4I1AA

Crystal structure of the apo form of rapi
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
274
structure length
274
Chain Sequence
LEYYFYFFKGMYEFRRKELISAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSMNYANRALKIFREYEEYAVQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHLIAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNVALIYFRKGRFIADKSDDKEYSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENFSIEVADYFHEQGNLMLSNEYYRMSIEARRKIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase I
publication title Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 114
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1aA00
1HXIA 1KLXA 2LSUA 5LCWC 4GYYA 5FZQA 1YA0A 3CK8A 3ASDA 4HOSA 4J8FA 3UUXA 3LY7A 5D0QD 5FZRA 3JYSA 2VGXB 2Y4TA 1QZ2A 5EX3A 2J9QA 3MV2B 3LYAA 3Q15A 2HR2A 1ELWA 4RG9A 3ESKA 4O6FA 4H7YA 4JL0A 3ZN3A 4GCOA 4KYOB 3PE3A 4I17A 4HOQA 5CHEE 4N3AA 3ULQA 3EDTB 2KATA 3QWWA 2DBAA 3PDNA 4I2ZA 3KAEA 3S7JA 3LY8A 2XEVA 1WAO1 4G1TA 2OOEA 2C2LA 2Q7FA 1TJCA 1OUVA 2NC9A 5HI7A 3OXLA 5G04J 4BT8A 4BWRA 3Q49B 4J0UA 4HOTA 2KCKA 4U04A 4XI9A 4GA0A 4G2VA 4HOUA 4WNFA 4JA9A 3GZ2A 4G26A 2BUGA 4AIFA 2FBNA 3OXFA 2UY1B 4W9RA 4GPKA 3U3WA 4EQFA 4YVQC 1NA3A 3CVLA 2FI7A 1NA0A 3QKYA 3QOUA 5JJ6A 3CKBA 3MEKA 3LCAA 1NZNA 3GYZA 3Q4AB 4I9CA 1ZU2A 2C0MA 2E2EA 2MHKA 4KBQA 2PQRA 4N3BA 2FEZA 1FCHA 4GZ6A 4U0ZA 3GZ1A 3ASGA 3FP3A 1P5QA 2L6JA 3QWPA 2YQ8A 4UQZA 4YVOA 2UY1A 3CK9A 5FT9A 5G05J 2XCBA 5D0OD 2VYIA 2IFUA 5A7DB 2R5SA 5AYWD 3FWVA 2WQHA 3RKVA 3RO3A 3LY9A 3ZHEA 4U0SA 2ONDA 4GA2A 4IN3B 5EX0A 3RJVA 3UQ3A 4F3VA 4UI9K 4U07A 5BT1A 2WPVA 2KC7A 2C0LA 3MA5A 4N3CA 4GA1A 3VTYA 2PL2A 2GW1A 1HH8A 4U0UA 3MKRA 1B89A 2XGSA 5C1DA 2FO7A 3LKUA 4XI0A 2XCCA 3RO2A 4KXKB 2KCVA 1PC2A 2FF4A 5ARGA 5G05C 3TAXA 3UPVA 2VGXA 3RIBA 3CV0A 3U4TA 4JA7A 3TGOA 2JLBA 1XNFA 4BTBA 3GW4A 2I6HA 2P58C 3KS2A 4BT9A 4N39A 1KT1A 4A1SA 3IEGA 3TG5A 1A17A 3ASHA 4WNEA 5ARFA 2PQNA 1W3BA 3CKCA 2QFCA 4G23A 3Q5MA 2LNIA 4N5CA 2VSNA 5BW8C 4LEUA 4WNGA 2XPIA 4AM9A 5KJNA 4RG6A 4GYOA 4G25A 2AVPA 4AY5A 4H7XA 4NRHB 3RU0A 4XIFA 3SF4A 4APOA 2HYZA 4GZ5A 5CCMA 1KT0A 5KJMA 5M72A 3R9AB 3TG4A 3AS4A 1IYGA 4UQXA 4UI9C 2XGOA 1WM5A 4UQYA 3AS8A 4J8DA 3CK7A 3S7DA 3OXGA 4GYWA 3NF1A 3BEEA 4B94A 1Y8MA 5FJYA 1E96B 2LSVA 3HYMB 5JJTA 3QWVA 4GZ3A 3AS5A 4Y6CA 4I2WA 3CEQA 3VTXA 4CGWA 3URZA 2PZIA 4G24A 5A6CA 5KJKA 5CCLA 4JHRA 3LPZA 1IHGA 3MV3B 5KJLA 3N71A 5FTPA 3CVNA 4ME2A 1HZ4A 2HO1A 3CVQA 3ZPJA 2VSYA 4YNDA 3E4BA 3QDNA 3CVPA 4GCNA 2V5FA 3K9IA 4NQ0A 2YHCA 5HQ8A 5DBKA 3O48A 5JJ7A 3ASFA 2IF4A 4I9EA 2Y4UA 3WXXA 4N2SA 1QQEA 2XGMA 2VGYA 4UI9J 5BNWA 4WNDA 4CGVA 2VQ2A 4ABNA 5EKQD 4Y6WA 3S7FA 5LCWJ 2KCLA 5FZSA 3Q47B 3ZFWA 2UWJG 4I1AA 5DIZA 4BTAA 3SZ7A 4AY6A 4CDRA 4N2QA 1ZBPA 3ZHEB 3FFLA 4HORA 5G04C 3S7BA 3ZGQA 4WUYA 1ELRA 3KD7A 4J8EA 3PE4A
chains in the Genus database with same CATH superfamily
4TUMA 3MYVA 1HXIA 1KLXA 4UWHA 2A4ZA 5LCWC 3UMVA 1UG3A 4HOSA 4LRZA 3FULA 3AG1E 1INZA 1QZ2A 2J9QA 3ASOE 4RG9A 2J4DA 2MOWA 3E30A 4H7YA 3JQ0A 4K5AB 4UUCA 4HOQA 3B13A 5AIJA 3FEYA 1N54A 4ACLA 2L0TB 5ANLA 3ULQA 3PDNA 3FUDA 1H2UA 4IRUA 2LXLA 3S7JA 1WAO1 1ZB1A 4LNUD 3UTMA 2C2LA 3TWTA 1WY6A 5E75A 3FU3A 4KMOA 5HI7A 4BT8A 3D9PA 4C48B 4HOTA 1Z3YA 3UT8A 4L2YA 5JA4D 4TXRA 3DPYA 4J8SA 4WNFA 2XHEA 4G26A 2BUGA 5B3SE 4JXTA 4JB8P 4HVBA 2FBNA 2UY1B 4W9RA 4EBAG 5AQAA 3CHPA 4YVQC 1NA3A 1OWPA 1NA0A 3FDHA 3QKYA 2MRIA 5AN8A 1FPPA 2PM7A 1SZAA 4MS6A 5CRVA 3L16A 3MCXA 4HXIA 2QY7A 4PS3A 3PEUB 1FCHA 2EIJE 4GMLA 3NB2A 5A23A 4U0ZA 4P29A 2RD0A 3IXEA 3GZ1A 3ASGA 3EJNA 4FP7A 4UQZA 1MYOA 3ESLA 5ENRD 3APCA 3B7UX 5D0OD 2H6FA 3TXNA 1TN6A 1D8DA 2WQHA 1NFIE 3G2UA 3PH0C 4U0SA 4IN3B 2GRRB 4F3VA 3V2XA 4U07A 2JABA 3S2AA 3CSFA 2RFAA 4FADA 3VTYA 3PNLB 1HH8A 3E37A 4KZ0A 3UM2A 1JPLA 4QQIA 2X6JA 4DK5A 4A63B 4BSZB 3EUVA 4URKA 2DZNA 5ARGA 3CVYA 4CRWA 4JVSA 5B1AE 5T8IA 1UJJA 4GTVA 3U4TA 2A5UA 2F8XK 3TGOA 2JLBA 5LOZA 3FUEA 1NL4A 4EHMA 3L08A 3PUKA 1HU3A 4RLYA 3GW4A 2I6HA 4BT9A 4N39A 2XS8A 5CMYA 4A1SA 3O4ZA 2CFZA 5G2NA 5ITZF 3DBSA 5FINA 1A17A 3ASHA 1PY1A 1N95A 4U8VD 4LNGA 3ZU7B 4ILHB 4GTPA 3TJPA 2Y0BG 3UM0A 5BW8C 4AEZC 4WNGA 3ZEFA 1TEZA 4AM9A 5KJNA 3PNTB 3L54A 4XIFA 2KZTB 1U3DA 4ANWA 4GTMA 1N52A 4FLHA 3NZSA 4XE0A 2WXMA 4DUIA 1KT0A 5KJMA 4XX5A 1PAQA 1H19A 3AS4A 4QFVA 4JW1A 2VJ8A 4K5BA 1WM5A 3HXEA 3HXFA 3AG4E 1UOHA 3CVXA 4DRXE 1HS6A 2EINE 3NF1A 4BESA 4CCAA 4OAUC 1YYHA 1OWLA 5LX8A 1E96B 1TNOA 2KBXA 3HYMB 3IBEA 2I1KA 5EILA 3ZKJA 5ENPD 3TWWA 3G2WA 3T5VA 4YDEA 1HF8A 2PZIA 5A6CA 3LXUX 4JHRA 1E7VA 2AXUA 4HLLA 3UIPC 1BI8B 4LUNU 2WXOA 1HX8A 3QJZA 3J5PA 1HO8A 4JZYA 3D9IA 4ZFHA 4MKTA 3SY2A 4DX7D 3B7RL 3CVPA 1O1SA 3RSEG 2YHCA 5HQ8A 3UM1A 4M7CA 3PVLA 4O60A 3ASFA 4C9BB 2Y4UA 3WXXA 2J8SD 2VGYA 4L1BA 4UI9J 5AJDA 2H6IA 1FT1A 3PZ1A 4ABNA 5EKQD 4Y6WA 3S7FA 5LCWJ 5FZSA 1FVFA 4I1AA 3VLFA 3R7RA 4EZJA 3IV0A 4BTAA 4ANXA 4L2LA 1GW6A 3HDXA 4N2QA 1S63A 3OTNA 2ETAA 1ZBPA 1S64A 1MX2A 3TWSA 4LNBA 5G04C 3LDZA 2X38A 3ZW3A 3VLEA 3DSVA 4ILIA 3KD7A 4J8EA 3PE4A 2XEHA 2IOSA 2CG2A 5EYPF 2LSUA 3SD5A 5FZQA 4N5QA 4J8FA 3L9TA 2J08A 5KWDA 3HVEA 3ZUVB 1OCOE 3JYSA 1RW2A 2X6HA 2Y4TA 3FUKA 3BG0B 5EX3A 1MX4A 4GTTA 1HFAA 3LYAA 4EBAA 5BPPA 3AJIA 3V2OA 3U66A 1FVHA 1O5MA 2WXRA 3TWXA 4KYOB 3PE3A 4MLPA 2ZGDA 4N3AA 2A5EA 3QWWA 4I2ZA 4AJWA 3U9WA 4A1GA 4G1TA 2OOEA 3DSSA 2XQ0A 1TJCA 4ATZD 4HNAD 5AENA 2WB2A 3Q49B 4GZCA 3FH8A 4U04A 1A5EA 4G2VA 4YDOA 