU C;  1MZE A;  1VF5 B;  4DV0 O;  3AK2 A;  4TOI A;  3KZI Z;  1SQV H;  2ZDI A;  3IAY A;  4N21 A;  3HKC B;  5JWP A;  1NJI W;  2VWJ A;  3CPW U;  1F7Y A;  5EBM C;  3HKC A;  2HEP A;  4JI1 B;  3SGI A;  1KUQ A;  1JQ0 A;  1SQF A;  4MTG A;  4DXW A;  3GB7 C;  1V55 C;  4DV3 O;  5E79 Z;  4DR2 O;  4GX0 A;  1FYJ A;  3JSN A;  1DF4 A;  2AZ2 A;  4IT5 A;  4PDR A;  3H9V A;  3O9O A;  1R1B A;  1KU9 A;  1VQ5 V;  3ABK B;  1VAR A;  3M8A A;  4J80 A;  4DUZ O;  2ZIN A;  1VQO V;  4B08 A;  5C93 A;  1NH2 D;  3AK3 A;  4FM0 A;  5KHG A;  5LP6 C;  2ITD C;  2L6L A;  3ZRS A;  5GTH Z;  2ZCE A;  4I50 B;  4ICG A;  4FLZ A;  2OCC C;  3J81 N;  2QTO A;  1XL4 A;  1G6U A;  4PA7 A;  4I50 A;  3KKY A;  5EIB C;  4ZBM A;  3FB8 C;  5BMV B;  1Y4M A;  4KHP B;  1N34 O;  2ZM6 O;  5BMV A;  4J7K A;  5KAF Z;  3VBB A;  5B1B C;  4DW0 A;  1S0V A;  4KP4 A;  1J95 A;  3IJ4 A;  1SKV A;  1XEQ A;  2F43 G;  4WCE V;  1TAE A;  4O4I B;  2XAQ A;  3UCS C;  2UXC B;  3L75 H;  4O4I A;  4LH6 A;  5JVD B;  3CCR V;  4FM2 A;  2AZ0 A;  4RUF A;  1AR5 A;  4YHH B;  4JV5 O;  4MVS A;  4I7Z B;  5JVD A;  4UCS A;  2LGW A;  1FJG B;  1K5S A;  3HKD B;  3E2E A;  2H3O A;  3EHB B;  5L3B A;  4D6T H;  1WB7 A;  2JEX A;  2RN9 A;  3HKD A;  4I55 B;  4JI4 B;  3VQV A;  1M93 A;  1DK1 A;  4K0K O;  1HNZ O;  5IWA B;  4YIO A;  1N8R W;  1MA1 A;  4I55 A;  4X1I B;  1AJQ A;  3CCQ V;  1EN4 A;  5CA3 A;  5CMU A;  3I5D A;  1Z2G A;  3AG2 B;  4LWS B;  4X1I A;  2D2C B;  3QO5 A;  3T4Z A;  5HFL A;  4LWS A;  1U96 A;  2ZQM A;  3P3P A;  3OGI B;  1WPX A;  3SYA A;  1XIL A;  5EZY B;  2IJJ A;  4MVU A;  3D36 C;  5EZY A;  3RYI B;  1SF9 A;  4ZOL B;  1BCC H;  3RYI A;  4ZOL A;  3ZHU A;  1V55 B;  2CUG A;  2CTW A;  2WA3 A;  1HNW B;  5IJ0 B;  1O9G A;  1EBO A;  1FPO A;  3OR7 C;  4CH4 A;  3OEH G;  3T1Y O;  5IJ0 A;  3QTC A;  3ZMV A;  1YIT V;  4RWU A;  3CCM V;  1VQP V;  1EZV H;  3B8M A;  4KXR A;  4EKW A;  2W6J G;  1BHB A;  5DM6 V;  4DR4 O;  5KX5 B;  4DR3 O;  5LP6 B;  1K97 A;  1Q7Y W;  1I7F A;  4DV5 B;  5KX5 A;  2ZE6 A;  4C7U A;  5EYP B;  1X4T A;  4G28 B;  5LP6 A;  2OCC B;  1B04 A;  2LW1 A;  4DYL A;  1PNM A;  3ZN0 A;  3J80 N;  3E8F A;  5EYP A;  2YXL A;  3FYE B;  2YEV B;  4LF9 O;  4LFA B;  3MAQ A;  1IDS A;  3JAM N;  2YEV A;  5B1B B;  3CC7 V;  1IXB A;  3ASO C;  1Q81 W;  2A06 H;  2PGG A;  3CCV V;  3ZHS A;  3HR0 A;  2JIZ G;  1BS3 A;  2RCV A;  3WG7 C;  4JYY A;  2BTO A;  1XNQ B;  2OT5 A;  3C3S A;  1D2D A;  1P7B A;  4P9P A;  3K57 A;  4LF8 B;  1H2M A;  3B77 A;  4CH3 A;  3LDE A;  1PL4 A;  3ZS8 C;  2HHH B;  1NTM H;  2EIJ B;  3OD4 