4I1AA

Crystal structure of the apo form of rapi
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
274
structure length
274
Chain Sequence
LEYYFYFFKGMYEFRRKELISAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSMNYANRALKIFREYEEYAVQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHLIAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNVALIYFRKGRFIADKSDDKEYSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENFSIEVADYFHEQGNLMLSNEYYRMSIEARRKIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Response regulator aspartate phosphatase I
total genus 114
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1aA00
2XEVA 2C0LA 3HYMB 3QWPA 2MHKA 3JYSA 4GZ5A 1KT0A 4JL0A 3GZ2A 2J9QA 2C2LA 2PL2A 3LY7A 3CVLA 3MEKA 4HOQA 4U04A 4APOA 4BT9A 5G05J 3MV2B 4GPKA 5D0OD 4Y6CA 3AS8A 3TGOA 4J0UA 2UY1B 3ZN3A 2PQNA 4GA0A 5KJNA 2VQ2A 3S7BA 2V5FA 4I17A 3CVNA 5FT9A 3E4BA 3Q15A 3VTXA 4G2VA 5CCLA 4XI9A 2LSVA 2L6JA 5AYWD 2GW1A 1YA0A 1QQEA 3Q4AB 1ELWA 2YQ8A 3Q47B 2VSNA 4UQZA 4WNGA 3ZFWA 4ABNA 5HQ8A 4HORA 4HOSA 4GYYA 1W3BA 4WUYA 4KYOB 4I9CA 5DBKA 2HYZA 2KCVA 3RIBA 2XGOA 3RKVA 1ZU2A 4I2WA 3TAXA 3QWWA 5HI7A 5EKQD 4G24A 5FZRA 3RO2A 3LYAA 2FF4A 2NC9A 3BEEA 3QDNA 4O6FA 4YVOA 5KJLA 4RG9A 3GW4A 4G1TA 4UI9K 3U4TA 4N3AA 4B94A 4GCOA 2JLBA 4GA1A 3ZHEA 2VGXA 2VGYA 3CKBA 4N5CA 1OUVA 3N71A 4JA7A 3FFLA 3IEGA 3OXLA 2I6HA 4UQYA 3AS4A 2E2EA 1NA3A 2Y4UA 4KBQA 5ARGA 2ONDA 1NA0A 3CK8A 3LPZA 4U0ZA 3QKYA 2PZIA 2HO1A 3SF4A 3TG5A 3ASFA 1KT1A 2UWJG 3UUXA 4N2SA 2VSYA 3QOUA 4H7YA 5JJ7A 2VYIA 1PC2A 4GZ6A 5FTPA 2R5SA 3CK7A 3LY8A 4IN3B 4A1SA 1A17A 1NZNA 5KJKA 4U07A 1ELRA 3S7FA 3PDNA 5DIZA 4GYWA 2IFUA 3CVPA 3CEQA 4GA2A 2KCKA 2DBAA 5LCWJ 5JJ6A 4GZ3A 5FZSA 2FBNA 3LKUA 1ZBPA 5D0QD 4LEUA 3QWVA 5EX3A 4G23A 5G05C 4JHRA 1E96B 4CGWA 3GZ1A 1HXIA 5CCMA 1WAO1 2WPVA 2XGMA 3CV0A 3ASHA 2KCLA 3NF1A 4I2ZA 5G04C 3O48A 4H7XA 5M72A 3KS2A 4KXKB 3MKRA 4AIFA 2Y4TA 5FJYA 4UQXA 4AM9A 3LCAA 3WXXA 3GYZA 1QZ2A 4U0SA 4G26A 3PE4A 4J8DA 2KC7A 2HR2A 4N3BA 1B89A 2AVPA 4WNEA 4XIFA 5BW8C 3ULQA 1HZ4A 4XI0A 3RO3A 3S7JA 2VGXB 3OXGA 5A7DB 4BTAA 2OOEA 4J8FA 5FZQA 