4HOUA 1OWNA 2CFUA 3SQVA 2BEDA 1SA4A 3DSUA 4DPRA 3U3WA 5FIOA 4EQFA 4NURA 5JHAA 1TNYA 4O1OA 5CEAA 3ZRHA 4Z68A 3MEKA 3D9OA 1NZNA 4U63A 3GYZA 3MJWA 3GZSA 3B7SA 4I6EA 2CHWA 2E2EA 2MHKA 1O1RA 4PS8A 2ILRA 4KBQA 2PQRA 2FEZA 3P2BA 4GMRA 1IKND 2FO1E 3KSLA 4GMJA 3PZ2A 1JWGA 3I3NA 3DSXA 4ANVA 2IFUA 5A7DB 5AYWD 3FWVA 1IQRA 4E6HA 5ENQD 2BTDA 1LTXA 2X6IA 3CQCB 3C3QA 5CECB 1XGWA 3UQ3A 1TNBA 5BT1A 4U7EB 2P9IG 2WPVA 3ZYLA 2WXFA 2KC7A 1H2VC 4GA1A 2OVFA 4U0UA 4FA6A 3ONLA 1B89A 5C1DA 2FO7A 1OCRE 3SI5A 4IYPA 4XI0A 5AQBA 3DPDA 1E8WA 3RO2A 2OV8A 1WG0A 5G05C 1H6KA 2XPZA 3IHVA 4F1PA 3EHNA 3UPVA 2VGEA 1YMPA 4UWKA 1QYMA 3ZVVA 4HI9A 2B0OE 4JA7A 2IEJA 4JEHA 4PS7A 2VSXE 3HHMA 5D66A 4BTBA 2V4HC 3HG0D 3QK0A 1E8XA 3DSTA 3E33A 5HRYA 1OXJA 3T9KA 1O1TA 5T4YA 4UWFA 4WNEA 3AU4A 4Q96A 2R59A 4YDYA 5ENTD 1YCSB 3CKCA 3J5QB 3ML8A 2YHEA 5CBOA 4N5CA 2OEVA 4LEUA 3L13A 3ZNGA 1JCRA 4RG6A 2LAHA 2DYRE 4G25A 2AVPA 1X5BA 1JCQA 4PH4B 4KZCA 3RU0A 3E34A 2P9UG 2KXPC 3SF4A 4R7LA 3UKUG 5HS0A 5KBAA 4L23A 3UI2A 2VTBA 1BU9A 2WXKA 4X8QA 4U8YD 1FT2A 2EQXA 2AXZA 3B95A 4KVOA 1LD7A 2CHZA 4J8DA 3S7DA 3FTXA 5LP0A 4HBDA 3FHEA 1Z6TA 2QC9A 4B94A 1Y8MA 1EYHA 5KNGA 3V30A 2CHXA 3C3RA 4TXPA 3U64A 3FTYA 4GZ3A 3HIZA 1NI1A 4TRQA 2ZU6B 3DEPA 2YINA 1H0AA 2BKGA 4G24A 5CCLA 3CHOA 1SA5A 4HQDA 4ACKA 3MKQA 2IU1A 3FUHA 1MZCA 4FC8A 4CDMA 4ME2A 1HZ4A 4GTSA 4ANUA 2AXVA 1LD8A 3TWRA 5J08A 3L22A 5ENNA 3L6AA 2V5FA 3K9IA 3SFXA 3HXDA 4AP2A 2XPYA 4B8CB 1N0QA 1EDUA 3EIJA 3CIAA 3O48A 2EIKE 3ML9A 3FTZA 2DCPA 1OY3D 1N4SA 3E32A 2XGMA 3L82A 4K0RA 4Q69A 4BEPA 4BY6A 4EZLA 2GRLA 2X3MA 2GROB 3Q47B 2WMNA 2UWJG 3JQ1A 3ZYQA 5DIZA 3IKOB 3FEXA 2F37A 4JEUA 4CDRA 1DCQA 3HVEB 3ZYKA 4LSZE 3W9GA 3D9LA 3C72A 2Y69E 3FFLA 4NACA 2J4BA 1K1AA 4E85A 5KNHD 4DJAA 2Y3AA 3Q79A 3ZXSA 1K1BA 4GU5A 3RRUA 4GYYA 3ASDA 3Q9NC 4M3OA 3TWVA 5D0QD 2XEEA 3QC1A 2PNNA 4XKBA 2RKKA 4FJZA 3MV2B 2NSZA 4BETA 4J6IA 1ELWA 1BD8A 4G8KA 4ZHBA 5T3RA 2R02A 3PS6A 4O6FA 3ZN3A 4JHJA 5KCMA 4GCOA 4I17A 1E8ZA 1QNFA 1E7UA 4KT6B 3EDTB 2KATA 5EN5D 2CG3A 1V54E 2J09A 4GTQA 3T8MA 3LY8A 2XEVA 4FULA 2Q7FA 2GGFA 4GTOA 4DX2A 2NC9A 5AARA 4I43A 1Q2ZA 3C3OA 4B0ZA 4BWRA 5ENSD 2QYUA 2X6FA 4OYSA 2R2LA 2KCKA 4HRNA 4WAFA 2OCCE 1UJKA 2R05A 4ATGA 3CHQA 4JD2G 3UINC 4TV3A 1WDYA 5CBNA 2ZISA 1H6OA 2X6KA 3OXFA 4F1SA 3JXJA 4GPKA 4I6GA 4B89A 3CVLA 3NOCD 3JUEA 3QOUA 5JJ6A 1AP7A 3CQGB 1TR4A 3LCAA 4RVBA 3AG2E 4I1OB 4I9CA 3FUNA 2YNQA 2WXJA 1ZU2A 2C0MA 1KZOA 4A3VA 3NZUA 2V8SE 3ABME 2WQ7A 3UX4A 4GZ6A 4AXHA 3FP3A 3UXGA 4BSXA 4F6RD 2ZIRA 5JHBA 4FHJA 3QWPA 4WWNA 4DX1A 1Z3XA 1G3NB 3HRAA 3ZIMA 3CK9A 2P9SG 3MZLB 3QNKA 5G05J 3TWQA 2J07A 2VYIA 2ETBA 3NQPA 1S70B 3DXKG 3UKRG 3CGHA 4BFRA 3FTWA 3RO3A 4GA2A 5BUZA 3RJVA 1JUQA 3KEAA 3LJ3A 4DX5D 1N11A 2PL2A 2DIWA 2GW1A 4HB5A 5EYLA 3FUJA 3MKRA 1U2VG 2XGSA 3RK6A 3EHMA 3LKUA 2MYOA 1TN7A 4CZ2D 2XCCA 2KCVA 1ELKA 3PZDA 4RQIA 1BPOA 4LCTA 5CMWA 3TAXA 3NOGD 4CYMD 2I1JA 2L0IA 5EIBE 1UW4B 2GRMA 3KSQA 4F7AA 2IO2C 4NIKA 5BV1A 2F0YA 3BG1B 1TNUA 1N9AA 2WXPA 2H6HA 2P58C 3KS2A 2HM8A 1E90A 3CHSA 4EPZA 5BXUA 1KT1A 3D9JA 4TXQA 3IEGA 3D9HA 2RFMA 3TG5A 1AWCB 5ANRA 2OEWA 3FH5A 2VTBB 4V3IA 4HS2A 1OCCE 5J90A 1W3BA 2AW6A 2L6BA 3FTUA 2GRPB 3Q75A 2VSNA 4MBGA 4GYOA 3ASNE 4PDXA 2WXLA 4AY5A 1TJFA 3Q73A 3FY4A 3R7QA 2HYZA 1SVXA 4GZ5A 1TN8A 1H2TC 5M72A 3Q78A 3DSWA 1Y6IA 3LVRE 1IYGA 4UQXA 3MKQB 4UI9C 2AWIA 4L7TA 3B7BA 3CK7A 1DC2A 3G2VA 3OXGA 4WWOA 3G2SA 4JHKA 4K5CA 3BEEA 3ZXPA 5FJYA 3VLDA 3ENEA 5AQ9A 3F6QA 3LS8A 2BKKB 3AS5A 3CVVA 3PZ3A 4Y6CA 2KM4A 3CEQA 3VTXA 4CGWA 3KEZA 3URZA 5KJKA 3IHYA 2RG8A 3LPZA 1IHGA 1V55E 3CVWA 1UN8A 5KJLA 3N71A 2GRNB 2HE0A 2JEKA 3ABLE 3CVNA 3AG3E 2HO1A 2LXMA 4WWPA 2VSYA 4YNDA 3OAWA 2IY0C 3E4BA 4KVMA 3QDNA 4GCNA 4Q94A 3TXMA 3DWLG 4NQ0A 1UN9A 4FLBA 3LVQE 5DBKA 2DWZA 5JJ7A 3AU5A 1SZ9A 4I9EA 1LF8A 1SW6A 2WQ6A 1QQEA 3FTVA 5BNWA 2WXHA 4GPMA 3ABKE 5B1BE 1IQUA 3HXCA 2P2CP 2KCLA 4F53A 3Q9UC 2LAIA 3SZ7A 3EU9A 3NAWA 4C0EA 3CR3A 4G8LA 1S0PA 3ZHEB 4GZDA 1OT8A 3APDA 4CEMA 4HORA 3CHRA 3S7BA 1N94A 3CVUA 2V4LA 2M63A 3FU5A 2EILE 4UWLA 4HRMB 4XZ4A 3EHRA 4FU3A 1IHBA 4FHKA 2V5QC 1TNZA 1YA0A 3CK8A 1L5JA 2IOLA 4DX6D 3UUXA 3LY7A 5FZRA 3V31A 5BXOA 2EIME 2VGXB 4APFA 3SBTB 2I2OA 1N0RA 2XS1A 2WXGA 3Q15A 2HR2A 1TYQG 3BUAA 3ESKA 3CLJA 3RRMB 4JL0A 2H6GA 4LERA 3BU8A 2DZOA 2ZGGA 2OVBA 5CHEE 3EHQA 4DLQA 2DBAA 1HG5A 1MQSA 2DVWA 3KAEA 2FULA 4I6JA 4IULA 3FTSA 1OUVA 3QARA 3OXLA 5G04J 5IY5E 1H6PA 4J0UA 3ULEG 4XI9A 4AVXA 2LUHA 2ZXWE 4GA0A 2NXPA 4EECA 4JA9A 4O1PA 4DI3A 3GZ2A 2V0PA 1KPSB 3NBNB 4L9PA 5AQ7A 3I5PA 5G55A 4AIFA 1N4RA 3APFA 2XZDG 2NYJA 3ONKA 5HKPA 2FI7A 3MGBA 3TWUA 3MX3A 1DCEA 3CKBA 4J7WA 4J8YA 4HI8A 3FUIA 3Q4AB 4B93B 3RRNB 3D9KA 2I9CA 4GB9A 4N3BA 1EPUA 2B6CA 3LJNA 5FQ7A 5FQ4A 1P5QA 2L6JA 2YQ8A 4YVOA 3T5XA 3UT4A 2UY1A 3QB2A 5FT9A 4DI4A 2XCBA 1NP7A 3C5RA 4OVVA 4DLOA 5BV0A 3UIOC 2R5SA 3I4GA 4PUCA 3RKVA 3PEVB 3LY9A 3ZHEA 2ONDA 5EX0A 4UI9K 2WXNA 3D3MA 2C0LA 3MA5A 4N3CA 3WG7E 2IJGX 3SFYA 4B8AA 3FU0A 2GRQB 4JC8A 3FH7A 4KXKB 1PC2A 3SNXA 2DYSE 2FF4A 3SFZA 3JXIA 4OVUA 1JWFA 1X81A 4BX8A 4U8HA 3B7TA 2VGXA 4MRUA 3RIBA 3CV0A 4I1MA 1E8YA 2F8YA 4OAVB 1XNFA 3EU5A 4LG6A 1N4QA 2XENA 3QAQA 1IXVA 3C98A 5FQ8A 2WVIA 4GAAA 3FUFA 2L9BA 2P9LG 5EDSA 4K03A 5C2YA 5ARFA 2PQNA 4GTRA 1DVPA 2Y1LE 3UM3A 2QFCA 1OWOA 4XEIG 1Z5SC 4G23A 3Q5MA 1K3ZD 5FQ6A 2LNIA 3CHMA 2XPIA 5CERB 2ETCA 4RSYA 1D8EA 4A55A 2LO6A 4U96D 4H7XA 4NRHB 2QYJA 4EZKA 3D9NA 4HRLA 