4I1AA

Crystal structure of the apo form of rapi
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
274
structure length
274
Chain Sequence
LEYYFYFFKGMYEFRRKELISAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSMNYANRALKIFREYEEYAVQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHLIAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNVALIYFRKGRFIADKSDDKEYSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENFSIEVADYFHEQGNLMLSNEYYRMSIEARRKIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Response regulator aspartate phosphatase I
total genus 114
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1aA00
4UI9K 4GZ3A 2YHCA 4G2VA 3KD7A 5KJLA 3ASFA 2WQHA 5DIZA 3LPZA 4J8FA 4G1TA 3KAEA 5JJ6A 4U0SA 4A1SA 5M72A 1W3BA 2C0LA 4J0UA 3CK8A 5D0QD 4GZ6A 4H7XA 5G05J 2GW1A 4G26A 1QQEA 2J9QA 2FBNA 3LKUA 2HYZA 5G04C 3SZ7A 4N39A 5FJYA 4WNFA 3ZGQA 1HH8A 2C2LA 4GCOA 5HQ8A 4I2ZA 3MKRA 5CCMA 3TG4A 3N71A 5EX0A 3BEEA 2PL2A 3RO2A 3ASDA 2IFUA 3LY9A 1ELRA 2VGXA 2XPIA 4I17A 4IN3B 3GZ2A 5BW8C 5LCWC 3FP3A 4I9CA 3UQ3A 1KT1A 2UY1B 2VSYA 4JL0A 3S7BA 3ZHEA 4BT9A 3UPVA 3OXGA 4I1AA 4JHRA 4XI0A 4GYWA 2UWJG 3R9AB 2VYIA 3GZ1A 3KS2A 4GCNA 3E4BA 3RU0A 2FI7A 4G24A 2PZIA 2VGYA 1KLXA 4WNDA 3URZA 2YQ8A 4JA7A 2L6JA 2AVPA 3AS5A 3O48A 3Q15A 4WNGA 4N3BA 5A7DB 5BNWA 3U3WA 3Q5MA 4GYYA 4RG9A 4GA0A 2FEZA 4W9RA 4AM9A 2XGOA 4UQZA 1WM5A 3CK9A 1TJCA 5FT9A 1FCHA 3GW4A 4N3CA 2I6HA 4F3VA 4CGVA 4Y6WA 2C0MA 4HORA 4CDRA 2BUGA 5EX3A 1YA0A 2VGXB 3CVLA 4AY5A 5CHEE 3RO3A 2XGMA 4ME2A 3RJVA 4G23A 3QKYA 1IYGA 1NA3A 1QZ2A 2FO7A 2NC9A 2VQ2A 2XGSA 3AS8A 3CKCA 3EDTB 3QWVA 4NQ0A 4NRHB 4WNEA 4XI9A 3VTYA 5JJ7A 5LCWJ 3RIBA 4AY6A 1A17A 4AIFA 3CVQA 3TG5A 2XEVA 3CV0A 5A6CA 4CGWA 2PQRA 4J8EA 3QDNA 4LEUA 5KJMA 1HZ4A 4GZ5A 3JYSA 4GYOA 4RG6A 3WXXA 4ABNA 3ESKA 1ZU2A 5AYWD 2KCVA 3CKBA 4UQYA 4UI9C 4N2QA 5JJTA 4JA9A 3FWVA 3NF1A 5FZSA 3S7DA 4HOQA 4B94A 3PE3A 5CCLA 1NA0A 2XCBA 5ARGA 5DBKA 3FFLA 1OUVA 4KXKB 2DBAA 3PE4A 1NZNA 3CVNA 2XCCA 3OXLA 2HR2A 4H7YA 4N5CA 4UI9J 2WPVA 4XIFA 3LY8A 3OXFA 5EKQD 5FZQA 2KCKA 1ELWA 3MV3B 3ZN3A 5KJKA 4HOTA 5KJNA 5C1DA 4J8DA 3QWWA 4BWRA 5FTPA 2QFCA 3PDNA 3Q47B 2ONDA 3VTXA 4N3AA 2JLBA 2P58C 3MV2B 4YVOA 3IEGA 4HOUA 4WUYA 3ZFWA 4UQXA 4G25A 2LSVA 4KYOB 5G05C 4N2SA 1WAO1 1E96B 3TGOA 4O6FA 3LYAA 3Q4AB 4Y6CA 2Y4UA 3HYMB 4YVQC 3SF4A 5BT1A 2HO1A 2FF4A 5FZRA 4EQFA 4HOSA 3GYZA 1XNFA 1P5QA 1B89A 1PC2A 1ZBPA 2OOEA 2Y4TA 3K9IA 3LY7A 4GA2A 4I9EA 4KBQA 2IF4A 3ZHEB 4U0ZA 5D0OD 3Q49B 5HI7A 2PQNA 1HXIA 3ULQA 3QWPA 4BTAA 4I2WA 1Y8MA 4APOA 2R5SA 4GPKA 1KT0A 2E2EA 2KATA 3S7JA 4BTBA 3MA5A 3CK7A 3ASGA 3TAXA 4U0UA 2KCLA 3UUXA 4U07A 2KC7A 2V5FA 3U4TA 3ZPJA 5G04J 3MEKA 3QOUA 3CEQA 2Q7FA 2MHKA 5ARFA 4GA1A 3RKVA 2UY1A 3S7FA 3CVPA 4BT8A 3AS4A 1IHGA 3LCAA 4U04A 2LSUA 3ASHA 2LNIA 2VSNA 4YNDA
chains in the Genus database with same CATH superfamily
3KAEA 3BUAA 4LERA 3EIQC 2BTDA 2P9LG 3LVQE 4GTQA 3ISMC 4B8CB 3FHEA 3V31A 3PZDA 1OWNA 2WXHA 5T3RA 2RFMA 4JEHA 1L5JA 1WM5A 4RLYA 5FT9A 2BKKB 1FCHA 3GW4A 4KZ0A 5ANLA 3ABLE 4XKBA 2WXLA 2VQ2A 3AU4A 5JMND 2GRPB 2DCPA 4AVXA 3CVVA 3HVEB 3ESKA 1V54E 4I43A 3TXNA 2I1KA 3AU5A 4Z68A 5EIDA 3I5PA 4KXKB 3T8KA 3CVNA 3DEPA 3V30A 3FUMA 2WXFA 2JLBA 3FU0A 4G25A 3CSTA 2BKGA 4ILHB 1LD7A 3SQVA 5CBOA 2HE0A 5D0OD 1EF1C 4B8AA 4APOA 2R5SA 3FUHA 3B7SA 2NXPA 3CIAA 1BLXB 2LSUA 2B0OE 4PUCA 3R7RA 2VSNA 4U96D 3ASFA 3LPZA 2GRLA 4JW1A 1SQMA 2R17C 5G05J 3SHFA 3QARA 3L6AA 4GTPA 2WXRA 3TG4A 4GB9A 2PNNA 1HG5A 4TXPA 2I9CA 2QYJA 4LUNU 1HFAA 3EJNA 2GGFA 1E8XA 1HG2A 3RRMB 4N3CA 2C0MA 5E75A 5H7PA 2VGXB 4AY5A 5EDSA 3SFXA 3RJVA 4BFRA 3QJZA 1MX2A 3D9OA 2WXNA 4NQ0A 3C5RA 4LNGA 3CV0A 2EQXA 4ABNA 4E85A 5FINA 3U9WA 2J09A 3ZYMA 1VDYA 3L9TA 3MYVA 4ANXA 1OUVA 3ESLA 1ELWA 1TNYA 4BWRA 4HS2A 4LNUD 3CR3A 4N2SA 2KM4A 1SZ9A 1YMPA 1BI7B 1HXIA 1JCQA 3PZ1A 1N0RA 3L13A 3HXFA 2VSXE 3IXEA 2LXLA 3SNXA 3AS4A 5ENPD 3AG3E 3IBEA 1TN8A 4HNAD 3EHRA 4A1SA 1W3BA 4J0UA 3CK8A 1NL4A 5G04C 3HRAA 3L22A 3MKRA 1UJJA 4LCTA 1LTXA 3C3OA 2PL2A 2DYSE 3FP3A 3EUVA 5JA4D 4RVBA 4I6EA 1MQSA 3IKOB 4DJAA 2R05A 3I4RB 2KZTA 4F6RD 4JVSA 4G11A 4JHJA 2XEHA 2ZU6B 3HXBA 3Q7AA 1TNOA 3QWVA 4WNEA 1ZB1A 5JJ7A 3FTZA 3KSLA 2XZDG 2J4BA 4GZ5A 4RG6A 4UQYA 5FZSA 4BY6A 2HR2A 4H7YA 5BXUA 3MV2B 3TXMA 2L6BA 2IOLA 4KYOB 2RG8A 2GRMA 1OCCE 5BT1A 2HO1A 4EHMA 5ENRD 4GTOA 3U64A 4U0ZA 5AN8A 3MA5A 2KCLA 2J49A 1LD8A 2LUHA 3ZPJA 2BEDA 3SFYA 5AQ7A 1QNFA 3D9NA 3LCAA 1K1BA 3E33A 3APCA 4B0ZA 4G1TA 3DEOA 4L2YA 4HVBA 3T5VA 3FTVA 1UOHA 4WNFA 1PAQA 5AIJA 1WG0A 2LO6A 1E8YA 4PS8A 4I1OB 3AAAC 4BT9A 3QK0A 3BG1B 4JEUA 3C72A 1N4SA 1KLXA 2XS1A 5BNWA 3FTYA 5JHBA 4DX7D 2ZGGA 3AG1E 3ONKA 4XX5A 4C0MA 4DUIA 3KEAA 4U8HA 1IYGA 5B3SE 3CKCA 2WXQA 1JUQA 4DLQA 4GYOA 5AYWD 4O60A 4L2LA 1H2UA 2NSZA 1NA0A 2XCBA 4YDYA 2QFCA 3VTXA 4FLHA 2Y3AA 3LJNA 1N0QA 1B89A 1HU3A 1ZBPA 2V5QC 2XHEA 3QWPA 4RQIA 1Y8MA 3PEUB 4XZ4A 3QOUA 2MHKA 4BERA 1TN7A 3KD7A 2X6JA 4J8SA 2BF0X 1E8ZA 1IHBA 5LFAA 3F6QA 1JWGA 4I2ZA 4K5AB 4KVOA 4EZLA 3UX4A 2VGXA 3UI2A 4I17A 4AM9A 2UWJG 4XEIG 2P2CP 4F1PA 3MJWA 3AS5A 3IV0A 3VLDA 4W9RA 3CK9A 2I6HA 4JB8P 4MRUA 3PUJA 3AS8A 4R7LA 4ACKA 5KNGA 5LCWJ 2XEVA 1BU9A 2F0YA 4O1PA 3D9IA 3UIPC 5CBNA 4KT6B 3SD5A 1OXJA 4B94A 4L9PA 3FUIA 3HXEA 3Q7FA 3BG0B 5EKQD 3MV3B 3D9HA 3LDZA 3Q9UC 3G2TA 2VTBB 4EBAG 2VJ8A 2EINE 1TN6A 2Y0BG 3EHNA 2B6CA 2XRZA 4YVQC 3V2OA 2Y4UA 2P9UG 3JUEA 4PH4B 1PC2A 3ZHEB 3K9IA 3UT4A 2A4ZA 2LAIA 