3VTYA 4WNDA 3ASGA 2P58C 4I9EA 3URZA 2UY1A 3ZGQA 3RU0A 4ME2A 5A6CA 1KLXA 5EX0A 5KJMA 1WM5A 4JA9A 2XGSA 4WNFA 4EQFA 3PE3A 3MV3B 4G25A 2Q7FA 3S7DA 5CHEE 5BNWA 2FO7A 1IHGA 4W9RA 2PQRA 3ASDA 4CDRA 4F3VA 3SZ7A 4UI9J 4Y6WA 3CVQA 4N39A 3U3WA 4RG6A 3ZPJA 4HOTA 3MA5A 4J8EA 4N2QA 3LY9A 4YVQC 4CGVA 4AY6A 3UQ3A 3FWVA 4NQ0A 4NRHB 4UI9C 3CK9A 3UPVA 2BUGA 2YHCA 1TJCA 3AS5A 3Q49B 2FEZA 4YNDA 4BT8A 5LCWC 1P5QA 3K9IA 4HOUA 1HH8A 1FCHA 4AY5A 1XNFA 4BTBA 2LSUA 3ZHEB 3CKCA 5ARFA 2XCBA 5BT1A 2LNIA 2QFCA 3TG4A 5C1DA 4GYOA 3EDTB 3KD7A 3ESKA 3FP3A 2FI7A 2XPIA 3Q5MA 3R9AB 2KATA 1IYGA 4BWRA 4N3CA 1Y8MA 3RJVA 4I1AA 3KAEA 4U0UA 2XCCA 3OXFA 2IF4A 2C0MA 4GCNA 5JJTA 5G04J 2WQHA
chains in the Genus database with same CATH superfamily
1D8DA 3JQ0A 3B7SA 2Y1LE 3T8MA 3VTXA 3FHEA 4WWNA 4NIKA 5AN8A 2VSNA 1N52A 3ULEG 2HYZA 3ZYKA 3QWWA 1TNUA 4G24A 3FTXA 3QC1A 4ATGA 4JB8P 5EN5D 1IQRA 2R03A 3D9KA 4O1OA 2P9NG 3UI2A 3QOUA 2IY0C 4A1SA 4XEIG 4IRUA 4M7CA 3AU5A 2ZISA 3FEXA 1N54A 1TN8A 4DI3A 3D9OA 3W9FA 2KC7A 5LP0A 4PS7A 5A6CA 3RU0A 1E90A 4EQFA 2CG2A 5CCMA 1KPSB 3MV3B 4JW1A 3S7DA 4F3VA 4XE0A 4HI9A 2NYJA 5AQBA 4CDMA 1FVHA 1H2VC 4J8SA 2BUGA 3DPDA 3CHQA 4ACKA 1JCSA 1H6KA 2DYSE 3KEZA 4C0EA 3FU6A 4CEMA 5C1DA 4GU5A 3ZIMA 4I6JA 1TR4A 3D9NA 3HVEA 1KT0A 4L1BA 3MV2B 4GZDA 1OWOA 4U95D 4C0MA 5KJNA 3FU0A 4KYOB 4CT4A 2XGOA 2I9CA 2V5QC 3LYAA 3BEEA 4O6FA 1H6OA 1UN9A 3E33A 2JLBA 3ULYA 4JHJA 4B8CB 3Q75A 2ONDA 4GAAA 2WXGA 3FH5A 4GTTA 2WXNA 1A5EA 3IHYA 4EZKA 4K5BA 2KCKA 2Y3AA 2FBNA 1ZBPA 4GTSA 3EUVA 1WAO1 2WPVA 2XGMA 2KCLA 3UMVA 4CRWA 1K3ZD 3UM3A 3FUKA 3ULQA 4EPZA 4YDOA 3T8KA 5KJMA 3AJIA 3FUJA 4CDNA 5AQAA 2JABA 4RG6A 2F37A 3JQ1A 2CHXA 1DCEA 3AS5A 4MRUA 2L9BA 3TL5A 1SA4A 3APDA 2WXMA 3CKCA 4LSZE 2EINE 2J09A 3TG4A 2AXZA 4BSZB 4B89A 3EJNA 2H6GA 2WQ6A 3JXIA 4D10C 3DXMG 2WQHA 5ENPD 3EU5A 4N5QA 4NURA 5G05J 2OEWA 3NOGD 3CVVA 1V55E 3HXFA 4K03A 3UIPC 2XS8A 2V5FA 2GW1A 3ZFWA 3KEAA 4BESA 3FEYA 1PY1A 3L17A 3AG3E 1HG5A 2J4BA 4YVOA 4B94A 2VJ8A 3U64A 2VGXA 2VGYA 4GMJA 4ILIA 4HLEA 3AS4A 3SF4A 3QKYA 5AENA 1A17A 1FT2A 3NZSA 4KVMA 3QARA 1TN7A 3CSTA 3B7UX 4JD2G 3G2UA 