2WXIA 5CRUA 2P9PG 4APOA 3ISMC 5CCMA 3Q7AA 4AOFA 4HFGA 3R9AB 3TG4A 5E76A 2R17C 2XGOA 3FU6A 4CT4A 4G11A 5AAOA 4UQYA 3I4RB 3AS8A 3R9MA 3ULYA 4BX9A 1OWMA 3ZYMA 4GYWA 4U95D 1QBQA 4CDNA 2BF0X 2LSVA 5JJTA 3QWVA 3JUIA 2KZTA 2P9NG 3G2TA 3AAAC 5CEDB 3CSTA 1KZPA 4I2WA 3D9MA 3V79K 1N4PA 3T8KA 3FUMA 1U3CA 1MJ0A 1OCZE 4CT0A 3RAUA 2WXQA 5JMND 3MV3B 5FTPA 3X2QE 4A3TA 2QZAA 3SGHA 4JPSA 2R03A 3EIQC 1JCSA 3SHFA 1EF1C 5H7PA 3CVQA 3ZPJA 3DRAA 1RZ4A 2E0IA 2PM6A 2WM9A 3PREA 5LFAA 5ENOD 3L17A 5D2MC 2IONA 2IF4A 3HXBA 4BERA 2IO3C 3SBSA 2XRYA 3PZ4A 4N2SA 1BI7B 1VDYA 4AV7A 2P9KG 4UWGA 1MHQA 4TUUA 3DXMG 4WNDA 3W9FA 4CGVA 4FJYA 2VQ2A 3PRZA 1D9SA 3UT7A 2XZTG 5EIDA 4D10C 3ZFWA 3TL5A 3BQOA 4AY6A 4YDWA 2WMOA 4C0MA 2IQCA 1HG2A 1HE8A 2J49A 4ILGA 3Q7FA 4XKCA 4HLEA 1DNPA 3DEOA 5AJLA 3PUJA 2VSOE 2XRZA 1MX6A 3P1UA 3LEWA 1SQMA 1BLXB 3ZGQA 3JCKC 4WUYA 1ELRA 2AJAA 3SO8A 5FWQA 1K8KG
chains in the Genus database with same CATH topology
4FHKA 2IOSA 3MYVA 1HXIA 3ZXSA 1KLXA 2CG2A 4UWHA 4GU5A 2A4ZA 3RRUA 2LSUA 3SD5A 5LCWC 4GYYA 5FZQA 3UMVA 1YA0A 3CK8A 3ASDA 1UG3A 1L5JA 2IOLA 4M3OA 4HOSA 4J8FA 3UUXA 4LRZA 3LY7A 3FULA 2J08A 5D0QD 5FZRA 3HVEA 3QC1A 3JYSA 4XKBA 2VGXB 4APFA 3SBTB 1INZA 2X6HA 2Y4TA 2I2OA 3FUKA 3BG0B 1QZ2A 5EX3A 2J9QA 4FJZA 2WXGA 1HFAA 3LYAA 2NSZA 2HR2A 3MV2B 3Q15A 4EBAA 5BPPA 4J6IA 1ELWA 4RG9A 2J4DA 3ESKA 2MOWA 5T3RA 3U66A 3PS6A 1FVHA 3CLJA 4H7YA 4O6FA 3RRMB 4JL0A 3JQ0A 3ZN3A 4JHJA 5KCMA 2WXRA 4GCOA 4KYOB 3PE3A 4I17A 1E8ZA 4HOQA 4LERA 4MLPA 1QNFA 3B13A 2OVBA 5AIJA 1E7UA 5CHEE 3FEYA 4KT6B 1N54A 4N3AA 4ACLA 2L0TB 5ANLA 3EDTB 3ULQA 4DLQA 2KATA 3QWWA 2DBAA 1HG5A 2CG3A 3PDNA 3FUDA 4I2ZA 2J09A 4AJWA 1MQSA 1H2UA 4IRUA 3U9WA 3KAEA 3T8MA 3S7JA 3LY8A 2XEVA 4A1GA 2FULA 1WAO1 4G1TA 4I6JA 2OOEA 4FULA 4IULA 2XQ0A 2C2LA 2Q7FA 3FTSA 1TJCA 1OUVA 1WY6A 2GGFA 5E75A 3FU3A 2NC9A 4KMOA 3QARA 5HI7A 4I43A 3OXLA 5AENA 5G04J 4B0ZA 2WB2A 4BT8A 4BWRA 3Q49B 3D9PA 4J0UA 4HOTA 1Z3YA 4GZCA 2X6FA 4OYSA 3UT8A 4L2YA 3FH8A 2KCKA 4U04A 4XI9A 4WAFA 4AVXA 4GA0A 4G2VA 4J8SA 2NXPA 4HOUA 4WNFA 4EECA 1UJKA 4JA9A 2XHEA 4DI3A 3GZ2A 2V0PA 4G26A 4ATGA 3CHQA 1OWNA 2BUGA 2CFUA 4TV3A 3I5PA 5G55A 4AIFA 3APFA 4JXTA 4HVBA 2FBNA 2X6KA 3OXFA 2UY1B 4W9RA 4DPRA 4F1SA 4GPKA 4EBAG 3U3WA 4I6GA 4EQFA 4NURA 3CHPA 4B89A 3ONKA 4YVQC 1NA3A 1OWPA 3CVLA 2FI7A 5JHAA 1NA0A 3MGBA 3FDHA 3QKYA 2MRIA 3QOUA 3MX3A 5JJ6A 3CKBA 3CQGB 3ZRHA 2PM7A 3D9OA 1NZNA 3LCAA 3MEKA 4RVBA 4U63A 1SZAA 3FUIA 3GYZA 3MJWA 4MS6A 3Q4AB 4I1OB 3GZSA 4I9CA 3FUNA 3B7SA 4I6EA 3L16A 3MCXA 2YNQA 2WXJA 3RRNB 1ZU2A 4HXIA 2CHWA 2C0MA 3D9KA 2E2EA 2MHKA 4PS8A 2I9CA 4GB9A 4A3VA 3NZUA 2ILRA 2QY7A 2PQRA 4KBQA 4PS3A 3PEUB 4N3BA 2FEZA 2V8SE 3P2BA 1FCHA 2WQ7A 1EPUA 3UX4A 4GMLA 4GMJA 4GZ6A 5A23A 4U0ZA 4P29A 4AXHA 2RD0A 3GZ1A 3ASGA 3FP3A 4BSXA 5FQ7A 1JWGA 5JHBA 5FQ4A 1P5QA 3EJNA 4FHJA 4FP7A 2L6JA 3QWPA 4WWNA 2YQ8A 4UQZA 4YVOA 1Z3XA 3T5XA 3UT4A 2UY1A 3ZIMA 3CK9A 3I3NA 3MZLB 3QB2A 3ESLA 3QNKA 3APCA 2XCBA 1NP7A 3B7UX 5D0OD 5FT9A 2J07A 5G05J 4DI4A 2VYIA 4ANVA 2IFUA 5A7DB 4OVVA 3NQPA 4DLOA 5BV0A 3TXNA 2R5SA 5AYWD 3CGHA 3FWVA 1IQRA 4E6HA 3I4GA 2WQHA 3FTWA 4BFRA 2BTDA 2X6IA 4PUCA 3RKVA 3PH0C 3G2UA 3CQCB 3PEVB 3LY9A 3RO3A 3ZHEA 4U0SA 2ONDA 4GA2A 5BUZA 4IN3B 1XGWA 5EX0A 3RJVA 3UQ3A 4F3VA 4UI9K 2WXNA 1JUQA 4U07A 5BT1A 3LJ3A 2WPVA 3CSFA 3S2AA 2WXFA 3ZYLA 3D3MA 2KC7A 1H2VC 2C0LA 3MA5A 4N3CA 4FADA 3PNLB 4GA1A 2PL2A 2DIWA 2GW1A 1HH8A 2OVFA 4U0UA 3VTYA 4FA6A 2IJGX 3FUJA 3MKRA 3ONLA 1B89A 2XGSA 4KZ0A 5C1DA 1JPLA 2FO7A 4B8AA 2X6JA 3RK6A 4DK5A 3EHMA 3FU0A 4IYPA 3SI5A 3LKUA 4XI0A 2XCCA 3DPDA 1E8WA 4JC8A 3FH7A 2KCVA 4KXKB 1ELKA 3RO2A 2OV8A 1PC2A 3PZDA 4URKA 1BPOA 4LCTA 3SNXA 2FF4A 3SFZA 5ARGA 3CVYA 4OVUA 1JWFA 1H6KA 5G05C 2XPZA 4CRWA 3IHVA 5CMWA 3EHNA 4JVSA 3TAXA 4BX8A 5T8IA 4U8HA 3UPVA 1UJJA 4UWKA 2I1JA 3B7TA 2L0IA 2VGXA 4MRUA 3RIBA 1UW4B 2GRMA 4F7AA 3CV0A 4I1MA 3U4TA 2A5UA 3ZVVA 4JA7A 4JEHA 1E8YA 3TGOA 2JLBA 5BV1A 3BG1B 4PS7A 5LOZA 3FUEA 2WXPA 3L08A 2VSXE 1XNFA 3PUKA 3HHMA 1HU3A 4BTBA 3GW4A 2I6HA 2P58C 3KS2A 4BT9A 4N39A 2HM8A 1E90A 3QAQA 3CHSA 3QK0A 1E8XA 4EPZA 1KT1A 5CMYA 3D9JA 4A1SA 3C98A 3IEGA 3O4ZA 5FQ8A 2CFZA 5G2NA 2WVIA 3TG5A 4GAAA 3DBSA 1A17A 5ANRA 3ASHA 3FUFA 2L9BA 4UWFA 1PY1A 3FH5A 5T4YA 4V3IA 2VTBB 5EDSA 4HS2A 4K03A 5C2YA 4WNEA 3AU4A 5ARFA 5J90A 4Q96A 2R59A 2PQNA 1W3BA 2AW6A 3CKCA 3FTUA 1DVPA 3ML8A 2QFCA 1OWOA 4G23A 3Q5MA 2YHEA 5FQ6A 4ILHB 2LNIA 3TJPA 4N5CA 3CHMA 2VSNA 5BW8C 4AEZC 4LEUA 4WNGA 2XPIA 3ZEFA 1TEZA 3L13A 4AM9A 5KJNA 4RG6A 2LAHA 4GYOA 4G25A 3PNTB 3L54A 4RSYA 2AVPA 2WXLA 4PDXA 1X5BA 4A55A 2LO6A 4PH4B 4AY5A 4H7XA 4NRHB 4KZCA 3RU0A 4XIFA 2KZTB 1TJFA 1U3DA 4ANWA 4EZKA 3D9NA 1N52A 3FY4A 2WXIA 4FLHA 3NZSA 3R7QA 3SF4A 2HYZA 4R7LA 4APOA 4XE0A 2WXMA 4GZ5A 5CCMA 1KT0A 5KJMA 4AOFA 4XX5A 1PAQA 1H2TC 5M72A 1H19A 4HFGA 3R9AB 3TG4A 1Y6IA 3AS4A 3LVRE 5E76A 4L23A 4JW1A 4QFVA 2VTBA 2VJ8A 1IYGA 4UQXA 3MKQB 2R17C 4UI9C 2WXKA 2XGOA 3FU6A 1WM5A 4CT4A 4G11A 2AWIA 4UQYA 2EQXA 2AXZA 3I4RB 4L7TA 4KVOA 3AS8A 4BX9A 2CHZA 1OWMA 3CK7A 4J8DA 3S7DA 3G2VA 3ZYMA 3OXGA 3CVXA 1HS6A 4GYWA 3NF1A 4WWOA 3FTXA 3G2SA 4JHKA 5LP0A 4CCAA 3BEEA 3FHEA 1OWLA 1Z6TA 5LX8A 4B94A 1Y8MA 5FJYA 1E96B 4CDNA 1EYHA 2BF0X 2LSVA 3HYMB 2CHXA 3IBEA 3QWVA 5JJTA 3JUIA 3FTYA 2KZTA 2I1KA 4GZ3A 3U64A 3VLDA 3HIZA 3ENEA 3G2TA 3LS8A 4TRQA 2ZU6B 3AS5A 3CVVA 3CSTA 2YINA 3G2WA 1H0AA 3T5VA 4Y6CA 2KM4A 3CEQA 3D9MA 4I2WA 3VTXA 4CGWA 3KEZA 1HF8A 