4I1AA

Crystal structure of the apo form of rapi
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
274
structure length
274
Chain Sequence
b'LEYYFYFFKGMYEFRRKELISAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSMNYANRALKIFREYEEYAVQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHLIAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNVALIYFRKGRFIADKSDDKEYSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENFSIEVADYFHEQGNLMLSNEYYRMSIEARRKIKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase I
publication title Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 114
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1aA00
4I17A 2JLBA 4N3AA 5M72A 3ESKA 5DBKA 3MKRA 2LNIA 3N71A 4B94A 4O6FA 3JYSA 3PE3A 1ZU2A 1TJCA 4HOQA 5JJ7A 5EX3A 4ME2A 5EKQD 2KATA 3LY8A 4BT8A 3Q15A 2OOEA 2FEZA 3Q5MA 3Q4AB 3SF4A 4JA7A 3ZGQA 4BTAA 4GA1A 4U04A 4I2WA 4HORA 3TAXA 3URZA 1WAO1 2VGYA 4HOTA 2XCCA 2FI7A 3OXLA 4APOA 3Q49B 3S7DA 5FJYA 4JHRA 1KT1A 4A1SA 4UI9K 4AIFA 3BEEA 4BWRA 4Y6CA 2MHKA 2PQRA 4U0ZA 2ONDA 5A6CA 3CVQA 3OXGA 3S7FA 3FFLA 3U4TA 3ZHEA 3TG4A 2KCLA 4I2ZA 2I6HA 5LCWC 4KYOB 3QWVA 5D0OD 3WXXA 3K9IA 5BT1A 3QKYA 5JJTA 2YQ8A 2XPIA 1NA0A 3VTYA 2FF4A 1ELRA 4GPKA 2XCBA 3AS4A 3RO3A 3HYMB 3QWWA 4GZ6A 3CK8A 4J8FA 2HO1A 3GYZA 3FP3A 3ZN3A 5BNWA 1KT0A 3OXFA 5FZQA 3AS8A 4GZ5A 3TG5A 4HOUA 2Q7FA 3UPVA 5C1DA 2NC9A 4G23A 5LCWJ 1ELWA 5G04C 5FT9A 4HOSA 3KS2A 2UWJG 4N3CA 2FO7A 4WUYA 2WPVA 5G05J 3RKVA 2AVPA 2L6JA 1NA3A 2PL2A 4RG9A 2HR2A 4NRHB 2P58C 4XI0A 4KXKB 4WNGA 2GW1A 2VGXB 4F3VA 4AM9A 5CHEE 4XIFA 4NQ0A 2PZIA 4Y6WA 5HQ8A 4GYYA 2KC7A 3LCAA 3LYAA 1KLXA 2UY1A 4I9EA 2V5FA 3NF1A 2LSUA 2FBNA 3PDNA 2IFUA 3CVLA 5KJKA 4N2QA 4BTBA 2Y4UA 3AS5A 4LEUA 4UQYA 3CK9A 3Q47B 5EX0A 5FZRA 4N3BA 2BUGA 4EQFA 4BT9A 2C2LA 3CVNA 3MV2B 2UY1B 4J8DA 5CCMA 4YVQC 1HZ4A 3PE4A 5A7DB 1HXIA 4ABNA 2LSVA 1IYGA 4GCNA 1W3BA 4H7XA 1E96B 3CKBA 4WNEA 3RU0A 5JJ6A 5FZSA 3CEQA 3LY9A 2XEVA 1YA0A 4W9RA 2Y4TA 3MA5A 3ZHEB 3ASGA 4U0SA 4UQXA 5DIZA 3O48A 3QOUA 1OUVA 4G26A 2XGOA 4GZ3A 3ASFA 3UQ3A 3U3WA 4GA2A 5D0QD 3CVPA 4UI9C 5FTPA 4I1AA 5KJMA 3GZ2A 1QZ2A 3VTXA 2QFCA 2XGMA 3QWPA 3LKUA 4G24A 2C0LA 1ZBPA 3RJVA 2IF4A 2WQHA 2PQNA 4N5CA 4WNFA 4U07A 3EDTB 4N39A 3ZFWA 4WNDA 4JA9A 4RG6A 4G25A 3ULQA 3KAEA 5KJLA 1NZNA 4AY5A 5ARFA 3CKCA 2YHCA 5ARGA 4UI9J 2VSNA 5KJNA 3FWVA 5G04J 3GW4A 3UUXA 3R9AB 3GZ1A 1A17A 4J8EA 3ZPJA 3E4BA 2DBAA 3MV3B 3KD7A 3LPZA 4XI9A 4N2SA 3S7BA 1QQEA 4IN3B 1FCHA 5AYWD 2VSYA 1WM5A 5BW8C 3IEGA 2R5SA 2VQ2A 4KBQA 3CV0A 4G1TA 2HYZA 2KCKA 4J0UA 4U0UA 3LY7A 3MEKA 2VYIA 4JL0A 4AY6A 3RO2A 1Y8MA 3CK7A 4GCOA 4UQZA 5G05C 2KCVA 3ASHA 4YNDA 1P5QA 1B89A 4GYOA 1IHGA 4G2VA 3RIBA 4CDRA 4CGVA 2E2EA 4I9CA 2XGSA 4CGWA 3ASDA 4GA0A 4YVOA 4GYWA 2VGXA 1XNFA 2J9QA 5HI7A 3TGOA 3QDNA 3SZ7A 1HH8A 2C0MA 4H7YA 1PC2A 3S7JA 5CCLA
chains in the Genus database with same CATH superfamily
1ELKA 4X8QA 4EPZA 5G55A 3LXUX 3ESKA 3CR3A 3JYSA 2X6KA 3UINC 3R7QA 4DX2A 2KATA 5ENPD 3LY8A 2X6JA 2JEKA 2XPYA 3P1UA 2FEZA 2V4LA 4C0EA 2ETCA 3SFZA 5HS0A 5C2YA 3ZGQA 4BTAA 1INZA 3ONLA 1QYMA 2EIKE 1E8XA 2YINA 4F53A 4AOFA 3RRUA 3KEAA 1WAO1 2RD0A 4BSXA 2FI7A 4O1PA 4APOA 4NIKA 3PZ3A 3ISMC 5FJYA 2QYUA 4A1SA 4AIFA 2JABA 3AG1E 2MHKA 5AQAA 2ONDA 5A6CA 2XRYA 3CVQA 5BXUA 1YCSB 1O1SA 4AJWA 1U2VG 5LCWC 4KYOB 3QWVA 5FINA 3K9IA 2LXLA 5BT1A 5B1BE 4N5QA 3VTYA 4HB5A 3RO3A 3HYMB 1Y6IA 1TJFA 3HDXA 3C3QA 2WB2A 4LNBA 2J07A 5BNWA 1KT0A 2MOWA 3D9NA 4G8KA 2KZTB 4PS3A 3PZDA 3BU8A 4GMJA 4I1MA 1OY3D 1DNPA 3TG5A 3GZSA 2NC9A 4EHMA 3CQGB 5KNGA 3UIPC 5G04C 4HOSA 3E33A 2ILRA 2WPVA 2HR2A 1BD8A 4U7EB 4IYPA 4WNGA 2FULA 2F37A 4DX5D 4LG6A 3NQPA 1YYHA 3AAAC 4CZ2D 3HXFA 3PNLB 4DX7D 1N0QA 4NURA 4Y6WA 3CHRA 2XS1A 2NXPA 2KC7A 2ETAA 4NACA 5T4YA 3E37A 3JUIA 3JCKC 2LSUA 3ZNGA 4GTMA 3E30A 4O60A 1V54E 4BTBA 3CSFA 5CMYA 1RZ4A 1BU9A 4HLLA 5EX0A 2XEEA 3V2OA 2EILE 1HG2A 4Q96A 3SD5A 3B7BA 2C2LA 4FHKA 4AEZC 3UT7A 5CCMA 4FLBA 4YVQC 3PE4A 3V2XA 4EBAG 3MGBA 3RK6A 1O1RA 1N4RA 2BF0X 2LSVA 4H7XA 3G2TA 2XEVA 2WQ6A 4W9RA 3T5XA 2Y4TA 3Q75A 2WXHA 1WG0A 3MA5A 3FH8A 3ZHEB 5CBOA 3ASGA 1HFAA 3SQVA 3JQ0A 5BXOA 2GRMA 3HIZA 3TWRA 3ZYKA 1HO8A 3B7TA 3CVPA 5G2NA 5ENOD 1NFIE 2PNNA 3J5QB 4GB9A 4I1AA 5BUZA 5KJMA 4HRLA 4HBDA 4TXQA 1QZ2A 2XZDG 3VTXA 3C5RA 2P9LG 5J08A 3QK0A 2PQNA 1SZAA 2WXNA 4I6GA 4WNDA 4RG6A 4A63B 4G25A 4GAAA 3ULQA 4B89A 3KAEA 3ZVVA 3RSEG 1QNFA 2H6FA 3EJNA 2VSOE 4AY5A 2EINE 1JWGA 5LFAA 3CKCA 1H6PA 1OCOE 2DYSE 1N4SA 4JHKA 2H6HA 1BI8B 4V3IA 5KJNA 5G04J 3GW4A 4PS7A 3UUXA 3FH7A 1A17A 2L0IA 2QC9A 4AXHA 3ZPJA 2DBAA 4N2SA 1K1BA 3CHPA 4LSZE 3DSXA 5B3SE 4TRQA 5ANRA 3TWSA 2I2OA 3LDZA 3CHSA 2IQCA 5AJLA 5BW8C 3IEGA 4KMOA 3ZW3A 3FUHA 4EBAA 4DUIA 5AJDA 1TN7A 3FU3A 1TNZA 3C72A 4GZDA 2HYZA 3IHYA 5CECB 3KEZA 2KCKA 1S63A 3D9PA 3V31A 4F1SA 3EUVA 1HS6A 4JL0A 4HVBA 4ANXA 2AJAA 3ZU7B 3HXEA 4ILHB 5G05C 3ASHA 4YNDA 3FDHA 1B89A 2CFUA 1K3ZD 1QBQA 4QQIA 4AP2A 4J7WA 4G2VA 4UWKA 2WXJA 3TXMA 4CGWA 2P2CP 2AWIA 4XKCA 2XEHA 2VGXA 2GRLA 5FQ8A 3AG3E 4B0ZA 4F6RD 4APFA 5CEDB 5IY5E 3R7RA 4J6IA 5KNHD 3QDNA 1OCZE 1HH8A 4I6EA 2J09A 1NI1A 4H7YA 4GMLA 3EIJA 1OWPA 2RFMA 1H19A 4I17A 2JLBA 2ZU6B 4JEUA 5DBKA 3MKRA 2LNIA 3N71A 2PM7A 4RLYA 1ZU2A 4RQIA 1TJCA 3TWQA 4HOQA 5EX3A 1D9SA 2Y69E 4L2YA 5AQ9A 4TXRA 1OXJA 3SF4A 1E7VA 3PZ4A 4U04A 2L6BA 1UG3A 3R9MA 2IEJA 4CCAA 3URZA 3SHFA 4ATGA 4CYMD 1BI7B 2WXPA 3OXLA 2P9IG 4GU5A 2A5EA 3Q49B 3FTWA 3ZYMA 