4MBGA 4PS8A 4DLQA 2F8XK 5ENNA 3CHPA 1TN6A 1WY6A 4B93B 1H2TC 5AQ9A 4AIFA 4UWHA 4GTVA 4FC8A 2LO6A 3LXUX 1TJFA 2UY1A 5EX0A 5CHEE 2J4DA 5EYPF 4Y6WA 2XRYA 4DPRA 2LSUA 2XCBA 3FY4A 4Q96A 3D9JA 2GRLA 2MRIA 3TWVA 2C0LA 3QWPA 4FU3A 4GZ5A 3GZ2A 3HXDA 4U04A 1O1SA 1TYQG 3AG4E 4LNUD 2J07A 2LUHA 3SY2A 4DLOA 5ENRD 3DSWA 3FUFA 3S2AA 3SBTB 3DEPA 5HQ8A 5DBKA 2KCVA 4TV3A 4GTOA 3OTNA 4BERA 4EZLA 3L08A 3RO2A 1TNOA 3QDNA 2RFAA 4GA1A 5CERB 2MYOA 1OUVA 3N71A 3OXLA 3NOCD 4L2YA 4N2SA 3G2SA 5FTPA 5E76A 3UM2A 3NAWA 2IFUA 5BV1A 5FZSA 5EX3A 3QWVA 4G23A 1D8EA 5J90A 2H6HA 3BQOA 4LRZA 1N9AA 2Y4TA 4UWGA 5T3RA 3FDHA 3Q73A 2VGXB 3SFXA 4J7WA 3ONKA 3EU9A 3ZEFA 1MZCA 3HHMA 2LXMA 3CVQA 3U3WA 3MJWA 3J5QB 5BPPA 4U8VD 3LVRE 4NQ0A 3SD5A 2XZTG 5B1AE 1TJCA 1P5QA 3UTMA 3FTVA 3PUKA 4A55A 2Y69E 4YDYA 1HF8A 3C3OA 3CQGB 3ESKA 2WM9A 2KATA 2WXFA 1O5MA 4U0UA 3APCA 3ML9A 3G2VA 3MEKA 4RQIA 1NL4A 1N4SA 4Y6CA 3TGOA 4QFVA 2JEKA 4M3OA 3R7RA 3S7BA 2EQXA 3SNXA 1DCQA 1JWGA 4HOSA 3TAXA 2I2OA 1AWCB 4BX8A 3CLJA 4TUUA 3UINC 4UI9K 1E7VA 4U8YD 1LF8A 3FFLA 4DI4A 2I6HA 2Y4UA 4KBQA 1ELKA 4R7LA 1NA0A 3CK8A 2PZIA 4PS3A 4DX2A 4H7YA 5JJ7A 4PDXA 5KJKA 3C3QA 4U07A 4GPMA 5ITZF 1V54E 4B0ZA 1QYMA 5JJ6A 3B13A 3C3RA 3FTWA 3Q7AA 3SBSA 3ZVVA 1K1AA 3SQVA 4GTRA 5G55A 3C72A 1WG0A 4KXKB 3UT4A 3DSUA 4F7AA 2ETCA 3PE4A 1YMPA 3DSTA 3PZ3A 4C48B 2R02A 3ZNGA 3VLEA 5ENOD 2BF0X 1EYHA 4N39A 1KZOA 4J8EA 4N2QA 1N95A 1HS6A 2MOWA 1HU3A 3DPYA 3QB2A 1N0QA 4WWOA 4GYOA 4UWKA 3Q5MA 3R9AB 3SHFA 4CYMD 3RJVA 3Q79A 3KAEA 3PZDA 2WMNA 2X6HA 4GCNA 3E32A 2X6FA 4WNGA 3DBSA 4N3AA 2J9QA 4MLPA 4TXPA 3I4RB 3KSQA 4I17A 2L6JA 3B7RL 2YQ8A 4LG6A 2RFMA 3ZRHA 3RRUA 4I9CA 4CZ2D 3LJ3A 3ZYLA 3IXEA 1E8WA 3JCKC 2WMOA 2BEDA 2WXHA 4Q94A 4RG9A 2CHWA 3GW4A 2WXRA 3BG1B 4GMLA 4GCOA 5B3SE 1INZA 2XHEA 5FQ7A 1OCCE 3MCXA 3FUHA 4AXHA 2X38A 5CRVA 5D0QD 4ATZD 3CV0A 4IULA 2AWIA 5J08A 1JWFA 2ZXWE 4PUCA 3ASNE 2P58C 3ZXSA 4UI9J 3AAAC 1BI8B 2Y0BG 3W9GA 3LEWA 4BT8A 3LVQE 2R05A 5FINA 3MKQA 4I1AA 2ZGGA 5KWDA 4HBDA 2X6KA 2KBXA 2P9UG 3T5VA 3FUIA 2KM4A 4BT9A 1LD7A 2QYJA 5FT9A 2EIKE 4ABNA 2DWZA 2X6JA 4G11A 1EF1C 1IKND 5D66A 3T5XA 