4I0XA

Crystal structure of the mycobacterum abscessus esxef (mab_3112-mab_3113) complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
75
structure length
75
Chain Sequence
DEVGALSKFAASLADQMRAGSNSLDRDVQSLFGVWKGSAADAYRSGWDEMQDGATKVWNALTDIASTLGSNAAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESAT-6-like protein MAB_3112
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Structural genomics, unknown function
total genus 30
structure length 75
sequence length 75
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2012-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4i0xA00
2VS0A 2VRZA 3FAVA 2AZ0A 3TXSA 3Q4HA 3FAVB 3HR0A 4ABMA 2KG7A 3Q4HB 2DE0X 4LWSA 2KG7B 3G80A 3GVMA 1WA8A 4LWSB 2AZ2A 4I0XA 3GWKC 1WA8B 4GZRB 4I0XB 2B9ZA 3OGIB 3ZBHA 3O9OA 3FD9A 3TXQA
chains in the Genus database with same CATH superfamily
1QVFU 4PI0A 2A06H 4YJ3A 4X66O 4LFAO 3OR7C 4O4HA 4LF7B 4X62B 4LF9O 2DWEC 1S3JA 4JI5B 1Y76A 4J11A 2XAQA 3SDLA 2GTSA 4WFHA 3CRRA 4X66B 4LFAB 4OPAA 4LF9B 1KECA 3STLC 1GK9A 4O2AB 4DUYB 1GTOA 3L74H 5CA3A 2QDOA 4DR5B 2XASA 3CCQV 4JI2B 2Q69A 3H1IH 4Z2WA 1N8RW 3KZIZ 3ZRWA 1YEWA 3T4ZA 2JJ2G 5LXTB 3K58A 1CPYA 2O57A 1S72V 2WA3A 4E4EA 1RSOA 4FLZA 2QWOB 2QE7G 5L3FA 3CEIA 3K57A 4WFBV 4LFCO 3JARA 3VBBA 1Q82W 4PA7A 1AP5A 1Y6XA 3JAWA 1WNSA 3BVOA 5LMUB 5D5PA 4EKWA 1OCRB 2W0FC 3HR0A 4LFCB 1M57B 2ZE6A 4HNAA 4JV5O 3JAMN 4Q20A 3E8BA 1VQ8V 5F2VO 1D5AA 2K1EA 1JFFA 2ODMA 4NB5A 5KHHA 4FM2A 3UT5B 4I9WA 2WLHA 4IIJA 4D6TH 2QA4V 2JGDA 1Y74B 1NI8A 1SF9A 3JATA 4UCTA 2QM8A 1TGOA 1FXKC 1KP3A 4PA4A 1FPOA 4JYBA 3UO3A 3G6EV 4PDMA 1BL8A 2CTWA 1AI6A 2ZIOA 3T1HB 3ABKB 1M4UA 3DXRB 4I0XB 4U3JB 2OCCC 3ZJZA 2YUAA 1VF7A 2Y4UA 3K5OA 3OW2U 1XREA 4LFBO 1BZKA 1GN4A 2QWNB 2ZQMA 1YI2V 2AGAA 3T1YO 5TISZ 3RYHB 2YIBA 4LFBB 5JJEB 4ZHQA 3AK2A 5LYJA 3P32A 1MSDA 1R3JC 2A7WA 2DOSA 3JCUZ 2LGQA 4TQFA 3ABMC 5BMVA 4UV8A 5LP6C 1YTFD 2OIGA 3AK1A 4RUEA 1G4YB 3H01A 1ENVA 5LHHA 1K34A 1Q6IA 4LF4O 3G71V 4UCUA 1ZAUA 3J81N 3WB2A 1WA8A 4KP4A 3UKMA 2V7QG 1NH2D 1RM1C 4LBEC 2ZDIA 1VARA 2YIDA 4DV3O 2EINC 1FYJA 1QQCA 3AEIA 3ZHVA 1Q6UA 1Y4MA 3CC7V 1AI7A 3TJTA 4AQYB 2X7RB 4XDLA 3E22A 3CCMV 4FLUA 1H2KA 4FFBA 4Q6GA 4MVSA 1KUQA 5EIBD 3CCEV 1I94O 3GWKC 1IXMA 4B3SO 3K5NA 3BA8A 3AK3A 5JVDB 2PTMA 2E76B 2OT5A 1VQ4V 2P6JA 2EIKB 2YDEA 3SJAC 2Y48A 1I94B 3E2EA 1WLEA 2BSKA 2CH7B 4B3SB 1XMQO 2ADPA 5FL7G 4UB8Z 5IJ0A 2F66C 1KKDA 2A0LA 5IYZB 1COWG 1BCCH 4CH5A 2AZ2A 3N2KA 3ZMUA 4PD4F 3JAKB 4WF9V 1XMQB 4N21A 4JYCA 4JI1B 2PI4A 5L3CA 4YY3B 4H44B 1YTFB 1YDXA 1P4RA 3SYPA 3T2MA 4CC5A 1NTMH 3A0HZ 4MSWC 4ZKIA 1S76D 2W0XA 4DRXA 4UUJC 1P7GA 2GUZB 3AG2B 2JDIG 4EFBA 4GZRB 1WN7A 5FLXN 2QM4A 3R66A 1EZVH 1RFYA 3BPZA 4RWUA 3K9AA 1SS3A 1F4MA 4ZIBA 2X6AA 3K04A 2RJZA 1JOYA 1SQFA 3SR2C 3IFXA 5KA5A 1H8EG 5BY1A 2LO1A 4DR1O 2LW7A 2XUMA 5C93A 3ZHSA 5D5QA 3CC2V 1KKCA 3AG1C 1H2LA 2ZE8A 1URFA 4FLYA 4ZI7B 1HNZB 2JEXA 2K9PA 5KA6A 4IYIA 4K8ZA 3F5TA 1MZEA 4D7TA 4JAAA 5CA1B 2FTKA 1LUVA 1H2SB 3UM7A 1AI4A 1O9HA 1VF6C 4KL1A 4YJ2B 4GX5A 1EN6A 2HVKC 3U11A 3L73H 5LXTA 1BQ0A 5K1XA 2ATKC 5EZYA 2DWDC 4X8AA 1PV0A 2DYSB 3IAYA 3CE2A 5LGNA 1XDCA 5IWAO 1DGSA 1LNQA 5B1BB 2F93B 4K35A 4FVMA 2WA4A 5L3EA 3J7AU 4DR7B 3K9SA 3C3TA 5LHIA 4H0LB 4WFAV 1ROPA 1EBOA 1Z5WA 2E74B 1Y74A 1B06A 3U10A 2ZKOA 1VQPV 2Y4TA 4X20B 1K7DA 4FIPC 1WPBA 4JYYA 2W6JG 4GKKO 2RCVA 4J7ZA 2QTSA 5L3BA 3HKEB 3DXRA 4U3JA 4DR6O 1ZX3A 4IL6Z 2X6CA 5IDJA 1VMGA 4DW0A 4O4LB 3L75H 1NU1H 4MTGA 2ZNJA 1JCHA 3ZEDA 3CP1A 3RYHA 1CEZA 4O4JA 4G2KA 4MVUA 2JEUA 4QNHB 3CMEV 1ORQC 2QSAA 5ITZB 1ZWIC 5LOVB 2UXXA 3RVZA 1QLNA 1US6A 4YHHB 2F23A 5CMUA 4DV6O 3OTOB 3P3PA 3APQA 5B3SC 2LFSA 2IW5A 2OWOA 4H13B 4BR6A 5LHGA 4I5SA 3ZX6A 2DYRB 2IM9A 3CPWU 4MVMA 3JD3A 4F6RB 3SGIA 4I4TB 3ZMVA 1ZL8B 2QEXV 4Z1MG 3JALB 5J2TB 1E1QG 3W7TA 2UXBO 1VP7A 4JI4B 1Q86W 1Z2GA 2KB1A 2KG7B 2XAGA 5JVDA 5BZBA 4DR3B 4LH6A 