2P9PG 4JHRA 3U66A 1KT1A 5H7PA 3EHNA 3BEEA 4Y6CA 1IQRA 3CHMA 4Q69A 3OXGA 2GRRB 3L54A 4BFRA 4OYSA 4BETA 2KM4A 3U4TA 3ABKE 4I2ZA 3EHMA 4DI4A 3SBSA 2WVIA 5AQBA 3WXXA 1SVXA 4CT0A 1HE8A 3QKYA 5JJTA 3F6QA 1NA0A 1D8DA 2FF4A 3UIOC 4GPKA 1MX6A 3AS4A 3CHOA 3QWWA 3HXCA 5EYLA 3FULA 2ZIRA 4ACLA 1WY6A 3W9GA 4LNUD 2KBXA 1JCSA 5EIDA 3D9MA 3UPVA 5C1DA 3APCA 2R59A 3UM1A 2WXKA 1ELWA 1MJ0A 2HM8A 3Q7AA 4ILIA 5JMND 3KS2A 2UWJG 5AN8A 4WUYA 3FTUA 5G05J 3ULEG 2L6JA 1NA3A 4RG9A 4NRHB 1E8WA 5ENQD 2FO1E 4KXKB 3ML8A 4WWOA 3L17A 3DEOA 4AM9A 5CHEE 4NQ0A 2X6FA 3ASOE 5HQ8A 1N9AA 4A3VA 3DXKG 2I1JA 4J8YA 2WM9A 4GYYA 2H6IA 1KLXA 2UY1A 4I9EA 5JHAA 3D9LA 4M7CA 3DSSA 2IFUA 3BUAA 1OWOA 3AS5A 4DX6D 2E0IA 3DSVA 3DRAA 4N3BA 3B7RL 2ETBA 4FA6A 4BT9A 3U64A 1IQUA 1EYHA 1VDYA 3PEVB 4XX5A 2UY1B 4J8DA 5LOZA 1HU3A 1IXVA 3TWVA 4ABNA 3WG7E 1W3BA 4WNEA 1N11A 4I43A 5JJ6A 3G2VA 1Z5SC 3FU0A 3LVQE 2WXIA 4EZJA 5AQ7A 1YMPA 1ZB1A 2VTBA 4K5AB 2RFAA 3O48A 1OUVA 3EIQC 3UQ3A 4L7TA 4GA2A 5D0QD 3D9KA 4PS8A 4WWPA 2GRQB 5FTPA 3FTXA 2Y3AA 3JXJA 3KSQA 3AU5A 1OT8A 3QAQA 3DPYA 4RVBA 3QWPA 4FC8A 2GGFA 3UXGA 3LKUA 4YDOA 3BG1B 3MKQA 1ZBPA 2B6CA 4FHJA 2WQHA 2QYJA 2WXQA 4TUUA 4J8SA 3B95A 3ZFWA 2DZNA 4ZHBA 2WQ7A 3CSTA 4JW1A 3DSUA 4ACKA 4XEIG 4B93B 1EF1C 2WXMA 2R02A 5ARFA 1Q2ZA 4FULA 1OWMA 3SFXA 4FU3A 3MKQB 4TXPA 5AIJA 3T8MA 4G8LA 4KT6B 3C3RA 1TNYA 3R9AB 3GZ1A 3EU5A 4K5CA 2QY7A 1S64A 2F0YA 5ENTD 4TV3A 3KD7A 3S7BA 2WMNA 1FVFA 1H2VC 3FTYA 2VSYA 5JHBA 3FHEA 3FU5A 3ENEA 3CHQA 1Z3YA 4YDWA 4DLOA 1SZ9A 3E32A 5KBAA 3FTSA 1UJJA 2OVFA 2MRIA 3D3MA 4YDEA 5CRUA 3RO2A 1Y8MA 4JXTA 2GROB 2OEWA 4GCOA 2I9CA 3ABME 4UQZA 4Z68A 3PUJA 1E8YA 4CDNA 1H2TC 3UT4A 1P5QA 2IOSA 1MYOA 3L16A 4ILGA 3RIBA 5EDSA 4CGVA 2E2EA 4I9CA 4O1OA 3ASDA 2AW6A 3U9WA 4GYWA 1D8EA 3FY4A 4EZKA 3ABLE 4HS2A 4GPMA 3Q9NC 5CEAA 2MYOA 5CCLA 2XPZA 2WMOA 5M72A 3QNKA 1HG5A 4HRNA 3ZXSA 1FT1A 4O6FA 4B94A 5BV1A 4UUCA 5EIBE 1LF8A 3MYVA 3MCXA 5EKQD 2ZGGA 4BT8A 3Q15A 3CVWA 2OOEA 4E6HA 3DPDA 3Q4AB 2I1KA 1KZOA 4JA7A 1OWNA 3QJZA 4GA1A 2OCCE 2L0TB 2IU1A 3IXEA 4HORA 3UX4A 2OEVA 1TYQG 3TAXA 3I4GA 3ZYLA 3CVVA 2VGYA 4KVOA 3UKUG 2XCCA 4HOTA 5JA4D 3S7DA 4MBGA 1TNOA 4UI9K 3L22A 4C48B 4GTQA 3FUMA 2PQRA 5CMWA 4U0ZA 3G2SA 1NL4A 3B13A 1U3DA 3S7FA 3FFLA 4CT4A 3L6AA 1DC2A 4FLHA 3TG4A 2KCLA 2I6HA 4R7LA 3ONKA 2NYJA 3RRMB 3FUDA 5AAOA 2WXOA 4I1OB 2YQ8A 2IY0C 2XPIA 4MLPA 1ELRA 3DBSA 2IOLA 3UM3A 3CK8A 2LAIA 4J8FA 2HO1A 4DPRA 5J90A 3FP3A 3TXNA 1L5JA 1X5BA 4HI8A 4HNAD 2X6IA 2DIWA 4UWGA 1SQMA 2VJ8A 3AS8A 3SFYA 1UN9A 2BKKB 5HKPA 4ANUA 4HLEA 4HOUA 1SW6A 3APFA 1TEZA 4LNGA 3ASNE 4K5BA 3X2QE 4GZCA 4DX1A 3NZSA 4EZLA 3L82A 2CFZA 1UJKA 4N3CA 2FO7A 4ANWA 4DK5A 2AVPA 4KZCA 1IKND 2P58C 4C0MA 4ZFHA 2ZXWE 1WDYA 2GW1A 2VGXB 4F3VA 4XIFA 1UW4B 2F8YA 2R2LA 2PZIA 1K8KG 2V8SE 2H6GA 4BERA 3D9IA 4MKTA 2IONA 2M63A 3PNTB 2IO3C 2NSZA 4XKBA 3SI5A 4JEHA 3CGHA 5KJKA 4A55A 4N2QA 4WAFA 1N0RA 3D9HA 3NB2A 4LEUA 4UQYA 2XZTG 3CK9A 3PUKA 3C3OA 2X38A 2X6HA 3I5PA 4EQFA 2CHXA 2CG3A 3CVNA 3JUEA 1JCRA 3MV2B 4JD2G 5FIOA 3AJIA 1N95A 3TWWA 5A7DB 4CRWA 4RSYA 1HXIA 1KPSB 4GCNA 1E96B 3PS6A 3CKBA 2DWZA 3ZEFA 1UOHA 3CEQA 3LY9A 3PZ2A 3OTNA 5BPPA 3FUJA 3B7SA 3PEUB 1FVHA 4F1PA 2DYRE 5DIZA 3QOUA 4G26A 2XGOA 3T8KA 4UWLA 3BQOA 1KZPA 2BEDA 1V55E 2F8XK 1OCCE 3UKRG 3D9OA 3GZ2A 1N4PA 3NOCD 2P9NG 1GW6A 2XGMA 3HHMA 4L23A 2C0LA 4PUCA 3PZ1A 4U63A 1RW2A 3D9JA 2WXGA 3UMVA 3UM2A 4A1GA 4IRUA 3RRNB 3HG0D 1FPPA 2XHEA 3EDTB 4G11A 3FEYA 4JA9A 3SNXA 2XQ0A 4HRMB 3W9FA 3JXIA 5AENA 3O4ZA 1NZNA 2DCPA 1FT2A 1XGWA 5D66A 3RAUA 4B8AA 4AV7A 4UI9J 2VSNA 3EU9A 1BLXB 3CIAA 3FWVA 3L13A 3ZUVB 2EIME 4BX9A 3Q9UC 4J8EA 2Y1LE 3C98A 4U8YD 5ENRD 1MX4A 4U96D 3MV3B 3LPZA 2ZGDA 1Z6TA 1QQEA 5AARA 1H6OA 1LD7A 1WM5A 5B1AE 3SY2A 2A4ZA 5E75A 4LERA 3PVLA 4JZYA 2R17C 1S70B 3IHVA 3E34A 3AG2E 4BSZB 4LUNU 3TWTA 4J0UA 2CG2A 4U0UA 2AXVA 5LP0A 3MEKA 2P9SG 2VYIA 2KZTA 2J4BA 3CK7A 5T3RA 1S0PA 1TN6A 2YHEA 1E7UA 1DCEA 1N52A 2KCVA 1JUQA 4XZ4A 2EQXA 3ML9A 2A5UA 4GYOA 4BY6A 1O1TA 4C9BB 1MZCA 3VLEA 3I3NA 3OAWA 3HXDA 4YDYA 2GRPB 3FTVA 4F7AA 4GTTA 2LO6A 4GA0A 3Q73A 1TR4A 3APDA 2VTBB 4L1BA 5HI7A 3TGOA 4TUMA 4FJYA 1H6KA 2C0MA 5EYPF 3UT8A 3S7JA 3PREA 5ANLA 2GRNB 3ZKJA 4N3AA 2BTDA 4A3TA 4DRXE 1N94A 3FU6A 2RKKA 3KSLA 3PE3A 4K03A 5JJ7A 4U8VD 4ME2A 4M3OA 1OWLA 1MQSA 3G2UA 1E8ZA 1IHBA 3LJ3A 3Q5MA 4BEPA 5EILA 1JPLA 5KWDA 3PH0C 4I2WA 3CVUA 4DJAA 3TWUA 4CDMA 2EIJE 5KCMA 3ZRHA 2VSXE 3AG4E 4QFVA 4BWRA 2KXPC 4MS6A 1JCQA 2L9BA 1NP7A 1PY1A 2V4HC 4LCTA 3I4RB 3AU4A 3ZHEA 3CQCB 4WWNA 3MX3A 5D0OD 2XS8A 3ZYQA 3B7UX 2DVWA 4HFGA 3VLFA 5EN5D 4B8CB 2CHWA 2B0OE 1A5EA 3BG0B 2LAHA 2XCBA 2J8SD 4GZ6A 1TNUA 3NBNB 2YNQA 3GYZA 3FUKA 4CEMA 4DI3A 3ZN3A 1HF8A 3OXFA 3QC1A 3FUEA 5FZQA 4EECA 4K0RA 2J4DA 4GZ5A 5CRVA 2XENA 3QARA 2Q7FA 3L08A 4G23A 5LCWJ 3TWXA 1K1AA 4FJZA 2V5QC 3UM0A 5LX8A 5FT9A 5FQ7A 3RKVA 3VLDA 3T5VA 4DLQA 2PL2A 1LD8A 2VGEA 4BESA 3EHQA 4KVMA 4XI0A 4E85A 2OV8A 5A23A 2ZISA 1N4QA 3HXBA 4HI9A 5HRYA 3NOGD 4GTPA 2WXRA 4PH4B 5ENSD 4Q94A 2IO2C 3LCAA 3LYAA 4D10C 2BKGA 1N54A 2V5FA 3NF1A 5CERB 3DSTA 2FBNA 3PDNA 3CVLA 2QZAA 3MZLB 4L9PA 2Y4UA 3G2WA 3DWLG 4URKA 4OAVB 3Q47B 2CHZA 5FZRA 2BUGA 3ZXPA 2J49A 3V79K 3ZIMA 1LTXA 4BX8A 1AP7A 2LUHA 3NAWA 5FQ4A 5ENNA 1HZ4A 3LVRE 2LXMA 3Q78A 4OVUA 3HRAA 3MJWA 4ATZD 1IYGA 4GTRA 4JHJA 3DXMG 3RU0A 5FZSA 3ULYA 3FUFA 4P29A 3IBEA 1YA0A 1G3NB 4GTVA 3ESLA 4XE0A 2J08A 4U0SA 4HQDA 2AXUA 3FUIA 4ANVA 1Z3XA 4UQXA 3FTZA 