4GPKA 1KT0A 2I1JA 2KATA 1O1RA 4FU3A 3UUXA 4GA1A 1DC2A 3V2XA 4U8VD 4DPRA 4YNDA 3APFA 3RK6A 4URKA 4UWLA 3SZ7A 2C2LA 4EZJA 1N94A 4GAAA 4N5QA 3TWXA 3GZ2A 4HBDA 3DSTA 3R9AB 4LNBA 3FTXA 3ZUVB 2L6JA 3O48A 5ENOD 3R7QA 3UM0A 2DWZA 4RG9A 1DCQA 1YCSB 2GRRB 4CCAA 2V4LA 1YA0A 3PUKA 4ZFHA 1SW6A 4GMJA 3FU3A 2QC9A 5FQ4A 3QDNA 3CLJA 3NF1A 3S7DA 3BQOA 2J4DA 2L0TB 3FFLA 2XCCA 3L17A 2DZNA 5AENA 5KJNA 1Q2ZA 3PDNA 3ZFWA 3FUJA 3KEZA 4FHKA 2IQCA 3HVEA 1DVPA 3TWSA 3T8MA 2X6FA 3CHOA 1V55E 3LY7A 2P9PG 2IF4A 4BTAA 3NQPA 2A5UA 5AQBA 4I6JA 3PNLB 4GZDA 3FUKA 4FULA 2YHCA 4G2VA 1N95A 3IHVA 2WQHA 1BI8B 1HF8A 1MJ0A 1TR4A 3G2WA 1GW6A 3FULA 1QQEA 3ZGQA 2XPZA 3D9JA 3ULEG 2WXMA 3ZYLA 1DCEA 4FLBA 3FUDA 2F37A 4XE0A 4GZCA 3RU0A 2VGYA 5ANRA 2V8SE 2IO3C 2FEZA 2X3MA 3JXIA 4F3VA 3B7UX 2XENA 4NIKA 4APFA 2NC9A 4XI9A 4DRXE 4AY6A 4TRQA 5BV0A 4U63A 2V4HC 5ENSD 3ULYA 4JA9A 3PE3A 3ZYKA 4U95D 2CHWA 2DBAA 1IXVA 4PS3A 5KJKA 4TUMA 3G2UA 4HOUA 1WAO1 2ETAA 3DSWA 1OWLA 3GYZA 3LVRE 4M7CA 3ULQA 4F1SA 1E8WA 2FO1E 1MZCA 4U07A 3CEQA 4BT8A 2X38A 4TV3A 3Q75A 4UI9K 3MKQB 4FA6A 4J8FA 5FWQA 3LXUX 1N54A 1KZOA 5EYLA 3LKUA 4BSZB 1HH8A 4FJYA 1D9SA 1YYHA 1UW4B 3BEEA 3LY9A 2IFUA 4IN3B 4UWHA 3CHPA 2IY0C 4B93B 1H2VC 5FQ8A 2VYIA 2PZIA 5AJLA 3TWUA 3URZA 1DNPA 4ANWA 5CRUA 3Q5MA 3VLEA 3B95A 4K5BA 1IQRA 2EIME 2BUGA 2JABA 1IKND 5EN5D 4LRZA 1FT2A 3WXXA 1ELKA 1ZU2A 3HXDA 5T8IA 4QQIA 3CKBA 1K1AA 4OVUA 1Z3YA 2WVIA 4HOQA 5KJLA 4XIFA 2CFZA 3FUNA 3UXGA 4N3AA 5EYPF 1H6KA 4YDEA 1E96B 3TGOA 3ASOE 3Q78A 3I3NA 4HLLA 5G55A 3B7BA 2H6FA 4HXIA 5E76A 3UMVA 1Z6TA 4JXTA 4I2WA 4CYMD 2DYRE 1D8DA 3CK7A 2OEVA 2WXJA 4U0UA 5AARA 4A3TA 3PEVB 1U3DA 4CZ2D 4ACLA 3V79K 4HFGA 4JZYA 4H7XA 4HI9A 4CT4A 4G26A 1FPPA 2J9QA 5EIBE 1RW2A 1O1SA 4JD2G 4UWFA 3ONLA 3N71A 4PS7A 2EILE 4J8YA 2J08A 4Q96A 2VSYA 1TEZA 3ZHEA 4JHRA 4F53A 4GYWA 4AIFA 4G24A 2L9BA 3GZSA 4N3BA 3DSXA 2P9NG 3U3WA 4GYYA 1JPLA 4DX1A 4L1BA 3AJIA 2XGSA 1TYQG 4J6IA 5D2MC 1HS6A 4FJZA 2KBXA 5IY5E 2AXZA 4DX2A 3FDHA 3FWVA 2CG3A 3ZIMA 3C3QA 5J08A 3SFZA 4N5CA 3T5XA 3SBSA 4G8KA 1HO8A 2XS8A 5G05C 3C3RA 3LYAA 4HI8A 3DXKG 3ZVVA 4Q94A 1WDYA 1P5QA 2OOEA 3RO3A 1AP7A 4IRUA 3ZNGA 1EDUA 3EHQA 3ML8A 3MEKA 5ARFA 2Q7FA 2UY1A 4EBAA 2RD0A 2NYJA 1E90A 3ABME 2X6KA 3D9LA 1OCRE 3E32A 4CDNA 4AOFA 2GW1A 2AWIA 4C48B 1XGWA 4JHKA 2DIWA 1KT1A 1OY3D 4OAVB 2ZISA 1RZ4A 1SVXA 1A5EA 4CDMA 3DPYA 2DVWA 4C9BB 4CGVA 3EIJA 3E30A 4V3IA 4LSZE 1O1TA 3FY4A 2ZIRA 5CHEE 3QKYA 2FO7A 2AXVA 4LG6A 4U8YD 2CHXA 2XPYA 1UJKA 4GPMA 5HKPA 4TXQA 5CCLA 1KPSB 2IO2C 3WG7E 3PH0C 5BV1A 3OXLA 3DSUA 3OXFA 5C1DA 4J8DA 4MKTA 3Q47B 4PDXA 3UT8A 4OVVA 2R2LA 2QZAA 2LSVA 2HM8A 4O6FA 3C98A 3SBTB 2F8XK 4I9EA 1HX8A 4KZCA 1Z5SC 4AV7A 3ASGA 3DBSA 3RKVA 4FP7A 4U04A 4DX5D 3UM1A 1TNBA 2XEEA 5DIZA 1JCSA 3UKUG 1OCZE 2C0LA 5D0QD 1TNUA 4N39A 3OAWA 4IYPA 3RO2A 1NFIE 2XPIA 3EU5A 3PRZA 3OTNA 3QNKA 3UPVA 3CVXA 3E4BA 4CEMA 3UM3A 5B1AE 3DPDA 1E7VA 3IHYA 2KZTB 2GROB 2QYUA 3S2AA 3CGHA 3ZKJA 3ZU7B 3CVLA 4G8LA 3RSEG 2GRQB 4XKCA 2RFAA 5KBAA 3O4ZA 4LEUA 5KJMA 4HRNA 1FVFA 3PS6A 2YHEA 3HIZA 4J7WA 5CEDB 3SGHA 4TXRA 1PY1A 4BX9A 4K0RA 3UM2A 5FQ6A 4KVMA 2AW6A 3JCKC 3ZN3A 1UN8A 4DK5A 3NB2A 4WUYA 4RSYA 3CQCB 3DWLG 3LS8A 3Q4AB 3SF4A 1S70B 4A3VA 4HOSA 2ZGDA 3J5PA 4GA2A 3Q49B 2XZTG 1JWFA 1OT8A 3J5QB 1QBQA 3ASNE 4AEZC 3U4TA 4ILGA 4DX6D 1IHGA 1WY6A 2P9IG 2WQ7A 4GZ3A 3E37A 3PZ3A 3L82A 3D3MA 3KSQA 2CG2A 1K3ZD 2CHZA 4AP2A 3LEWA 2MYOA 3APDA 4I1AA 2FI7A 2YQ8A 4JA7A 5G2NA 1N52A 4ATZD 4ATGA 3B7RL 3P2BA 4MS6A 5AQAA 4UQZA 3UINC 2QY7A 3NZUA 4CDRA 4GTRA 3SI5A 3R9MA 1H6OA 4GMRA 3JYSA 2IU1A 3TWWA 4M3OA 1AWCB 4C0EA 4EECA 4GTVA 2J8SD 3D9MA 3RAUA 4YDOA 3MGBA 4ZHBA 5HQ8A 5FZQA 3EU9A 2KCKA 4GMLA 4NACA 3HYMB 4GTTA 2Y4TA 3D9PA 2ETCA 2YNQA 4ANVA 4B89A 4X8QA 4K03A 3TAXA 3UKRG 3FEYA 3ZYQA 5ITZF 2WXPA 5D66A 3TWQA 3NZSA 3HHMA 4HRLA 4HRMB 5JJ6A 4GZ6A 4BSXA 3CVYA 4GCOA 1NP7A 3TWVA 4JC8A 5CMWA 5ENTD 3S7BA 5LOZA 3KS2A 4GCNA 4WNDA 3DRAA 4WNGA 3G2VA 2MOWA 5A7DB 5CECB 2H6GA 2VSOE 1TJCA 2V0PA 3ZXPA 4ME2A 1X5BA 3VTYA 3EDTB 4GTMA 3ML9A 3RIBA 3TG5A 4DLOA 5A6CA 4CGWA 3AG2E 1HZ4A 5ENNA 4A63B 4I1MA 1K8KG 5DBKA 3CSFA 3PE4A 3MCXA 3DSSA 1S64A 3RRUA 3ZW3A 4BETA 3SY2A 5FTPA 5CRVA 2OV8A 1QYMA 3IEGA 3FTUA 1FT1A 2KXPC 1O5MA 4BX8A 2A5EA 4UWGA 3PNTB 5BXOA 1EPUA 2FF4A 4EQFA 4OYSA 2DZOA 3L54A 2XQ0A 1LF8A 3ABKE 3B7TA 3I4GA 2Y69E 3S7FA 5BUZA 3PREA 3CHMA 4WWPA 3T9KA 5KCMA 4BEPA 2X6HA 2ZXWE 2RKKA 3CHRA 5LX8A 5EILA 2VGEA 2FBNA 3JUIA 4AXHA 3Q79A 5FJYA 1H0AA 1IQUA 5EX0A 1N4RA 3DXMG 3FH7A 2R03A 2PM7A 3CHQA 4ILIA 3X2QE 5BW8C 2H6IA 2E0IA 1UG3A 3JQ0A 4UWKA 3FU6A 5CCMA 3GZ1A 3W9FA 3TL5A 3U66A 3Q15A 1U3CA 1OWMA 2XRYA 2FULA 2WB2A 1MX4A 4UUCA 2XGMA 3RRNB 3FTWA 1QZ2A 4I6GA 3CVWA 2P9SG 1A17A 2PQRA 3P1UA 4J8EA 4L7TA 5C2YA 2WXOA 2Y1LE 3EHMA 5CEAA 4N2QA 1OWPA 2I2OA 1D8EA 1N9AA 2J07A 1S63A 4UI9J 2WPVA 3QWWA 5J90A 2PM6A 5AAOA 3MX3A 3NAWA 5JHAA 3MKQA 4JPSA 3TWRA 1HE8A 2L0IA 3HG0D 2WXKA 2F8YA 2WXIA 3FEXA 3W9GA 1SZAA 2PQNA 2IEJA 5T4YA 4D10C 4CRWA 4F7AA 4DI4A 2AJAA 2WMNA 2IONA 3PZ4A 4WWNA 1N4PA 3CQGB 2LNIA 2CFUA 4HQDA 2JEKA 3CVUA 3ENEA 5KWDA 4AJWA 4GU5A 4A55A 2EIJE 4HB5A 3FH5A 3QB2A 4MBGA 2WXGA 1S0PA 3ASDA 1ELRA 1OCOE 2UY1B 1TNZA 3FUEA 4L23A 4FADA 4Q69A 1BPOA 2AVPA 2X6IA 3PZ2A 3JXJA 2LXMA 3LJ3A 3FTSA 4GA0A 2XGOA 2ILRA 3L08A 4Y6WA 2IOSA 3VLFA 4IULA 4G23A 1NA3A 4NRHB 1E7UA 2YINA 3CVQA 3ZEFA 2AXUA 1G3NB 1JCRA 3ZRHA 3TJPA 1X81A 1KZPA 2OVFA 2KCVA 4UI9C 5JJTA 1OWOA 