1H2NA 4UV9A 4HYOA 2UXBB 2Q0OC 4MVRA 1PM9A 4B7EA 2CH7A 3ZMTA 3WFVA 1R73A 1NZ6A 2P22C 2QKAA 3CCJV 5JWPA 2VQEO 2ARHA 1MNGA 2YICA 1K97A 4HZ3A 2Q7EA 5LMNO 5IYZA 5H6RA 1I7FA 3JAKA 3O65A 3E86A 1PP9H 2FKXA 1K92A 3JYCA 2JK5C 3CJHB 4UCSA 2WLIB 4A5UB 2UXDO 3B4SA 1VQ6V 4BAYA 1AROP 2WLJA 3PN1A 2UUAO 2ZCEA 4JYAO 3RYFB 1FD9A 2HHHO 3MAQA 1FJGO 1GAXA 2GHYA 2F1MA 2YIAA 3WU2Z 2GUZA 1VEWA 4UCRA 2WSSG 1M90W 2UUAB 1OJHA 1SC5B 2W6IG 4JI0B 1OCZB 1AJQA 4FM0A 1PD3A 2GDSA 4LF6O 2UU9O 1THZA 2OIEA 4W4LA 5GW7A 2IH1C 1U96A 2M6YA 2KKWA 4BW5A 2CDYA 2ZDIC 1NT2B 4B7KA 3ZHUA 1Q90D 2DQ0A 5B5EZ 4IGGA 2Y69C 4QPJA 3A0BZ 1L0LH 4DK1A 4DV1O 2Z3YA 1VF5B 5EBMC 1GMGA 2XHBA 2NR5A 3WG7B 4ZI7A 2VRZA 2PY5A 5GONB 3L9DA 1PPJH 1OCCC 5CA1A 3OGCC 3ETQA 1IBMB 3H1LH 1XBLA 4GUNA 1F51A 1Y67A 2YS8A 1JQ0A 3CSXA 5KMGB 4YJ2A 2N74A 2ZXWC 1WAZA 4KFMA 3T4DA 3VQWA 1ZLZA 3D36A 4ZOLB 4MW3A 4DUYO 2Q68A 3FB6C 4DR5O 3G80A 4JI2O 1XL4A 5IYDO 3OAAG 4HBNA 2PF4E 5EC1C 3SPJA 3K0DA 1XEQA 3FD9A 1S5LZ 3RFRA 1KU9A 1KQSU 1BGYH 2WPDG 4H37A 4X65B 3B8NA 2OTLV 3OFNG 4UCOA 5LGUA 3FB5C 3L72H 1XMOB 1YHQV 5CA0B 5A2QN 2EJRA 4UB6Z 1WP8A 3DC6A 5LMUO 2HP8A 4L87A 5HFLA 1QLEC 1AB3A 1PL4A 2Y0IA 1AR5A 4JI3B 1GRJA 2CTPA 3ABLC 1FXKB 3RWRD 3RYCB 2XOKG 4X20A 2IJKA 4XDKA 3DC5A 3B8MA 4DR4B 1XI1A 1GN6A 4JTAB 3HKEA 1K4DC 1Q8IA 3RN4A 4BIOA 4IT5A 4WFGA 2HJFC 2QR4A 4UVAA 3D3QA 1WJZA 2B1GA 1N36B 4O4LA 3T1HO 1RPRA 2E5LB 1R3IC 4X1IB 4FLVA 4B3MB 2P4VA 1H8HG 2P4KA 2VWJA 3JSNA 2ZIMA 3JCZA 4P9PA 4JASA 2HVJC 4HAMA 2WAMA 5ITZA 4PI2A 4TWKA 5LOVA 5LA6B 4X89A 5KAIZ 1FS0G 2ZNIA 4JI6B 2FMLA 3N27A 1TVKB 4O2BB 2YXHA 3P3NA 1RM1B 3CMAV 3E89A 2QKSA 1I5YA 4MT8A 4F6RA 1B04A 4GCZA 4I4TA 1YJWV 1ZL8A 3UCSC 2E3CA 2M7WA 4QE9A 2ITDC 3JALA 5J2TA 2D3OW 2QJ1A 2KG7A 5HFMA 1B3QA 5BR8B 1VQMV 2FL4A 2JJ1G 1XOUA 4PV1B 3CWBH 3ML0A 3OGIB 3ABKC 4AQYO 2ILMA 1VQOV 1W0JG 1ZSPA 1DLBA 2EIJC 1X59A 1ZUQA 1XILA 2HG5C 1XHXA 3HKBB 3CXCU 4CS3A 1VIBA 5DEDA 3K03A 1KB9F 3CX5F 4MW8A 2VWKA 2EZPA 3CJHA 2WLIA 4NTXA 1J5EO 3BEHA 4OPHA 3RYFA 4KHPB 4ASUG 2R72A 4DV7B 3LSSA 3AG3B 3W7WA 3T1CA 1BMFG 2AHYA 4PELA 2PUSA 3ASNC 3P30A 1EN5A 1J5EB 1L0NH 2Z0AA 2CGOA 2ETNA 3JASB 4JI1O 4YXWG 1Q81W 4YY3O 3VQVA 3ABUA 1DF5A 4I50B 4FK5C 2OCHA 1E79G 1FAFA 2CTRA 4RO2A 2YI9A 4AHCA 4BIUA 2GBOA 1FKAO 4CH4A 1JPXA 4JI7B 4Z1VA 1NTKH 4N23A 4J10A 3AG1B 1CXZB 4X1YA 1NH2B 4GYCB 1PL0A 1I08A 3I55V 1TUBB 1S5HC 1M1KW 3M8AA 5GONA 3TGUH 1KC8W 2ZINA 2EIKC 1KBHA 1SERA 2B5UA 3THOA 2BTOA 2ZT9B 1XL6A 1N0JA 4DW1A 3QTCA 1TUEB 2F4VB 3CB2A 4U3FH 3ASOC 1HNZO 5CBFA 4DYLA 1VQ5V 2EILB 1R1BA 4TV9B 3TXQA 1HNXB 4BIZA 4ZOLA 1BQZA 1M56C 4O4IB 2RMKB 1N0NA 2H8PC 3SYOA 3G67A 5EYPB 1LUWA 3K5MA 4J41A 4YIOA 3RYIB 3K59A 4IHJB 1GH6A 1SQXH 4O2AA 1JJOA 1Q6HA 4KUMA 1YXBA 5GTIZ 2WLLB 3E8HA 2VQFB 1VQLV 3O9OA 4FMTA 2HR3A 1V9PA 3L71H 2P90A 2QKCA 3EFFK 4GT1A 1KYOF 4LC1A 2GTAA 2Q6AA 5CA0A 2XAFA 2HEPA 3ZN1A 3F7VC 2P67A 1FXVA 4XBFA 4K8XA 5DN6G 4WFFA 3X2QC 1G6UA 4DR7O 1DF4A 1FXKA 4WCEV 4FJCC 3RYCA 3AG4B 1YVWA 4C7UA 2UXCB 3DGEA 5IY5B 3K5LA 2GV9A 3A8TA 1HNWB 1IDSA 4JZ2A 2JS3A 4QJFB 3LSQA 2H3OA 1B6QA 1RPOA 3UT5A 2HJDA 4JI8B 5IE9A 5L3GA 2ZE7A 4BWAA 2LJ2A 2RDCA 3HKCB 2L6LA 5JH7B 3J80N 3K06A 5H2FZ 3CCVV 4MS2A 1QCEA 4B3RO 1GM7A 4EB6B 3W7XA 1D5NA 3AG7A 5LGTA 1DTOA 3BRCA 2A79B 4PA6A 3ICXA 5IT9N 2L35A 4B3RB 2Q5ZA 4NXNB 4I0XA 4FZ1A 1RSOB 1VQKV 2DYSC 1YITV 2YIBD 5LA6A 4TV8B 3WB0A 4DV0B 1BSMA 2Q8VA 3OE7G 5B1BC 1TVKA 4O2BA 3FYIB 2R70A 1VQ7V 5CN0A 1WB8A 1OCOC 2ZR2A 2XAHA 1EZJA 3B09A 4LWSB 3R65A 2UXNA 3ZN0A 1NJIW 3OTFA 1QBZA 1YF2A 4YHHO 1AI5A 3OTOO 3H1JH 1M93A 4X88A 1JMKC 5KX5B 2QTOA 1XUQA 2IBZH 2X6BA 4GKJB 1FFXB 1H38A 4K0KB 5JJNB 2FB5A 2AXTZ 2UUCB 1SA0B 5JJJB 4F4LA 1NVPD 5KHJA 5KHIA 4JI4O 4LF5B 2IU3A 1K4CC 2Q7GA 1IBKB 5B1AB 3B2EE 1XNQB 1N32O 3HKBA 3BAAA 4DR3O 1G1XB 1V55B 2ZE5A 4GX2A 1S0VA 1GN3A 3OEHG 1K5QA 3QNEA 1AVMA 1W2BU 1N32B 1R3LC 2XAJA 3HB3B 4QE7A 4X9QA 1F23A 