4GZ3A 3ASFA 1H2UA 3U3WA 2R05A 3EHRA 1OCRE 4UI9C 2V0PA 3CVXA 1X81A 1MHQA 2QFCA 4G24A 4FADA 1O5MA 3V30A 4JVSA 3LEWA 3RJVA 5E76A 2IF4A 1BPOA 4N5CA 4AVXA 4WNFA 2X3MA 1SA4A 4U07A 3Q79A 4N39A 1DCQA 4KZ0A 5D2MC 3HVEA 3JQ1A 2R03A 4UWHA 5FWQA 4UWFA 3FH5A 5KJLA 3J5PA 3FEXA 1AWCB 3SGHA 2OVBA 3IKOB 2DZOA 4OAUC 5ITZF 3S2AA 1UN8A 1U3CA 2YHCA 5ARGA 3SO8A 3L9TA 2WXLA 3T9KA 3HVEB 3DEPA 4GMRA 3PRZA 4L2LA 3NZUA 5FQ6A 3E4BA 2Y0BG 1JWFA 4XI9A 2WXFA 1DVPA 2P9KG 4IN3B 1FCHA 5AYWD 1EPUA 4PDXA 3SBTB 4OVVA 2AXZA 1TN8A 1HX8A 3LS8A 3QB2A 2R5SA 2VQ2A 4KBQA 3CV0A 4IULA 2P9UG 4G1TA 4GTOA 4HXIA 3TJPA 3FUNA 2HE0A 1MX2A 3IV0A 3LY7A 2XRZA 4AY6A 4GTSA 4LRZA 1PAQA 3UTMA 4JB8P 1E90A 2RG8A 2IJGX 4JPSA 1H0AA 3DSWA 4U95D 3Q7FA 4U8HA 1IHGA 3LJNA 4CDRA 3CLJA 5T8IA 1EDUA 4MRUA 3CVYA 2XGSA 3P2BA 4YVOA 3UI2A 1XNFA 4I6JA 1SA5A 1TNBA 2J9QA 4JC8A 3TL5A 5BV0A 4FP7A 3SZ7A 2PM6A 1PC2A 5CBNA
chains in the Genus database with same CATH topology
2XPZA 2WMOA 4I17A 1ELKA 2JLBA 2ZU6B 4N3AA 4EPZA 5G55A 5M72A 2BTDA 4A3TA 3LXUX 4JEUA 3ESKA 3CR3A 3QNKA 5DBKA 1HG5A 3MKRA 2LNIA 3ZXSA 3N71A 4B94A 4O6FA 5BV1A 2PM7A 3FU6A 3JYSA 3PE3A 4K03A 1LF8A 1ZU2A 2X6KA 1TJCA 3R7QA 4HOQA 5JJ7A 3MYVA 5EX3A 4ME2A 3MCXA 4M3OA 5EKQD 2KATA 1OWLA 1MQSA 3G2UA 1E8ZA 3LY8A 2X6JA 2JEKA 4BT8A 3Q15A 2XPYA 2OOEA 3P1UA 3CVWA 2FEZA 2V4LA 4L2YA 3LJ3A 4C0EA 3SFZA 4E6HA 3Q5MA 3DPDA 3Q4AB 2I1KA 5C2YA 3SF4A 4JA7A 3ZGQA 1E7VA 1OWNA 3QJZA 4BTAA 1INZA 3ONLA 4GA1A 4U04A 1JPLA 2L0TB 1E8XA 1UG3A 2IU1A 3PH0C 4I2WA 4HORA 3UX4A 2YINA 3CVUA 4CCAA 4F53A 3TAXA 3RRUA 4AOFA 4DJAA 3URZA 3I4GA 1WAO1 3ZYLA 3CVVA 2RD0A 3SHFA 4ATGA 2VGYA 4KVOA 4HOTA 2XCCA 2WXPA 4BSXA 2FI7A 3OXLA 4APOA 4GU5A 4CDMA 3Q49B 3S7DA 3FTWA 5KCMA 3ZRHA 3ZYMA 5FJYA 3U66A 4JHRA 1KT1A 3EHNA 2VSXE 4A1SA 4UI9K 4AIFA 3L22A 4QFVA 3BEEA 4BWRA 4Y6CA 2MHKA 1IQRA 3FUMA 2PQRA 4MS6A 4U0ZA 5CMWA 3G2SA 2ONDA 2L9BA 1NP7A 3B13A 3CHMA 1PY1A 5A6CA 1U3DA 4Q69A 2XRYA 3CVQA 4LCTA 3OXGA 3S7FA 3FFLA 3L54A 4BFRA 4OYSA 4CT4A 3L6AA 2KM4A 3U4TA 3I4RB 3AU4A 4FLHA 3TG4A 3ZHEA 2KCLA 4AJWA 4I2ZA 2I6HA 3CQCB 5LCWC 4KYOB 3EHMA 4WWNA 3MX3A 3QWVA 5D0OD 4DI4A 3ZYQA 4R7LA 3SBSA 2WVIA 3B7UX 3ONKA 3WXXA 3K9IA 4HFGA 3VLFA 4CT0A 3RRMB 3FUDA 5BT1A 2WXOA 1HE8A 3QKYA 5JJTA 4I1OB 4B8CB 2YQ8A 2CHWA 2XPIA 1NA0A 3VTYA 4MLPA 2FF4A 1ELRA 3BG0B 3DBSA 2LAHA 4GPKA 2IOLA 2XCBA 3AS4A 3CHOA 3RO3A 3HYMB 3QWWA 4GZ6A 1Y6IA 1TJFA 3CK8A 2LAIA 3HDXA 3FULA 2HO1A 2YNQA 4J8FA 4ACLA 4DPRA 3GYZA 3FUKA 4CEMA 4DI3A 2WB2A 5J90A 3FP3A 3ZN3A 3TXNA 1WY6A 1HF8A 2J07A 1KT0A 1L5JA 3OXFA 3QC1A 5BNWA 3FUEA 2MOWA 3D9NA 5FZQA 1X5BA 4EECA 2KZTB 2X6IA 4PS3A 2DIWA 3PZDA 4UWGA 1SQMA 4K0RA 2VJ8A 3AS8A 2J4DA 1UN9A 4GMJA 4GZ5A 4I1MA 1DNPA 4ANUA 3TG5A 4HLEA 3QARA 4HOUA 2Q7FA 3D9MA 3GZSA 5C1DA 3APFA 2NC9A 3UPVA 3L08A 3APCA 4G23A 1TEZA 2R59A 5LCWJ 3CQGB 2WXKA 1ELWA 4GZCA 2HM8A 3NZSA 4EZLA 4FJZA 5LX8A 4ILIA 5G04C 5FT9A 4HOSA 3KS2A 2CFZA 1UJKA 2UWJG 2ILRA 5FQ7A 4N3CA 2FO7A 4WUYA 2WPVA 4ANWA 3FTUA 5G05J 3RKVA 4DK5A 2AVPA 4KZCA 3VLDA 2L6JA 1NA3A 3T5VA 4DLQA 2PL2A 4RG9A 2HR2A 4NRHB 2P58C 4KVMA 4XI0A 1E8WA 4C0MA 2OV8A 4IYPA 4E85A 4KXKB 4WNGA 3ML8A 2FULA 4WWOA 3L17A 2GW1A 2VGXB 3NQPA 4F3VA 4AM9A 5CHEE 5A23A 3PNLB 4XIFA 1UW4B 4NQ0A 2PZIA 4NURA 4Y6WA 2V8SE 2X6FA 5HQ8A 3CHRA 3D9IA 2WXRA 4A3VA 4PH4B 4MKTA 4Q94A 2I1JA 2WM9A 4GYYA 2NXPA 2KC7A 2IONA 4NACA 2M63A 3LCAA 3PNTB 3LYAA 1KLXA 4D10C 2UY1A 4I9EA 5T4YA 1N54A 2V5FA 5JHAA 3JUIA 2NSZA 3JCKC 3NF1A 3D9LA 2LSUA 4XKBA 2FBNA 3SI5A 3PDNA 2IFUA 3CVLA 4JEHA 3CGHA 5KJKA 3MZLB 4A55A 4N2QA 4BTBA 4WAFA 2Y4UA 3G2WA 1OWOA 3CSFA 5CMYA 3AS5A 4URKA 4LEUA 2E0IA 4UQYA 3CK9A 3PUKA 3Q47B 5EX0A 2X38A 2CHZA 5FZRA 4N3BA 2BUGA 2X6HA 3B7RL 3I5PA 1HG2A 4FA6A 4EQFA 4BT9A 2J49A 4Q96A 3U64A 3SD5A 3ZIMA 2C2LA 4BX8A 1EYHA 1IQUA 2CHXA 2CG3A 1VDYA 3CVNA 4FHKA 3PEVB 3MV2B 2UY1B 4J8DA 4XX5A 5FQ4A 5ENNA 3UT7A 4AEZC 5LOZA 4FLBA 4YVQC 5CCMA 1HZ4A 1HU3A 3PE4A 3LVRE 4OVUA 4EBAG 3MGBA 5A7DB 4CRWA 3RK6A 4RSYA 1HXIA 3MJWA 4ABNA 2BF0X 2LSVA 1IYGA 4GCNA 1W3BA 4H7XA 4JHJA 1E96B 3PS6A 3CKBA 4WNEA 4I43A 3RU0A 3ZEFA 3G2TA 5JJ6A 3G2VA 5FZSA 3FU0A 3CEQA 3FUFA 3LVQE 2WXIA 3LY9A 2XEVA 4EZJA 4P29A 3IBEA 2WQ6A 3OTNA 5BPPA 1YA0A 3FUJA 4W9RA 3T5XA 2Y4TA 2WXHA 3B7SA 3MA5A 3ESLA 4XE0A 2J08A 3FH8A 3PEUB 3ZHEB 1FVHA 2VTBA 3ASGA 4U0SA 2AXUA 1HFAA 3FUIA 4ANVA 1Z3XA 4UQXA 3JQ0A 5DIZA 3O48A 3FTZA 1OUVA 3QOUA 4G26A 2XGOA 4UWLA 2GRMA 3EIQC 3HIZA 3ZYKA 4GZ3A 1HO8A 1H2UA 3ASFA 4L7TA 4GA2A 3UQ3A 3U3WA 3B7TA 5D0QD 3D9KA 3CVPA 5G2NA 4PS8A 4WWPA 4UI9C 5FTPA 4GB9A 3FTXA 2V0PA 2Y3AA 3D9OA 4I1AA 3AU5A 5BUZA 5KJMA 3CVXA 3QAQA 3GZ2A 1QZ2A 1MHQA 4RVBA 3VTXA 1GW6A 2QFCA 2XGMA 3QWPA 2GGFA 3LKUA 4FC8A 4G24A 4FADA 5J08A 3HHMA 4L23A 2C0LA 4PUCA 4JVSA 4U63A 3BG1B 3LEWA 1ZBPA 3D9JA 3MKQA 3RJVA 3QK0A 2WXGA 5E76A 3UMVA 2IF4A 4A1GA 4FHJA 4IRUA 2WQHA 2PQNA 1BPOA 4N5CA 4AVXA 4WNFA 2WXQA 1SZAA 2X3MA 2WXNA 4I6GA 3RRNB 4TUUA 4U07A 2XHEA 3EDTB 4J8SA 4N39A 4G11A 3ZFWA 4WNDA 3FEYA 4JA9A 4RG6A 3SNXA 2XQ0A 4KZ0A 2WQ7A 3HVEA 3CSTA 4G25A 4GAAA 3ULQA 3JQ1A 4B89A 4UWHA 5FWQA 4JW1A 5AENA 3KAEA 4UWFA 3FH5A 3O4ZA 3ZVVA 5KJLA 1NZNA 1QNFA 3FEXA 4ACKA 2DCPA 3EJNA 2VSOE 4AY5A 1EF1C 1XGWA 2WXMA 3SGHA 2OVBA 5ARFA 1JWGA 3IKOB 5LFAA 4FULA 1OWMA 3CKCA 4B8AA 4FU3A 3MKQB 3S2AA 4AV7A 1UN8A 1U3CA 2YHCA 5ARGA 5AIJA 4UI9J 2VSNA 3T8MA 4JHKA 4KT6B 4V3IA 5KJNA 2WXLA 3CIAA 3FWVA 5G04J 3L13A 3GW4A 4PS7A 3UUXA 3FH7A 3R9AB 3GZ1A 3HVEB 1A17A 