3U4TA 5ANRA 3TXNA 2A5EA 4UQYA 3QK0A 4F1SA 3LPZA 5BUZA 2HO1A 2UWJG 3CK7A 3HVEB 3S7FA 3PDNA 4EECA 2DBAA 4LUNU 2H6IA 1LD8A 1X5BA 3EIQC 5HRYA 1Z5SC 4CGWA 3FH8A 4DRXE 3PREA 5JA4D 3QJZA 2IO3C 3WXXA 5KCMA 3GYZA 4FA6A 1E8YA 4FLHA 4UWLA 1DVPA 4HRNA 5A7DB 3SGHA 4I9EA 1KLXA 2FO7A 4F1PA 2WXKA 1GW6A 3LY9A 4CGVA 3CHRA 2NSZA 2OVFA 1N0RA 3PZ1A 1OWNA 3ZHEB 2GGFA 1YYHA 5CECB 4HVBA 1IYGA 5E75A 4X8QA 1S64A 3CVWA 1FT1A 4DX5D 1TEZA 5D2MC 4F6RD 4BSXA 3L16A 3HXEA 5EILA 4KZCA 3C98A 4I2WA 1HE8A 2EILE 2CFZA 3PS6A 3MKQB 1LTXA 4AEZC 4K5CA 2GRPB 3IKOB 4IN3B 3UIOC 4ACLA 1U3DA 4HB5A 4EHMA 3P1UA 4GTQA 1X81A 5FWQA 4KVOA 2RKKA 1Z6TA 3ABKE 3PVLA 3UM1A 1SVXA 5M72A 1DNPA 2LAHA 2F8YA 2XRZA 4AM9A 1SZ9A 2EIME 4DX7D 4YDWA 1UJKA 4O1PA 3ASGA 3CQCB 3ML8A 4WNFA 5LX8A 3TWUA 4HLLA 4QQIA 3SZ7A 5KNGA 2IONA 3Q49B 3UX4A 2X3MA 4JHKA 3ZKJA 3UKRG 3DSVA 3FTZA 2WXLA 4WAFA 3L9TA 3LJNA 2XCCA 2IF4A 3DWLG 3HYMB 4XZ4A 4DK5A 5CBOA 4U63A 2A5UA 2PL2A 4J0UA 2P2CP 2UY1B 4TUMA 5G2NA 4LERA 2VQ2A 4J8YA 3PEVB 5JHAA 5AYWD 3Q7FA 1YA0A 1QQEA 4OVVA 3APFA 3PZ2A 3DEOA 2V4HC 2CG3A 3TWQA 2YHEA 3CKBA 4Q69A 4NACA 4JXTA 3CHOA 4JC8A 3TG5A 4GTMA 4IYPA 5AIJA 3CSFA 3AG2E 3RK6A 3SI5A 2RG8A 5CBNA 2L0TB 4RSYA 3CVPA 3HXCA 2P9SG 2XPYA 5BV0A 2XEHA 4ZFHA 3CVXA 2CFUA 3FUMA 1JUQA 4EBAA 3MKRA 4A3VA 2KXPC 4N3BA 3RRMB 1B89A 3FUEA 3L13A 4J8FA 4K5AB 1MJ0A 4ME2A 5EIDA 3EIJA 1IHGA 2PQRA 1OWPA 5AAOA 4P29A 4NRHB 3E37A 5BXUA 2YHCA 5LCWC 4B8AA 1UOHA 4HNAD 3EHNA 4HOUA 4OAUC 2XPZA 1VDYA 3Q9UC 2LNIA 2QFCA 1N11A 3CGHA 5B1BE 3B7TA 2B6CA 4K0RA 2HM8A 3B7BA 2BKGA 5FQ8A 3ISMC 2XEVA 4AY5A 4JL0A 3U9WA 3LY7A 5D0OD 1SW6A 4FHKA 5FIOA 3FTSA 2VTBA 2XS1A 2PM6A 4J6IA 1ELWA 3Q47B 1YCSB 4UQZA 4GYYA 3ZUVB 3RKVA 2XZDG 3EHMA 5KJLA 4AP2A 5CMYA 3AU4A 4OVUA 2R17C 3RAUA 4DX1A 3ESLA 3Q78A 2ZGDA 4LNBA 2FO1E 3D9MA 4APFA 2OEVA 1E8ZA 2XENA 1QZ2A 1JPLA 2HR2A 3FUDA 2RD0A 3OXGA 1U3CA 3TWTA 2XGSA 4FADA 4FHJA 3VLFA 1MX6A 3FWVA 4HI8A 3I4GA 2R2LA 5FQ6A 1O1RA 5ARFA 4HRMB 1S70B 4U7EB 3V79K 3VLDA 4GMRA 1IHBA 2V0PA 1TNBA 2WQ7A 4L2LA 3PNTB 4EZJA 1RZ4A 3JUIA 1XGWA 2WXIA 4LCTA 1ZB1A 1D9SA 3IEGA 2GROB 2X6IA 4UUCA 4DX6D 1H2UA 1EPUA 