2PZIA 4G24A 3URZA 5A6CA 3LXUX 5KJKA 3FUMA 1U3CA 5CCLA 4JHRA 3CHOA 3IHYA 1E7VA 2AXUA 2RG8A 3LPZA 4ACKA 1IHGA 3MKQA 4CT0A 3CVWA 2WXQA 1UN8A 2IU1A 3MV3B 3N71A 5KJLA 3FUHA 4LUNU 5FTPA 2WXOA 4A3TA 2JEKA 1HX8A 3CVNA 4FC8A 4CDMA 3QJZA 3SGHA 4ME2A 1HZ4A 3EIQC 2HO1A 4JPSA 4ANUA 1HO8A 2AXVA 4JZYA 3D9IA 3SHFA 4MKTA 1EF1C 5J08A 3L22A 3CVQA 3ZPJA 5ENNA 4WWPA 2VSYA 4YNDA 3B7RL 3OAWA 3E4BA 4KVMA 3QDNA 3L6AA 2E0IA 3CVPA 2PM6A 2V5FA 4GCNA 2WM9A 4Q94A 3TXMA 3K9IA 4NQ0A 1UN9A 2YHCA 3PREA 4AP2A 2XPYA 5HQ8A 4FLBA 4B8CB 5LFAA 3LVQE 5DBKA 1EDUA 3EIJA 3CIAA 3O48A 3L17A 3PVLA 3ML9A 2IONA 3ASFA 5JJ7A 2IF4A 3FTZA 4C9BB 2DCPA 3AU5A 3SBSA 2XRYA 1SZ9A 4I9EA 1LF8A 2Y4UA 3WXXA 4N2SA 2WQ6A 1VDYA 4AV7A 1QQEA 2XGMA 4L1BA 2VGYA 4UI9J 4UWGA 1MHQA 4TUUA 3FTVA 4K0RA 5AJDA 5BNWA 4WNDA 4CGVA 4Q69A 2WXHA 4FJYA 4BY6A 4EZLA 2GRLA 2VQ2A 2X3MA 3PRZA 4ABNA 1IQUA 3UT7A 5EKQD 4Y6WA 4D10C 3S7FA 5LCWJ 2KCLA 5FZSA 1FVFA 3Q47B 2WMNA 3ZFWA 2UWJG 4F53A 3JQ1A 4I1AA 3VLFA 3ZYQA 5DIZA 3R7RA 4EZJA 3TL5A 3IV0A 3IKOB 3FEXA 4JEUA 4ANXA 4L2LA 4BTAA 2LAIA 3SZ7A 4AY6A 4CDRA 1GW6A 2WMOA 3HDXA 3HVEB 3ZYKA 2IQCA 4C0MA 1HG2A 4N2QA 1HE8A 2J49A 3OTNA 4C0EA 4ILGA 3CR3A 1ZBPA 3D9LA 1S0PA 3ZHEB 4GZDA 3FFLA 4XKCA 4HLEA 3APDA 4NACA 1DNPA 4CEMA 3CHRA 2J4BA 4HORA 5G04C 4E85A 5AJLA 3PUJA 3S7BA 3LDZA 2X38A 3ZW3A 2VSOE 3CVUA 2XRZA 3VLEA 3P1UA 4DJAA 2V4LA 2Y3AA 3LEWA 1SQMA 2M63A 3FU5A 3ZGQA 4ILIA 3JCKC 4WUYA 4UWLA 1ELRA 3KD7A 4J8EA 4XZ4A 3PE4A 4FU3A 5FWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXI A;  1KLX A;  2LSU A;  5LCW C;  4GYY A;  5FZQ A;  1YA0 A;  3CK8 A;  3ASD A;  4HOS A;  4J8F A;  3UUX A;  3LY7 A;  5D0Q D;  5FZR A;  3JYS A;  2VGX B;  2Y4T A;  1QZ2 A;  5EX3 A;  2J9Q A;  3MV2 B;  3LYA A;  3Q15 A;  2HR2 A;  1ELW A;  4RG9 A;  3ESK A;  4O6F A;  4H7Y A;  4JL0 A;  3ZN3 A;  4GCO A;  4KYO B;  3PE3 A;  4I17 A;  4HOQ A;  5CHE E;  4N3A A;  3ULQ A;  3EDT B;  2KAT A;  3QWW A;  2DBA A;  3PDN A;  4I2Z A;  3KAE A;  3S7J A;  3LY8 A;  2XEV A;  1WAO 1;  4G1T A;  2OOE A;  2C2L A;  2Q7F A;  1TJC A;  1OUV A;  2NC9 A;  5HI7 A;  3OXL A;  5G04 J;  4BT8 A;  4BWR A;  3Q49 B;  4J0U A;  4HOT A;  2KCK A;  4U04 A;  4XI9 A;  4GA0 A;  4G2V A;  4HOU A;  4WNF A;  4JA9 A;  3GZ2 A;  4G26 A;  2BUG A;  4AIF A;  2FBN A;  3OXF A;  2UY1 B;  4W9R A;  4GPK A;  3U3W A;  4EQF A;  4YVQ C;  1NA3 A;  3CVL A;  2FI7 A;  1NA0 A;  3QKY A;  3QOU A;  5JJ6 A;  3CKB A;  3MEK A;  3LCA A;  1NZN A;  3GYZ A;  3Q4A B;  4I9C A;  1ZU2 A;  2C0M A;  2E2E A;  2MHK A;  4KBQ A;  2PQR A;  4N3B A;  2FEZ A;  1FCH A;  4GZ6 A;  4U0Z A;  3GZ1 A;  3ASG A;  3FP3 A;  1P5Q A;  2L6J A;  3QWP A;  2YQ8 A;  4UQZ A;  4YVO A;  2UY1 A;  3CK9 A;  5FT9 A;  5G05 J;  2XCB A;  5D0O D;  2VYI A;  2IFU A;  5A7D B;  2R5S A;  5AYW D;  3FWV A;  2WQH A;  3RKV A;  3RO3 A;  3LY9 A;  3ZHE A;  4U0S A;  2OND A;  4GA2 A;  4IN3 B;  5EX0 A;  3RJV A;  3UQ3 A;  4F3V A;  4UI9 K;  4U07 A;  5BT1 A;  2WPV A;  2KC7 A;  2C0L A;  3MA5 A;  4N3C A;  4GA1 A;  3VTY A;  2PL2 A;  2GW1 A;  1HH8 A;  4U0U A;  3MKR A;  1B89 A;  2XGS A;  5C1D A;  2FO7 A;  3LKU A;  4XI0 A;  2XCC A;  3RO2 A;  4KXK B;  2KCV A;  1PC2 A;  2FF4 A;  5ARG A;  5G05 C;  3TAX A;  3UPV A;  2VGX A;  3RIB A;  3CV0 A;  3U4T A;  4JA7 A;  3TGO A;  2JLB A;  1XNF A;  4BTB A;  3GW4 A;  2I6H A;  2P58 C;  3KS2 A;  4BT9 A;  4N39 A;  1KT1 A;  4A1S A;  3IEG A;  3TG5 A;  1A17 A;  3ASH A;  4WNE A;  5ARF A;  2PQN A;  1W3B A;  3CKC A;  2QFC A;  4G23 A;  3Q5M A;  2LNI A;  4N5C A;  2VSN A;  5BW8 C;  4LEU A;  4WNG A;  2XPI A;  4AM9 A;  5KJN A;  4RG6 A;  4GYO A;  4G25 A;  2AVP A;  4AY5 A;  4H7X A;  4NRH B;  3RU0 A;  4XIF A;  3SF4 A;  4APO A;  2HYZ A;  4GZ5 A;  5CCM A;  1KT0 A;  5KJM A;  5M72 A;  3R9A B;  3TG4 A;  3AS4 A;  1IYG A;  4UQX A;  4UI9 C;  2XGO A;  1WM5 A;  4UQY A;  3AS8 A;  4J8D A;  3CK7 A;  3S7D A;  3OXG A;  4GYW A;  3NF1 A;  3BEE A;  4B94 A;  1Y8M A;  5FJY A;  1E96 B;  2LSV A;  3HYM B;  5JJT A;  3QWV A;  4GZ3 A;  3AS5 A;  4Y6C A;  4I2W A;  3CEQ A;  3VTX A;  4CGW A;  3URZ A;  2PZI A;  4G24 A;  5A6C A;  5KJK A;  5CCL A;  4JHR A;  3LPZ A;  1IHG A;  3MV3 B;  5KJL A;  3N71 A;  5FTP A;  3CVN A;  4ME2 A;  1HZ4 A;  2HO1 A;  3CVQ A;  3ZPJ A;  2VSY A;  4YND A;  3E4B A;  3QDN A;  3CVP A;  4GCN A;  2V5F A;  3K9I A;  4NQ0 A;  2YHC A;  5HQ8 A;  5DBK A;  3O48 A;  5JJ7 A;  3ASF A;  2IF4 A;  4I9E A;  2Y4U A;  3WXX A;  4N2S A;  1QQE A;  2XGM A;  2VGY A;  4UI9 J;  5BNW A;  4WND A;  4CGV A;  2VQ2 A;  4ABN A;  5EKQ D;  4Y6W A;  3S7F A;  5LCW J;  2KCL A;  5FZS A;  3Q47 B;  3ZFW A;  2UWJ G;  4I1A A;  5DIZ A;  4BTA A;  3SZ7 A;  4AY6 A;  4CDR A;  4N2Q A;  1ZBP A;  3ZHE B;  3FFL A;  4HOR A;  5G04 C;  3S7B A;  3ZGQ A;  4WUY A;  1ELR A;  3KD7 A;  4J8E A;  3PE4 A; 
#chains in the Genus database with same CATH topology