2L0IA 2QY7A 3PRZA 4BX9A 4J8EA 4L2LA 4AXHA 3C98A 3NZUA 5FQ6A 3ZPJA 3E4BA 2DBAA 4TV3A 1JWFA 3MV3B 3KD7A 3LPZA 4XI9A 4N2SA 3CHPA 1Z6TA 2WXFA 1DVPA 3S7BA 2WMNA 1FVFA 1H2VC 1QQEA 4IN3B 1FCHA 4TRQA 5ANRA 3FTYA 2I2OA 5AYWD 2VSYA 3LDZA 3CHSA 1WM5A 5JHBA 1EPUA 2A4ZA 5E75A 2IQCA 4LERA 4PDXA 3FHEA 5AJLA 5BW8C 3FU5A 4OVVA 3IEGA 4KMOA 3SBTB 3ZW3A 2AXZA 3PVLA 3FUHA 4JZYA 4EBAA 1HX8A 3LS8A 2R17C 3QB2A 2R5SA 3ENEA 5AJDA 2VQ2A 4KBQA 3CV0A 3IHVA 4IULA 3FU3A 3CHQA 1Z3YA 4G1TA 4DLOA 4GZDA 2HYZA 1SZ9A 4HXIA 3FTSA 3TJPA 3FUNA 1UJJA 3IHYA 4LUNU 3KEZA 2KCKA 4J0UA 2CG2A 3IV0A 4U0UA 2AXVA 3LY7A 5LP0A 2OVFA 2MRIA 3D9PA 4F1SA 3MEKA 3D3MA 1HS6A 2VYIA 4JL0A 2KZTA 2XRZA 4AY6A 2J4BA 4HVBA 4LRZA 1PAQA 3RO2A 4ANXA 1Y8MA 4JXTA 3CK7A 4GCOA 5T3RA 1S0PA 1E90A 2YHEA 2I9CA 4UQZA 1E7UA 4ILHB 1N52A 3PUJA 5G05C 1E8YA 4CDNA 2RG8A 2IJGX 2KCVA 3ASHA 1H2TC 1JUQA 4YNDA 3UT4A 3FDHA 4JPSA 4XZ4A 1H0AA 1P5QA 2IOSA 1B89A 2CFUA 4U8HA 3L16A 2EQXA 3ML9A 2A5UA 4GYOA 4ILGA 1IHGA 4BY6A 4AP2A 4C9BB 3VLEA 4G2VA 3RIBA 4CDRA 5EDSA 3CLJA 4CGVA 3I3NA 3OAWA 5T8IA 1EDUA 2E2EA 4I9CA 4MRUA 4UWKA 2WXJA 3FTVA 3CVYA 2XGSA 3P2BA 3TXMA 4F7AA 4CGWA 2AWIA 3ASDA 2LO6A 2AW6A 4GA0A 4XKCA 4YVOA 3U9WA 4GYWA 3APDA 2VGXA 3FY4A 2GRLA 1XNFA 5FQ8A 4I6JA 2VTBB 4L1BA 2J9QA 4JC8A 3TL5A 4B0ZA 4EZKA 5HI7A 4HS2A 4FP7A 4APFA 5BV0A 3TGOA 3R7RA 4J6IA 3QDNA 3SZ7A 2PM6A 1HH8A 4FJYA 1H6KA 4I6EA 2C0MA 2J09A 4H7YA 4GMLA 3EIJA 3UT8A 1PC2A 3PREA 3S7JA 5ANLA 1OWPA 5CCLA 1H19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I17 A;  2JLB A;  4N3A A;  5M72 A;  3ESK A;  5DBK A;  3MKR A;  2LNI A;  3N71 A;  4B94 A;  4O6F A;  3JYS A;  3PE3 A;  1ZU2 A;  1TJC A;  4HOQ A;  5JJ7 A;  5EX3 A;  4ME2 A;  5EKQ D;  2KAT A;  3LY8 A;  4BT8 A;  3Q15 A;  2OOE A;  2FEZ A;  3Q5M A;  3Q4A B;  3SF4 A;  4JA7 A;  3ZGQ A;  4BTA A;  4GA1 A;  4U04 A;  4I2W A;  4HOR A;  3TAX A;  3URZ A;  1WAO 1;  2VGY A;  4HOT A;  2XCC A;  2FI7 A;  3OXL A;  4APO A;  3Q49 B;  3S7D A;  5FJY A;  4JHR A;  1KT1 A;  4A1S A;  4UI9 K;  4AIF A;  3BEE A;  4BWR A;  4Y6C A;  2MHK A;  2PQR A;  4U0Z A;  2OND A;  5A6C A;  3CVQ A;  3OXG A;  3S7F A;  3FFL A;  3U4T A;  3ZHE A;  3TG4 A;  2KCL A;  4I2Z A;  2I6H A;  5LCW C;  4KYO B;  3QWV A;  5D0O D;  3WXX A;  3K9I A;  5BT1 A;  3QKY A;  5JJT A;  2YQ8 A;  2XPI A;  1NA0 A;  3VTY A;  2FF4 A;  1ELR A;  4GPK A;  2XCB A;  3AS4 A;  3RO3 A;  3HYM B;  3QWW A;  4GZ6 A;  3CK8 A;  4J8F A;  2HO1 A;  3GYZ A;  3FP3 A;  3ZN3 A;  5BNW A;  1KT0 A;  3OXF A;  5FZQ A;  3AS8 A;  4GZ5 A;  3TG5 A;  4HOU A;  2Q7F A;  3UPV A;  5C1D A;  2NC9 A;  4G23 A;  5LCW J;  1ELW A;  5G04 C;  5FT9 A;  4HOS A;  3KS2 A;  2UWJ G;  4N3C A;  2FO7 A;  4WUY A;  2WPV A;  5G05 J;  3RKV A;  2AVP A;  2L6J A;  1NA3 A;  2PL2 A;  4RG9 A;  2HR2 A;  4NRH B;  2P58 C;  4XI0 A;  4KXK B;  4WNG A;  2GW1 A;  2VGX B;  4F3V A;  4AM9 A;  5CHE E;  4XIF A;  4NQ0 A;  2PZI A;  4Y6W A;  5HQ8 A;  4GYY A;  2KC7 A;  3LCA A;  3LYA A;  1KLX A;  2UY1 A;  4I9E A;  2V5F A;  3NF1 A;  2LSU A;  2FBN A;  3PDN A;  2IFU A;  3CVL A;  5KJK A;  4N2Q A;  4BTB A;  2Y4U A;  3AS5 A;  4LEU A;  4UQY A;  3CK9 A;  3Q47 B;  5EX0 A;  5FZR A;  4N3B A;  2BUG A;  4EQF A;  4BT9 A;  2C2L A;  3CVN A;  3MV2 B;  2UY1 B;  4J8D A;  5CCM A;  4YVQ C;  1HZ4 A;  3PE4 A;  5A7D B;  1HXI A;  4ABN A;  2LSV A;  1IYG A;  4GCN A;  1W3B A;  4H7X A;  1E96 B;  3CKB A;  4WNE A;  3RU0 A;  5JJ6 A;  5FZS A;  3CEQ A;  3LY9 A;  2XEV A;  1YA0 A;  4W9R A;  2Y4T A;  3MA5 A;  3ZHE B;  3ASG A;  4U0S A;  4UQX A;  5DIZ A;  3O48 A;  3QOU A;  1OUV A;  4G26 A;  2XGO A;  4GZ3 A;  3ASF A;  3UQ3 A;  3U3W A;  4GA2 A;  5D0Q D;  3CVP A;  4UI9 C;  5FTP A;  4I1A A;  5KJM A;  3GZ2 A;  1QZ2 A;  3VTX A;  2QFC A;  2XGM A;  3QWP A;  3LKU A;  4G24 A;  2C0L A;  1ZBP A;  3RJV A;  2IF4 A;  2WQH A;  2PQN A;  4N5C A;  4WNF A;  4U07 A;  3EDT B;  4N39 A;  3ZFW A;  4WND A;  4JA9 A;  4RG6 A;  4G25 A;  3ULQ A;  3KAE A;  5KJL A;  1NZN A;  4AY5 A;  5ARF A;  3CKC A;  2YHC A;  5ARG A;  4UI9 J;  2VSN A;  5KJN A;  3FWV A;  5G04 J;  3GW4 A;  3UUX A;  3R9A B;  3GZ1 A;  1A17 A;  4J8E A;  3ZPJ A;  3E4B A;  2DBA A;  3MV3 B;  3KD7 A;  3LPZ A;  4XI9 A;  4N2S A;  3S7B A;  1QQE A;  4IN3 B;  1FCH A;  5AYW D;  2VSY A;  1WM5 A;  5BW8 C;  3IEG A;  2R5S A;  2VQ2 A;  4KBQ A;  3CV0 A;  4G1T A;  2HYZ A;  2KCK A;  4J0U A;  4U0U A;  3LY7 A;  3MEK A;  2VYI A;  4JL0 A;  4AY6 A;  3RO2 A;  1Y8M A;  3CK7 A;  4GCO A;  4UQZ A;  5G05 C;  2KCV A;  3ASH A;  4YND A;  1P5Q A;  1B89 A;  4GYO A;  1IHG A;  4G2V A;  3RIB A;  4CDR A;  4CGV A;  2E2E A;  4I9C A;  2XGS A;  4CGW A;  3ASD A;  4GA0 A;  4YVO A;  4GYW A;  2VGX A;  1XNF A;  2J9Q A;  5HI7 A;  3TGO A;  3QDN A;  3SZ7 A;  1HH8 A;  2C0M A;  4H7Y A;  1PC2 A;  3S7J A;  5CCL A; 
#chains in the Genus database with same CATH topology