A;  1WN7 A;  5KUK A;  2YUA A;  1AI6 A;  1W0K G;  4JTA B;  3ABL C;  1S76 D;  5EBW C;  1WLE A;  1N36 B;  2RJZ A;  2ZXW C;  1K33 A;  4J42 A;  5LHG A;  3OEE G;  4JYA O;  3F5T A;  2ZNI A;  2R9R B;  4OPA A;  2V4D A;  1B6Q A;  5L3D A;  4EFE A;  1NI8 A;  3BAB A;  5B3S C;  4YJ3 B;  3OAA G;  1Y74 B;  2CTP A;  4DV4 O;  3CE2 A;  3SR2 C;  1SZT A;  3DTU B;  3WU2 Z;  4YJ3 A;  4ZIB A;  1Y74 A;  2VQE O;  3H1I H;  4DW1 A;  2VRZ A;  4NXM B;  1V9P A;  3D36 A;  1TGO A;  2YI8 A;  4L87 A;  4LF5 B;  4PD4 F;  1BL8 A;  2KKW A;  2FTK A;  1K3E A;  4I9Q A;  2LFS A;  2HJF C;  4DR6 O;  2UU9 O;  2XAH A;  3N2G B;  4MVO A;  2CAZ C;  4J7J A;  5IY5 B;  3ZHT A;  3N2G A;  3T1H O;  3CC4 V;  2BTQ B;  4O2B B;  4LF4 B;  1WB8 A;  3FYI B;  4BIZ A;  4MVR A;  1JA8 A;  4FIP C;  2DYR C;  3ZCC A;  2BTQ A;  4O2B A;  3UM7 A;  4YY3 O;  3A0H Z;  1FXK C;  1GN4 A;  3SPJ A;  4JGS A;  2M6Y A;  4MW3 A;  4LF6 O;  1Z5V A;  1BGY H;  2R9A A;  3I56 V;  2V1D A;  1WPB A;  3JCZ A;  5LBQ A;  4IHJ B;  4X66 O;  2VQF B;  1E1Q G;  1PPJ H;  5DED A;  1R3I C;  3LSS A;  4DV2 O;  2Q9L A;  3ASO B;  4IHJ A;  2EX3 A;  4LF7 O;  5IJ9 B;  1BE3 H;  5LXT B;  2EIL C;  2RQ6 A;  1SC5 B;  4Q20 A;  1Q82 W;  4BWA A;  4ZI7 B;  4NB5 A;  5IJ9 A;  2B5U A;  5LXT A;  1M4U A;  3FB6 C;  3WG7 B;  2ADQ B;  2WLI B;  4ZI7 A;  4NXN B;  5H6Q A;  1H8E G;  4TV9 B;  4CBC A;  2OWO A;  2WLI A;  3K03 A;  4TV9 A;  2AXT Z;  4LFB B;  2ZD9 A;  3K59 A;  2QE7 G;  1X59 A;  5LGT A;  5LMU O;  1ENV A;  1FXH A;  4RUE A;  1I94 O;  2Q73 A;  4X20 B;  1R3K C;  3ETQ A;  2PF4 E;  1AJN A;  2Y0P A;  1R6T A;  5KHH A;  3CEI A;  1Q86 W;  3SPC A;  3UT5 B;  3SPH A;  2LFR A;  3ABL B;  4NTX A;  4X20 A;  4BAY A;  2F4V O;  3MD0 A;  1YXB A;  2CGO A;  1VP7 A;  4IYH A;  2NN4 A;  2XUM A;  2ZXW B;  3UT5 A;  3CS5 A;  3IGA C;  4QPJ A;  3NR7 A;  5K1P A;  1M1K W;  4CH5 A;  3OTO O;  4E2L A;  5B3S B;  2AGA A;  1LUV A;  1RM1 C;  1EN5 A;  2QM7 A;  4XDJ A;  2ZE8 A;  2QWO B;  2Q5Z A;  4X89 A;  3SJC C;  3CRA A;  1MMM A;  2DOS A;  5KHI A;  3A0R A;  1IXM A;  2BCC H;  3OM3 B;  3EXA A;  3K08 A;  3EVK A;  2ILM A;  1PNL A;  3CRQ A;  2WWW A;  2XAJ A;  5B5E Z;  1ROP A; 
#chains in the Genus database with same CATH homology
 2DE0 X;  4LWS B;  3GWK C;  2KG7 A;  3FAV A;  2AZ2 A;  2VS0 A;  3O9O A;  4LWS A;  1WA8 B;  3GVM A;  3ZBH A;  3TXQ A;  4GZR B;  3Q4H B;  2B9Z A;  3TXS A;  3OGI B;  4I0X B;  3G80 A;  1WA8 A;  2VRZ A;  3Q4H A;  2AZ0 A;  3FD9 A;  2KG7 B;  3HR0 A;  3FAV B;  4I0X A;  4ABM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...