1BHAA 4J42A 4J7KA 1Q5OA 3FKSG 1IURA 3TCUA 4H33A 5BMVB 1NKDA 3H1HH 3MHSC 1N34B 3ZS8C 4CBCA 4TQDA 3JASA 1K33A 2EIMB 2DMXA 2KQXA 2Q9LA 2CGNA 5KHGA 4I50A 3LNMB 4JZGA 5IJ9B 5FPRA 3QG5A 3IC7A 4JI0O 2LGWA 3MD0A 1V54B 4UVCA 1K73W 5B1OA 2NLJC 3Q4HB 2ZR3A 2LW1A 3M7MX 2QM7A 4TSFG 5E79Z 1TUBA 4LP8A 1AILA 2YC0A 4R7CA 4NXMO 4AILC 3ZMZA 3L70H 3FB8C 1BS3A 5C8YB 5E1AC 1HW7A 2H94A 4MTOA 4NTWA 2HLDG 4MVZA 4NXMB 1OHHG 3ZRVA 2WLKA 3KKYA 2C2AA 3QO8A 1NBMG 1VF6A 1XQ8A 4TV9A 2ZXWB 1PNKA 4MTXA 1EFRG 4U7NA 1GN2A 4LNUB 1H2MA 2VS0A 4O4IA 1WB7A 3FX7A 5JCOA 1IBMO 1BHBA 1R6TA 3CHXA 5EYPA 2N04A 3SPCA 2JRIA 3RYIA 1KMIZ 4IHJA 4PA9A 2IU0A 3CCSV 4DUZO 1I5XA 2WLLA 4DV2B 1OCZC 3PJSK 2BOBC 2UUBB 2AZ0A 1MA1A 4DUZB 1FXHA 1L8DA 2R9AA 4FLTA 1JJ2U 4X64B 1AJNA 1XHZA 1MG1A 2PZSA 1WP7A 1UPGA 2BTQB 3ETGA 4X65O 3CCRV 1HR0O 2KSDA 1MMMA 1XMOO 3C3SA 3K08A 3LNNA 4JTDB 3OEEG 1VQ9V 4JF3A 2RQ6A 3IJ4A 5J2UB 3FYEB 3WG7C 1MABG 3BABA 1XNRO 1ZTEA 5KHKA 3FAVB 5KUMA 1K5SA 1HR0B 5KLVH 4L8JA 4P30A 4JI3O 2Q4PA 2PYLA 1XNRB 4GX1A 3HKCA 3S3XA 5JH7A 4DR4O 2CTQA 1W0KG 4EB6A 3I56V 2P7TC 1IX9A 3BCCH 3BA9A 4P2ZA 1M5IA 3F5WC 3OR6C 1CP9A 1IVSA 2B1IA 5EZYB 3CCLV 1Q3EA 1N36O 3RW0A 2OCCB 4B08A 1T5EA 2E5LO 4ZBMA 4B3MO 4MVQA 4TV8A 5KAFZ 1Z5VA 3CYOA 3B77A 2YEVB 2DQ3A 3C90A 1NR1A 3D3IA 4LWSA 4PA3A 4PDVA 3DSQA 2HKOA 4U7OA 3APOA 3SJQC 1AP6A 3JD2A 4JI6O 3LDCA 3ABMB 5H6QA 4RQEA 5LP6B 2YI8A 5CBHA 4JV5B 5FNVB 5KX5A 3H9VA 4CS4A 3G4SV 2NN4A 1P84F 5EBLC 1FFXA 3SPIA 1OCRC 2CE4A 2LP7A 1AR1B 3SPHA 1SA0A 2LFRA 1M57C 1Y66A 3E83A 3LUTB 1S5JA 3I5DA 2EINB 2V1DA 1QHTA 3OMNB 2EIJB 4DK0A 2X0LA 4OGQB 4YIPA 1LR1A 5BR8O 4QGPA 1KD1W 3IGAC 5B66Z 4J9YB 4K3AA 4QIWF 2EBOA 1R3KC 3E8GA 4PDRA 4I55B 3GVMA 1QR9A 3ETEA 5DECA 4O4JB 5EC2C 2AHZA 1S77D 1PKXA 3K0GA 1GKFA 2Z5UA 2EULA 3ZRSA 3ASNB 5IYBO 3T1YB 1BT8A 1X4TA 1NTZH 2Q0AA 4WBNB 1O9GA 2ZM6O 1A32A 1SZTA 4KHPO 4DV7O 2DN9A 3ZRXA 5IJ9A 5EK0A 4LF4B 2ZM6B 5KUKA 2CAZC 3MDSA 3Q4HA 2XT9A 4DV3B 4J9ZB 3RBZA 5J9PC 1SRYA 2ZD9A 2XTAA 1E1RG 1AJPA 3OT7A 3SYQA 2EZOA 3LDEA 4FFKA 4TUYB 1DK1A 3K79A 1SETA 3A2FA 1BE3H 3ZBHA 5C8YA 3NR7A 1SESA 3TETA 2BCCH 4JI7O 2NNUA 4CZZA 3RGBA 3IC9A 3GB7C 1MZFA 2QWRB 3ASOB 1G8MA 5LL6Y 4AI8A 3OMAB 2RN9A 5CB4B 3JD1A 2JGUA 3N2GB 3W7SA 4JAUA 4LNUA 1M56B 1OZ0A 2BE3A 2ADQB 1M9NA 2IJIA 4I9QA 2F4VO 2Q73A 3AG3C 2D2CB 4RQFA 1N4CA 3OUFA 1IBLO 1HNXO 4R8CA 4TOIA 3CRAA 2JVDA 1HP8A 3HKDB 5KMGA 1YZBA 2YXLA 1GO3F 1IBLB 2OYQA 4CH6A 3F7YC 3QO5A 4DV4O 2VQFO 3ZHTA 3X2QB 2BTQA 2A3QA 3LDDA 1QNMA 2AW9A 3QF7A 4JAVA 4UXNA 3E8FA 2CUGA 3SJBC 3CRCA 1AR4A 4DV4B 3AG2C 2JS5A 3BY6A 4JPRA 1HDJA 5J2UA 4DR1B 3VOUA 3FAVA 2BOCC 2Q67A 1EM1A 3CC4V 4E2LA 2OTJV 4GX0A 5IYCO 4TT3G 4W4KA 4X1KB 2ITCC 3LSUA 4J80A 5H9CA 3STZC 4J7JA 4G28B 4WFEA 1TAEA 2UXCO 2WWWA 4NVPA 1N33O 2R9RB 1NR7A 1RP3B 5EIBC 3CRMA 4QPKA 5JQGB 1SKVA 1SQQH 1HNWO 3ZHRA 2EILC 4PDLA 1N33B 1P7BA 4YJ3B 4LF8O 2MW2B 4O4HB 4JI8O 1Y76B 3OD4A 5JCOC 1VQNV 5K1PA 3SPGA 4EEQA 3EHBB 4LF8B 1WPXA 5L3DA 3DTUB 2Y0PA 1QR8A 1QVGU 1K9MW 2YXYA 4D7SA 1R6NA 4FM1A 4X1IA 4GLXA 4OX9O 3KG2A 2E75B 2YEVA 3MHHC 4DO2A 5LBQA 1OCOB 4NXNO 3ABTA 2F43G 1K3EA 3ZRWB 1GM8A 4B3TO 5IWAB 3OUSA 4DV0O 4NR1A 4NYKA 4OX9B 3D36C 3U0ZA 1F4NA 5LP6A 1UJWB 3VQXA 4RAIA 4CS2A 5FNVA 4B3TB 3ZIAG 3JARB 4XDJA 2IH3C 1MOFA 3JAWB 3AG4C 3GWOA 4CH3A 3VQYA 4OXSA 5B3SB 4ABMA 2DW4A 1HWYA 5IY5C 4PHZA 1Q43A 1R6KA 1D2DA 2XNDG 4HNAB 1YJ9V 3ZMSA 4RUFA 1JFFB 3CCUV 3CS5A 4GKKB 4GKJO 4CC6A 3RVYA 4IIJB 4K0KO 3JD0A 1J95A 2IJHA 2JGDB 2UUCO 4DR6B 3UO2A 1PNLA 3JATB 4EFEA 4DR2O 2EJ7A 4I55A 2PGGA 2DE0X 4LF5O 2IJJA 4DV5O 3EVKA 4P9OA 3RT3C 1IBKO 1XNQO 4BW9A 5FPOA 2Q7HA 4DR2B 4ICGA 4FPPA 5AG2A 4MTFA 4LR3A 4DV5B 3BFRA 4WBNA 3A0RA 4LCUC 3K3WA 1NS1A 1UFIA 1SZXA 4DXWA 4FLXA 3TK1A 1N34O 1TA8A 3JSLA 4DV6B 2WLMA 1FFTB 4ZHQB 5LYJB 5H5NA 1L1FA 2A9HA 5GTHZ 4R6ZA 3QO7A 2LQTA 3FFQA 2P5OA 4FZ0A 4UCVA 2PI5A 4UFZA 4TUYA 3FB7C 3EXAA 