3G2SA 5ARGA 3FUFA 5FQ7A 3HXCA 4MLPA 3L16A 3TWTA 5HRYA 4WAFA 1NI1A 5A23A 1EYHA 2ONDA 2P58C 4YVOA 2MRIA 4CT0A 1FVHA 4QFVA 4Y6CA 5AJDA 4TUUA 5FZRA 3QC1A 4A1GA 4ANUA 4KBQA 4BESA 3UT7A 1N4QA 3QAQA 2OCCE 2ETBA 3DSVA 2E2EA 4GTSA 3S7JA 1Z3XA 2WM9A 2KC7A 5BPPA 1MYOA 1H19A 3ASHA 5G04J 4E6HA 1H6PA 4WWOA 1MHQA 4U0SA 5M72A 2IJGX 1N11A 2OVBA 5CERB 2HYZA 3FU5A 3CHSA 4EZKA 5LCWC 4I9CA 3UQ3A 4JL0A 2H6HA 2OEWA 3OXGA 3NOGD 2M63A 4XI0A 1BD8A 3FH8A 5CMYA 3NBNB 4OAUC 1H2TC 4HORA 5EX3A 4U7EB 4YDWA 4HOTA 2R02A 2R59A 3UIOC 3PVLA 4K5CA 4FC8A 5ENQD 4FHJA 5LP0A 5B1BE 3UTMA 3JQ1A 4KMOA 5HS0A 3ZXSA 5AQ9A 4DI3A 1UN9A 3MZLB 1NZNA 1MX6A 3LY8A 3B13A 1INZA 1SA5A 1TJFA 3BU8A 4UQXA 3E34A 4NURA 3AG4E 3D9KA 3HDXA 2WMOA 1XNFA 3Q73A 1U2VG 5HI7A 1Y6IA 3NOCD 4EPZA 4O1OA 4BTBA 2GRNB 4P29A 4HLEA 2V5FA 2LAHA 5FIOA 3CVPA 2VTBA 2P9KG 2EIKE 5KNHD 3Q9NC 2WQ6A 3SO8A 1SA4A
chains in the Genus database with same CATH topology
1U3DA 3KD7A 4ACLA 2X6JA 4J8SA 2BF0X 1E8ZA 3KAEA 4HFGA 4LERA 5JJ6A 5LFAA 3EIQC 2BTDA 4JZYA 4GZ6A 4BSXA 4H7XA 3LVQE 4CT4A 4G26A 2J9QA 3CVYA 4GCOA 1JWGA 4I2ZA 4UWFA 1NP7A 3ONLA 3N71A 4PS7A 4KVOA 4JC8A 4EZLA 3UX4A 2VGXA 5CMWA 4I17A 2J08A 4Q96A 2VSYA 4B8CB 3FHEA 3ZHEA 3S7BA 1TEZA 4JHRA 5LOZA 4AM9A 3PEVB 2UWJG 3PZDA 3KS2A 4GYWA 4GCNA 1OWNA 4AIFA 2WXHA 4G24A 4WNDA 5T3RA 2L9BA 3MJWA 3AS5A 4JEHA 3GZSA 3IV0A 3G2VA 2MOWA 4N3BA 4WNGA 1L5JA 5A7DB 3U3WA 4GYYA 3VLDA 4W9RA 1JPLA 1WM5A 3CK9A 2VSOE 1TJCA 5FT9A 1FCHA 3GW4A 4KZ0A 2I6HA 5ANLA 4L1BA 2V0PA 4MRUA 4XKBA 4ME2A 2WXLA 3PUJA 1X5BA 2VQ2A 2XGSA 3AU4A 3AS8A 4R7LA 3EDTB 3VTYA 4ACKA 4J6IA 3ML9A 5LCWJ 3RIBA 3TG5A 2XEVA 4DLOA 5A6CA 4CGWA 2DCPA 1HS6A 1HZ4A 4FJZA 4AVXA 3CVVA 3HVEB 3D9IA 3ESKA 5ENNA 2AXZA 4I43A 3TXNA 3FDHA 2I1KA 4I1MA 4KT6B 3AU5A 3FWVA 2CG3A 3SD5A 3I5PA 3ZIMA 4B94A 3FUIA 5J08A 5DBKA 3CSFA 3SFZA 4KXKB 3PE4A 3BG0B 3CVNA 4N5CA 3T5XA 5EKQD 3MV3B 3MCXA 3FUMA 3RRUA 2WXFA 3ZW3A 3LDZA 3SBSA 3G2TA 5FTPA 2VTBB 4EBAG 2JLBA 2VJ8A 2OV8A 3FU0A 3IEGA 3FTUA 4G25A 1HO8A 3EHNA 5G05C 3CSTA 2XRZA 4ILHB 4BX8A 3LYAA 4YVQC 2Y4UA 4UWGA 3PNTB 1EPUA 2FF4A 3ZVVA 4EQFA 4PH4B 4OYSA 4Q94A 1P5QA 2OOEA 1PC2A 3RO3A 3L54A 3ZHEB 3K9IA 3UT4A 2XQ0A 5D0OD 1EF1C 2A4ZA 1LF8A 4IRUA 2LAIA 4B8AA 4APOA 2R5SA 4GPKA 1KT0A 1EDUA 2I1JA 3B7TA 2KATA 3FUHA 3I4GA 4FU3A 3UUXA 3B7SA 2NXPA 3ML8A 3MEKA 5ARFA 2Q7FA 3CIAA 3S7FA 4GA1A 5BUZA 2UY1A 3PREA 4EBAA 2RD0A 3CHMA 2LSUA 4PUCA 4WWPA 3R7RA 4DPRA 2VSNA 4YNDA 3APFA 5KCMA 2X6HA 1E90A 3ASFA 2X6KA 3RK6A 3D9LA 3LPZA 3CHRA 4URKA 5LX8A 2GRLA 4JW1A 1SQMA 2R17C 4UWLA 4CDNA 5G05J 3SHFA 2GW1A 4AOFA 3SZ7A 2FBNA 3JUIA 3QARA 4AXHA 5FJYA 1H0AA 3L6AA 2C2LA 4EZJA 1IQUA 2WXRA 3TG4A 2AWIA 4GAAA 5EX0A 4GB9A 1XGWA 3FH7A 3CHQA 2PM7A 4ILIA 1HG5A 5BW8C 3GZ2A 4JHKA 2DIWA 2E0IA 1KT1A 1UG3A 2I9CA 3JQ0A 4UWKA 4LUNU 1HFAA 3R9AB 3FU6A 5CCMA 3GZ1A 3EJNA 3TL5A 3U66A 2GGFA 3FTXA 2L6JA 3O48A 1U3CA 3Q15A 3R7QA 1E8XA 1OWMA 4RG9A 4CDMA 1HG2A 2XRYA 4C9BB 2FULA 2WB2A 3RRMB 4CCAA 4CGVA 4N3CA 2V4LA 3EIJA 4V3IA 2C0MA 5E75A 3FY4A 1YA0A 2VGXB 3PUKA 4AY5A 5EDSA 5CHEE 2XGMA 3RJVA 4BFRA 3RRNB 3QJZA 3D9OA 2WXNA 3QKYA 3FTWA 2FO7A 1QZ2A 4I6GA 3CVWA 4NQ0A 2AXVA 1A17A 4GMJA 3CV0A 3FU3A 2PQRA 3P1UA 3QDNA 4J8EA 4L7TA 5FQ4A 2EQXA 2WXOA 5C2YA 3EHMA 4ABNA 4E85A 2CHXA 2XPYA 4N2QA 1OWPA 1UJKA 2I2OA 3CLJA 3NF1A 3U9WA 2J09A 3S7DA 2J4DA 2L0TB 3ZYMA 5CCLA 1VDYA 2J07A 3MYVA 4ANXA 3PH0C 3FFLA 5BV1A 1OUVA 3OXLA 2XCCA 4UI9J 2WPVA 3L17A 3OXFA 3ESLA 1ELWA 5AENA 5KJNA 5C1DA 4J8DA 3QWWA 4BWRA 4MKTA 5J90A 3PDNA 3Q47B 4HS2A 2PM6A 3MX3A 3CR3A 4PDXA 5JHAA 3UT8A 3ZFWA 4OVVA 3FUJA 3KEZA 4FHKA 2LSVA 2IQCA 4N2SA 3MKQA 3HVEA 4JPSA 1DVPA 2HM8A 4O6FA 1HE8A 2L0IA 3T8MA 3C98A 2WXKA 2WXIA 2X6FA 2KM4A 3FEXA 3CHOA 3SBTB 3LY7A 1SZ9A 1SZAA 4I9EA 1HX8A 2IF4A 2PQNA 1HXIA 4KZCA 4BTAA 4AV7A 3L13A 3ASGA 5T4YA 4D10C 4CRWA 3DBSA 4F7AA 4F53A 2VSXE 4DI4A 2WMNA 3RKVA 3SNXA 3NQPA 2IONA 2A5UA 3AS4A 4FP7A 4U04A 4I6JA 3PNLB 4WWNA 3CQGB 4GZDA 3FUKA 2LNIA 2CFUA 3IBEA 4FULA 2YHCA 4G2VA 2JEKA 3IHVA 2WQHA 5DIZA 3CVUA 3ENEA 1HF8A 4A1SA 4AJWA 3G2WA 4GU5A 4A55A 1W3BA 2C0LA 1GW6A 3CK8A 4J0UA 5D0QD 3FH5A 3FULA 1QQEA 3ZGQA 2XPZA 3QB2A 5G04C 3D9JA 4N39A 3L22A 3OAWA 4IYPA 3MKRA 1UJJA 2WXGA 2WXMA 1S0PA 4LCTA 3ZYLA 3RO2A 2PL2A 3ASDA 3PRZA 1ELRA 2XPIA 4FLBA 3OTNA 3QNKA 3FP3A 3FUDA 2UY1B 4XE0A 3UPVA 3FUEA 4GZCA 3RU0A 3CVXA 4RVBA 3E4BA 4L23A 2VGYA 4FADA 4I6EA 5ANRA 4Q69A 4CEMA 1BPOA 2AVPA 1MQSA 2V8SE 3IKOB 2X6IA 3LJ3A 3DPDA 3FTSA 2FEZA 2X3MA 1E7VA 2XGOA 3IHYA 4GA0A 4DJAA 2ILRA 2KZTA 2KZTB 3I4RB 3L08A 4JVSA 4F3VA 3S2AA 3B7UX 4G11A 3CGHA 4Y6WA 2IOSA 4JHJA 3VLFA 4IULA 2ZU6B 3CVLA 4APFA 4G23A 1NA3A 2NC9A 4XKCA 4NRHB 3QWVA 1E7UA 4WNEA 4XI9A 5JJ7A 2YINA 4AY6A 3FTZA 3CVQA 3ZEFA 3O4ZA 4TRQA 5BV0A 2AXUA 4U63A 4LEUA 2J4BA 5KJMA 3ZRHA 4GZ5A 4RG6A 1FVFA 3PS6A 2OVFA 3TJPA 2YHEA 2KCVA 4UQYA 4UI9C 5JJTA 3HIZA 1OWOA 4JA9A 3SGHA 5FZSA 1PY1A 3PE3A 3ZYKA 4BX9A 3G2SA 4BY6A 5ARGA 2CHWA 3FUFA 2DBAA 5FQ7A 2HR2A 4H7YA 4K0RA 4MLPA 3L16A 4PS3A 4KVMA 2AW6A 3JCKC 4WAFA 5FQ6A 3ZN3A 5KJKA 1UN8A 5A23A 1EYHA 4DK5A 2ONDA 2P58C 3MV2B 3G2UA 4YVOA 4HOUA 3TXMA 4WUYA 2MRIA 4RSYA 2IOLA 4KYOB 3CQCB 2RG8A 4CT0A 1FVHA 1WAO1 3LS8A 4QFVA 3Q4AB 4Y6CA 2GRMA 5AJDA 3SF4A 5BT1A 4TUUA 2HO1A 5FZRA 4A3VA 3QC1A 4HOSA 1OWLA 3GYZA 4A1GA 4ANUA 3LVRE 4KBQA 3U64A 4GA2A 4U0ZA 3UT7A 3Q49B 3ULQA 3QAQA 1JWFA 2E2EA 3S7JA 1Z3XA 3MA5A 4F1SA 1E8WA 2WM9A 2KCLA 2J49A 4U07A 2KC7A 4AEZC 3U4TA 3ZPJA 