3ASFA 1H19A 4GTPA 1PC2A 3KSLA 1DC2A 3WG7E 1E7UA 2WXQA 2KZTA 2QZAA 4I43A 1IXVA 5CEDB 4PH4B 3I5PA 2VTBB 3TWRA 1Q2ZA 3GZ1A 3MGBA 3ASHA 4H7XA 4URKA 2BKKB 4YDEA 1N4QA 3F6QA 1Z3XA 3V2XA 3ZGQA 4JA9A 3ZYMA 4TXQA 4W9RA 2P9IG 3ASDA 5ENTD 4HOTA 3MX3A 1HX8A 1MX2A 2DZNA 3CK9A 3UPVA 4FJYA 3PEUB 1HH8A 5BT1A 3UT7A 2AW6A 3NZUA 2GRMA 3FTYA 2GRQB 5JJTA 2QYUA 1OWLA 4FLBA 1K8KG 1BU9A 2WXPA 4GPKA 3EHQA 4ANXA 2WVIA 4DUIA 3MZLB 2PQNA 4I1MA 3CVNA 4L9PA 3FU3A 5EIBE 4HS2A 1EDUA 4G8LA 3ENEA 1UN8A 2FF4A 1NI1A 3HIZA 5KNHD 5H7PA 2ZIRA 3BU8A 5ARGA 3PZ4A 3CIAA 2WB2A 4ANWA 3Q9NC 3TXMA 4GZ6A 1BLXB 1NZNA 5EYLA 3C5RA 4U8HA 2WXOA 4GYWA 2IJGX 3CEQA 3PH0C 4GZ3A 4LEUA 5G05C 1FPPA 1HXIA 3RRNB 5ENSD 3NB2A 4UWFA 1UW4B 4JPSA 4I6EA 4WNEA 1OY3D 3S7JA 2AXUA 1SA5A 2IOSA 5AQ7A 3RSEG 3V30A 4ILGA 2KZTB 3IBEA 2FEZA 5HKPA 2V4LA 4AV7A 3QNKA 5CRUA 3K9IA 5EDSA 4BTBA 1XNFA 3SFZA 4XX5A 1MQSA 5BXOA 3L54A 2PM7A 4HRLA 3KD7A 3NQPA 4JVSA 4BWRA 2XEEA 4O60A 5LOZA 4KZ0A 2C0MA 3LS8A 5G04J 2QY7A 3JYSA 3CVLA 3V2OA 3ABLE 3NBNB 2AJAA 4BY6A 2P9KG 3CHMA 3UXGA 1W3BA 4WUYA 4L7TA 5AJLA 2M63A 5HI7A 5EKQD 1KZPA 2NC9A 5ENQD 3UKUG 2DYRE 3ZHEA 1N4RA 4N5CA 2GRRB 3D9LA 2WXJA 4L23A 1KT1A 2R59A 3V31A 3HXBA 4RLYA 2IO2C 2J8SD 1HFAA 3PRZA 2CHZA 3R7QA 3D9PA 4JEUA 4JHRA 3NF1A 5G04C 4E6HA 3FTUA 1OCRE 4JEHA 5FJYA 4HFGA 3I3NA 1UJJA 4G26A 4J8DA 4ILHB 1OCZE 5FZQA 3ZW3A 5LCWJ 2E0IA 4GB9A 2FULA 4ANUA 4YVQC 3UT8A 1AP7A 1QBQA 1OWMA 4EBAG 2A4ZA 3UM0A 4HXIA 3LDZA 2DZOA 1MHQA 3EDTB 3D9IA 3IV0A 5T4YA 1Y8MA 5T8IA 2IQCA 1TNZA 2MHKA 2H6FA 3ZXPA 5C2YA 4MKTA 3ZN3A 4GA0A 1E8XA 3E4BA 1MX4A 4RVBA 5HS0A 3RIBA 2LAIA 3MYVA 1ZU2A 3JUEA 4V3IA 5FZRA 2DVWA 4KMOA 1MYOA 1IQUA 1H0AA 2YINA 1S0PA 1SZAA 3TWWA 3OAWA 4FULA 4U0ZA 3DSXA 1QNFA 3UUXA 5IY5E 2GRNB 2VSYA 2VYIA 1ELRA 5DIZA 2DCPA 4GA2A 3ABME 4AOFA 2VSXE 5AARA 3EHRA 4BX9A 5LFAA 3SO8A 4GZCA 3AG1E 2HE0A 3PUJA 3TWXA 2ETBA 3L82A 3KS2A 2PNNA 3LCAA 1Z3YA 3PNLB 1SQMA 3E30A 4XI0A 2BTDA 2ILRA 1N94A 4WNDA 2J08A 3HDXA 1S63A 1WM5A 3D3MA 4AY6A 1HO8A 4AJWA 4KT6B 4YNDA 3L6AA 2I1KA 1FCHA 1K1BA 5CMWA 5ANLA 1HG2A 1U2VG 3FULA 3SFYA 3FP3A 1N4PA 1OCOE 3OXFA 4FP7A 