 4TUM A;  3MYV A;  1HXI A;  1KLX A;  4UWH A;  2A4Z A;  5LCW C;  3UMV A;  1UG3 A;  4HOS A;  4LRZ A;  3FUL A;  3AG1 E;  1INZ A;  1QZ2 A;  2J9Q A;  3ASO E;  4RG9 A;  2J4D A;  2MOW A;  3E30 A;  4H7Y A;  3JQ0 A;  4K5A B;  4UUC A;  4HOQ A;  3B13 A;  5AIJ A;  3FEY A;  1N54 A;  4ACL A;  2L0T B;  5ANL A;  3ULQ A;  3PDN A;  3FUD A;  1H2U A;  4IRU A;  2LXL A;  3S7J A;  1WAO 1;  1ZB1 A;  4LNU D;  3UTM A;  2C2L A;  3TWT A;  1WY6 A;  5E75 A;  3FU3 A;  4KMO A;  5HI7 A;  4BT8 A;  3D9P A;  4C48 B;  4HOT A;  1Z3Y A;  3UT8 A;  4L2Y A;  5JA4 D;  4TXR A;  3DPY A;  4J8S A;  4WNF A;  2XHE A;  4G26 A;  2BUG A;  5B3S E;  4JXT A;  4JB8 P;  4HVB A;  2FBN A;  2UY1 B;  4W9R A;  4EBA G;  5AQA A;  3CHP A;  4YVQ C;  1NA3 A;  1OWP A;  1NA0 A;  3FDH A;  3QKY A;  2MRI A;  5AN8 A;  1FPP A;  2PM7 A;  1SZA A;  4MS6 A;  5CRV A;  3L16 A;  3MCX A;  4HXI A;  2QY7 A;  4PS3 A;  3PEU B;  1FCH A;  2EIJ E;  4GML A;  3NB2 A;  5A23 A;  4U0Z A;  4P29 A;  2RD0 A;  3IXE A;  3GZ1 A;  3ASG A;  3EJN A;  4FP7 A;  4UQZ A;  1MYO A;  3ESL A;  5ENR D;  3APC A;  3B7U X;  5D0O D;  2H6F A;  3TXN A;  1TN6 A;  1D8D A;  2WQH A;  1NFI E;  3G2U A;  3PH0 C;  4U0S A;  4IN3 B;  2GRR B;  4F3V A;  3V2X A;  4U07 A;  2JAB A;  3S2A A;  3CSF A;  2RFA A;  4FAD A;  3VTY A;  3PNL B;  1HH8 A;  3E37 A;  4KZ0 A;  3UM2 A;  1JPL A;  4QQI A;  2X6J A;  4DK5 A;  4A63 B;  4BSZ B;  3EUV A;  4URK A;  2DZN A;  5ARG A;  3CVY A;  4CRW A;  4JVS A;  5B1A E;  5T8I A;  1UJJ A;  4GTV A;  3U4T A;  2A5U A;  2F8X K;  3TGO A;  2JLB A;  5LOZ A;  3FUE A;  1NL4 A;  4EHM A;  3L08 A;  3PUK A;  1HU3 A;  4RLY A;  3GW4 A;  2I6H A;  4BT9 A;  4N39 A;  2XS8 A;  5CMY A;  4A1S A;  3O4Z A;  2CFZ A;  5G2N A;  5ITZ F;  3DBS A;  5FIN A;  1A17 A;  3ASH A;  1PY1 A;  1N95 A;  4U8V D;  4LNG A;  3ZU7 B;  4ILH B;  4GTP A;  3TJP A;  2Y0B G;  3UM0 A;  5BW8 C;  4AEZ C;  4WNG A;  3ZEF A;  1TEZ A;  4AM9 A;  5KJN A;  3PNT B;  3L54 A;  4XIF A;  2KZT B;  1U3D A;  4ANW A;  4GTM A;  1N52 A;  4FLH A;  3NZS A;  4XE0 A;  2WXM A;  4DUI A;  1KT0 A;  5KJM A;  4XX5 A;  1PAQ A;  1H19 A;  3AS4 A;  4QFV A;  4JW1 A;  2VJ8 A;  4K5B A;  1WM5 A;  3HXE A;  3HXF A;  3AG4 E;  1UOH A;  3CVX A;  4DRX E;  1HS6 A;  2EIN E;  3NF1 A;  4BES A;  4CCA A;  4OAU C;  1YYH A;  1OWL A;  5LX8 A;  1E96 B;  1TNO A;  2KBX A;  3HYM B;  3IBE A;  2I1K A;  5EIL A;  3ZKJ A;  5ENP D;  3TWW A;  3G2W A;  3T5V A;  4YDE A;  1HF8 A;  2PZI A;  5A6C A;  3LXU X;  4JHR A;  1E7V A;  2AXU A;  4HLL A;  3UIP C;  1BI8 B;  4LUN U;  2WXO A;  1HX8 A;  3QJZ A;  3J5P A;  1HO8 A;  4JZY A;  3D9I A;  4ZFH A;  4MKT A;  3SY2 A;  4DX7 D;  3B7R L;  3CVP A;  1O1S A;  3RSE G;  2YHC A;  5HQ8 A;  3UM1 A;  4M7C A;  3PVL A;  4O60 A;  3ASF A;  4C9B B;  2Y4U A;  3WXX A;  2J8S D;  2VGY A;  4L1B A;  4UI9 J;  5AJD A;  2H6I A;  1FT1 A;  3PZ1 A;  4ABN A;  5EKQ D;  4Y6W A;  3S7F A;  5LCW J;  5FZS A;  1FVF A;  4I1A A;  3VLF A;  3R7R A;  4EZJ A;  3IV0 A;  4BTA A;  4ANX A;  4L2L A;  1GW6 A;  3HDX A;  4N2Q A;  1S63 A;  3OTN A;  2ETA A;  1ZBP A;  1S64 A;  1MX2 A;  3TWS A;  4LNB A;  5G04 C;  3LDZ A;  2X38 A;  3ZW3 A;  3VLE A;  3DSV A;  4ILI A;  3KD7 A;  4J8E A;  3PE4 A;  2XEH A;  2IOS A;  2CG2 A;  5EYP F;  2LSU A;  3SD5 A;  5FZQ A;  4N5Q A;  4J8F A;  3L9T A;  2J08 A;  5KWD A;  3HVE A;  3ZUV B;  1OCO E;  3JYS A;  1RW2 A;  2X6H A;  2Y4T A;  3FUK A;  3BG0 B;  5EX3 A;  1MX4 A;  4GTT A;  1HFA A;  3LYA A;  4EBA A;  5BPP A;  3AJI A;  3V2O A;  3U66 A;  1FVH A;  1O5M A;  2WXR A;  3TWX A;  4KYO B;  3PE3 A;  4MLP A;  2ZGD A;  4N3A A;  2A5E A;  3QWW A;  4I2Z A;  4AJW A;  3U9W A;  4A1G A;  4G1T A;  2OOE A;  3DSS A;  2XQ0 A;  1TJC A;  4ATZ D;  4HNA D;  5AEN A;  2WB2 A;  3Q49 B;  4GZC A;  3FH8 A;  4U04 A;  1A5E A;  4G2V A;  4YDO A;  4HOU A;  1OWN A;  2CFU A;  3SQV A;  2BED A;  1SA4 A;  3DSU A;  4DPR A;  3U3W A;  5FIO A;  4EQF A;  4NUR A;  5JHA A;  1TNY A;  4O1O A;  5CEA A;  3ZRH A;  4Z68 A;  3MEK A;  3D9O A;  1NZN A;  4U63 A;  3GYZ A;  3MJW A;  3GZS A;  3B7S A;  4I6E A;  2CHW A;  2E2E A;  2MHK A;  1O1R A;  4PS8 A;  2ILR A;  4KBQ A;  2PQR A;  2FEZ A;  3P2B A;  4GMR A;  1IKN D;  2FO1 E;  3KSL A;  4GMJ A;  3PZ2 A;  1JWG A;  3I3N A;  3DSX A;  4ANV A;  2IFU A;  5A7D B;  5AYW D;  3FWV A;  1IQR A;  4E6H A;  5ENQ D;  2BTD A;  1LTX A;  2X6I A;  3CQC B;  3C3Q A;  5CEC B;  1XGW A;  3UQ3 A;  1TNB A;  5BT1 A;  4U7E B;  2P9I G;  2WPV A;  3ZYL A;  2WXF A;  2KC7 A;  1H2V C;  4GA1 A;  2OVF A;  4U0U A;  4FA6 A;  3ONL A;  1B89 A;  5C1D A;  2FO7 A;  1OCR E;  3SI5 A;  4IYP A;  4XI0 A;  5AQB A;  3DPD A;  1E8W A;  3RO2 A;  2OV8 A;  1WG0 A;  5G05 C;  1H6K A;  2XPZ A;  3IHV A;  4F1P A;  3EHN A;  3UPV A;  2VGE A;  1YMP A;  4UWK A;  1QYM A;  3ZVV A;  4HI9 A;  2B0O E;  4JA7 A;  2IEJ A;  4JEH A;  4PS7 A;  2VSX E;  3HHM A;  5D66 A;  4BTB A;  2V4H C;  3HG0 D;  3QK0 A;  1E8X A;  3DST A;  3E33 A;  5HRY A;  1OXJ A;  3T9K A;  1O1T A;  5T4Y A;  4UWF A;  4WNE A;  3AU4 A;  4Q96 A;  2R59 A;  4YDY A;  5ENT D;  1YCS B;  3CKC A;  3J5Q B;  3ML8 A;  2YHE A;  5CBO A;  4N5C A;  2OEV A;  4LEU A;  3L13 A;  3ZNG A;  1JCR A;  4RG6 A;  2LAH A;  2DYR E;  4G25 A;  2AVP A;  1X5B A;  1JCQ A;  4PH4 B;  4KZC A;  3RU0 A;  3E34 A;  2P9U G;  2KXP C;  3SF4 A;  4R7L A;  3UKU G;  5HS0 A;  5KBA A;  4L23 A;  3UI2 A;  2VTB A;  1BU9 A;  2WXK A;  4X8Q A;  4U8Y D;  1FT2 A;  2EQX A;  2AXZ A;  3B95 A;  4KVO A;  1LD7 A;  2CHZ A;  4J8D A;  3S7D A;  3FTX A;  5LP0 A;  4HBD A;  3FHE A;  1Z6T A;  2QC9 A;  4B94 A;  1Y8M A;  1EYH A;  5KNG A;  3V30 A;  2CHX A;  3C3R A;  4TXP A;  3U64 A;  3FTY A;  4GZ3 A;  3HIZ A;  1NI1 A;  4TRQ A;  2ZU6 B;  3DEP A;  2YIN A;  1H0A A;  2BKG A;  4G24 A;  5CCL A;  3CHO A;  1SA5 A;  4HQD A;  4ACK A;  3MKQ A;  2IU1 A;  3FUH A;  1MZC A;  4FC8 A;  4CDM A;  4ME2 A;  1HZ4 A;  4GTS A;  4ANU A;  2AXV A;  1LD8 A;  3TWR A;  5J08 A;  3L22 A;  5ENN A;  3L6A A;  2V5F A;  3K9I A;  3SFX A;  3HXD A;  4AP2 A;  2XPY A;  4B8C B;  1N0Q A;  1EDU A;  3EIJ A;  3CIA A;  3O48 A;  2EIK