3CEQA 4ILGA 4BT8A 5BPPA 2X38A 3D9NA 1QNFA 4TV3A 1IHGA 3LCAA 1WY6A 3ASHA 1H19A 5G04J 2WQ7A 4UI9K 4GZ3A 3MKQB 3D3MA 3APCA 4E6HA 4B0ZA 4FA6A 2CG2A 4J8FA 4G1TA 5FWQA 4WWOA 1MHQA 4U0SA 5M72A 2IJGX 4L2YA 4HVBA 3LXUX 1N54A 2CHZA 2OVBA 3FTVA 3LKUA 2HYZA 3T5VA 4AP2A 3FU5A 3LEWA 3CHSA 1HH8A 1PAQA 4WNFA 5AIJA 4FJYA 2LO6A 1UW4B 4EZKA 1E8YA 3BEEA 3APDA 3LY9A 2IFUA 4IN3B 5LCWC 4PS8A 4I1OB 4I9CA 4UWHA 3UQ3A 4JL0A 4BT9A 3CHPA 3QK0A 3BG1B 4JEUA 3OXGA 1H2VC 4I1AA 2M63A 4XI0A 5FQ8A 2VYIA 2FI7A 2PZIA 5AJLA 1KLXA 3URZA 1DNPA 2YQ8A 4JA7A 5G2NA 1N52A 4ANWA 3FH8A 4ATGA 5CMYA 5BNWA 3FTYA 3Q5MA 5JHBA 3B7RL 3P2BA 4MS6A 3VLEA 3ONKA 4UQZA 4XX5A 1H2TC 1IQRA 2QY7A 4HORA 3NZUA 4CDRA 4C0MA 2BUGA 5EX3A 4U8HA 1IYGA 3SI5A 3CKCA 4HOTA 2WXQA 2R59A 4LRZA 3PVLA 1JUQA 4DLQA 4FC8A 3JYSA 4GYOA 2IU1A 3WXXA 1ELKA 1ZU2A 4FHJA 5T8IA 5LP0A 5AYWD 4M3OA 3CKBA 3JQ1A 4OVUA 1Z3YA 4KMOA 4C0EA 2WVIA 4L2LA 1H2UA 4HOQA 4EECA 2NSZA 3ZXSA 3D9MA 4DI3A 1UN9A 1NA0A 2XCBA 3MZLB 3MGBA 1NZNA 5HQ8A 5FZQA 4XIFA 5KJLA 3LY8A 2CFZA 2KCKA 3FUNA 3B13A 1INZA 2QFCA 3VTXA 4N3AA 1TJFA 4FLHA 2Y3AA 4UQXA 4GMLA 4NURA 4NACA 1H6KA 1E96B 3D9KA 3TGOA 3HYMB 3HDXA 3I3NA 5G55A 2WMOA 1XNFA 1B89A 1HU3A 1ZBPA 2Y4TA 3D9PA 4HXIA 5E76A 2YNQA 3UMVA 1Z6TA 4ANVA 4B89A 5HI7A 2XHEA 3QWPA 4JXTA 4I2WA 1Y6IA 1Y8MA 4EPZA 3PEUB 4K03A 4BTBA 3CK7A 4P29A 3TAXA 2WXJA 4HLEA 4U0UA 3FEYA 4XZ4A 2V5FA 3QOUA 3ZYQA 2MHKA 2LAHA 3CVPA 2VTBA 4A3TA 2WXPA 2WQ6A 3NZSA 3HHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UI9 K;  4GZ3 A;  2YHC A;  4G2V A;  3KD7 A;  5KJL A;  3ASF A;  2WQH A;  5DIZ A;  3LPZ A;  4J8F A;  4G1T A;  3KAE A;  5JJ6 A;  4U0S A;  4A1S A;  5M72 A;  1W3B A;  2C0L A;  4J0U A;  3CK8 A;  5D0Q D;  4GZ6 A;  4H7X A;  5G05 J;  2GW1 A;  4G26 A;  1QQE A;  2J9Q A;  2FBN A;  3LKU A;  2HYZ A;  5G04 C;  3SZ7 A;  4N39 A;  5FJY A;  4WNF A;  3ZGQ A;  1HH8 A;  2C2L A;  4GCO A;  5HQ8 A;  4I2Z A;  3MKR A;  5CCM A;  3TG4 A;  3N71 A;  5EX0 A;  3BEE A;  2PL2 A;  3RO2 A;  3ASD A;  2IFU A;  3LY9 A;  1ELR A;  2VGX A;  2XPI A;  4I17 A;  4IN3 B;  3GZ2 A;  5BW8 C;  5LCW C;  3FP3 A;  4I9C A;  3UQ3 A;  1KT1 A;  2UY1 B;  2VSY A;  4JL0 A;  3S7B A;  3ZHE A;  4BT9 A;  3UPV A;  3OXG A;  4I1A A;  4JHR A;  4XI0 A;  4GYW A;  2UWJ G;  3R9A B;  2VYI A;  3GZ1 A;  3KS2 A;  4GCN A;  3E4B A;  3RU0 A;  2FI7 A;  4G24 A;  2PZI A;  2VGY A;  1KLX A;  4WND A;  3URZ A;  2YQ8 A;  4JA7 A;  2L6J A;  2AVP A;  3AS5 A;  3O48 A;  3Q15 A;  4WNG A;  4N3B A;  5A7D B;  5BNW A;  3U3W A;  3Q5M A;  4GYY A;  4RG9 A;  4GA0 A;  2FEZ A;  4W9R A;  4AM9 A;  2XGO A;  4UQZ A;  1WM5 A;  3CK9 A;  1TJC A;  5FT9 A;  1FCH A;  3GW4 A;  4N3C A;  2I6H A;  4F3V A;  4CGV A;  4Y6W A;  2C0M A;  4HOR A;  4CDR A;  2BUG A;  5EX3 A;  1YA0 A;  2VGX B;  3CVL A;  4AY5 A;  5CHE E;  3RO3 A;  2XGM A;  4ME2 A;  3RJV A;  4G23 A;  3QKY A;  1IYG A;  1NA3 A;  1QZ2 A;  2FO7 A;  2NC9 A;  2VQ2 A;  2XGS A;  3AS8 A;  3CKC A;  3EDT B;  3QWV A;  4NQ0 A;  4NRH B;  4WNE A;  4XI9 A;  3VTY A;  5JJ7 A;  5LCW J;  3RIB A;  4AY6 A;  1A17 A;  4AIF A;  3CVQ A;  3TG5 A;  2XEV A;  3CV0 A;  5A6C A;  4CGW A;  2PQR A;  4J8E A;  3QDN A;  4LEU A;  5KJM A;  1HZ4 A;  4GZ5 A;  3JYS A;  4GYO A;  4RG6 A;  3WXX A;  4ABN A;  3ESK A;  1ZU2 A;  5AYW D;  2KCV A;  3CKB A;  4UQY A;  4UI9 C;  4N2Q A;  5JJT A;  4JA9 A;  3FWV A;  3NF1 A;  5FZS A;  3S7D A;  4HOQ A;  4B94 A;  3PE3 A;  5CCL A;  1NA0 A;  2XCB A;  5ARG A;  5DBK A;  3FFL A;  1OUV A;  4KXK B;  2DBA A;  3PE4 A;  1NZN A;  3CVN A;  2XCC A;  3OXL A;  2HR2 A;  4H7Y A;  4N5C A;  4UI9 J;  2WPV A;  4XIF A;  3LY8 A;  3OXF A;  5EKQ D;  5FZQ A;  2KCK A;  1ELW A;  3MV3 B;  3ZN3 A;  5KJK A;  4HOT A;  5KJN A;  5C1D A;  4J8D A;  3QWW A;  4BWR A;  5FTP A;  2QFC A;  3PDN A;  3Q47 B;  2OND A;  3VTX A;  4N3A A;  2JLB A;  2P58 C;  3MV2 B;  4YVO A;  3IEG A;  4HOU A;  4WUY A;  3ZFW A;  4UQX A;  4G25 A;  2LSV A;  4KYO B;  5G05 C;  4N2S A;  1WAO 1;  1E96 B;  3TGO A;  4O6F A;  3LYA A;  3Q4A B;  4Y6C A;  2Y4U A;  3HYM B;  4YVQ C;  3SF4 A;  5BT1 A;  2HO1 A;  2FF4 A;  5FZR A;  4EQF A;  4HOS A;  3GYZ A;  1XNF A;  1P5Q A;  1B89 A;  1PC2 A;  1ZBP A;  2OOE A;  2Y4T A;  3K9I A;  3LY7 A;  4GA2 A;  4I9E A;  4KBQ A;  2IF4 A;  3ZHE B;  4U0Z A;  5D0O D;  3Q49 B;  5HI7 A;  2PQN A;  1HXI A;  3ULQ A;  3QWP A;  4BTA A;  4I2W A;  1Y8M A;  4APO A;  2R5S A;  4GPK A;  1KT0 A;  2E2E A;  2KAT A;  3S7J A;  4BTB A;  3MA5 A;  3CK7 A;  3ASG A;  3TAX A;  4U0U A;  2KCL A;  3UUX A;  4U07 A;  2KC7 A;  2V5F A;  3U4T A;  3ZPJ A;  5G04 J;  3MEK A;  3QOU A;  3CEQ A;  2Q7F A;  2MHK A;  5ARF A;  4GA1 A;  3RKV A;  2UY1 A;  3S7F A;  3CVP A;  4BT8 A;  3AS4 A;  1IHG A;  3LCA A;  4U04 A;  2LSU A;  3ASH A;  2LNI A;  2VSN A;  4YND A; 
#chains in the Genus database with same CATH topology