2VSOE 2P9PG 3FH7A 3TJPA 3AS8A 3E34A 4FJZA 3T9KA 3DSSA 3Q15A 4G2VA 2LSVA 3Q4AB 3ZU7B 2AXVA 4DJAA 2IOLA 2QC9A 4OAVB 1OT8A 4Z68A 2VGEA 2E2EA 4ANVA 3GZSA 5FQ4A 3L22A 2L6BA 2R5SA 3QAQA 2V8SE 3ONLA 4JZYA 1Y6IA 3BG0B 3FU5A 3BUAA 3LKUA 4AVXA 4F53A 5A23A 4E85A 4LNGA 3CVUA 3ZYQA 4I2ZA 5AJDA 3O48A 2OCCE 3HRAA 4TXRA 4C9BB 3FUNA 4U0SA 3D9HA 4OYSA 4XIFA 5BW8C 2I1JA 4BTAA 1PAQA 3URZA 2IEJA 1G3NB 3PE3A 4G25A 5BNWA 1RW2A 4CDRA 1BPOA 1O1TA 5JMND 3ZPJA 2LXLA 3MA5A 3UQ3A 3B95A 4BFRA 2J49A 2FI7A 2OV8A 2YNQA 4BETA 4I6GA 1L5JA 2XQ0A 4HOQA 2C2LA 3R9MA 4APOA 1JCQA 3O4ZA 2L0IA 3G2TA 4A63B 4XKBA 5CCLA 3ASOE 4XI9A 3CR3A 4G8KA 4HORA 2EIJE 2IU1A 3U66A 2F0YA 3CVYA 2ETAA 4U96D 3DXKG 4G1TA 2ZU6B 4I1OB 4TRQA 3X2QE 4CT0A 4JA7A 1BD8A 5KBAA 3JXJA 4CCAA 1NA3A 3J5PA 3LY8A 1JCRA 3G2WA 3IHVA 1TNYA 1BI7B 4XKCA 1E96B 4MS6A 3P2BA 1WDYA 2OVBA 4UQXA 1FVFA 3CHSA 2AVPA 1HZ4A 3RO3A 2OOEA 3VTYA 2Q7FA 4ZHBA 1NP7A 1H6PA 1OXJA 4UI9C 3HG0D 2B0OE 3DRAA 3TWSA 1NFIE 4A1GA 5JHBA 2NXPA 2XPIA 5CEAA 2DIWA 4N3CA 4HQDA 1UG3A 4A3TA 2P9LG 4WWPA 4BEPA
chains in the Genus database with same CATH topology
3ML9A 3HYMB 4XZ4A 2QY7A 4DK5A 3JYSA 4U63A 2A5UA 3G2VA 2PL2A 3JQ0A 3CVLA 3MEKA 3B7SA 4Y6CA 3TGOA 4J0UA 2UY1B 5G2NA 3T8MA 4QFVA 2JEKA 4LERA 2VQ2A 4M3OA 3R7RA 3S7BA 2EQXA 3PEVB 3SNXA 3VTXA 5JHAA 1JWGA 4BY6A 3FHEA 5AYWD 4WWNA 1YA0A 1QQEA 3CHMA 2VSNA 1N52A 4HOSA 4OVVA 3APFA 1W3BA 4WUYA 4L7TA 2HYZA 3ZYKA 5AJLA 3TAXA 2I2OA 2M63A 3QWWA 4BX8A 3CLJA 5EKQD 4G24A 3FTXA 4TUUA 5HI7A 2CG3A 2NC9A 3QC1A 4ATGA 4UI9K 1E7VA 2YHEA 3ZHEA 3CKBA 4N5CA 4Q69A 3D9LA 1LF8A 3FFLA 4DI4A 2I6HA 4NACA 1IQRA 2Y4UA 4JXTA 1ELKA 4KBQA 3CHOA 3D9KA 1NA0A 3CK8A 4JC8A 2WXJA 4L23A 4R7LA 3TG5A 2PZIA 4IYPA 4PS3A 1KT1A 5AIJA 2R59A 3CSFA 3QOUA 4H7YA 5JJ7A 3RK6A 4PDXA 4A1SA 3SI5A 5KJKA 2RG8A 4U07A 4IRUA 2L0TB 3AU5A 3CVPA 4RSYA 4B0ZA 1HFAA 5JJ6A 3PRZA 3B13A 2XPYA 2CHZA 3ZVVA 3FTWA 5BV0A 3R7QA 3SBSA 3CVXA 3D9PA 2CFUA 4JEUA 4JHRA 3FEXA 3FUMA 3NF1A 5G04C 1JUQA 1N54A 5G55A 3FTUA 4E6HA 3UT4A 4KXKB 3MKRA 4EBAA 4JEHA 4A3VA 5FJYA 4DI3A 4HFGA 3D9OA 3I3NA 1UJJA 4F7AA 4G26A 3PE4A 4J8DA 2KC7A 4N3BA 