 1ELK A;  4X8Q A;  4EPZ A;  5G55 A;  3LXU X;  3ESK A;  3CR3 A;  3JYS A;  2X6K A;  3UIN C;  3R7Q A;  4DX2 A;  2KAT A;  5ENP D;  3LY8 A;  2X6J A;  2JEK A;  2XPY A;  3P1U A;  2FEZ A;  2V4L A;  4C0E A;  2ETC A;  3SFZ A;  5HS0 A;  5C2Y A;  3ZGQ A;  4BTA A;  1INZ A;  3ONL A;  1QYM A;  2EIK E;  1E8X A;  2YIN A;  4F53 A;  4AOF A;  3RRU A;  3KEA A;  1WAO 1;  2RD0 A;  4BSX A;  2FI7 A;  4O1P A;  4APO A;  4NIK A;  3PZ3 A;  3ISM C;  5FJY A;  2QYU A;  4A1S A;  4AIF A;  2JAB A;  3AG1 E;  2MHK A;  5AQA A;  2OND A;  5A6C A;  2XRY A;  3CVQ A;  5BXU A;  1YCS B;  1O1S A;  4AJW A;  1U2V G;  5LCW C;  4KYO B;  3QWV A;  5FIN A;  3K9I A;  2LXL A;  5BT1 A;  5B1B E;  4N5Q A;  3VTY A;  4HB5 A;  3RO3 A;  3HYM B;  1Y6I A;  1TJF A;  3HDX A;  3C3Q A;  2WB2 A;  4LNB A;  2J07 A;  5BNW A;  1KT0 A;  2MOW A;  3D9N A;  4G8K A;  2KZT B;  4PS3 A;  3PZD A;  3BU8 A;  4GMJ A;  4I1M A;  1OY3 D;  1DNP A;  3TG5 A;  3GZS A;  2NC9 A;  4EHM A;  3CQG B;  5KNG A;  3UIP C;  5G04 C;  4HOS A;  3E33 A;  2ILR A;  2WPV A;  2HR2 A;  1BD8 A;  4U7E B;  4IYP A;  4WNG A;  2FUL A;  2F37 A;  4DX5 D;  4LG6 A;  3NQP A;  1YYH A;  3AAA C;  4CZ2 D;  3HXF A;  3PNL B;  4DX7 D;  1N0Q A;  4NUR A;  4Y6W A;  3CHR A;  2XS1 A;  2NXP A;  2KC7 A;  2ETA A;  4NAC A;  5T4Y A;  3E37 A;  3JUI A;  3JCK C;  2LSU A;  3ZNG A;  4GTM A;  3E30 A;  4O60 A;  1V54 E;  4BTB A;  3CSF A;  5CMY A;  1RZ4 A;  1BU9 A;  4HLL A;  5EX0 A;  2XEE A;  3V2O A;  2EIL E;  1HG2 A;  4Q96 A;  3SD5 A;  3B7B A;  2C2L A;  4FHK A;  4AEZ C;  3UT7 A;  5CCM A;  4FLB A;  4YVQ C;  3PE4 A;  3V2X A;  4EBA G;  3MGB A;  3RK6 A;  1O1R A;  1N4R A;  2BF0 X;  2LSV A;  4H7X A;  3G2T A;  2XEV A;  2WQ6 A;  4W9R A;  3T5X A;  2Y4T A;  3Q75 A;  2WXH A;  1WG0 A;  3MA5 A;  3FH8 A;  3ZHE B;  5CBO A;  3ASG A;  1HFA A;  3SQV A;  3JQ0 A;  5BXO A;  2GRM A;  3HIZ A;  3TWR A;  3ZYK A;  1HO8 A;  3B7T A;  3CVP A;  5G2N A;  5ENO D;  1NFI E;  2PNN A;  3J5Q B;  4GB9 A;  4I1A A;  5BUZ A;  5KJM A;  4HRL A;  4HBD A;  4TXQ A;  1QZ2 A;  2XZD G;  3VTX A;  3C5R A;  2P9L G;  5J08 A;  3QK0 A;  2PQN A;  1SZA A;  2WXN A;  4I6G A;  4WND A;  4RG6 A;  4A63 B;  4G25 A;  4GAA A;  3ULQ A;  4B89 A;  3KAE A;  3ZVV A;  3RSE G;  1QNF A;  2H6F A;  3EJN A;  2VSO E;  4AY5 A;  2EIN E;  1JWG A;  5LFA A;  3CKC A;  1H6P A;  1OCO E;  2DYS E;  1N4S A;  4JHK A;  2H6H A;  1BI8 B;  4V3I A;  5KJN A;  5G04 J;  3GW4 A;  4PS7 A;  3UUX A;  3FH7 A;  1A17 A;  2L0I A;  2QC9 A;  4AXH A;  3ZPJ A;  2DBA A;  4N2S A;  1K1B A;  3CHP A;  4LSZ E;  3DSX A;  5B3S E;  4TRQ A;  5ANR A;  3TWS A;  2I2O A;  3LDZ A;  3CHS A;  2IQC A;  5AJL A;  5BW8 C;  3IEG A;  4KMO A;  3ZW3 A;  3FUH A;  4EBA A;  4DUI A;  5AJD A;  1TN7 A;  3FU3 A;  1TNZ A;  3C72 A;  4GZD A;  2HYZ A;  3IHY A;  5CEC B;  3KEZ A;  2KCK A;  1S63 A;  3D9P A;  3V31 A;  4F1S A;  3EUV A;  1HS6 A;  4JL0 A;  4HVB A;  4ANX A;  2AJA A;  3ZU7 B;  3HXE A;  4ILH B;  5G05 C;  3ASH A;  4YND A;  3FDH A;  1B89 A;  2CFU A;  1K3Z D;  1QBQ A;  4QQI A;  4AP2 A;  4J7W A;  4G2V A;  4UWK A;  2WXJ A;  3TXM A;  4CGW A;  2P2C P;  2AWI A;  4XKC A;  2XEH A;  2VGX A;  2GRL A;  5FQ8 A;  3AG3 E;  4B0Z A;  4F6R D;  4APF A;  5CED B;  5IY5 E;  3R7R A;  4J6I A;  5KNH D;  3QDN A;  1OCZ E;  1HH8 A;  4I6E A;  2J09 A;  1NI1 A;  4H7Y A;  4GML A;  3EIJ A;  1OWP A;  2RFM A;  1H19 A;  4I17 A;  2JLB A;  2ZU6 B;  4JEU A;  5DBK A;  3MKR A;  2LNI A;  3N71 A;  2PM7 A;  4RLY A;  1ZU2 A;  4RQI A;  1TJC A;  3TWQ A;  4HOQ A;  5EX3 A;  1D9S A;  2Y69 E;  4L2Y A;  5AQ9 A;  4TXR A;  1OXJ A;  3SF4 A;  1E7V A;  3PZ4 A;  4U04 A;  2L6B A;  1UG3 A;  3R9M A;  2IEJ A;  4CCA A;  3URZ A;  3SHF A;  4ATG A;  4CYM D;  1BI7 B;  2WXP A;  3OXL A;  2P9I G;  4GU5 A;  2A5E A;  3Q49 B;  3FTW A;  3ZYM A;  2P9P G;  4JHR A;  3U66 A;  1KT1 A;  5H7P A;  3EHN A;  3BEE A;  4Y6C A;  1IQR A;  3CHM A;  4Q69 A;  3OXG A;  2GRR B;  3L54 A;  4BFR A;  4OYS A;  4BET A;  2KM4 A;  3U4T A;  3ABK E;  4I2Z A;  3EHM A;  4DI4 A;  3SBS A;  2WVI A;  5AQB A;  3WXX A;  1SVX A;  4CT0 A;  1HE8 A;  3QKY A;  5JJT A;  3F6Q A;  1NA0 A;  1D8D A;  2FF4 A;  3UIO C;  4GPK A;  1MX6 A;  3AS4 A;  3CHO A;  3QWW A;  3HXC A;  5EYL A;  3FUL A;  2ZIR A;  4ACL A;  1WY6 A;  3W9G A;  4LNU D;  2KBX A;  1JCS A;  5EID A;  3D9M A;  3UPV A;  5C1D A;  3APC A;  2R59 A;  3UM1 A;  2WXK A;  1ELW A;  1MJ0 A;  2HM8 A;  3Q7A A;  4ILI A;  5JMN D;  3KS2 A;  2UWJ G;  5AN8 A;  4WUY A;  3FTU A;  5G05 J;  3ULE G;  2L6J A;  1NA3 A;  4RG9 A;  4NRH B;  1E8W A;  5ENQ D;  2FO1 E;  4KXK B;  3ML8 A;  4WWO A;  3L17 A;  3DEO A;  4AM9 A;  5CHE E;  4NQ0 A;  2X6F A;  3ASO E;  5HQ8 A;  1N9A A;  4A3V A;  3DXK G;  2I1J A;  4J8Y A;  2WM9 A;  4GYY A;  2H6I A;  1KLX A;  2UY1 A;  4I9E A;  5JHA A;  3D9L A;  4M7C A;  3DSS A;  2IFU A;  3BUA A;  1OWO A;  3AS5 A;  4DX6 D;  2E0I A;  3DSV A;  3DRA A;  4N3B A;  3B7R L;  2ETB A;  4FA6 A;  4BT9 A;  3U64 A;  1IQU A;  1EYH A;  1VDY A;  3PEV B;  4XX5 A;  2UY1 B;  4J8D A;  5LOZ A;  1HU3 A;  1IXV A;  3TWV A;  4ABN A;  3WG7 E;  1W3B A;  4WNE A;  1N11 A;  4I43 A;  5JJ6 A;  3G2V A;  1Z5S C;  3FU0 A;  3LVQ E;  2WXI A;  4EZJ A;  5AQ7 A;  1YMP A;  1ZB1 A;  2VTB A;  4K5A B;  2RFA A;  3O48 A;  1OUV A;  3EIQ C;  3UQ3 A;  4L7T A;  4GA2 A;  5D0Q D;  3D9K A;  4PS8 A;  4WWP A;  2GRQ B;  5FTP A;  3FTX A;  2Y3A A;  3JXJ A;  3KSQ A;  3AU5 A;  1OT8 A;  3QAQ A;  3DPY A;  4RVB A;  3QWP A;  4FC8 A;  2GGF A;  3UXG A;  3LKU A;  4YDO A;  3BG1 B;  3MKQ A;  1ZBP A;  2B6C A;  4FHJ A;  2WQH A;  2QYJ A;  2WXQ A;  4TUU A;  4J8S A;  3B95 A;  3ZFW A;  2DZN A;  4ZHB A;  2WQ7 A;  3CST A;  4JW1 A;  3DSU A;  4ACK A;  4XEI G;  4B93 B;  1EF1 C;  2WXM A;  2R02 A;  5ARF A;  1Q2Z A;  4FUL A;  1OWM A;  3SFX A;  4FU3 A;  3MKQ B;  4TXP A;  5AIJ A;  3T8M A;  4G8L A;  4KT6 B;  3C3R A;  1TNY A;  3R9A B;  3GZ1 A;  3EU5 A;  4K5C A;  2QY7 A;  1S64 A;  2F0Y A;  5ENT D;  4TV3 A;  3KD7 A;  3S7B A;  2WMN A;  1FVF A;  1H2V C;  3FTY A;  2VSY A;  5JHB A;  3FHE A;  3FU5 A;  3ENE A;  3CHQ A;  