 3KAE A;  3BUA A;  4LER A;  3EIQ C;  2BTD A;  2P9L G;  3LVQ E;  4GTQ A;  3ISM C;  4B8C B;  3FHE A;  3V31 A;  3PZD A;  1OWN A;  2WXH A;  5T3R A;  2RFM A;  4JEH A;  1L5J A;  1WM5 A;  4RLY A;  5FT9 A;  2BKK B;  1FCH A;  3GW4 A;  4KZ0 A;  5ANL A;  3ABL E;  4XKB A;  2WXL A;  2VQ2 A;  3AU4 A;  5JMN D;  2GRP B;  2DCP A;  4AVX A;  3CVV A;  3HVE B;  3ESK A;  1V54 E;  4I43 A;  3TXN A;  2I1K A;  3AU5 A;  4Z68 A;  5EID A;  3I5P A;  4KXK B;  3T8K A;  3CVN A;  3DEP A;  3V30 A;  3FUM A;  2WXF A;  2JLB A;  3FU0 A;  4G25 A;  3CST A;  2BKG A;  4ILH B;  1LD7 A;  3SQV A;  5CBO A;  2HE0 A;  5D0O D;  1EF1 C;  4B8A A;  4APO A;  2R5S A;  3FUH A;  3B7S A;  2NXP A;  3CIA A;  1BLX B;  2LSU A;  2B0O E;  4PUC A;  3R7R A;  2VSN A;  4U96 D;  3ASF A;  3LPZ A;  2GRL A;  4JW1 A;  1SQM A;  2R17 C;  5G05 J;  3SHF A;  3QAR A;  3L6A A;  4GTP A;  2WXR A;  3TG4 A;  4GB9 A;  2PNN A;  1HG5 A;  4TXP A;  2I9C A;  2QYJ A;  4LUN U;  1HFA A;  3EJN A;  2GGF A;  1E8X A;  1HG2 A;  3RRM B;  4N3C A;  2C0M A;  5E75 A;  5H7P A;  2VGX B;  4AY5 A;  5EDS A;  3SFX A;  3RJV A;  4BFR A;  3QJZ A;  1MX2 A;  3D9O A;  2WXN A;  4NQ0 A;  3C5R A;  4LNG A;  3CV0 A;  2EQX A;  4ABN A;  4E85 A;  5FIN A;  3U9W A;  2J09 A;  3ZYM A;  1VDY A;  3L9T A;  3MYV A;  4ANX A;  1OUV A;  3ESL A;  1ELW A;  1TNY A;  4BWR A;  4HS2 A;  4LNU D;  3CR3 A;  4N2S A;  2KM4 A;  1SZ9 A;  1YMP A;  1BI7 B;  1HXI A;  1JCQ A;  3PZ1 A;  1N0R A;  3L13 A;  3HXF A;  2VSX E;  3IXE A;  2LXL A;  3SNX A;  3AS4 A;  5ENP D;  3AG3 E;  3IBE A;  1TN8 A;  4HNA D;  3EHR A;  4A1S A;  1W3B A;  4J0U A;  3CK8 A;  1NL4 A;  5G04 C;  3HRA A;  3L22 A;  3MKR A;  1UJJ A;  4LCT A;  1LTX A;  3C3O A;  2PL2 A;  2DYS E;  3FP3 A;  3EUV A;  5JA4 D;  4RVB A;  4I6E A;  1MQS A;  3IKO B;  4DJA A;  2R05 A;  3I4R B;  2KZT A;  4F6R D;  4JVS A;  4G11 A;  4JHJ A;  2XEH A;  2ZU6 B;  3HXB A;  3Q7A A;  1TNO A;  3QWV A;  4WNE A;  1ZB1 A;  5JJ7 A;  3FTZ A;  3KSL A;  2XZD G;  2J4B A;  4GZ5 A;  4RG6 A;  4UQY A;  5FZS A;  4BY6 A;  2HR2 A;  4H7Y A;  5BXU A;  3MV2 B;  3TXM A;  2L6B A;  2IOL A;  4KYO B;  2RG8 A;  2GRM A;  1OCC E;  5BT1 A;  2HO1 A;  4EHM A;  5ENR D;  4GTO A;  3U64 A;  4U0Z A;  5AN8 A;  3MA5 A;  2KCL A;  2J49 A;  1LD8 A;  2LUH A;  3ZPJ A;  2BED A;  3SFY A;  5AQ7 A;  1QNF A;  3D9N A;  3LCA A;  1K1B A;  3E33 A;  3APC A;  4B0Z A;  4G1T A;  3DEO A;  4L2Y A;  4HVB A;  3T5V A;  3FTV A;  1UOH A;  4WNF A;  1PAQ A;  5AIJ A;  1WG0 A;  2LO6 A;  1E8Y A;  4PS8 A;  4I1O B;  3AAA C;  4BT9 A;  3QK0 A;  3BG1 B;  4JEU A;  3C72 A;  1N4S A;  1KLX A;  2XS1 A;  5BNW A;  3FTY A;  5JHB A;  4DX7 D;  2ZGG A;  3AG1 E;  3ONK A;  4XX5 A;  4C0M A;  4DUI A;  3KEA A;  4U8H A;  1IYG A;  5B3S E;  3CKC A;  2WXQ A;  1JUQ A;  4DLQ A;  4GYO A;  5AYW D;  4O60 A;  4L2L A;  1H2U A;  2NSZ A;  1NA0 A;  2XCB A;  4YDY A;  2QFC A;  3VTX A;  4FLH A;  2Y3A A;  3LJN A;  1N0Q A;  1B89 A;  1HU3 A;  1ZBP A;  2V5Q C;  2XHE A;  3QWP A;  4RQI A;  1Y8M A;  3PEU B;  4XZ4 A;  3QOU A;  2MHK A;  4BER A;  1TN7 A;  3KD7 A;  2X6J A;  4J8S A;  2BF0 X;  1E8Z A;  1IHB A;  5LFA A;  3F6Q A;  1JWG A;  4I2Z A;  4K5A B;  4KVO A;  4EZL A;  3UX4 A;  2VGX A;  3UI2 A;  4I17 A;  4AM9 A;  2UWJ G;  4XEI G;  2P2C P;  4F1P A;  3MJW A;  3AS5 A;  3IV0 A;  3VLD A;  4W9R A;  3CK9 A;  2I6H A;  4JB8 P;  4MRU A;  3PUJ A;  3AS8 A;  4R7L A;  4ACK A;  5KNG A;  5LCW J;  2XEV A;  1BU9 A;  2F0Y A;  4O1P A;  3D9I A;  3UIP C;  5CBN A;  4KT6 B;  3SD5 A;  1OXJ A;  4B94 A;  4L9P A;  3FUI A;  3HXE A;  3Q7F A;  3BG0 B;  5EKQ D;  3MV3 B;  3D9H A;  3LDZ A;  3Q9U C;  3G2T A;  2VTB B;  4EBA G;  2VJ8 A;  2EIN E;  1TN6 A;  2Y0B G;  3EHN A;  2B6C A;  2XRZ A;  4YVQ C;  3V2O A;  2Y4U A;  2P9U G;  3JUE A;  4PH4 B;  1PC2 A;  3ZHE B;  3K9I A;  3UT4 A;  2A4Z A;  2LAI A;  4GPK A;  1KT0 A;  2I1J A;  2KAT A;  1O1R A;  4FU3 A;  3UUX A;  4GA1 A;  1DC2 A;  3V2X A;  4U8V D;  4DPR A;  4YND A;  3APF A;  3RK6 A;  4URK A;  4UWL A;  3SZ7 A;  2C2L A;  4EZJ A;  1N94 A;  4GAA A;  4N5Q A;  3TWX A;  3GZ2 A;  4HBD A;  3DST A;  3R9A B;  4LNB A;  3FTX A;  3ZUV B;  2L6J A;  3O48 A;  5ENO D;  3R7Q A;  3UM0 A;  2DWZ A;  4RG9 A;  1DCQ A;  1YCS B;  2GRR B;  4CCA A;  2V4L A;  1YA0 A;  3PUK A;  4ZFH A;  1SW6 A;  4GMJ A;  3FU3 A;  2QC9 A;  5FQ4 A;  3QDN A;  3CLJ A;  3NF1 A;  3S7D A;  3BQO A;  2J4D A;  2L0T B;  3FFL A;  2XCC A;  3L17 A;  2DZN A;  5AEN A;  5KJN A;  1Q2Z A;  3PDN A;  3ZFW A;  3FUJ A;  3KEZ A;  4FHK A;  2IQC A;  3HVE A;  1DVP A;  3TWS A;  3T8M A;  2X6F A;  3CHO A;  1V55 E;  3LY7 A;  2P9P G;  2IF4 A;  4BTA A;  3NQP A;  2A5U A;  5AQB A;  4I6J A;  3PNL B;  4GZD A;  3FUK A;  4FUL A;  2YHC A;  4G2V A;  1N95 A;  3IHV A;  2WQH A;  1BI8 B;  1HF8 A;  1MJ0 A;  1TR4 A;  3G2W A;  1GW6 A;  3FUL A;  1QQE A;  3ZGQ A;  2XPZ A;  3D9J A;  3ULE G;  2WXM A;  3ZYL A;  1DCE A;  4FLB A;  3FUD A;  2F37 A;  4XE0 A;  4GZC A;  3RU0 A;  2VGY A;  5ANR A;  2V8S E;  2IO3 C;  2FEZ A;  2X3M A;  3JXI A;  4F3V A;  3B7U X;  2XEN A;  4NIK A;  4APF A;  2NC9 A;  4XI9 A;  4DRX E;  4AY6 A;  4TRQ A;  5BV0 A;  4U63 A;  2V4H C;  5ENS D;  3ULY A;  4JA9 A;  3PE3 A;  3ZYK A;  4U95 D;  2CHW A;  2DBA A;  1IXV A;  4PS3 A;  5KJK A;  4TUM A;  3G2U A;  4HOU A;  1WAO 1;  2ETA A;  3DSW A;  1OWL A;  3GYZ A;  3LVR E;  4M7C A;  3ULQ A;  4F1S A;  1E8W A;  2FO1 E;  1MZC A;  4U07 A;  3CEQ A;  4BT8 A;  2X38 A;  4TV3 A;  3Q75 A;  4UI9 K;  3MKQ B;  4FA6 A;  4J8F A;  5FWQ A;  3LXU X;  1N54 A;  1KZO A;  5EYL A;  3LKU A;  4BSZ B;  1HH8 A;  4FJY A;  1D9S A;  1YYH A;  1UW4 B;  3BEE A;  3LY9 A;  2IFU A;  4IN3 B;  4UWH A;  3CHP A;  2IY0 C;  4B93 B;  1H2V C;  5FQ8 A;  2VYI A;  2PZI A;  5AJL A;  3TWU A;  3URZ A;  1DNP A;  4ANW A;  5CRU A;  3Q5M A;  3VLE A;  3B95 A;  4K5B A;  1IQR A;  2EIM E;  2BUG A;  2JAB A;  1IKN D;  5EN5 D;  4LRZ A;  1FT2 A;  3WXX A;  1ELK A;  1ZU2 A;  3HXD A;  5T8I A;  4QQI A;  3CKB A;  1K1A A;  4OVU A;  1Z3Y A;  2WVI A;  4HOQ A;  5KJL A;  4XIF A;  2CFZ A;  3FUN A;  3UXG A;  4N3A A;  5EYP F;  