3RRMB 1B89A 3FUEA 3L13A 5LP0A 4ILHB 4PS7A 5FZQA 4J8FA 3VLEA 3ZW3A 5A6CA 3RU0A 4ME2A 1E90A 4EQFA 2CG2A 5CCMA 3EIJA 2E0IA 3MV3B 4JW1A 3S7DA 5LCWJ 1IHGA 4GB9A 2PQRA 4F3VA 4XE0A 2BF0X 1EYHA 4N39A 1OWPA 2FULA 4J8EA 4N2QA 4ANUA 4YVQC 4CDMA 4P29A 1HS6A 1FVHA 1H2VC 4J8SA 4NRHB 3UT8A 2MOWA 1HU3A 3DPDA 1OWMA 2BUGA 2YHCA 2A4ZA 3QB2A 4B8AA 3CHQA 4ACKA 5LCWC 3EHNA 4HOUA 4HXIA 1H6KA 4WWOA 2XPZA 3KEZA 1VDYA 3LDZA 2LNIA 2QFCA 4C0EA 3FU6A 1MHQA 4CEMA 3CGHA 4GYOA 3EDTB 5C1DA 3B7TA 3D9IA 3IV0A 4K0RA 4UWKA 3Q5MA 5T4YA 3R9AB 3SHFA 2HM8A 4GU5A 3RJVA 1Y8MA 3ZIMA 5T8IA 3KAEA 2IQCA 2WMNA 3PZDA 2X6HA 4GCNA 4I6JA 3D9NA 5FQ8A 3HVEA 2X6FA 2XEVA 4WNGA 2MHKA 4EBAG 3DBSA 1KT0A 4JL0A 4N3AA 2J9QA 4L1BA 3LY7A 3U9WA 4AY5A 5C2YA 4MLPA 3MV2B 4GZDA 1OWOA 5D0OD 4MKTA 3I4RB 4C0MA 3ZN3A 4FHKA 4GA0A 5KJNA 3FTSA 1E8XA 2VTBA 4I17A 3E4BA 3FU0A 4RVBA 2L6JA 3B7RL 2PM6A 4J6IA 1ELWA 2YQ8A 3Q47B 4UQZA 3ZRHA 4GYYA 3RRUA 4KYOB 4I9CA 3LJ3A 2LAIA 2XGOA 3MYVA 1ZU2A 3RIBA 4V3IA 3RKVA 3ZYLA 4CT4A 5FZRA 1E8WA 3JCKC 2I9CA 3LYAA 2WMOA 3BEEA 3EHMA 2WXHA 4O6FA 5KJLA 1UN9A 4Q94A 2CHWA 3GW4A 4KMOA 2WXRA 3BG1B 4GMLA 4GCOA 1IQUA 2JLBA 4AP2A 1INZA 1H0AA 5CMYA 2YINA 2XHEA 1S0PA 1SZAA 2R17C 3AU4A 4OVUA 5FQ7A 4JHJA 3OAWA 4B8CB 4FULA 2ONDA 4GAAA 4U0ZA 1QNFA 3UUXA 2VSYA 3ESLA 2VYIA 2WXGA 3MCXA 3FUHA 3FH5A 2WXNA 1ELRA 5DIZA 2DCPA 3IHYA 4AXHA 4EZKA 4GA2A 2KCKA 2Y3AA 2X38A 2FBNA 4AOFA 2VSXE 1ZBPA 5D0QD 4BX9A 5LFAA 3D9MA 4GZCA 4APFA 3PUJA 1WAO1 2WPVA 2XGMA 3CV0A 2KCLA 4IULA 2AWIA 3KS2A 3UMVA 1E8ZA 3LCAA 4CRWA 5J08A 1Z3YA 1QZ2A 1JPLA 3FUKA 3PNLB 1SQMA 1JWFA 2HR2A 3ULQA 3FUDA 4EPZA 4PUCA 2RD0A 4XI0A 3OXGA 1U3CA 2BTDA 2ILRA 4WNDA 2P58C 2J08A 5KJMA 3HDXA 1WM5A 2XGSA 3FUJA 4CDNA 3ZXSA 4UI9J 4FADA 4RG6A 3D3MA 3JQ1A 4FHJA 2CHXA 3VLFA 4AY6A 3FWVA 1HO8A 4AJWA 3I4GA 5FQ6A 3LEWA 4KT6B 3AS5A 4MRUA 4YNDA 4BT8A 3L6AA 2I1KA 2L9BA 3TL5A 1FCHA 5CMWA 3APDA 2WXMA 3LVQE 3CKCA 5ANLA 5ARFA 2J09A 3TG4A 1HG2A 2AXZA 3FULA 3MKQA 4B89A 3FP3A 3EJNA 2WQ6A 4I1AA 4D10C 3VLDA 3OXFA 4FP7A 2V0PA 2VSOE 2WQHA 2X6KA 3FH7A 3T5VA 3FUIA 2KM4A 2WQ7A 4NURA 3TJPA 4BT9A 5G05J 3AS8A 4FJZA 3CVVA 4K03A 