1Z3Y A;  4YDW A;  4DLO A;  1SZ9 A;  3E32 A;  5KBA A;  3FTS A;  1UJJ A;  2OVF A;  2MRI A;  3D3M A;  4YDE A;  5CRU A;  3RO2 A;  1Y8M A;  4JXT A;  2GRO B;  2OEW A;  4GCO A;  2I9C A;  3ABM E;  4UQZ A;  4Z68 A;  3PUJ A;  1E8Y A;  4CDN A;  1H2T C;  3UT4 A;  1P5Q A;  2IOS A;  1MYO A;  3L16 A;  4ILG A;  3RIB A;  5EDS A;  4CGV A;  2E2E A;  4I9C A;  4O1O A;  3ASD A;  2AW6 A;  3U9W A;  4GYW A;  1D8E A;  3FY4 A;  4EZK A;  3ABL E;  4HS2 A;  4GPM A;  3Q9N C;  5CEA A;  2MYO A;  5CCL A;  2XPZ A;  2WMO A;  5M72 A;  3QNK A;  1HG5 A;  4HRN A;  3ZXS A;  1FT1 A;  4O6F A;  4B94 A;  5BV1 A;  4UUC A;  5EIB E;  1LF8 A;  3MYV A;  3MCX A;  5EKQ D;  2ZGG A;  4BT8 A;  3Q15 A;  3CVW A;  2OOE A;  4E6H A;  3DPD A;  3Q4A B;  2I1K A;  1KZO A;  4JA7 A;  1OWN A;  3QJZ A;  4GA1 A;  2OCC E;  2L0T B;  2IU1 A;  3IXE A;  4HOR A;  3UX4 A;  2OEV A;  1TYQ G;  3TAX A;  3I4G A;  3ZYL A;  3CVV A;  2VGY A;  4KVO A;  3UKU G;  2XCC A;  4HOT A;  5JA4 D;  3S7D A;  4MBG A;  1TNO A;  4UI9 K;  3L22 A;  4C48 B;  4GTQ A;  3FUM A;  2PQR A;  5CMW A;  4U0Z A;  3G2S A;  1NL4 A;  3B13 A;  1U3D A;  3S7F A;  3FFL A;  4CT4 A;  3L6A A;  1DC2 A;  4FLH A;  3TG4 A;  2KCL A;  2I6H A;  4R7L A;  3ONK A;  2NYJ A;  3RRM B;  3FUD A;  5AAO A;  2WXO A;  4I1O B;  2YQ8 A;  2IY0 C;  2XPI A;  4MLP A;  1ELR A;  3DBS A;  2IOL A;  3UM3 A;  3CK8 A;  2LAI A;  4J8F A;  2HO1 A;  4DPR A;  5J90 A;  3FP3 A;  3TXN A;  1L5J A;  1X5B A;  4HI8 A;  4HNA D;  2X6I A;  2DIW A;  4UWG A;  1SQM A;  2VJ8 A;  3AS8 A;  3SFY A;  1UN9 A;  2BKK B;  5HKP A;  4ANU A;  4HLE A;  4HOU A;  1SW6 A;  3APF A;  1TEZ A;  4LNG A;  3ASN E;  4K5B A;  3X2Q E;  4GZC A;  4DX1 A;  3NZS A;  4EZL A;  3L82 A;  2CFZ A;  1UJK A;  4N3C A;  2FO7 A;  4ANW A;  4DK5 A;  2AVP A;  4KZC A;  1IKN D;  2P58 C;  4C0M A;  4ZFH A;  2ZXW E;  1WDY A;  2GW1 A;  2VGX B;  4F3V A;  4XIF A;  1UW4 B;  2F8Y A;  2R2L A;  2PZI A;  1K8K G;  2V8S E;  2H6G A;  4BER A;  3D9I A;  4MKT A;  2ION A;  2M63 A;  3PNT B;  2IO3 C;  2NSZ A;  4XKB A;  3SI5 A;  4JEH A;  3CGH A;  5KJK A;  4A55 A;  4N2Q A;  4WAF A;  1N0R A;  3D9H A;  3NB2 A;  4LEU A;  4UQY A;  2XZT G;  3CK9 A;  3PUK A;  3C3O A;  2X38 A;  2X6H A;  3I5P A;  4EQF A;  2CHX A;  2CG3 A;  3CVN A;  3JUE A;  1JCR A;  3MV2 B;  4JD2 G;  5FIO A;  3AJI A;  1N95 A;  3TWW A;  5A7D B;  4CRW A;  4RSY A;  1HXI A;  1KPS B;  4GCN A;  1E96 B;  3PS6 A;  3CKB A;  2DWZ A;  3ZEF A;  1UOH A;  3CEQ A;  3LY9 A;  3PZ2 A;  3OTN A;  5BPP A;  3FUJ A;  3B7S A;  3PEU B;  1FVH A;  4F1P A;  2DYR E;  5DIZ A;  3QOU A;  4G26 A;  2XGO A;  3T8K A;  4UWL A;  3BQO A;  1KZP A;  2BED A;  1V55 E;  2F8X K;  1OCC E;  3UKR G;  3D9O A;  3GZ2 A;  1N4P A;  3NOC D;  2P9N G;  1GW6 A;  2XGM A;  3HHM A;  4L23 A;  2C0L A;  4PUC A;  3PZ1 A;  4U63 A;  1RW2 A;  3D9J A;  2WXG A;  3UMV A;  3UM2 A;  4A1G A;  4IRU A;  3RRN B;  3HG0 D;  1FPP A;  2XHE A;  3EDT B;  4G11 A;  3FEY A;  4JA9 A;  3SNX A;  2XQ0 A;  4HRM B;  3W9F A;  3JXI A;  5AEN A;  3O4Z A;  1NZN A;  2DCP A;  1FT2 A;  1XGW A;  5D66 A;  3RAU A;  4B8A A;  4AV7 A;  4UI9 J;  2VSN A;  3EU9 A;  1BLX B;  3CIA A;  3FWV A;  3L13 A;  3ZUV B;  2EIM E;  4BX9 A;  3Q9U C;  4J8E A;  2Y1L E;  3C98 A;  4U8Y D;  5ENR D;  1MX4 A;  4U96 D;  3MV3 B;  3LPZ A;  2ZGD A;  1Z6T A;  1QQE A;  5AAR A;  1H6O A;  1LD7 A;  1WM5 A;  5B1A E;  3SY2 A;  2A4Z A;  5E75 A;  4LER A;  3PVL A;  4JZY A;  2R17 C;  1S70 B;  3IHV A;  3E34 A;  3AG2 E;  4BSZ B;  4LUN U;  3TWT A;  4J0U A;  2CG2 A;  4U0U A;  2AXV A;  5LP0 A;  3MEK A;  2P9S G;  2VYI A;  2KZT A;  2J4B A;  3CK7 A;  5T3R A;  1S0P A;  1TN6 A;  2YHE A;  1E7U A;  1DCE A;  1N52 A;  2KCV A;  1JUQ A;  4XZ4 A;  2EQX A;  3ML9 A;  2A5U A;  4GYO A;  4BY6 A;  1O1T A;  4C9B B;  1MZC A;  3VLE A;  3I3N A;  3OAW A;  3HXD A;  4YDY A;  2GRP B;  3FTV A;  4F7A A;  4GTT A;  2LO6 A;  4GA0 A;  3Q73 A;  1TR4 A;  3APD A;  2VTB B;  4L1B A;  5HI7 A;  3TGO A;  4TUM A;  4FJY A;  1H6K A;  2C0M A;  5EYP F;  3UT8 A;  3S7J A;  3PRE A;  5ANL A;  2GRN B;  3ZKJ A;  4N3A A;  2BTD A;  4A3T A;  4DRX E;  1N94 A;  3FU6 A;  2RKK A;  3KSL A;  3PE3 A;  4K03 A;  5JJ7 A;  4U8V D;  4ME2 A;  4M3O A;  1OWL A;  1MQS A;  3G2U A;  1E8Z A;  1IHB A;  3LJ3 A;  3Q5M A;  4BEP A;  5EIL A;  1JPL A;  5KWD A;  3PH0 C;  4I2W A;  3CVU A;  4DJA A;  3TWU A;  4CDM A;  2EIJ E;  5KCM A;  3ZRH A;  2VSX E;  3AG4 E;  4QFV A;  4BWR A;  2KXP C;  4MS6 A;  1JCQ A;  2L9B A;  1NP7 A;  1PY1 A;  2V4H C;  4LCT A;  3I4R B;  3AU4 A;  3ZHE A;  3CQC B;  4WWN A;  3MX3 A;  5D0O D;  2XS8 A;  3ZYQ A;  3B7U X;  2DVW A;  4HFG A;  3VLF A;  5EN5 D;  4B8C B;  2CHW A;  2B0O E;  1A5E A;  3BG0 B;  2LAH A;  2XCB A;  2J8S D;  4GZ6 A;  1TNU A;  3NBN B;  2YNQ A;  3GYZ A;  3FUK A;  4CEM A;  4DI3 A;  3ZN3 A;  1HF8 A;  3OXF A;  3QC1 A;  3FUE A;  5FZQ A;  4EEC A;  4K0R A;  2J4D A;  4GZ5 A;  5CRV A;  2XEN A;  3QAR A;  2Q7F A;  3L08 A;  4G23 A;  5LCW J;  3TWX A;  1K1A A;  4FJZ A;  2V5Q C;  3UM0 A;  5LX8 A;  5FT9 A;  5FQ7 A;  3RKV A;  3VLD A;  3T5V A;  4DLQ A;  2PL2 A;  1LD8 A;  2VGE A;  4BES A;  3EHQ A;  4KVM A;  4XI0 A;  4E85 A;  2OV8 A;  5A23 A;  2ZIS A;  1N4Q A;  3HXB A;  4HI9 A;  5HRY A;  3NOG D;  4GTP A;  2WXR A;  4PH4 B;  5ENS D;  4Q94 A;  2IO2 C;  3LCA A;  3LYA A;  4D10 C;  2BKG A;  1N54 A;  2V5F A;  3NF1 A;  5CER B;  3DST A;  2FBN A;  3PDN A;  3CVL A;  2QZA A;  3MZL B;  4L9P A;  2Y4U A;  3G2W A;  3DWL G;  4URK