1H6K A;  4YDE A;  1E96 B;  3TGO A;  3ASO E;  3Q78 A;  3I3N A;  4HLL A;  5G55 A;  3B7B A;  2H6F A;  4HXI A;  5E76 A;  3UMV A;  1Z6T A;  4JXT A;  4I2W A;  4CYM D;  2DYR E;  1D8D A;  3CK7 A;  2OEV A;  2WXJ A;  4U0U A;  5AAR A;  4A3T A;  3PEV B;  1U3D A;  4CZ2 D;  4ACL A;  3V79 K;  4HFG A;  4JZY A;  4H7X A;  4HI9 A;  4CT4 A;  4G26 A;  1FPP A;  2J9Q A;  5EIB E;  1RW2 A;  1O1S A;  4JD2 G;  4UWF A;  3ONL A;  3N71 A;  4PS7 A;  2EIL E;  4J8Y A;  2J08 A;  4Q96 A;  2VSY A;  1TEZ A;  3ZHE A;  4JHR A;  4F53 A;  4GYW A;  4AIF A;  4G24 A;  2L9B A;  3GZS A;  4N3B A;  3DSX A;  2P9N G;  3U3W A;  4GYY A;  1JPL A;  4DX1 A;  4L1B A;  3AJI A;  2XGS A;  1TYQ G;  4J6I A;  5D2M C;  1HS6 A;  4FJZ A;  2KBX A;  5IY5 E;  2AXZ A;  4DX2 A;  3FDH A;  3FWV A;  2CG3 A;  3ZIM A;  3C3Q A;  5J08 A;  3SFZ A;  4N5C A;  3T5X A;  3SBS A;  4G8K A;  1HO8 A;  2XS8 A;  5G05 C;  3C3R A;  3LYA A;  4HI8 A;  3DXK G;  3ZVV A;  4Q94 A;  1WDY A;  1P5Q A;  2OOE A;  3RO3 A;  1AP7 A;  4IRU A;  3ZNG A;  1EDU A;  3EHQ A;  3ML8 A;  3MEK A;  5ARF A;  2Q7F A;  2UY1 A;  4EBA A;  2RD0 A;  2NYJ A;  1E90 A;  3ABM E;  2X6K A;  3D9L A;  1OCR E;  3E32 A;  4CDN A;  4AOF A;  2GW1 A;  2AWI A;  4C48 B;  1XGW A;  4JHK A;  2DIW A;  1KT1 A;  1OY3 D;  4OAV B;  2ZIS A;  1RZ4 A;  1SVX A;  1A5E A;  4CDM A;  3DPY A;  2DVW A;  4C9B B;  4CGV A;  3EIJ A;  3E30 A;  4V3I A;  4LSZ E;  1O1T A;  3FY4 A;  2ZIR A;  5CHE E;  3QKY A;  2FO7 A;  2AXV A;  4LG6 A;  4U8Y D;  2CHX A;  2XPY A;  1UJK A;  4GPM A;  5HKP A;  4TXQ A;  5CCL A;  1KPS B;  2IO2 C;  3WG7 E;  3PH0 C;  5BV1 A;  3OXL A;  3DSU A;  3OXF A;  5C1D A;  4J8D A;  4MKT A;  3Q47 B;  4PDX A;  3UT8 A;  4OVV A;  2R2L A;  2QZA A;  2LSV A;  2HM8 A;  4O6F A;  3C98 A;  3SBT B;  2F8X K;  4I9E A;  1HX8 A;  4KZC A;  1Z5S C;  4AV7 A;  3ASG A;  3DBS A;  3RKV A;  4FP7 A;  4U04 A;  4DX5 D;  3UM1 A;  1TNB A;  2XEE A;  5DIZ A;  1JCS A;  3UKU G;  1OCZ E;  2C0L A;  5D0Q D;  1TNU A;  4N39 A;  3OAW A;  4IYP A;  3RO2 A;  1NFI E;  2XPI A;  3EU5 A;  3PRZ A;  3OTN A;  3QNK A;  3UPV A;  3CVX A;  3E4B A;  4CEM A;  3UM3 A;  5B1A E;  3DPD A;  1E7V A;  3IHY A;  2KZT B;  2GRO B;  2QYU A;  3S2A A;  3CGH A;  3ZKJ A;  3ZU7 B;  3CVL A;  4G8L A;  3RSE G;  2GRQ B;  4XKC A;  2RFA A;  5KBA A;  3O4Z A;  4LEU A;  5KJM A;  4HRN A;  1FVF A;  3PS6 A;  2YHE A;  3HIZ A;  4J7W A;  5CED B;  3SGH A;  4TXR A;  1PY1 A;  4BX9 A;  4K0R A;  3UM2 A;  5FQ6 A;  4KVM A;  2AW6 A;  3JCK C;  3ZN3 A;  1UN8 A;  4DK5 A;  3NB2 A;  4WUY A;  4RSY A;  3CQC B;  3DWL G;  3LS8 A;  3Q4A B;  3SF4 A;  1S70 B;  4A3V A;  4HOS A;  2ZGD A;  3J5P A;  4GA2 A;  3Q49 B;  2XZT G;  1JWF A;  1OT8 A;  3J5Q B;  1QBQ A;  3ASN E;  4AEZ C;  3U4T A;  4ILG A;  4DX6 D;  1IHG A;  1WY6 A;  2P9I G;  2WQ7 A;  4GZ3 A;  3E37 A;  3PZ3 A;  3L82 A;  3D3M A;  3KSQ A;  2CG2 A;  1K3Z D;  2CHZ A;  4AP2 A;  3LEW A;  2MYO A;  3APD A;  4I1A A;  2FI7 A;  2YQ8 A;  4JA7 A;  5G2N A;  1N52 A;  4ATZ D;  4ATG A;  3B7R L;  3P2B A;  4MS6 A;  5AQA A;  4UQZ A;  3UIN C;  2QY7 A;  3NZU A;  4CDR A;  4GTR A;  3SI5 A;  3R9M A;  1H6O A;  4GMR A;  3JYS A;  2IU1 A;  3TWW A;  4M3O A;  1AWC B;  4C0E A;  4EEC A;  4GTV A;  2J8S D;  3D9M A;  3RAU A;  4YDO A;  3MGB A;  4ZHB A;  5HQ8 A;  5FZQ A;  3EU9 A;  2KCK A;  4GML A;  4NAC A;  3HYM B;  4GTT A;  2Y4T A;  3D9P A;  2ETC A;  2YNQ A;  4ANV A;  4B89 A;  4X8Q A;  4K03 A;  3TAX A;  3UKR G;  3FEY A;  3ZYQ A;  5ITZ F;  2WXP A;  5D66 A;  3TWQ A;  3NZS A;  3HHM A;  4HRL A;  4HRM B;  5JJ6 A;  4GZ6 A;  4BSX A;  3CVY A;  4GCO A;  1NP7 A;  3TWV A;  4JC8 A;  5CMW A;  5ENT D;  3S7B A;  5LOZ A;  3KS2 A;  4GCN A;  4WND A;  3DRA A;  4WNG A;  3G2V A;  2MOW A;  5A7D B;  5CEC B;  2H6G A;  2VSO E;  1TJC A;  2V0P A;  3ZXP A;  4ME2 A;  1X5B A;  3VTY A;  3EDT B;  4GTM A;  3ML9 A;  3RIB A;  3TG5 A;  4DLO A;  5A6C A;  4CGW A;  3AG2 E;  1HZ4 A;  5ENN A;  4A63 B;  4I1M A;  1K8K G;  5DBK A;  3CSF A;  3PE4 A;  3MCX A;  3DSS A;  1S64 A;  3RRU A;  3ZW3 A;  4BET A;  3SY2 A;  5FTP A;  5CRV A;  2OV8 A;  1QYM A;  3IEG A;  3FTU A;  1FT1 A;  2KXP C;  1O5M A;  4BX8 A;  2A5E A;  4UWG A;  3PNT B;  5BXO A;  1EPU A;  2FF4 A;  4EQF A;  4OYS A;  2DZO A;  3L54 A;  2XQ0 A;  1LF8 A;  3ABK E;  3B7T A;  3I4G A;  2Y69 E;  3S7F A;  5BUZ A;  3PRE A;  3CHM A;  4WWP A;  3T9K A;  5KCM A;  4BEP A;  2X6H A;  2ZXW E;  2RKK A;  3CHR A;  5LX8 A;  5EIL A;  2VGE A;  2FBN A;  3JUI A;  4AXH A;  3Q79 A;  5FJY A;  1H0A A;  1IQU A;  5EX0 A;  1N4R A;  3DXM G;  3FH7 A;  2R03 A;  2PM7 A;  3CHQ A;  4ILI A;  3X2Q E;  5BW8 C;  2H6I A;  2E0I A;  1UG3 A;  3JQ0 A;  4UWK A;  3FU6 A;  5CCM A;  3GZ1 A;  3W9F A;  3TL5 A;  3U66 A;  3Q15 A;  1U3C A;  1OWM A;  2XRY A;  2FUL A;  2WB2 A;  1MX4 A;  4UUC A;  2XGM A;  3RRN B;  3FTW A;  1QZ2 A;  4I6G A;  3CVW A;  2P9S G;  1A17 A;  2PQR A;  3P1U A;  4J8E A;  4L7T A;  5C2Y A;  2WXO A;  2Y1L E;  3EHM A;  5CEA A;  4N2Q A;  1OWP A;  2I2O A;  1D8E A;  1N9A A;  2J07 A;  1S63 A;  4UI9 J;  2WPV A;  3QWW A;  5J90 A;  2PM6 A;  5AAO A;  3MX3 A;  3NAW A;  5JHA A;  3MKQ A;  4JPS A;  3TWR A;  1HE8 A;  2L0I A;  3HG0 D;  2WXK A;  2F8Y A;  2WXI A;  3FEX A;  3W9G A;  1SZA A;  2PQN A;  2IEJ A;  5T4Y A;  4D10 C;  4CRW A;  4F7A A;  4DI4 A;  2AJA A;  2WMN A;  2ION A;  3PZ4 A;  4WWN A;  1N4P A;  3CQG B;  2LNI A;  2CFU A;  4HQD A;  2JEK A;  3CVU A;  3ENE A;  5KWD A;  4AJW A;  4GU5 A;  4A55 A;  2EIJ E;  4HB5 A;  3FH5 A;  3QB2 A;  4MBG A;  2WXG A;  1S0P A;  3ASD A;  1ELR A;  1OCO E;  2UY1 B;  1TNZ A;  3FUE A;  4L23 A;  4FAD A;  4Q69 A;  1BPO A;  2AVP A;  2X6I A;  3PZ2 A;  3JXJ A;  2LXM A;  3LJ3 A;  3FTS A;  4GA0 A;  2XGO A;  2ILR A;  3L08 A;  4Y6W A;  2IOS A;  3VLF A;  4IUL A;  4G23 A;  1NA3 A;  4NRH B;  1E7U A;  2YIN A;  3CVQ A;  3ZEF A;  2AXU A;  1G3N B;  1JCR A;  3ZRH A;  3TJP A;  1X81 A;  1KZP A;  2OVF A;  2KCV A;  4UI9 C;  5JJT A;  1OWO A;  3G2S A;  5ARG A;  3FUF A;  5FQ7 A;  3HXC A;  4MLP A;  3L16 A;  3TWT A;  5HRY A;  4WAF A;  1NI1 A;  5A23 A;  1EYH A;  2OND A;  2P58 C;  4YVO A;  2MRI A;  4CT0 A;  1FVH A;  4QFV A;  4Y6C A;  5AJD A;  4TUU A;  5FZR A;  3QC1 A;  4A1G A;  4ANU A;  4KBQ A;  4BES A;  3UT7 A;  1N4Q A;  3QAQ A;  2OCC E;  2ETB A;  3DSV A;  2E2E A;  4GTS A;  3S7J A;  1Z3X A;  2WM9 A;  2KC7 A;  5BPP A;  1MYO A;  1H19 A;  3ASH A;  5G04 J;  4E6H A;  1H6P A;  4WWO A;  1MHQ A;  4U0S A;  5M72 A;  2IJG X;  1N11 A;  2OVB A;  5CER B;  2HYZ A;  3FU5 A;  3CHS A;  4EZK A;  5LCW C;  4I9C A;  3UQ3 A;  4JL0 A;  2H6H A;  2OEW A;  3OXG A;  3NOG D;  2M63 A;  4XI0 A;  1BD8 A;  3FH8 A;  5CMY A;  3NBN B;  4OAU C;  1H2T C;  4HOR A;  5EX3 A;  4U7E B;  4YDW A;  4HOT A;  2R02 A;  2R59 A;  3UIO C;  3PVL A;  4K5C A;  4FC8 A;  5ENQ D;  4FHJ A;  5LP0 A;  5B1B E;  3UTM A;  3JQ1 A;  4KMO A;  5HS0 A;  3ZXS A;  5AQ9 A;  4DI3 A;  1UN9 A;  3MZL B;  1NZN A;  1MX6 A;  3LY8 A;  3B13 A;  1INZ A;  1SA5 A;  1TJF A;  3BU8 A;  4UQX A;  3E34 A;  4NUR A;  3AG4 E;  3D9K A;  3HDX A;  2WMO A;  1XNF A;  3Q73 A;  1U2V G;  5HI7 A;  1Y6I A;  3NOC D;  4EPZ A;  4O1O A;  4BTB A;  2GRN B;  4P29 A;  4HLE A;  2V5F A;  2LAH A;  5FIO A;  3CVP A;  2VTB A;  2P9K G;  2EIK E;  5KNH D;  3Q9N C;  2WQ6 A;  3SO8 A;  1SA4 A; 
#chains in the Genus database with same CATH homology
 1U3D A;  3KD7 A;  4ACL A;  2X6J A;  4J8S A;  2BF0 X;  1E8Z A;  3KAE A;  4HFG A;  4LER A;  5JJ6 A;  5LFA A;  3EIQ C;  2BTD A;  4JZY A;  4GZ6 A;  4BSX A;  4H7X A;  3LVQ E;  4CT4 A;  4G26 A;  2J9Q A;  3CVY A;  4GCO A;  1JWG A;  4I2Z A;  4UWF A;  1NP7 A;  3ONL A;  3N71 A;  4PS7 A;  4KVO A;  4JC8 A;  4EZL A;  3UX4 A;  2VGX A;  5CMW A;  4I17 A;  2J08 A;  4Q96 A;  2VSY A;  4B8C B;  3FHE A;  3ZHE A;  3S7B A;  1TEZ A;  4JHR A;  5LOZ A;  4AM9 A;  3PEV B;  2UWJ G;  3PZD A;  3KS2 A;  4GYW A;  4GCN A;  1OWN A;  4AIF A;  2WXH A;  4G24 A;  4WND A;  5T3R A;  2L9B A;  3MJW A;  3AS5 A;  4JEH A;  3GZS A;  3IV0 A;  3G2V A;  2MOW A;  4N3B A;  4WNG A;  1L5J A;  5A7D B;  3U3W A;  4GYY A;  3VLD A;  4W9R A;  1JPL A;  1WM5 A;  3CK9 A;  2VSO E;  1TJC A;  5FT9 A;  1FCH A;  3GW4 A;  4KZ0 A;  2I6H A;  5ANL A;  4L1B A;  2V0P A;  4MRU A;  4XKB A;  4ME2 A;  2WXL A;  3PUJ A;  1X5B A;  2VQ2 A;  2XGS A;  3AU4 A;  3AS8 A;  4R7L A;  3EDT B;  3VTY A;  4ACK A;  4J6I A;  3ML9 A;  5LCW J;  3RIB A;  3TG5 A;  2XEV A;  4DLO A;  5A6C A;  4CGW A;  2DCP A;  1HS6 A;  1HZ4 A;  4FJZ A;  4AVX A;  3CVV A;  3HVE B;  3D9I A;  3ESK A;  5ENN A;  2AXZ A;  4I43 A;  3TXN A;  3FDH A;  2I1K A;  4I1M A;  4KT6 B;  3AU5 A;  3FWV A;  2CG3 A;  3SD5 A;  3I5P A;  3ZIM A;  4B94 A;  3FUI A;  5J08 A;  5DBK A;  3CSF A;  3SFZ A;  4KXK B;  3PE4 A;  3BG0 B;  3CVN A;  4N5C A;  3T5X A;  5EKQ D;  3MV3 B;  3MCX A;  3FUM A;  3RRU A;  2WXF A;  3ZW3 A;  3LDZ A;  3SBS A;  3G2T A;  5FTP A;  2VTB B;  4EBA G;  2JLB A;  2VJ8 A;  2OV8 A;  3FU0 A;  3IEG A;  3FTU A;  4G25 A;  1HO8 A;  3EHN A;  5G05 C;  3CST A;  2XRZ A;  4ILH B;  4BX8 A;  3LYA A;  4YVQ C;  2Y4U A;  4UWG A;  3PNT B;  1EPU A;  2FF4 A;  3ZVV A;  4EQF A;  4PH4 B;  4OYS A;  4Q94 A;  1P5Q A;  2OOE A;  1PC2 A;  3RO3 A;  3L54 A;  3ZHE B;  3K9I A;  3UT4 A;  2XQ0 A;  5D0O D;  1EF1 C;  2A4Z A;  1LF8 A;  4IRU A;  2LAI A;  4B8A A;  4APO A;  2R5S A;  4GPK A;  1KT0 A;  1EDU A;  2I1J A;  3B7T A;  2KAT A;  3FUH A;  3I4G A;  4FU3 A;  3UUX A;  3B7S A;  2NXP A;  3ML8 A;  3MEK A;  5ARF A;  2Q7F A;  3CIA A;  3S7F A;  4GA1 A;  5BUZ A;  2UY1 A;  3PRE A;  4EBA A;  2RD0 A;  3CHM A;  2LSU A;  4PUC A;  4WWP A;  3R7R A;  4DPR A;  2VSN A;  4YND A;  3APF A;  5KCM A;  2X6H A;  1E90 A;  3ASF A;  2X6K A;  3RK6 A;  3D9L A;  3LPZ A;  3CHR A;  4URK A;  5LX8 A;  2GRL A;  4JW1 A;  1SQM A;  2R17 C;  4UWL A;  4CDN A;  5G05 J;  3SHF A;  2GW1 A;  4AOF A;  3SZ7 A;  2FBN A;  3JUI A;  3QAR A;  4AXH A;  5FJY A;  1H0A A;  3L6A A;  2C2L A;  4EZJ A;  1IQU A;  2WXR A;  3TG4 A;  2AWI A;  4GAA A;  5EX0 A;  4GB9 A;  1XGW A;  3FH7 A;  3CHQ A;  2PM7 A;  4ILI A;  1HG5 A;  5BW8 C;  3GZ2 A;  4JHK A;  2DIW A;  2E0I A;  1KT1 A;  1UG3 A;  2I9C A;  3JQ0 A;  4UWK A;  4LUN U;  1HFA A;  3R9A B;  3FU6 A;  5CCM A;  3GZ1 A;  3EJN A;  3TL5 A;  3U66 A;  2GGF A;  3FTX A;  2L6J A;  3O48 A;  1U3C A;  3Q15 A;  3R7Q A;  1E8X A;  1OWM A;  4RG9 A;  4CDM A;  1HG2 A;  2XRY A;  4C9B B;  2FUL A;  2WB2 A;  3RRM B;  4CCA A;  4CGV A;  4N3C A;  2V4L A;  3EIJ A;  4V3I A;  2C0M A;  5E75 A;  3FY4 A;  1YA0 A;  2VGX B;  3PUK A;  4AY5 A;  5EDS A;  5CHE E;  2XGM A;  3RJV A;  4BFR A;  3RRN B;  3QJZ A;  3D9O A;  2WXN A;  3QKY A;  3FTW A;  2FO7 A;  1QZ2 A;  4I6G A;  3CVW A;  4NQ0 A;  2AXV A;  1A17 A;  4GMJ A;  3CV0 A;  3FU3 A;  2PQR A;  3P1U A;  3QDN A;  4J8E A;  4L7T A;  5FQ4 A;  2EQX A;  2WXO A;  5C2Y A;  3EHM A;  4ABN A;  4E85 A;  2CHX A;  2XPY A;  4N2Q A;  1OWP A;  1UJK A;  2I2O A;  3CLJ A;  3NF1 A;  3U9W