E;  3ML9 A;  3FTZ A;  2DCP A;  1OY3 D;  1N4S A;  3E32 A;  2XGM A;  3L82 A;  4K0R A;  4Q69 A;  4BEP A;  4BY6 A;  4EZL A;  2GRL A;  2X3M A;  2GRO B;  3Q47 B;  2WMN A;  2UWJ G;  3JQ1 A;  3ZYQ A;  5DIZ A;  3IKO B;  3FEX A;  2F37 A;  4JEU A;  4CDR A;  1DCQ A;  3HVE B;  3ZYK A;  4LSZ E;  3W9G A;  3D9L A;  3C72 A;  2Y69 E;  3FFL A;  4NAC A;  2J4B A;  1K1A A;  4E85 A;  5KNH D;  4DJA A;  2Y3A A;  3Q79 A;  3ZXS A;  1K1B A;  4GU5 A;  3RRU A;  4GYY A;  3ASD A;  3Q9N C;  4M3O A;  3TWV A;  5D0Q D;  2XEE A;  3QC1 A;  2PNN A;  4XKB A;  2RKK A;  4FJZ A;  3MV2 B;  2NSZ A;  4BET A;  4J6I A;  1ELW A;  1BD8 A;  4G8K A;  4ZHB A;  5T3R A;  2R02 A;  3PS6 A;  4O6F A;  3ZN3 A;  4JHJ A;  5KCM A;  4GCO A;  4I17 A;  1E8Z A;  1QNF A;  1E7U A;  4KT6 B;  3EDT B;  2KAT A;  5EN5 D;  2CG3 A;  1V54 E;  2J09 A;  4GTQ A;  3T8M A;  3LY8 A;  2XEV A;  4FUL A;  2Q7F A;  2GGF A;  4GTO A;  4DX2 A;  2NC9 A;  5AAR A;  4I43 A;  1Q2Z A;  3C3O A;  4B0Z A;  4BWR A;  5ENS D;  2QYU A;  2X6F A;  4OYS A;  2R2L A;  2KCK A;  4HRN A;  4WAF A;  2OCC E;  1UJK A;  2R05 A;  4ATG A;  3CHQ A;  4JD2 G;  3UIN C;  4TV3 A;  1WDY A;  5CBN A;  2ZIS A;  1H6O A;  2X6K A;  3OXF A;  4F1S A;  3JXJ A;  4GPK A;  4I6G A;  4B89 A;  3CVL A;  3NOC D;  3JUE A;  3QOU A;  5JJ6 A;  1AP7 A;  3CQG B;  1TR4 A;  3LCA A;  4RVB A;  3AG2 E;  4I1O B;  4I9C A;  3FUN A;  2YNQ A;  2WXJ A;  1ZU2 A;  2C0M A;  1KZO A;  4A3V A;  3NZU A;  2V8S E;  3ABM E;  2WQ7 A;  3UX4 A;  4GZ6 A;  4AXH A;  3FP3 A;  3UXG A;  4BSX A;  4F6R D;  2ZIR A;  5JHB A;  4FHJ A;  3QWP A;  4WWN A;  4DX1 A;  1Z3X A;  1G3N B;  3HRA A;  3ZIM A;  3CK9 A;  2P9S G;  3MZL B;  3QNK A;  5G05 J;  3TWQ A;  2J07 A;  2VYI A;  2ETB A;  3NQP A;  1S70 B;  3DXK G;  3UKR G;  3CGH A;  4BFR A;  3FTW A;  3RO3 A;  4GA2 A;  5BUZ A;  3RJV A;  1JUQ A;  3KEA A;  3LJ3 A;  4DX5 D;  1N11 A;  2PL2 A;  2DIW A;  2GW1 A;  4HB5 A;  5EYL A;  3FUJ A;  3MKR A;  1U2V G;  2XGS A;  3RK6 A;  3EHM A;  3LKU A;  2MYO A;  1TN7 A;  4CZ2 D;  2XCC A;  2KCV A;  1ELK A;  3PZD A;  4RQI A;  1BPO A;  4LCT A;  5CMW A;  3TAX A;  3NOG D;  4CYM D;  2I1J A;  2L0I A;  5EIB E;  1UW4 B;  2GRM A;  3KSQ A;  4F7A A;  2IO2 C;  4NIK A;  5BV1 A;  2F0Y A;  3BG1 B;  1TNU A;  1N9A A;  2WXP A;  2H6H A;  2P58 C;  3KS2 A;  2HM8 A;  1E90 A;  3CHS A;  4EPZ A;  5BXU A;  1KT1 A;  3D9J A;  4TXQ A;  3IEG A;  3D9H A;  2RFM A;  3TG5 A;  1AWC B;  5ANR A;  2OEW A;  3FH5 A;  2VTB B;  4V3I A;  4HS2 A;  1OCC E;  5J90 A;  1W3B A;  2AW6 A;  2L6B A;  3FTU A;  2GRP B;  3Q75 A;  2VSN A;  4MBG A;  4GYO A;  3ASN E;  4PDX A;  2WXL A;  4AY5 A;  1TJF A;  3Q73 A;  3FY4 A;  3R7Q A;  2HYZ A;  1SVX A;  4GZ5 A;  1TN8 A;  1H2T C;  5M72 A;  3Q78 A;  3DSW A;  1Y6I A;  3LVR E;  1IYG A;  4UQX A;  3MKQ B;  4UI9 C;  2AWI A;  4L7T A;  3B7B A;  3CK7 A;  1DC2 A;  3G2V A;  3OXG A;  4WWO A;  3G2S A;  4JHK A;  4K5C A;  3BEE A;  3ZXP A;  5FJY A;  3VLD A;  3ENE A;  5AQ9 A;  3F6Q A;  3LS8 A;  2BKK B;  3AS5 A;  3CVV A;  3PZ3 A;  4Y6C A;  2KM4 A;  3CEQ A;  3VTX A;  4CGW A;  3KEZ A;  3URZ A;  5KJK A;  3IHY A;  2RG8 A;  3LPZ A;  1IHG A;  1V55 E;  3CVW A;  1UN8 A;  5KJL A;  3N71 A;  2GRN B;  2HE0 A;  2JEK A;  3ABL E;  3CVN A;  3AG3 E;  2HO1 A;  2LXM A;  4WWP A;  2VSY A;  4YND A;  3OAW A;  2IY0 C;  3E4B A;  4KVM A;  3QDN A;  4GCN A;  4Q94 A;  3TXM A;  3DWL G;  4NQ0 A;  1UN9 A;  4FLB A;  3LVQ E;  5DBK A;  2DWZ A;  5JJ7 A;  3AU5 A;  1SZ9 A;  4I9E A;  1LF8 A;  1SW6 A;  2WQ6 A;  1QQE A;  3FTV A;  5BNW A;  2WXH A;  4GPM A;  3ABK E;  5B1B E;  1IQU A;  3HXC A;  2P2C P;  2KCL A;  4F53 A;  3Q9U C;  2LAI A;  3SZ7 A;  3EU9 A;  3NAW A;  4C0E A;  3CR3 A;  4G8L A;  1S0P A;  3ZHE B;  4GZD A;  1OT8 A;  3APD A;  4CEM A;  4HOR A;  3CHR A;  3S7B A;  1N94 A;  3CVU A;  2V4L A;  2M63 A;  3FU5 A;  2EIL E;  4UWL A;  4HRM B;  4XZ4 A;  3EHR A;  4FU3 A;  1IHB A;  4FHK A;  2V5Q C;  1TNZ A;  1YA0 A;  3CK8 A;  1L5J A;  2IOL A;  4DX6 D;  3UUX A;  3LY7 A;  5FZR A;  3V31 A;  5BXO A;  2EIM E;  2VGX B;  4APF A;  3SBT B;  2I2O A;  1N0R A;  2XS1 A;  2WXG A;  3Q15 A;  2HR2 A;  1TYQ G;  3BUA A;  3ESK A;  3CLJ A;  3RRM B;  4JL0 A;  2H6G A;  4LER A;  3BU8 A;  2DZO A;  2ZGG A;  2OVB A;  5CHE E;  3EHQ A;  4DLQ A;  2DBA A;  1HG5 A;  1MQS A;  2DVW A;  3KAE A;  2FUL A;  4I6J A;  4IUL A;  3FTS A;  1OUV A;  3QAR A;  3OXL A;  5G04 J;  5IY5 E;  1H6P A;  4J0U A;  3ULE G;  4XI9 A;  4AVX A;  2LUH A;  2ZXW E;  4GA0 A;  2NXP A;  4EEC A;  4JA9 A;  4O1P A;  4DI3 A;  3GZ2 A;  2V0P A;  1KPS B;  3NBN B;  4L9P A;  5AQ7 A;  3I5P A;  5G55 A;  4AIF A;  1N4R A;  3APF A;  2XZD G;  2NYJ A;  3ONK A;  5HKP A;  2FI7 A;  3MGB A;  3TWU A;  3MX3 A;  1DCE A;  3CKB A;  4J7W A;  4J8Y A;  4HI8 A;  3FUI A;  3Q4A B;  4B93 B;  3RRN B;  3D9K A;  2I9C A;  4GB9 A;  4N3B A;  1EPU A;  2B6C A;  3LJN A;  5FQ7 A;  5FQ4 A;  1P5Q A;  2L6J A;  2YQ8 A;  4YVO A;  3T5X A;  3UT4 A;  2UY1 A;  3QB2 A;  5FT9 A;  4DI4 A;  2XCB A;  1NP7 A;  3C5R A;  4OVV A;  4DLO A;  5BV0 A;  3UIO C;  2R5S A;  3I4G A;  4PUC A;  3RKV A;  3PEV B;  3LY9 A;  3ZHE A;  2OND A;  5EX0 A;  4UI9 K;  2WXN A;  3D3M A;  2C0L A;  3MA5 A;  4N3C A;  3WG7 E;  2IJG X;  3SFY A;  4B8A A;  3FU0 A;  2GRQ B;  4JC8 A;  3FH7 A;  4KXK B;  1PC2 A;  3SNX A;  2DYS E;  2FF4 A;  3SFZ A;  3JXI A;  4OVU A;  1JWF A;  1X81 A;  4BX8 A;  4U8H A;  3B7T A;  2VGX A;  4MRU A;  3RIB A;  3CV0 A;  4I1M A;  1E8Y A;  2F8Y A;  4OAV B;  1XNF A;  3EU5 A;  4LG6 A;  1N4Q A;  2XEN A;  3QAQ A;  1IXV A;  3C98 A;  5FQ8 A;  2WVI A;  4GAA A;  3FUF A;  2L9B A;  2P9L G;  5EDS A;  4K03 A;  5C2Y A;  5ARF A;  2PQN A;  4GTR A;  1DVP A;  2Y1L E;  3UM3 A;  2QFC A;  1OWO A;  4XEI G;  1Z5S C;  4G23 A;  3Q5M A;  1K3Z D;  5FQ6 A;  2LNI A;  3CHM A;  2XPI A;  5CER B;  2ETC A;  4RSY A;  1D8E A;  4A55 A;  2LO6 A;  4U96 D;  4H7X A;  4NRH B;  2QYJ A;  4EZK A;  3D9N A;  4HRL A;  2WXI A;  5CRU A;  2P9P G;  4APO A;  3ISM C;  5CCM A;  3Q7A A;  4AOF A;  4HFG A;  3R9A B;  3TG4 A;  5E76 A;  2R17 C;  2XGO A;  3FU6 A;  4CT4 A;  4G11 A;  5AAO A;  4UQY A;  3I4R B;  3AS8 A;  3R9M A;  3ULY A;  4BX9 A;  1OWM A;  3ZYM A;  4GYW A;  4U95 D;  1QBQ A;  4CDN A;  2BF0 X;  2LSV A;  5JJT A;  3QWV A;  3JUI A;  2KZT A;  2P9N G;  3G2T A;  3AAA C;  5CED B;  3CST A;  1KZP A;  4I2W A;  3D9M A;  3V79 K;  1N4P A;  3T8K A;  3FUM A;  1U3C A;  1MJ0 A;  1OCZ E;  4CT0 A;  3RAU A;  2WXQ A;  5JMN D;  3MV3 B;  5FTP A;  3X2Q E;  4A3T A;  2QZA A;  3SGH A;  4JPS A;  2R03 A;  3EIQ C;  1JCS A;  3SHF A;  1EF1 C;  5H7P A;  3CVQ A;  3ZPJ A;  3DRA A;  1RZ4 A;  2E0I A;  2PM6 A;  2WM9 A;  3PRE A;  5LFA A;  5ENO D;  3L17 A;  5D2M C;  2ION A;  2IF4 A;  3HXB A;  4BER A;  2IO3 C;  3SBS A;  2XRY A;  3PZ4 A;  4N2S A;  1BI7 B;  1VDY A;  4AV7 A;  2P9K G;  4UWG A;  1MHQ A;  4TUU A;  3DXM G;  4WND A;  3W9F A;  4CGV A;  4FJY A;  2VQ2 A;  3PRZ A;  1D9S A;  3UT7 A;  2XZT G;  5EID A;  4D10 C;  3ZFW A;  3TL5 A;  3BQO A;  4AY6 A;  4YDW A;  2WMO A;  4C0M A;  2IQC A;  1HG2 A;  1HE8 A;  2J49 A;  4ILG A;  3Q7F A;  4XKC A;  4HLE A;  1DNP A;  3DEO A;  5AJL A;  3PUJ A;  2VSO E;  2XRZ A;  1MX6 A;  3P1U A;  3LEW A;  1SQM A;  1BLX B;  3ZGQ A;  3JCK C;  4WUY A;  1ELR A;  2AJA A;  3SO8 A;  5FWQ A;  1K8K G; 
#chains in the Genus database with same CATH homology
 4FHK A;  2IOS A;  3MYV A;  1HXI A;  3ZXS A;  1KLX A;  2CG2 A;  4UWH A;  4GU5 A;  2A4Z A;  3RRU A;  2LSU A;  3SD5 A;  5LCW C;  4GYY A;  5FZQ A;  3UMV A;  1YA0 A;  3CK8 A;  3ASD A;  1UG3 A;  1L5J A;  2IOL A;  4M3O A;  4HOS A;  4J8F A;  3UUX A;  4LRZ A;  3LY7 A;  3FUL A;  2J08 A;  5D0Q D;  5FZR A;  3HVE A;  3QC1 A;  3JYS A;  4XKB A;  2VGX B;  4APF A;  3SBT B;  1INZ A;  2X6H A;  2Y4T A;  2I2O A;  3FUK A;  3BG0 B;  1QZ2 A;  5EX3 A;  2J9Q A;  4FJZ A;  2WXG A;  1HFA A;  3LYA A;  2NSZ A;  2HR2 A;  3MV2 B;  3Q15 A;  4EBA A;  5BPP A;  4J6I A;  1ELW A;  4RG9 A;  2J4D A;  3ESK A;  2MOW A;  5T3R A;  3U66 A;  3PS6 A;  1FVH A;  3CLJ A;  4H7Y A;  4O6F A;  3RRM B;  4JL0 A;  3JQ0 A;  3ZN3 A;  4JHJ A;  5KCM A;  2WXR A;  4GCO A;  4KYO B;  3PE3 A;  4I17 A;  1E8Z A;  4HOQ A;  4LER A;  4MLP A;  1QNF A;  3B13 A;  2OVB A;  5AIJ A;  1E7U A;  5CHE E;  3FEY A;  4KT6 B;  1N54 A;  4N3A A;  4ACL A;  2L0T B;  5ANL A;  3EDT B;  3ULQ A;  4DLQ A;  2KAT A;  3QWW A;  2DBA A;  1HG5 A;  2CG3 A;  3PDN A;  3FUD A;  4I2Z A;  2J09 A;  4AJW A;  1MQS A;  1H2U A;  4IRU A;  3U9W A;  3KAE A;  3T8M A;  3S7J A;  3LY8 A;  2XEV A;  4A1G A;  2FUL A;  1WAO 1;  4G1T A;  4I6J A;  2OOE A;  4FUL A;  4IUL A;  2XQ0 A;  2C2L A;  2Q7F A;  3FTS A;  1TJC A;  1OUV A;  1WY6 A;  2GGF A;  5E75 A;  3FU3 A;  2NC9 A;  4KMO A;  3QAR A;  5HI7 A;  4I43 A;  3OXL A;  5AEN A;  5G04 J;  4B0Z A;  2WB2 A;  4BT8 A;  4BWR A;  3Q49 B;  3D9P A;  4J0U A;  4HOT A;  1Z3Y A;  4GZC A;  2X6F A;  4OYS A;  3UT8 A;  4L2Y A;  3FH8 A;  2KCK A;  4U04 A;  4XI9 A;  4WAF A;  4AVX A;  4GA0 A;  4G2V A;  4J8S A;  2NXP A;  4HOU A;  4WNF A;  4EEC A;  1UJK A;  4JA9 A;  2XHE A;  4DI3 A;  3GZ2 A;  2V0P A;  4G26 A;  4ATG A;  3CHQ A;  1OWN A;  2BUG A;  2CFU A;  4TV3 A;  3I5P A;  5G55 A;  4AIF A;  3APF A;  4JXT A;  4HVB A;  2FBN A;  2X6K A;  3OXF A;  2UY1 B;  4W9R A;  4DPR A;  4F1S A;  4GPK A;  4EBA G;  3U3W A;  4I6G A;  4EQF A;  4NUR A;  3CHP A;  4B89 A;  3ONK A;  4YVQ C;  1NA3 A;  1OWP A;  3CVL A;  2FI7 A;  5JHA A;  1NA0 A;  3MGB A;  3FDH A;  3QKY A;  2MRI A;  3QOU A;  3MX3 A;  5JJ6 A;  3CKB A;  3CQG B;  3ZRH A;  2PM7 A;  3D9O A;  1NZN A;  3LCA A;  3MEK A;  4RVB A;  4U63 A;  1SZA A;  3FUI A;  3GYZ A;  3MJW A;  4MS6 A;  3Q4A B;  4I1O B;  3GZS A;  4I9C A;  3FUN A;  3B7S A;  4I6E A;  3L16 A;  3MCX A;  2YNQ A;  2WXJ A;  3RRN B;  1ZU2 A;  4HXI A;  2CHW A;  2C0M A;  3D9K A;  2E2E A;  2MHK A;  4PS8 A;  2I9C A;  4GB9 A;  4A3V A;  3NZU A;  2ILR A;  2QY7 A;  2PQR A;  4KBQ A;  4PS3 A;  3PEU B;  4N3B A;  2FEZ A;  2V8S E;  3P2B A;  1FCH A;  2WQ7 A;  1EPU A;  3UX4 A;  4GML A;  4GMJ A;  4GZ6 A;  5A23 A;  4U0Z A;  4P29 A;  4AXH A;  2RD0 A;  3GZ1 A;  3ASG A;  3FP3 A;  4BSX A;  5FQ7 A;  1JWG A;  5JHB A;  5FQ4 A;  1P5Q A;  3EJN A;  4FHJ A;  4FP7 A;  2L6J A;  3QWP A;  4WWN A;  2YQ8 A;  4UQZ A;  4YVO A;  1Z3X A;  3T5X A;  3UT4 A;  2UY1 A;  3ZIM A;  3CK9 A;  3I3N A;  3MZL B;  3QB2 A;  3ESL A;  3QNK A;  3APC A;  2XCB A;  1NP7 A;  3B7U X;  5D0O D;  5FT9 A;  2J07 A;  5G05 J;  4DI4 A;  2VYI A;  4ANV A;  2IFU A;  5A7D B;  4OVV A;  3NQP A;  4DLO A;  5BV0 A;  3TXN A;  2R5S A;  5AYW D;  3CGH A;  3FWV A;  1IQR A;  4E6H A;  3I4G A;  2WQH A;  3FTW A;  4BFR A;  2BTD A;  2X6I A;  4PUC A;  3RKV A;  3PH0 C;  3G2U A;  3CQC B;  3PEV B;  3LY9 A;  3RO3 A;  3ZHE A;  4U0S A;  2OND A;  4GA2 A;  5BUZ A;  4IN3 B;  1XGW A;  5EX0 A;  3RJV A;  3UQ3 A;  4F3V A;  4UI9 K;  2WXN A;  1JUQ A;  4U07 A;  5BT1 A;  3LJ3 A;  2WPV A;  3CSF A;  3S2A A;  