A;  4OAV B;  3Q47 B;  2CHZ A;  5FZR A;  2BUG A;  3ZXP A;  2J49 A;  3V79 K;  3ZIM A;  1LTX A;  4BX8 A;  1AP7 A;  2LUH A;  3NAW A;  5FQ4 A;  5ENN A;  1HZ4 A;  3LVR E;  2LXM A;  3Q78 A;  4OVU A;  3HRA A;  3MJW A;  4ATZ D;  1IYG A;  4GTR A;  4JHJ A;  3DXM G;  3RU0 A;  5FZS A;  3ULY A;  3FUF A;  4P29 A;  3IBE A;  1YA0 A;  1G3N B;  4GTV A;  3ESL A;  4XE0 A;  2J08 A;  4U0S A;  4HQD A;  2AXU A;  3FUI A;  4ANV A;  1Z3X A;  4UQX A;  3FTZ A;  4GZ3 A;  3ASF A;  1H2U A;  3U3W A;  2R05 A;  3EHR A;  1OCR E;  4UI9 C;  2V0P A;  3CVX A;  1X81 A;  1MHQ A;  2QFC A;  4G24 A;  4FAD A;  1O5M A;  3V30 A;  4JVS A;  3LEW A;  3RJV A;  5E76 A;  2IF4 A;  1BPO A;  4N5C A;  4AVX A;  4WNF A;  2X3M A;  1SA4 A;  4U07 A;  3Q79 A;  4N39 A;  1DCQ A;  4KZ0 A;  5D2M C;  3HVE A;  3JQ1 A;  2R03 A;  4UWH A;  5FWQ A;  4UWF A;  3FH5 A;  5KJL A;  3J5P A;  3FEX A;  1AWC B;  3SGH A;  2OVB A;  3IKO B;  2DZO A;  4OAU C;  5ITZ F;  3S2A A;  1UN8 A;  1U3C A;  2YHC A;  5ARG A;  3SO8 A;  3L9T A;  2WXL A;  3T9K A;  3HVE B;  3DEP A;  4GMR A;  3PRZ A;  4L2L A;  3NZU A;  5FQ6 A;  3E4B A;  2Y0B G;  1JWF A;  4XI9 A;  2WXF A;  1DVP A;  2P9K G;  4IN3 B;  1FCH A;  5AYW D;  1EPU A;  4PDX A;  3SBT B;  4OVV A;  2AXZ A;  1TN8 A;  1HX8 A;  3LS8 A;  3QB2 A;  2R5S A;  2VQ2 A;  4KBQ A;  3CV0 A;  4IUL A;  2P9U G;  4G1T A;  4GTO A;  4HXI A;  3TJP A;  3FUN A;  2HE0 A;  1MX2 A;  3IV0 A;  3LY7 A;  2XRZ A;  4AY6 A;  4GTS A;  4LRZ A;  1PAQ A;  3UTM A;  4JB8 P;  1E90 A;  2RG8 A;  2IJG X;  4JPS A;  1H0A A;  3DSW A;  4U95 D;  3Q7F A;  4U8H A;  1IHG A;  3LJN A;  4CDR A;  3CLJ A;  5T8I A;  1EDU A;  4MRU A;  3CVY A;  2XGS A;  3P2B A;  4YVO A;  3UI2 A;  1XNF A;  4I6J A;  1SA5 A;  1TNB A;  2J9Q A;  4JC8 A;  3TL5 A;  5BV0 A;  4FP7 A;  3SZ7 A;  2PM6 A;  1PC2 A;  5CBN A; 
#chains in the Genus database with same CATH homology
 2XPZ A;  2WMO A;  4I17 A;  1ELK A;  2JLB A;  2ZU6 B;  4N3A A;  4EPZ A;  5G55 A;  5M72 A;  2BTD A;  4A3T A;  3LXU X;  4JEU A;  3ESK A;  3CR3 A;  3QNK A;  5DBK A;  1HG5 A;  3MKR A;  2LNI A;  3ZXS A;  3N71 A;  4B94 A;  4O6F A;  5BV1 A;  2PM7 A;  3FU6 A;  3JYS A;  3PE3 A;  4K03 A;  1LF8 A;  1ZU2 A;  2X6K A;  1TJC A;  3R7Q A;  4HOQ A;  5JJ7 A;  3MYV A;  5EX3 A;  4ME2 A;  3MCX A;  4M3O A;  5EKQ D;  2KAT A;  1OWL A;  1MQS A;  3G2U A;  1E8Z A;  3LY8 A;  2X6J A;  2JEK A;  4BT8 A;  3Q15 A;  2XPY A;  2OOE A;  3P1U A;  3CVW A;  2FEZ A;  2V4L A;  4L2Y A;  3LJ3 A;  4C0E A;  3SFZ A;  4E6H A;  3Q5M A;  3DPD A;  3Q4A B;  2I1K A;  5C2Y A;  3SF4 A;  4JA7 A;  3ZGQ A;  1E7V A;  1OWN A;  3QJZ A;  4BTA A;  1INZ A;  3ONL A;  4GA1 A;  4U04 A;  1JPL A;  2L0T B;  1E8X A;  1UG3 A;  2IU1 A;  3PH0 C;  4I2W A;  4HOR A;  3UX4 A;  2YIN A;  3CVU A;  4CCA A;  4F53 A;  3TAX A;  3RRU A;  4AOF A;  4DJA A;  3URZ A;  3I4G A;  1WAO 1;  3ZYL A;  3CVV A;  2RD0 A;  3SHF A;  4ATG A;  2VGY A;  4KVO A;  4HOT A;  2XCC A;  2WXP A;  4BSX A;  2FI7 A;  3OXL A;  4APO A;  4GU5 A;  4CDM A;  3Q49 B;  3S7D A;  3FTW A;  5KCM A;  3ZRH A;  3ZYM A;  5FJY A;  3U66 A;  4JHR A;  1KT1 A;  3EHN A;  2VSX E;  4A1S A;  4UI9 K;  4AIF A;  3L22 A;  4QFV A;  3BEE A;  4BWR A;  4Y6C A;  2MHK A;  1IQR A;  3FUM A;  2PQR A;  4MS6 A;  4U0Z A;  5CMW A;  3G2S A;  2OND A;  2L9B A;  1NP7 A;  3B13 A;  3CHM A;  1PY1 A;  5A6C A;  1U3D A;  4Q69 A;  2XRY A;  3CVQ A;  4LCT A;  3OXG A;  3S7F A;  3FFL A;  3L54 A;  4BFR A;  4OYS A;  4CT4 A;  3L6A A;  2KM4 A;  3U4T A;  3I4R B;  3AU4 A;  4FLH A;  3TG4 A;  3ZHE A;  2KCL A;  4AJW A;  4I2Z A;  2I6H A;  3CQC B;  5LCW C;  4KYO B;  3EHM A;  4WWN A;  3MX3 A;  3QWV A;  5D0O D;  4DI4 A;  3ZYQ A;  4R7L A;  3SBS A;  2WVI A;  3B7U X;  3ONK A;  3WXX A;  3K9I A;  4HFG A;  3VLF A;  4CT0 A;  3RRM B;  3FUD A;  5BT1 A;  2WXO A;  1HE8 A;  3QKY A;  5JJT A;  4I1O B;  4B8C B;  2YQ8 A;  2CHW A;  2XPI A;  1NA0 A;  3VTY A;  4MLP A;  2FF4 A;  1ELR A;  3BG0 B;  3DBS A;  2LAH A;  4GPK A;  2IOL A;  2XCB A;  3AS4 A;  3CHO A;  3RO3 A;  3HYM B;  3QWW A;  4GZ6 A;  1Y6I A;  1TJF A;  3CK8 A;  2LAI A;  3HDX A;  3FUL A;  2HO1 A;  2YNQ A;  4J8F A;  4ACL A;  4DPR A;  3GYZ A;  3FUK A;  4CEM A;  4DI3 A;  2WB2 A;  5J90 A;  3FP3 A;  3ZN3 A;  3TXN A;  1WY6 A;  1HF8 A;  2J07 A;  1KT0 A;  1L5J A;  3OXF A;  3QC1 A;  5BNW A;  3FUE A;  2MOW A;  3D9N A;  5FZQ A;  1X5B A;  4EEC A;  2KZT B;  2X6I A;  4PS3 A;  2DIW A;  3PZD A;  4UWG A;  1SQM A;  4K0R A;  2VJ8 A;  3AS8 A;  2J4D A;  1UN9 A;  4GMJ A;  4GZ5 A;  4I1M A;  1DNP A;  4ANU A;  3TG5 A;  4HLE A;  3QAR A;  4HOU A;  2Q7F A;  3D9M A;  3GZS A;  5C1D A;  3APF A;  2NC9 A;  3UPV A;  3L08 A;  3APC A;  4G23 A;  1TEZ A;  2R59 A;  5LCW J;  3CQG B;  2WXK A;  1ELW A;  4GZC A;  2HM8 A;  3NZS A;  4EZL A;  4FJZ A;  5LX8 A;  4ILI A;  5G04 C;  5FT9 A;  4HOS A;  3KS2 A;  2CFZ A;  1UJK A;  2UWJ G;  2ILR A;  5FQ7 A;  4N3C A;  2FO7 A;  4WUY A;  2WPV A;  4ANW A;  3FTU A;  5G05 J;  3RKV A;  4DK5 A;  2AVP A;  4KZC A;  3VLD A;  2L6J A;  1NA3 A;  3T5V A;  4DLQ A;  2PL2 A;  4RG9 A;  2HR2 A;  4NRH B;  2P58 C;  4KVM A;  4XI0 A;  1E8W A;  4C0M A;  2OV8 A;  4IYP A;  4E85 A;  4KXK B;  4WNG A;  3ML8 A;  2FUL A;  4WWO A;  3L17 A;  2GW1 A;  2VGX B;  3NQP A;  4F3V A;  4AM9 A;  5CHE E;  5A23 A;  3PNL B;  4XIF A;  1UW4 B;  4NQ0 A;  2PZI A;  4NUR A;  4Y6W A;  2V8S E;  2X6F A;  5HQ8 A;  3CHR A;  3D9I A;  2WXR A;  4A3V A;  4PH4 B;  4MKT A;  4Q94 A;  2I1J A;  2WM9 A;  