1WA8B 2B9ZA 3UQ8A 2EX3A 2MK3A 3HPLC 2DYRC 2CK3G 1IXBA 1F7YA 3ZHQA 1JR9A 3S3WA 3SJCC 5B1AC 2Y69B 5CB4A 4NKGB 1JA8A 3N2GA 1V55C 3E22B 2V4DA 2N05A 3ZCCA 4FFBB 3W7UA 3NXSA 4LH7A 1I0HA 3KCYA 4JGSA 2DJVA 2VQEB 2HFEC 1NVPB 5LMNB 2YSUB 5BXZA 4KXRA 4NTYA 1MSWD 1SQBH 2G38A 2QWQB 4R50A 1YJNV 3E35A 4I7ZB 1P49A 1QU7A 2FYUH 3ETDA 3WB1A 1IZ3A 1OCCB 5CBGA 1PNMA 2BSKB 2UXDB 1SQGA 1SQVH 2JIZG 2EIMC 3JD4A 4JYAB 2QGNA 1OV9A 5IJ0B 3HKDA 2R9IA 2WLNA 1GM9A 2HHHB 2GSMB 1FJGB 3N2KB 4G27B 3CRQA 5A9GA 4PJ0Z 1KP2A 3M99B 1EN4A 3OMIB 4JTCB 3H1KH 4LF6B 4DV2O 3D8CA 2UU9B 1V54C 1YIJV 1W59A 2UUBO 3CXHF 5EBWC 1SQPH 4F6EA 4DRXB 5B1NA 3CD6V 3QVNA 4X1YB 2RNBA 1U97A 3OM3B 4X64O 1YSCA 2P06A 4UVBA 3BHPA 1JX9A 2QWPB 1K8AW 3SYAA 4DV1B 4IYHA 4FLWA 2PYJA 3TXSA 4X1KA 4MVOA 2F95B 3G6BA 1YCIA 3B40A 1NQTA 3SYCA 5DM6V 1H2GA 1Q7YW 1QLEB 4LF7O 4X62O 5JQGA 1JVMA 4JI5O 3KCXA 3ABLB
chains in the Genus database with same CATH topology
2VS0A 2VRZA 3FAVA 2AZ0A 3TXSA 3Q4HA 3FAVB 3HR0A 4ABMA 2KG7A 3Q4HB 2DE0X 4LWSA 2KG7B 3G80A 3GVMA 1WA8A 4LWSB 2AZ2A 4I0XA 3GWKC 1WA8B 4GZRB 4I0XB 2B9ZA 3OGIB 3ZBHA 3O9OA 3FD9A 3TXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VS0 A;  2VRZ A;  3FAV A;  2AZ0 A;  3TXS A;  3Q4H A;  3FAV B;  3HR0 A;  4ABM A;  2KG7 A;  3Q4H B;  2DE0 X;  4LWS A;  2KG7 B;  3G80 A;  3GVM A;  1WA8 A;  4LWS B;  2AZ2 A;  4I0X A;  3GWK C;  1WA8 B;  4GZR B;  4I0X B;  2B9Z A;  3OGI B;  3ZBH A;  3O9O A;  3FD9 A;  3TXQ A; 
#chains in the Genus database with same CATH topology
 1QVF U;  4PI0 A;  2A06 H;  4YJ3 A;  4X66 O;  4LFA O;  3OR7 C;  4O4H A;  4LF7 B;  4X62 B;  4LF9 O;  2DWE C;  1S3J A;  4JI5 B;  1Y76 A;  4J11 A;  2XAQ A;  3SDL A;  2GTS A;  4WFH A;  3CRR A;  4X66 B;  4LFA B;  4OPA A;  4LF9 B;  1KEC A;  3STL C;  1GK9 A;  4O2A B;  4DUY B;  1GTO A;  3L74 H;  5CA3 A;  2QDO A;  4DR5 B;  2XAS A;  3CCQ V;  4JI2 B;  2Q69 A;  3H1I H;  4Z2W A;  1N8R W;  3KZI Z;  3ZRW A;  1YEW A;  3T4Z A;  2JJ2 G;  5LXT B;  3K58 A;  1CPY A;  2O57 A;  1S72 V;  2WA3 A;  4E4E A;  1RSO A;  4FLZ A;  2QWO B;  2QE7 G;  5L3F A;  3CEI A;  3K57 A;  4WFB V;  4LFC O;  3JAR A;  3VBB A;  1Q82 W;  4PA7 A;  1AP5 A;  1Y6X A;  3JAW A;  1WNS A;  3BVO A;  5LMU B;  5D5P A;  4EKW A;  1OCR B;  2W0F C;  3HR0 A;  4LFC B;  1M57 B;  2ZE6 A;  4HNA A;  4JV5 O;  3JAM N;  4Q20 A;  3E8B A;  1VQ8 V;  5F2V O;  1D5A A;  2K1E A;  1JFF A;  2ODM A;  4NB5 A;  5KHH A;  4FM2 A;  3UT5 B;  4I9W A;  2WLH A;  4IIJ A;  4D6T H;  2QA4 V;  2JGD A;  1Y74 B;  1NI8 A;  1SF9 A;  3JAT A;  4UCT A;  2QM8 A;  1TGO A;  1FXK C;  1KP3 A;  4PA4 A;  1FPO A;  4JYB A;  3UO3 A;  3G6E V;  4PDM A;  1BL8 A;  2CTW A;  1AI6 A;  2ZIO A;  3T1H B;  3ABK B;  1M4U A;  3DXR B;  4I0X B;  4U3J B;  2OCC C;  3ZJZ A;  2YUA A;  1VF7 A;  2Y4U A;  3K5O A;  3OW2 U;  1XRE A;  4LFB O;  1BZK A;  1GN4 A;  2QWN B;  2ZQM A;  1YI2 V;  2AGA A;  3T1Y O;  5TIS Z;  3RYH B;  2YIB A;  4LFB B;  5JJE B;  4ZHQ A;  3AK2 A;  5LYJ A;  3P32 A;  1MSD A;  1R3J C;  2A7W A;  2DOS A;  3JCU Z;  2LGQ A;  4TQF A;  3ABM C;  5BMV A;  4UV8 A;  5LP6 C;  1YTF D;  2OIG A;  3AK1 A;  4RUE A;  1G4Y B;  3H01 A;  1ENV A;  5LHH A;  1K34 A;  1Q6I A;  4LF4 O;  3G71 V;  4UCU A;  1ZAU A;  3J81 N;  3WB2 A;  1WA8 A;  4KP4 A;  3UKM A;  2V7Q G;  1NH2 D;  1RM1 C;  4LBE C;  2ZDI A;  1VAR A;  2YID A;  4DV3 O;  2EIN C;  1FYJ A;  1QQC A;  3AEI A;  3ZHV A;  1Q6U A;  1Y4M A;  3CC7 V;  1AI7 A;  3TJT A;  4AQY B;  2X7R B;  4XDL A;  3E22 A;  3CCM V;  4FLU A;  1H2K A;  4FFB A;  4Q6G A;  4MVS A;  1KUQ A;  5EIB D;  3CCE V;  1I94 O;  3GWK C;  1IXM A;  4B3S O;  3K5N A;  3BA8 A;  3AK3 A;  5JVD B;  2PTM A;  2E76 B;  2OT5 A;  1VQ4 V;  2P6J A;  2EIK B;  2YDE A;  3SJA C;  2Y48 A;  1I94 B;  3E2E A;  1WLE A;  2BSK A;  2CH7 B;  4B3S B;  1XMQ O;  2ADP A;  5FL7 G;  4UB8 Z;  5IJ0 A;  2F66 C;  1KKD A;  2A0L A;  5IYZ B;  1COW G;  1BCC H;  