A;  2J09 A;  3S7D A;  2J4D A;  2L0T B;  3ZYM A;  5CCL A;  1VDY A;  2J07 A;  3MYV A;  4ANX A;  3PH0 C;  3FFL A;  5BV1 A;  1OUV A;  3OXL A;  2XCC A;  4UI9 J;  2WPV A;  3L17 A;  3OXF A;  3ESL A;  1ELW A;  5AEN A;  5KJN A;  5C1D A;  4J8D A;  3QWW A;  4BWR A;  4MKT A;  5J90 A;  3PDN A;  3Q47 B;  4HS2 A;  2PM6 A;  3MX3 A;  3CR3 A;  4PDX A;  5JHA A;  3UT8 A;  3ZFW A;  4OVV A;  3FUJ A;  3KEZ A;  4FHK A;  2LSV A;  2IQC A;  4N2S A;  3MKQ A;  3HVE A;  4JPS A;  1DVP A;  2HM8 A;  4O6F A;  1HE8 A;  2L0I A;  3T8M A;  3C98 A;  2WXK A;  2WXI A;  2X6F A;  2KM4 A;  3FEX A;  3CHO A;  3SBT B;  3LY7 A;  1SZ9 A;  1SZA A;  4I9E A;  1HX8 A;  2IF4 A;  2PQN A;  1HXI A;  4KZC A;  4BTA A;  4AV7 A;  3L13 A;  3ASG A;  5T4Y A;  4D10 C;  4CRW A;  3DBS A;  4F7A A;  4F53 A;  2VSX E;  4DI4 A;  2WMN A;  3RKV A;  3SNX A;  3NQP A;  2ION A;  2A5U A;  3AS4 A;  4FP7 A;  4U04 A;  4I6J A;  3PNL B;  4WWN A;  3CQG B;  4GZD A;  3FUK A;  2LNI A;  2CFU A;  3IBE A;  4FUL A;  2YHC A;  4G2V A;  2JEK A;  3IHV A;  2WQH A;  5DIZ A;  3CVU A;  3ENE A;  1HF8 A;  4A1S A;  4AJW A;  3G2W A;  4GU5 A;  4A55 A;  1W3B A;  2C0L A;  1GW6 A;  3CK8 A;  4J0U A;  5D0Q D;  3FH5 A;  3FUL A;  1QQE A;  3ZGQ A;  2XPZ A;  3QB2 A;  5G04 C;  3D9J A;  4N39 A;  3L22 A;  3OAW A;  4IYP A;  3MKR A;  1UJJ A;  2WXG A;  2WXM A;  1S0P A;  4LCT A;  3ZYL A;  3RO2 A;  2PL2 A;  3ASD A;  3PRZ A;  1ELR A;  2XPI A;  4FLB A;  3OTN A;  3QNK A;  3FP3 A;  3FUD A;  2UY1 B;  4XE0 A;  3UPV A;  3FUE A;  4GZC A;  3RU0 A;  3CVX A;  4RVB A;  3E4B A;  4L23 A;  2VGY A;  4FAD A;  4I6E A;  5ANR A;  4Q69 A;  4CEM A;  1BPO A;  2AVP A;  1MQS A;  2V8S E;  3IKO B;  2X6I A;  3LJ3 A;  3DPD A;  3FTS A;  2FEZ A;  2X3M A;  1E7V A;  2XGO A;  3IHY A;  4GA0 A;  4DJA A;  2ILR A;  2KZT A;  2KZT B;  3I4R B;  3L08 A;  4JVS A;  4F3V A;  3S2A A;  3B7U X;  4G11 A;  3CGH A;  4Y6W A;  2IOS A;  4JHJ A;  3VLF A;  4IUL A;  2ZU6 B;  3CVL A;  4APF A;  4G23 A;  1NA3 A;  2NC9 A;  4XKC A;  4NRH B;  3QWV A;  1E7U A;  4WNE A;  4XI9 A;  5JJ7 A;  2YIN A;  4AY6 A;  3FTZ A;  3CVQ A;  3ZEF A;  3O4Z A;  4TRQ A;  5BV0 A;  2AXU A;  4U63 A;  4LEU A;  2J4B A;  5KJM A;  3ZRH A;  4GZ5 A;  4RG6 A;  1FVF A;  3PS6 A;  2OVF A;  3TJP A;  2YHE A;  2KCV A;  4UQY A;  4UI9 C;  5JJT A;  3HIZ A;  1OWO A;  4JA9 A;  3SGH A;  5FZS A;  1PY1 A;  3PE3 A;  3ZYK A;  4BX9 A;  3G2S A;  4BY6 A;  5ARG A;  2CHW A;  3FUF A;  2DBA A;  5FQ7 A;  2HR2 A;  4H7Y A;  4K0R A;  4MLP A;  3L16 A;  4PS3 A;  4KVM A;  2AW6 A;  3JCK C;  4WAF A;  5FQ6 A;  3ZN3 A;  5KJK A;  1UN8 A;  5A23 A;  1EYH A;  4DK5 A;  2OND A;  2P58 C;  3MV2 B;  3G2U A;  4YVO A;  4HOU A;  3TXM A;  4WUY A;  2MRI A;  4RSY A;  2IOL A;  4KYO B;  3CQC B;  2RG8 A;  4CT0 A;  1FVH A;  1WAO 1;  3LS8 A;  4QFV A;  3Q4A B;  4Y6C A;  2GRM A;  5AJD A;  3SF4 A;  5BT1 A;  4TUU A;  2HO1 A;  5FZR A;  4A3V A;  3QC1 A;  4HOS A;  1OWL A;  3GYZ A;  4A1G A;  4ANU A;  3LVR E;  4KBQ A;  3U64 A;  4GA2 A;  4U0Z A;  3UT7 A;  3Q49 B;  3ULQ A;  3QAQ A;  1JWF A;  2E2E A;  3S7J A;  1Z3X A;  3MA5 A;  4F1S A;  1E8W A;  2WM9 A;  2KCL A;  2J49 A;  4U07 A;  2KC7 A;  4AEZ C;  3U4T A;  3ZPJ A;  3CEQ A;  4ILG A;  4BT8 A;  5BPP A;  2X38 A;  3D9N A;  1QNF A;  4TV3 A;  1IHG A;  3LCA A;  1WY6 A;  3ASH A;  1H19 A;  5G04 J;  2WQ7 A;  4UI9 K;  4GZ3 A;  3MKQ B;  3D3M A;  3APC A;  4E6H A;  4B0Z A;  4FA6 A;  2CG2 A;  4J8F A;  4G1T A;  5FWQ A;  4WWO A;  1MHQ A;  4U0S A;  5M72 A;  2IJG X;  4L2Y A;  4HVB A;  3LXU X;  1N54 A;  2CHZ A;  2OVB A;  3FTV A;  3LKU A;  2HYZ A;  3T5V A;  4AP2 A;  3FU5 A;  3LEW A;  3CHS A;  1HH8 A;  1PAQ A;  4WNF A;  5AIJ A;  4FJY A;  2LO6 A;  1UW4 B;  4EZK A;  1E8Y A;  3BEE A;  3APD A;  3LY9 A;  2IFU A;  4IN3 B;  5LCW C;  4PS8 A;  4I1O B;  4I9C A;  4UWH A;  3UQ3 A;  4JL0 A;  4BT9 A;  3CHP A;  3QK0 A;  3BG1 B;  4JEU A;  3OXG A;  1H2V C;  4I1A A;  2M63 A;  4XI0 A;  5FQ8 A;  2VYI A;  2FI7 A;  2PZI A;  5AJL A;  1KLX A;  3URZ A;  1DNP A;  2YQ8 A;  4JA7 A;  5G2N A;  1N52 A;  4ANW A;  3FH8 A;  4ATG A;  5CMY A;  5BNW A;  3FTY A;  3Q5M A;  5JHB A;  3B7R L;  3P2B A;  4MS6 A;  3VLE A;  3ONK A;  4UQZ A;  4XX5 A;  1H2T C;  1IQR A;  2QY7 A;  4HOR A;  3NZU A;  4CDR A;  4C0M A;  2BUG A;  5EX3 A;  4U8H A;  1IYG A;  3SI5 A;  3CKC A;  4HOT A;  2WXQ A;  2R59 A;  4LRZ A;  3PVL A;  1JUQ A;  4DLQ A;  4FC8 A;  3JYS A;  4GYO A;  2IU1 A;  3WXX A;  1ELK A;  1ZU2 A;  4FHJ A;  5T8I A;  5LP0 A;  5AYW D;  4M3O A;  3CKB A;  3JQ1 A;  4OVU A;  1Z3Y A;  4KMO A;  4C0E A;  2WVI A;  4L2L A;  1H2U A;  4HOQ A;  4EEC A;  2NSZ A;  3ZXS A;  3D9M A;  4DI3 A;  1UN9 A;  1NA0 A;  2XCB A;  3MZL B;  3MGB A;  1NZN A;  5HQ8 A;  5FZQ A;  4XIF A;  5KJL A;  3LY8 A;  2CFZ A;  2KCK A;  3FUN A;  3B13 A;  1INZ A;  2QFC A;  3VTX A;  4N3A A;  1TJF A;  4FLH A;  2Y3A A;  4UQX A;  4GML A;  4NUR A;  4NAC A;  1H6K A;  1E96 B;  3D9K A;  3TGO A;  3HYM B;  3HDX A;  3I3N A;  5G55 A;  2WMO A;  1XNF A;  1B89 A;  1HU3 A;  1ZBP A;  2Y4T A;  3D9P A;  4HXI A;  5E76 A;  2YNQ A;  3UMV A;  1Z6T A;  4ANV A;  4B89 A;  5HI7 A;  2XHE A;  3QWP A;  4JXT A;  4I2W A;  1Y6I A;  1Y8M A;  4EPZ A;  3PEU B;  4K03 A;  4BTB A;  3CK7 A;  4P29 A;  3TAX A;  2WXJ A;  4HLE A;  4U0U A;  3FEY A;  4XZ4 A;  2V5F A;  3QOU A;  3ZYQ A;  2MHK A;  2LAH A;  3CVP A;  2VTB A;  4A3T A;  2WXP A;  2WQ6 A;  3NZS A;  3HHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...