4GYY A;  2NXP A;  2KC7 A;  2ION A;  4NAC A;  2M63 A;  3LCA A;  3PNT B;  3LYA A;  1KLX A;  4D10 C;  2UY1 A;  4I9E A;  5T4Y A;  1N54 A;  2V5F A;  5JHA A;  3JUI A;  2NSZ A;  3JCK C;  3NF1 A;  3D9L A;  2LSU A;  4XKB A;  2FBN A;  3SI5 A;  3PDN A;  2IFU A;  3CVL A;  4JEH A;  3CGH A;  5KJK A;  3MZL B;  4A55 A;  4N2Q A;  4BTB A;  4WAF A;  2Y4U A;  3G2W A;  1OWO A;  3CSF A;  5CMY A;  3AS5 A;  4URK A;  4LEU A;  2E0I A;  4UQY A;  3CK9 A;  3PUK A;  3Q47 B;  5EX0 A;  2X38 A;  2CHZ A;  5FZR A;  4N3B A;  2BUG A;  2X6H A;  3B7R L;  3I5P A;  1HG2 A;  4FA6 A;  4EQF A;  4BT9 A;  2J49 A;  4Q96 A;  3U64 A;  3SD5 A;  3ZIM A;  2C2L A;  4BX8 A;  1EYH A;  1IQU A;  2CHX A;  2CG3 A;  1VDY A;  3CVN A;  4FHK A;  3PEV B;  3MV2 B;  2UY1 B;  4J8D A;  4XX5 A;  5FQ4 A;  5ENN A;  3UT7 A;  4AEZ C;  5LOZ A;  4FLB A;  4YVQ C;  5CCM A;  1HZ4 A;  1HU3 A;  3PE4 A;  3LVR E;  4OVU A;  4EBA G;  3MGB A;  5A7D B;  4CRW A;  3RK6 A;  4RSY A;  1HXI A;  3MJW A;  4ABN A;  2BF0 X;  2LSV A;  1IYG A;  4GCN A;  1W3B A;  4H7X A;  4JHJ A;  1E96 B;  3PS6 A;  3CKB A;  4WNE A;  4I43 A;  3RU0 A;  3ZEF A;  3G2T A;  5JJ6 A;  3G2V A;  5FZS A;  3FU0 A;  3CEQ A;  3FUF A;  3LVQ E;  2WXI A;  3LY9 A;  2XEV A;  4EZJ A;  4P29 A;  3IBE A;  2WQ6 A;  3OTN A;  5BPP A;  1YA0 A;  3FUJ A;  4W9R A;  3T5X A;  2Y4T A;  2WXH A;  3B7S A;  3MA5 A;  3ESL A;  4XE0 A;  2J08 A;  3FH8 A;  3PEU B;  3ZHE B;  1FVH A;  2VTB A;  3ASG A;  4U0S A;  2AXU A;  1HFA A;  3FUI A;  4ANV A;  1Z3X A;  4UQX A;  3JQ0 A;  5DIZ A;  3O48 A;  3FTZ A;  1OUV A;  3QOU A;  4G26 A;  2XGO A;  4UWL A;  2GRM A;  3EIQ C;  3HIZ A;  3ZYK A;  4GZ3 A;  1HO8 A;  1H2U A;  3ASF A;  4L7T A;  4GA2 A;  3UQ3 A;  3U3W A;  3B7T A;  5D0Q D;  3D9K A;  3CVP A;  5G2N A;  4PS8 A;  4WWP A;  4UI9 C;  5FTP A;  4GB9 A;  3FTX A;  2V0P A;  2Y3A A;  3D9O A;  4I1A A;  3AU5 A;  5BUZ A;  5KJM A;  3CVX A;  3QAQ A;  3GZ2 A;  1QZ2 A;  1MHQ A;  4RVB A;  3VTX A;  1GW6 A;  2QFC A;  2XGM A;  3QWP A;  2GGF A;  3LKU A;  4FC8 A;  4G24 A;  4FAD A;  5J08 A;  3HHM A;  4L23 A;  2C0L A;  4PUC A;  4JVS A;  4U63 A;  3BG1 B;  3LEW A;  1ZBP A;  3D9J A;  3MKQ A;  3RJV A;  3QK0 A;  2WXG A;  5E76 A;  3UMV A;  2IF4 A;  4A1G A;  4FHJ A;  4IRU A;  2WQH A;  2PQN A;  1BPO A;  4N5C A;  4AVX A;  4WNF A;  2WXQ A;  1SZA A;  2X3M A;  2WXN A;  4I6G A;  3RRN B;  4TUU A;  4U07 A;  2XHE A;  3EDT B;  4J8S A;  4N39 A;  4G11 A;  3ZFW A;  4WND A;  3FEY A;  4JA9 A;  4RG6 A;  3SNX A;  2XQ0 A;  4KZ0 A;  2WQ7 A;  3HVE A;  3CST A;  4G25 A;  4GAA A;  3ULQ A;  3JQ1 A;  4B89 A;  4UWH A;  5FWQ A;  4JW1 A;  5AEN A;  3KAE A;  4UWF A;  3FH5 A;  3O4Z A;  3ZVV A;  5KJL A;  1NZN A;  1QNF A;  3FEX A;  4ACK A;  2DCP A;  3EJN A;  2VSO E;  4AY5 A;  1EF1 C;  1XGW A;  2WXM A;  3SGH A;  2OVB A;  5ARF A;  1JWG A;  3IKO B;  5LFA A;  4FUL A;  1OWM A;  3CKC A;  4B8A A;  4FU3 A;  3MKQ B;  3S2A A;  4AV7 A;  1UN8 A;  1U3C A;  2YHC A;  5ARG A;  5AIJ A;  4UI9 J;  2VSN A;  3T8M A;  4JHK A;  4KT6 B;  4V3I A;  5KJN A;  2WXL A;  3CIA A;  3FWV A;  5G04 J;  3L13 A;  3GW4 A;  4PS7 A;  3UUX A;  3FH7 A;  3R9A B;  3GZ1 A;  3HVE B;  1A17 A;  2L0I A;  2QY7 A;  3PRZ A;  4BX9 A;  4J8E A;  4L2L A;  4AXH A;  3C98 A;  3NZU A;  5FQ6 A;  3ZPJ A;  3E4B A;  2DBA A;  4TV3 A;  1JWF A;  3MV3 B;  3KD7 A;  3LPZ A;  4XI9 A;  4N2S A;  3CHP A;  1Z6T A;  2WXF A;  1DVP A;  3S7B A;  2WMN A;  1FVF A;  1H2V C;  1QQE A;  4IN3 B;  1FCH A;  4TRQ A;  5ANR A;  3FTY A;  2I2O A;  5AYW D;  2VSY A;  3LDZ A;  3CHS A;  1WM5 A;  5JHB A;  1EPU A;  2A4Z A;  5E75 A;  2IQC A;  4LER A;  4PDX A;  3FHE A;  5AJL A;  5BW8 C;  3FU5 A;  4OVV A;  3IEG A;  4KMO A;  3SBT B;  3ZW3 A;  2AXZ A;  3PVL A;  3FUH A;  4JZY A;  4EBA A;  1HX8 A;  3LS8 A;  2R17 C;  3QB2 A;  2R5S A;  3ENE A;  5AJD A;  2VQ2 A;  4KBQ A;  3CV0 A;  3IHV A;  4IUL A;  3FU3 A;  3CHQ A;  1Z3Y A;  4G1T A;  4DLO A;  4GZD A;  2HYZ A;  1SZ9 A;  4HXI A;  3FTS A;  3TJP A;  3FUN A;  1UJJ A;  3IHY A;  4LUN U;  3KEZ A;  2KCK A;  4J0U A;  2CG2 A;  3IV0 A;  4U0U A;  2AXV A;  3LY7 A;  5LP0 A;  2OVF A;  2MRI A;  3D9P A;  4F1S A;  3MEK A;  3D3M A;  1HS6 A;  2VYI A;  4JL0 A;  2KZT A;  2XRZ A;  4AY6 A;  2J4B A;  4HVB A;  4LRZ A;  1PAQ A;  3RO2 A;  4ANX A;  1Y8M A;  4JXT A;  3CK7 A;  4GCO A;  5T3R A;  1S0P A;  1E90 A;  2YHE A;  2I9C A;  4UQZ A;  1E7U A;  4ILH B;  1N52 A;  3PUJ A;  5G05 C;  1E8Y A;  4CDN A;  2RG8 A;  2IJG X;  2KCV A;  3ASH A;  1H2T C;  1JUQ A;  4YND A;  3UT4 A;  3FDH A;  4JPS A;  4XZ4 A;  1H0A A;  1P5Q A;  2IOS A;  1B89 A;  2CFU A;  4U8H A;  3L16 A;  2EQX A;  3ML9 A;  2A5U A;  4GYO A;  4ILG A;  1IHG A;  4BY6 A;  4AP2 A;  4C9B B;  3VLE A;  4G2V A;  3RIB A;  4CDR A;  5EDS A;  3CLJ A;  4CGV A;  3I3N A;  3OAW A;  5T8I A;  1EDU A;  2E2E A;  4I9C A;  4MRU A;  4UWK A;  2WXJ A;  3FTV A;  3CVY A;  2XGS A;  3P2B A;  3TXM A;  4F7A A;  4CGW A;  2AWI A;  3ASD A;  2LO6 A;  2AW6 A;  4GA0 A;  4XKC A;  4YVO A;  3U9W A;  4GYW A;  3APD A;  2VGX A;  3FY4 A;  2GRL A;  1XNF A;  5FQ8 A;  4I6J A;  2VTB B;  4L1B A;  2J9Q A;  4JC8 A;  3TL5 A;  4B0Z A;  4EZK A;  5HI7 A;  4HS2 A;  4FP7 A;  4APF A;  5BV0 A;  3TGO A;  3R7R A;  4J6I A;  3QDN A;  3SZ7 A;  2PM6 A;  1HH8 A;  4FJY A;  1H6K A;  4I6E A;  2C0M A;  2J09 A;  4H7Y A;  4GML A;  3EIJ A;  3UT8 A;  1PC2 A;  3PRE A;  3S7J A;  5ANL A;  1OWP A;  5CCL A;  1H19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...