4CH5 A;  2AZ2 A;  3N2K A;  3ZMU A;  4PD4 F;  3JAK B;  4WF9 V;  1XMQ B;  4N21 A;  4JYC A;  4JI1 B;  2PI4 A;  5L3C A;  4YY3 B;  4H44 B;  1YTF B;  1YDX A;  1P4R A;  3SYP A;  3T2M A;  4CC5 A;  1NTM H;  3A0H Z;  4MSW C;  4ZKI A;  1S76 D;  2W0X A;  4DRX A;  4UUJ C;  1P7G A;  2GUZ B;  3AG2 B;  2JDI G;  4EFB A;  4GZR B;  1WN7 A;  5FLX N;  2QM4 A;  3R66 A;  1EZV H;  1RFY A;  3BPZ A;  4RWU A;  3K9A A;  1SS3 A;  1F4M A;  4ZIB A;  2X6A A;  3K04 A;  2RJZ A;  1JOY A;  1SQF A;  3SR2 C;  3IFX A;  5KA5 A;  1H8E G;  5BY1 A;  2LO1 A;  4DR1 O;  2LW7 A;  2XUM A;  5C93 A;  3ZHS A;  5D5Q A;  3CC2 V;  1KKC A;  3AG1 C;  1H2L A;  2ZE8 A;  1URF A;  4FLY A;  4ZI7 B;  1HNZ B;  2JEX A;  2K9P A;  5KA6 A;  4IYI A;  4K8Z A;  3F5T A;  1MZE A;  4D7T A;  4JAA A;  5CA1 B;  2FTK A;  1LUV A;  1H2S B;  3UM7 A;  1AI4 A;  1O9H A;  1VF6 C;  4KL1 A;  4YJ2 B;  4GX5 A;  1EN6 A;  2HVK C;  3U11 A;  3L73 H;  5LXT A;  1BQ0 A;  5K1X A;  2ATK C;  5EZY A;  2DWD C;  4X8A A;  1PV0 A;  2DYS B;  3IAY A;  3CE2 A;  5LGN A;  1XDC A;  5IWA O;  1DGS A;  1LNQ A;  5B1B B;  2F93 B;  4K35 A;  4FVM A;  2WA4 A;  5L3E A;  3J7A U;  4DR7 B;  3K9S A;  3C3T A;  5LHI A;  4H0L B;  4WFA V;  1ROP A;  1EBO A;  1Z5W A;  2E74 B;  1Y74 A;  1B06 A;  3U10 A;  2ZKO A;  1VQP V;  2Y4T A;  4X20 B;  1K7D A;  4FIP C;  1WPB A;  4JYY A;  2W6J G;  4GKK O;  2RCV A;  4J7Z A;  2QTS A;  5L3B A;  3HKE B;  3DXR A;  4U3J A;  4DR6 O;  1ZX3 A;  4IL6 Z;  2X6C A;  5IDJ A;  1VMG A;  4DW0 A;  4O4L B;  3L75 H;  1NU1 H;  4MTG A;  2ZNJ A;  1JCH A;  3ZED A;  3CP1 A;  3RYH A;  1CEZ A;  4O4J A;  4G2K A;  4MVU A;  2JEU A;  4QNH B;  3CME V;  1ORQ C;  2QSA A;  5ITZ B;  1ZWI C;  5LOV B;  2UXX A;  3RVZ A;  1QLN A;  1US6 A;  4YHH B;  2F23 A;  5CMU A;  4DV6 O;  3OTO B;  3P3P A;  3APQ A;  5B3S C;  2LFS A;  2IW5 A;  2OWO A;  4H13 B;  4BR6 A;  5LHG A;  4I5S A;  3ZX6 A;  2DYR B;  2IM9 A;  3CPW U;  4MVM A;  3JD3 A;  4F6R B;  3SGI A;  4I4T B;  3ZMV A;  1ZL8 B;  2QEX V;  4Z1M G;  3JAL B;  5J2T B;  1E1Q G;  3W7T A;  2UXB O;  1VP7 A;  4JI4 B;  1Q86 W;  1Z2G A;  2KB1 A;  2KG7 B;  2XAG A;  5JVD A;  5BZB A;  4DR3 B;  4LH6 A;  1H2N A;  4UV9 A;  4HYO A;  2UXB B;  2Q0O C;  4MVR A;  1PM9 A;  4B7E A;  2CH7 A;  3ZMT A;  3WFV A;  1R73 A;  1NZ6 A;  2P22 C;  2QKA A;  3CCJ V;  5JWP A;  2VQE O;  2ARH A;  1MNG A;  2YIC A;  1K97 A;  4HZ3 A;  2Q7E A;  5LMN O;  5IYZ A;  5H6R A;  1I7F A;  3JAK A;  3O65 A;  3E86 A;  1PP9 H;  2FKX A;  1K92 A;  3JYC A;  2JK5 C;  3CJH B;  4UCS A;  2WLI B;  4A5U B;  2UXD O;  3B4S A;  1VQ6 V;  4BAY A;  1ARO P;  2WLJ A;  3PN1 A;  2UUA O;  2ZCE A;  4JYA O;  3RYF B;  1FD9 A;  2HHH O;  3MAQ A;  1FJG O;  1GAX A;  2GHY A;  2F1M A;  2YIA A;  3WU2 Z;  2GUZ A;  1VEW A;  4UCR A;  2WSS G;  1M90 W;  2UUA B;  1OJH A;  1SC5 B;  2W6I G;  4JI0 B;  1OCZ B;  1AJQ A;  4FM0 A;  1PD3 A;  2GDS A;  4LF6 O;  2UU9 O;  1THZ A;  2OIE A;  4W4L A;  5GW7 A;  2IH1 C;  1U96 A;  2M6Y A;  2KKW A;  4BW5 A;  2CDY A;  2ZDI C;  1NT2 B;  4B7K A;  3ZHU A;  1Q90 D;  2DQ0 A;  5B5E Z;  4IGG A;  2Y69 C;  4QPJ A;  3A0B Z;  1L0L H;  4DK1 A;  4DV1 O;  2Z3Y A;  1VF5 B;  5EBM C;  1GMG A;  2XHB A;  2NR5 A;  3WG7 B;  4ZI7 A;  2VRZ A;  2PY5 A;  5GON B;  3L9D A;  1PPJ H;  1OCC C;  5CA1 A;  3OGC C;  3ETQ A;  1IBM B;  3H1L H;  1XBL A;  4GUN A;  1F51 A;  1Y67 A;  2YS8 A;  1JQ0 A;  3CSX A;  5KMG B;  4YJ2 A;  2N74 A;  2ZXW C;  1WAZ A;  4KFM A;  3T4D A;  3VQW A;  1ZLZ A;  3D36 A;  4ZOL B;  4MW3 A;  4DUY O;  2Q68 A;  3FB6 C;  4DR5 O;  3G80 A;  4JI2 O;  1XL4 A;  5IYD O;  3OAA G;  4HBN A;  2PF4 E;  5EC1 C;  3SPJ A;  3K0D A;  1XEQ A;  3FD9 A;  1S5L Z;  3RFR A;  1KU9 A;  1KQS U;  1BGY H;  2WPD G;  4H37 A;  4X65 B;  3B8N A;  2OTL V;  3OFN G;  4UCO A;  5LGU A;  3FB5 C;  3L72 H;  1XMO B;  1YHQ V;  5CA0 B;  5A2Q N;  2EJR A;  4UB6 Z;  1WP8 A;  3DC6 A;  5LMU O;  2HP8 A;  4L87 A;  5HFL A;  1QLE C;  1AB3 A;  1PL4 A;  2Y0I A;  1AR5 A;  4JI3 B;  1GRJ A;  2CTP A;  3ABL C;  1FXK B;  3RWR D;  3RYC B;  2XOK G;  4X20 A;  2IJK A;  4XDK A;  3DC5 A;  3B8M A;  4DR4 B;  1XI1 A;  1GN6 A;  4JTA B;  3HKE A;  1K4D C;  1Q8I A;  3RN4 A;  4BIO A;  4IT5 A;  4WFG A;  2HJF C;  2QR4 A;  4UVA A;  3D3Q A;  1WJZ A;  2B1G A;  1N36 B;  4O4L A;  3T1H O;  1RPR A;  2E5L B;  1R3I C;  4X1I B;  4FLV A;  4B3M B;  2P4V A;  1H8H G;  2P4K A;  2VWJ A;  3JSN A;  2ZIM A;  3JCZ A;  4P9P A;  4JAS A;  2HVJ C;  4HAM A;  2WAM A;  5ITZ A;  4PI2 A;  4TWK A;  5LOV A;  5LA6 B;  4X89 A;  5KAI Z;  1FS0 G;  2ZNI A;  4JI6 B;  2FML A;  3N27 A;  1TVK B;  4O2B B;  2YXH A;  3P3N A;  1RM1 B;  3CMA V;  3E89 A;  2QKS A;  1I5Y A;  4MT8 A;  4F6R A;  1B04 A;  4GCZ A;  4I4T A;  1YJW V;  1ZL8 A;  3UCS C;  2E3C A;  2M7W A;  4QE9 A;  2ITD C;  3JAL A;  5J2T A;  2D3O W;  2QJ1 A;  2KG7 A;  5HFM A;  1B3Q A;  5BR8 B;  1VQM V;  2FL4 A;  2JJ1 G;  1XOU A;  4PV1 B;  3CWB H;  3ML0 A;  3OGI B;  3ABK C;  4AQY O;  2ILM A;  1VQO V;  1W0J G;  1ZSP A;  1DLB A;  2EIJ C;  1X59 A;  1ZUQ A;  1XIL A;  2HG5 C;  1XHX A;  3HKB B;  3CXC U;  4CS3 A;  1VIB A;  5DED A;  3K03 A;  1KB9 F;  3CX5 F;  4MW8 A;  2VWK A;  2EZP A;  3CJH A;  2WLI A;  4NTX A;  1J5E O;  3BEH A;  4OPH A;  3RYF A;  4KHP B;  4ASU G;  2R72 A;  4DV7 B;  3LSS A;  3AG3 B;  3W7W A;  3T1C A;  1BMF G;  2AHY A;  4PEL A;  2PUS A;  3ASN C;  3P30 A;  1EN5 A;  1J5E B;  1L0N H;  2Z0A A;  2CGO A;  2ETN A;  3JAS B;  4JI1 O;  4YXW G;  1Q81 W;  4YY3 O;  3VQV A;  3ABU A;  1DF5 A;  4I50 B;  4FK5 C;  2OCH A;  1E79 G;  1FAF A;  2CTR A;  4RO2 A;  2YI9 A;  4AHC A;  4BIU A;  2GBO A;  1FKA O;  4CH4 A;  1JPX A;  4JI7 B;  4Z1V A;  1NTK H;  4N23 A;  4J10 A;  3AG1 B;  1CXZ B;  4X1Y A;  1NH2 B;  4GYC B;  1PL0 A;  1I08 A;  3I55 V;  1TUB B;  1S5H C;  1M1K W;  3M8A A;  5GON A;  3TGU H;  1KC8 W;  2ZIN A;  2EIK C;  1KBH A;  1SER A;  2B5U A;  3THO A;  2BTO A;  2ZT9 B;  1XL6 A;  1N0J A;  4DW1 A;  3QTC A;  1TUE B;  2F4V B;  3CB2 A;  4U3F H;  3ASO C;  1HNZ O;  5CBF A;  4DYL A;  1VQ5 V;  2EIL B;  1R1B A;  4TV9 B;  3TXQ A;  1HNX B;  4BIZ A;  4ZOL A;  1BQZ A;  1M56 C;  4O4I B;  2RMK B;  1N0N A;  2H8P C;  3SYO A;  3G67 A;  5EYP B;  1LUW A;  3K5M A;  4J41 A;  4YIO A;  3RYI B;  3K59 A;  4IHJ B;  1GH6 A;  1SQX H;  4O2A A;  1JJO A;  1Q6H A;  4KUM A;  1YXB A;  5GTI Z;  2WLL B;  3E8H A;  2VQF B;  1VQL V;  3O9O A;  4FMT A;  2HR3 A;  1V9P A;  3L71 H;  2P90 A;  2QKC A;  3EFF K;  4GT1 A;  1KYO F;  4LC1 A;  2GTA A;  2Q6A A;  5CA0 A;  2XAF A;  2HEP A;  3ZN1 A;  3F7V C;  2P67 A;  1FXV A;  4XBF A;  4K8X A;  5DN6 G;  4WFF A;  3X2Q C;  1G6U A;  4DR7 O;  1DF4 A;  1FXK A;  4WCE V;  4FJC C;  3RYC A;  3AG4 B;  1YVW A;  4C7U A;  2UXC B;  3DGE A;  5IY5 B;  3K5L A;  2GV9 A;  3A8T A;  1HNW B;  1IDS A;  4JZ2 A;  2JS3 A;  4QJF B;  3LSQ A;  2H3O A;  1B6Q A;  1RPO A;  3UT5 A;  2HJD A;  4JI8 B;  5IE9 A;  5L3G A;  2ZE7 A;  4BWA A;  2LJ2 A;  2RDC A;  3HKC B;  2L6L A;  5JH7 B;  3J80 N;  3K06 A;  5H2F Z;  3CCV V;  4MS2 A;  1QCE A;  4B3R O;  1GM7 A;  4EB6 B;  3W7X A;  1D5N A;  3AG7 A;  5LGT A;  1DTO A;  3BRC A;  2A79 B;  4PA6 A;  3ICX A;  5IT9 N;  2L35 A;  4B3R B;  2Q5Z A;  4NXN B;  4I0X A;  4FZ1 A;  1RSO B;  1VQK V;  2DYS C;  1YIT V;  2YIB D;  5LA6 A;  4TV8 B;  3WB0 A;  4DV0 B;  1BSM A;  2Q8V A;  3OE7 G;  5B1B C;  1TVK A;  4O2B A;  3FYI B;  2R70 A;  1VQ7 V;  5CN0 A;  1WB8 A;  1OCO C;  2ZR2 A;  2XAH A;  1EZJ A;  3B09 A;  4LWS B;  3R65 A;  2UXN A;  3ZN0 A;  1NJI W;  3OTF A;  1QBZ A;  1YF2 A;  4YHH O;  1AI5 A;  3OTO O;  3H1J H;  1M93 A;  4X88 A;  1JMK C;  5KX5 B;  2QTO A;  1XUQ A;  2IBZ H;  2X6B A;  4GKJ B;  1FFX B;  1H38 A;  4K0K B;  5JJN B;  2FB5 A;  2AXT Z;  2UUC B;  1SA0 B;  5JJJ B;  4F4L A;  1NVP D;  5KHJ A;  5KHI A;  4JI4 O;  4LF5 B;  2IU3 A;  1K4C C;  2Q7G A;  1IBK B;  5B1A B;  3B2E E;  1XNQ B;  1N32 O;  3HKB A;  3BAA A;  4DR3 O;  1G1X B;  1V55 B;  2ZE5 A;  4GX2 A;  1S0V A;  1GN3 A;  3OEH G;  1K5Q A;  3QNE A;  1AVM A;  1W2B U;  1N32 B;  1R3L C;  2XAJ A;  3HB3 B;  4QE7 A;  4X9Q A;  1F23 A;  1BHA A;  4J42 A;  4J7K A;  1Q5O A;  3FKS G;  1IUR A;  3TCU A;  4H33 A;  5BMV B;  1NKD A;  3H1H H;  3MHS C;  1N34 B;  3ZS8 C;  4CBC A;  4TQD A;  3JAS A;  1K33 A;  2EIM B;  2DMX A;  2KQX A;  2Q9L A;  2CGN A;  5KHG A;  4I50 A;  3LNM B;  4JZG A;  5IJ9 B;  5FPR A;  3QG5 A;  3IC7 A;  4JI0 O;  2LGW A;  3MD0 A;  1V54 B;  4UVC A;  1K73 W;  5B1O A;  2NLJ C;  3Q4H B;  2ZR3 A;  2LW1 A;  3M7M X;  2QM7 A;  4TSF G;  5E79 Z;  1TUB A;  4LP8 A;  1AIL A;  2YC0 A;  4R7C A;  4NXM O;  4AIL C;  3ZMZ A;  3L70 H;  3FB8 C;  1BS3 A;  5C8Y B;  5E1A C;  1HW7 A;  2H94 A;  4MTO A;  4NTW A;  2HLD G;  4MVZ A;  4NXM B;  1OHH G;  3ZRV A;  2WLK A;  3KKY A;  2C2A A;  3QO8 A;  1NBM G;  1VF6 A;  1XQ8 A;  4TV9 A;  2ZXW B;  1PNK A;  4MTX A;  1EFR G;  4U7N A;  1GN2 A;  4LNU B;  1H2M A;  2VS0 A;  4O4I A;  1WB7 A;  3FX7 A;  5JCO A;  1IBM O;  1BHB A;  1R6T A;  3CHX A;  5EYP A;  2N04 A;  3SPC A;  2JRI A;  3RYI A;  1KMI Z;  4IHJ A;  4PA9 A;  2IU0 A;  3CCS V;  4DUZ O;  1I5X A;  2WLL A;  4DV2 B;  1OCZ C;  3PJS K;  2BOB C;  2UUB B;  2AZ0 A;  1MA1 A;  4DUZ B;  1FXH A;  1L8D A;  2R9A A;  4FLT A;  1JJ2 U;  4X64 B;  1AJN A;  1XHZ A;  1MG1 A;  2PZS A;  1WP7 A;  1UPG A;  2BTQ B;  3ETG A;  4X65 O;  3CCR V;  1HR0 O;  2KSD A;  1MMM A;  1XMO O;  3C3S A;  3K08 A;  3LNN A;  4JTD B;  3OEE G;  1VQ9 V;  4JF3 A;  2RQ6 A;  3IJ4 A;  5J2U B;  3FYE B;  3WG7 C;  1MAB G;  3BAB A;  1XNR O;  1ZTE A;  5KHK A;  3FAV B;  5KUM A;  1K5S A;  1HR0 B;  5KLV H;  4L8J A;  4P30 A;  4JI3 O;  2Q4P A;  2PYL A;  1XNR B;  4GX1 A;  3HKC A;  3S3X A;  5JH7 A;  4DR4 O;  2CTQ A;  1W0K G;  4EB6 A;  3I56 V;  2P7T C;  1IX9 A;  3BCC H;  3BA9 A;  4P2Z A;  1M5I A;  3F5W C;  3OR6 C;  1CP9 A;  1IVS A;  2B1I A;  5EZY B;  3CCL V;  1Q3E A;  1N36 O;  3RW0 A;  2OCC B;  4B08 A;  1T5E A;  2E5L O;  4ZBM A;  4B3M O;  4MVQ A;  4TV8 A;  5KAF Z;  1Z5V A;  3CYO A;  3B77 A;  2YEV B;  2DQ3 A;  3C90 A;  1NR1 A;  3D3I A;  4LWS A;  4PA3 A;  4PDV A;  3DSQ A;  2HKO A;  4U7O A;  3APO A;  3SJQ C;  1AP6 A;  3JD2 A;  4JI6 O;  3LDC A;  3ABM B;  5H6Q A;  4RQE A;  5LP6 B;  2YI8 A;  5CBH A;  4JV5 B;  5FNV B;  5KX5 A;  3H9V A;  4CS4 A;  3G4S V;  2NN4 A;  1P84 F;  5EBL C;  1FFX A;  3SPI A;  1OCR C;  2CE4 A;  2LP7 A;  1AR1 B;  3SPH A;  1SA0 A;  2LFR A;  1M57 C;  1Y66 A;  3E83 A;  3LUT B;  1S5J A;  3I5D A;  2EIN B;  2V1D A;  1QHT A;  3OMN B;  2EIJ B;  4DK0 A;  2X0L A;  4OGQ B;  4YIP A;  1LR1 A;  5BR8 O;  4QGP A;  1KD1 W;  3IGA C;  5B66 Z;  4J9Y B;  4K3A A;  4QIW F;  2EBO A;  1R3K C;  3E8G A;  4PDR A;  4I55 B;  3GVM A;  1QR9 A;  3ETE A;  5DEC A;  4O4J B;  5EC2 C;  2AHZ A;  1S77 D;  1PKX A;  3K0G A;  1GKF A;  2Z5U A;  2EUL A;  3ZRS A;  3ASN B;  5IYB O;  3T1Y B;  1BT8 A;  1X4T A;  1NTZ H;  2Q0A A;  4WBN B;  1O9G A;  2ZM6 O;  1A32 A;  1SZT A;  4KHP O;  4DV7 O;  2DN9 A;  3ZRX A;  5IJ9 A;  5EK0 A;  4LF4 B;  2ZM6 B;  5KUK A;  2CAZ C;  3MDS A;  3Q4H A;  2XT9 A;  4DV3 B;  4J9Z B;  3RBZ A;  5J9P C;  1SRY A;  2ZD9 A;  2XTA A;  1E1R G;  1AJP A;  3OT7 A;  3SYQ A;  2EZO A;  3LDE A;  4FFK A;  4TUY B;  1DK1 A;  3K79 A;  1SET A;  3A2F A;  1BE3 H;  3ZBH A;  5C8Y A;  3NR7 A;  1SES A;  3TET A;  2BCC H;  4JI7 O;  2NNU A;  4CZZ A;  3RGB A;  3IC9 A;  3GB7 C;  1MZF A;  2QWR B;  3ASO B;  1G8M A;  5LL6 Y;  4AI8 A;  3OMA B;  2RN9 A;  5CB4 B;  3JD1 A;  2JGU A;  3N2G B;  3W7S A;  4JAU A;  4LNU A;  1M56 B;  1OZ0 A;  2BE3 A;  2ADQ B;  1M9N A;  2IJI A;  4I9Q A;  2F4V O;  2Q73 A;  3AG3 C;  2D2C B;  4RQF A;  1N4C A;  3OUF A;  1IBL O;  1HNX O;  4R8C A;  4TOI A;  3CRA A;  2JVD A;  1HP8 A;  3HKD B;  5KMG A;  1YZB A;  2YXL A;  1GO3 F;  1IBL B;  2OYQ A;  4CH6 A;  3F7Y C;  3QO5 