2WXF A;  3ZYL A;  3D3M A;  2KC7 A;  1H2V C;  2C0L A;  3MA5 A;  4N3C A;  4FAD A;  3PNL B;  4GA1 A;  2PL2 A;  2DIW A;  2GW1 A;  1HH8 A;  2OVF A;  4U0U A;  3VTY A;  4FA6 A;  2IJG X;  3FUJ A;  3MKR A;  3ONL A;  1B89 A;  2XGS A;  4KZ0 A;  5C1D A;  1JPL A;  2FO7 A;  4B8A A;  2X6J A;  3RK6 A;  4DK5 A;  3EHM A;  3FU0 A;  4IYP A;  3SI5 A;  3LKU A;  4XI0 A;  2XCC A;  3DPD A;  1E8W A;  4JC8 A;  3FH7 A;  2KCV A;  4KXK B;  1ELK A;  3RO2 A;  2OV8 A;  1PC2 A;  3PZD A;  4URK A;  1BPO A;  4LCT A;  3SNX A;  2FF4 A;  3SFZ A;  5ARG A;  3CVY A;  4OVU A;  1JWF A;  1H6K A;  5G05 C;  2XPZ A;  4CRW A;  3IHV A;  5CMW A;  3EHN A;  4JVS A;  3TAX A;  4BX8 A;  5T8I A;  4U8H A;  3UPV A;  1UJJ A;  4UWK A;  2I1J A;  3B7T A;  2L0I A;  2VGX A;  4MRU A;  3RIB A;  1UW4 B;  2GRM A;  4F7A A;  3CV0 A;  4I1M A;  3U4T A;  2A5U A;  3ZVV A;  4JA7 A;  4JEH A;  1E8Y A;  3TGO A;  2JLB A;  5BV1 A;  3BG1 B;  4PS7 A;  5LOZ A;  3FUE A;  2WXP A;  3L08 A;  2VSX E;  1XNF A;  3PUK A;  3HHM A;  1HU3 A;  4BTB A;  3GW4 A;  2I6H A;  2P58 C;  3KS2 A;  4BT9 A;  4N39 A;  2HM8 A;  1E90 A;  3QAQ A;  3CHS A;  3QK0 A;  1E8X A;  4EPZ A;  1KT1 A;  5CMY A;  3D9J A;  4A1S A;  3C98 A;  3IEG A;  3O4Z A;  5FQ8 A;  2CFZ A;  5G2N A;  2WVI A;  3TG5 A;  4GAA A;  3DBS A;  1A17 A;  5ANR A;  3ASH A;  3FUF A;  2L9B A;  4UWF A;  1PY1 A;  3FH5 A;  5T4Y A;  4V3I A;  2VTB B;  5EDS A;  4HS2 A;  4K03 A;  5C2Y A;  4WNE A;  3AU4 A;  5ARF A;  5J90 A;  4Q96 A;  2R59 A;  2PQN A;  1W3B A;  2AW6 A;  3CKC A;  3FTU A;  1DVP A;  3ML8 A;  2QFC A;  1OWO A;  4G23 A;  3Q5M A;  2YHE A;  5FQ6 A;  4ILH B;  2LNI A;  3TJP A;  4N5C A;  3CHM A;  2VSN A;  5BW8 C;  4AEZ C;  4LEU A;  4WNG A;  2XPI A;  3ZEF A;  1TEZ A;  3L13 A;  4AM9 A;  5KJN A;  4RG6 A;  2LAH A;  4GYO A;  4G25 A;  3PNT B;  3L54 A;  4RSY A;  2AVP A;  2WXL A;  4PDX A;  1X5B A;  4A55 A;  2LO6 A;  4PH4 B;  4AY5 A;  4H7X A;  4NRH B;  4KZC A;  3RU0 A;  4XIF A;  2KZT B;  1TJF A;  1U3D A;  4ANW A;  4EZK A;  3D9N A;  1N52 A;  3FY4 A;  2WXI A;  4FLH A;  3NZS A;  3R7Q A;  3SF4 A;  2HYZ A;  4R7L A;  4APO A;  4XE0 A;  2WXM A;  4GZ5 A;  5CCM A;  1KT0 A;  5KJM A;  4AOF A;  4XX5 A;  1PAQ A;  1H2T C;  5M72 A;  1H19 A;  4HFG A;  3R9A B;  3TG4 A;  1Y6I A;  3AS4 A;  3LVR E;  5E76 A;  4L23 A;  4JW1 A;  4QFV A;  2VTB A;  2VJ8 A;  1IYG A;  4UQX A;  3MKQ B;  2R17 C;  4UI9 C;  2WXK A;  2XGO A;  3FU6 A;  1WM5 A;  4CT4 A;  4G11 A;  2AWI A;  4UQY A;  2EQX A;  2AXZ A;  3I4R B;  4L7T A;  4KVO A;  3AS8 A;  4BX9 A;  2CHZ A;  1OWM A;  3CK7 A;  4J8D A;  3S7D A;  3G2V A;  3ZYM A;  3OXG A;  3CVX A;  1HS6 A;  4GYW A;  3NF1 A;  4WWO A;  3FTX A;  3G2S A;  4JHK A;  5LP0 A;  4CCA A;  3BEE A;  3FHE A;  1OWL A;  1Z6T A;  5LX8 A;  4B94 A;  1Y8M A;  5FJY A;  1E96 B;  4CDN A;  1EYH A;  2BF0 X;  2LSV A;  3HYM B;  2CHX A;  3IBE A;  3QWV A;  5JJT A;  3JUI A;  3FTY A;  2KZT A;  2I1K A;  4GZ3 A;  3U64 A;  3VLD A;  3HIZ A;  3ENE A;  3G2T A;  3LS8 A;  4TRQ A;  2ZU6 B;  3AS5 A;  3CVV A;  3CST A;  2YIN A;  3G2W A;  1H0A A;  3T5V A;  4Y6C A;  2KM4 A;  3CEQ A;  3D9M A;  4I2W A;  3VTX A;  4CGW A;  3KEZ A;  1HF8 A;  2PZI A;  4G24 A;  3URZ A;  5A6C A;  3LXU X;  5KJK A;  3FUM A;  1U3C A;  5CCL A;  4JHR A;  3CHO A;  3IHY A;  1E7V A;  2AXU A;  2RG8 A;  3LPZ A;  4ACK A;  1IHG A;  3MKQ A;  4CT0 A;  3CVW A;  2WXQ A;  1UN8 A;  2IU1 A;  3MV3 B;  3N71 A;  5KJL A;  3FUH A;  4LUN U;  5FTP A;  2WXO A;  4A3T A;  2JEK A;  1HX8 A;  3CVN A;  4FC8 A;  4CDM A;  3QJZ A;  3SGH A;  4ME2 A;  1HZ4 A;  3EIQ C;  2HO1 A;  4JPS A;  4ANU A;  1HO8 A;  2AXV A;  4JZY A;  3D9I A;  3SHF A;  4MKT A;  1EF1 C;  5J08 A;  3L22 A;  3CVQ A;  3ZPJ A;  5ENN A;  4WWP A;  2VSY A;  4YND A;  3B7R L;  3OAW A;  3E4B A;  4KVM A;  3QDN A;  3L6A A;  2E0I A;  3CVP A;  2PM6 A;  2V5F A;  4GCN A;  2WM9 A;  4Q94 A;  3TXM A;  3K9I A;  4NQ0 A;  1UN9 A;  2YHC A;  3PRE A;  4AP2 A;  2XPY A;  5HQ8 A;  4FLB A;  4B8C B;  5LFA A;  3LVQ E;  5DBK A;  1EDU A;  3EIJ A;  3CIA A;  3O48 A;  3L17 A;  3PVL A;  3ML9 A;  2ION A;  3ASF A;  5JJ7 A;  2IF4 A;  3FTZ A;  4C9B B;  2DCP A;  3AU5 A;  3SBS A;  2XRY A;  1SZ9 A;  4I9E A;  1LF8 A;  2Y4U A;  3WXX A;  4N2S A;  2WQ6 A;  1VDY A;  4AV7 A;  1QQE A;  2XGM A;  4L1B A;  2VGY A;  4UI9 J;  4UWG A;  1MHQ A;  4TUU A;  3FTV A;  4K0R A;  5AJD A;  5BNW A;  4WND A;  4CGV A;  4Q69 A;  2WXH A;  4FJY A;  4BY6 A;  4EZL A;  2GRL A;  2VQ2 A;  2X3M A;  3PRZ A;  4ABN A;  1IQU A;  3UT7 A;  5EKQ D;  4Y6W A;  4D10 C;  3S7F A;  5LCW J;  2KCL A;  5FZS A;  1FVF A;  3Q47 B;  2WMN A;  3ZFW A;  2UWJ G;  4F53 A;  3JQ1 A;  4I1A A;  3VLF A;  3ZYQ A;  5DIZ A;  3R7R A;  4EZJ A;  3TL5 A;  3IV0 A;  3IKO B;  3FEX A;  4JEU A;  4ANX A;  4L2L A;  4BTA A;  2LAI A;  3SZ7 A;  4AY6 A;  4CDR A;  1GW6 A;  2WMO A;  3HDX A;  3HVE B;  3ZYK A;  2IQC A;  4C0M A;  1HG2 A;  4N2Q A;  1HE8 A;  2J49 A;  3OTN A;  4C0E A;  4ILG A;  3CR3 A;  1ZBP A;  3D9L A;  1S0P A;  3ZHE B;  4GZD A;  3FFL A;  4XKC A;  4HLE A;  3APD A;  4NAC A;  1DNP A;  4CEM A;  3CHR A;  2J4B A;  4HOR A;  5G04 C;  4E85 A;  5AJL A;  3PUJ A;  3S7B A;  3LDZ A;  2X38 A;  3ZW3 A;  2VSO E;  3CVU A;  2XRZ A;  3VLE A;  3P1U A;  4DJA A;  2V4L A;  2Y3A A;  3LEW A;  1SQM A;  2M63 A;  3FU5 A;  3ZGQ A;  4ILI A;  3JCK C;  4WUY A;  4UWL A;  1ELR A;  3KD7 A;  4J8E A;  4XZ4 A;  3PE4 A;  4FU3 A;  5FWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...