A;  4DV4 O;  2VQF O;  3ZHT A;  3X2Q B;  2BTQ A;  2A3Q A;  3LDD A;  1QNM A;  2AW9 A;  3QF7 A;  4JAV A;  4UXN A;  3E8F A;  2CUG A;  3SJB C;  3CRC A;  1AR4 A;  4DV4 B;  3AG2 C;  2JS5 A;  3BY6 A;  4JPR A;  1HDJ A;  5J2U A;  4DR1 B;  3VOU A;  3FAV A;  2BOC C;  2Q67 A;  1EM1 A;  3CC4 V;  4E2L A;  2OTJ V;  4GX0 A;  5IYC O;  4TT3 G;  4W4K A;  4X1K B;  2ITC C;  3LSU A;  4J80 A;  5H9C A;  3STZ C;  4J7J A;  4G28 B;  4WFE A;  1TAE A;  2UXC O;  2WWW A;  4NVP A;  1N33 O;  2R9R B;  1NR7 A;  1RP3 B;  5EIB C;  3CRM A;  4QPK A;  5JQG B;  1SKV A;  1SQQ H;  1HNW O;  3ZHR A;  2EIL C;  4PDL A;  1N33 B;  1P7B A;  4YJ3 B;  4LF8 O;  2MW2 B;  4O4H B;  4JI8 O;  1Y76 B;  3OD4 A;  5JCO C;  1VQN V;  5K1P A;  3SPG A;  4EEQ A;  3EHB B;  4LF8 B;  1WPX A;  5L3D A;  3DTU B;  2Y0P A;  1QR8 A;  1QVG U;  1K9M W;  2YXY A;  4D7S A;  1R6N A;  4FM1 A;  4X1I A;  4GLX A;  4OX9 O;  3KG2 A;  2E75 B;  2YEV A;  3MHH C;  4DO2 A;  5LBQ A;  1OCO B;  4NXN O;  3ABT A;  2F43 G;  1K3E A;  3ZRW B;  1GM8 A;  4B3T O;  5IWA B;  3OUS A;  4DV0 O;  4NR1 A;  4NYK A;  4OX9 B;  3D36 C;  3U0Z A;  1F4N A;  5LP6 A;  1UJW B;  3VQX A;  4RAI A;  4CS2 A;  5FNV A;  4B3T B;  3ZIA G;  3JAR B;  4XDJ A;  2IH3 C;  1MOF A;  3JAW B;  3AG4 C;  3GWO A;  4CH3 A;  3VQY A;  4OXS A;  5B3S B;  4ABM A;  2DW4 A;  1HWY A;  5IY5 C;  4PHZ A;  1Q43 A;  1R6K A;  1D2D A;  2XND G;  4HNA B;  1YJ9 V;  3ZMS A;  4RUF A;  1JFF B;  3CCU V;  3CS5 A;  4GKK B;  4GKJ O;  4CC6 A;  3RVY A;  4IIJ B;  4K0K O;  3JD0 A;  1J95 A;  2IJH A;  2JGD B;  2UUC O;  4DR6 B;  3UO2 A;  1PNL A;  3JAT B;  4EFE A;  4DR2 O;  2EJ7 A;  4I55 A;  2PGG A;  2DE0 X;  4LF5 O;  2IJJ A;  4DV5 O;  3EVK A;  4P9O A;  3RT3 C;  1IBK O;  1XNQ O;  4BW9 A;  5FPO A;  2Q7H A;  4DR2 B;  4ICG A;  4FPP A;  5AG2 A;  4MTF A;  4LR3 A;  4DV5 B;  3BFR A;  4WBN A;  3A0R A;  4LCU C;  3K3W A;  1NS1 A;  1UFI A;  1SZX A;  4DXW A;  4FLX A;  3TK1 A;  1N34 O;  1TA8 A;  3JSL A;  4DV6 B;  2WLM A;  1FFT B;  4ZHQ B;  5LYJ B;  5H5N A;  1L1F A;  2A9H A;  5GTH Z;  4R6Z A;  3QO7 A;  2LQT A;  3FFQ A;  2P5O A;  4FZ0 A;  4UCV A;  2PI5 A;  4UFZ A;  4TUY A;  3FB7 C;  3EXA A;  1WA8 B;  2B9Z A;  3UQ8 A;  2EX3 A;  2MK3 A;  3HPL C;  2DYR C;  2CK3 G;  1IXB A;  1F7Y A;  3ZHQ A;  1JR9 A;  3S3W A;  3SJC C;  5B1A C;  2Y69 B;  5CB4 A;  4NKG B;  1JA8 A;  3N2G A;  1V55 C;  3E22 B;  2V4D A;  2N05 A;  3ZCC A;  4FFB B;  3W7U A;  3NXS A;  4LH7 A;  1I0H A;  3KCY A;  4JGS A;  2DJV A;  2VQE B;  2HFE C;  1NVP B;  5LMN B;  2YSU B;  5BXZ A;  4KXR A;  4NTY A;  1MSW D;  1SQB H;  2G38 A;  2QWQ B;  4R50 A;  1YJN V;  3E35 A;  4I7Z B;  1P49 A;  1QU7 A;  2FYU H;  3ETD A;  3WB1 A;  1IZ3 A;  1OCC B;  5CBG A;  1PNM A;  2BSK B;  2UXD B;  1SQG A;  1SQV H;  2JIZ G;  2EIM C;  3JD4 A;  4JYA B;  2QGN A;  1OV9 A;  5IJ0 B;  3HKD A;  2R9I A;  2WLN A;  1GM9 A;  2HHH B;  2GSM B;  1FJG B;  3N2K B;  4G27 B;  3CRQ A;  5A9G A;  4PJ0 Z;  1KP2 A;  3M99 B;  1EN4 A;  3OMI B;  4JTC B;  3H1K H;  4LF6 B;  4DV2 O;  3D8C A;  2UU9 B;  1V54 C;  1YIJ V;  1W59 A;  2UUB O;  3CXH F;  5EBW C;  1SQP H;  4F6E A;  4DRX B;  5B1N A;  3CD6 V;  3QVN A;  4X1Y B;  2RNB A;  1U97 A;  3OM3 B;  4X64 O;  1YSC A;  2P06 A;  4UVB A;  3BHP A;  1JX9 A;  2QWP B;  1K8A W;  3SYA A;  4DV1 B;  4IYH A;  4FLW A;  2PYJ A;  3TXS A;  4X1K A;  4MVO A;  2F95 B;  3G6B A;  1YCI A;  3B40 A;  1NQT A;  3SYC A;  5DM6 V;  1H2G A;  1Q7Y W;  1QLE B;  4LF7 O;  4X62 O;  5JQG A;  1JVM A;  4JI5 O;  3KCX A;  3ABL B; 
#chains in the Genus database with same CATH homology
 2VS0 A;  2VRZ A;  3FAV A;  2AZ0 A;  3TXS A;  3Q4H A;  3FAV B;  3HR0 A;  4ABM A;  2KG7 A;  3Q4H B;  2DE0 X;  4LWS A;  2KG7 B;  3G80 A;  3GVM A;  1WA8 A;  4LWS B;  2AZ2 A;  4I0X A;  3GWK C;  1WA8 B;  4GZR B;  4I0X B;  2B9Z A;  3OGI B;  3ZBH A;  3O9O A;  3FD9 A;  3TXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...