2V5FA 5FT9A 3Q15A 4L2LA 4G2VA 3PNTB 2LSVA 2GW1A 3ZFWA 3Q4AB 4EZJA 3JUIA 4ABNA 3FEYA 1XGWA 1PY1A 2WXIA 3L17A 2AXVA 4LCTA 2X6JA 4G11A 1EF1C 4DJAA 1HG5A 2J4BA 4YVOA 2IOLA 3T5XA 3U4TA 4B94A 2VJ8A 3U64A 2VGXA 2VGYA 4GMJA 5ANRA 3TXNA 4ILIA 3IEGA 4HLEA 4UQYA 3QK0A 2X6IA 3AS4A 2E2EA 4F1SA 4ANVA 1H2UA 3LPZA 3SF4A 3QKYA 3GZSA 2HO1A 1EPUA 5FQ4A 3ASFA 5BUZA 1H19A 2UWJG 3L22A 1PC2A 2R5SA 3CK7A 3QAQA 5AENA 2V8SE 1A17A 3HVEB 3S7FA 3PDNA 3NZSA 4EECA 1E7UA 2WXQA 2KZTA 3ONLA 3QARA 4I43A 4KVMA 4JZYA 1Y6IA 3BG0B 3CSTA 2DBAA 3FU5A 3B7UX 4LUNU 3LKUA 4AVXA 1X5BA 3G2UA 4PH4B 4PS8A 4DLQA 4F53A 3I5PA 5A23A 2VTBB 3EIQC 4E85A 4CGWA 3CVUA 3ZYQA 3GZ1A 3MGBA 5ENNA 3ASHA 4I2ZA 3CHPA 5AJDA 3FH8A 3O48A 4H7XA 1WY6A 3PREA 1H2TC 4AIFA 3QJZA 4URKA 3WXXA 4C9BB 5KCMA 4UWHA 3FUNA 3GYZA 4U0SA 4FA6A 1E8YA 4FLHA 4OYSA 4UWLA 4FC8A 4XIFA 5BW8C 2LO6A 1DVPA 3LXUX 2I1JA 1Z3XA 5A7DB 4BTAA 1PAQA 1TJFA 3SGHA 4I9EA 3URZA 2UY1A 3ZGQA 1KLXA 5EX0A 4JA9A 3ZYMA 3PE3A 4G25A 5BNWA 5CHEE 2FO7A 4W9RA 2J4DA 3ASDA 4CDRA 2WXKA 1BPOA 1GW6A 4Y6WA 3ZPJA 4HOTA 3MA5A 3MX3A 3LY9A 1HX8A 4CGVA 3CHRA 3UQ3A 2NSZA 3CK9A 3UPVA 2OVFA 4FJYA 2XRYA 3PEUB 1HH8A 3LS8A 5G04J 4DPRA 2LSUA 1OWNA 3ZHEB 5BT1A 2GGFA 2XCBA 3UT7A 4BFRA 2AW6A 3FY4A 4Q96A 2J49A 4HVBA 3D9JA 2FI7A 2GRLA 3NZUA 1IYGA 2OV8A 2YNQA 5E75A 2GRMA 2MRIA 3FTYA 5JJTA 1OWLA 4I6GA 1L5JA 4FLBA 2C0LA 2XQ0A 3QWPA 4FU3A 4GZ5A 3GZ2A 2WXPA 2C2LA 4HOQA 4U04A 4GPKA 4APOA 3CVWA 4ANXA 2WVIA 3MZLB 2PQNA 3O4ZA 2L0IA 4I1MA 2J07A 3G2TA 3CVNA 1TEZA 4DLOA 4XKBA 4BSXA 5CCLA 3L16A 3FU3A 3S2AA 3FUFA 4XI9A 3SBTB 4KZCA 4HS2A 3CR3A 5HQ8A 4HORA 3C98A 5DBKA 2IU1A 2KCVA 1EDUA 4TV3A 4I2WA 3U66A 3OTNA 4EZLA 3L08A 3RO2A 3CVYA 3ENEA 1UN8A 2FF4A 1HE8A 3QDNA 3HIZA 4G1TA 2ZU6B 4I1OB 4GA1A 4TRQA 4CT0A 2CFZA 3PS6A 1OUVA 3N71A 4JA7A 3OXLA 4CCAA 5ARGA 1NA3A 3CIAA 2WB2A 3MKQB 4ANWA 4L2YA 4AEZC 4N2SA 3G2SA 3TXMA 4GZ6A 3IKOB 5FTPA 3LY8A 4IN3B 4ACLA 1U3DA 5E76A 1NZNA 4U8HA 2WXOA 3G2WA 4GYWA 3IHVA 2IFUA 2IJGX 3CEQA 3P1UA 5BV1A 3PH0C 4GZ3A 5FZSA 4LEUA 3QWVA 5EX3A 4G23A 5G05C 4XKCA 4KVOA 1E96B 5FWQA 5J90A 1Z6TA 1HXIA 3P2BA 3PVLA 4MS6A 3RRNB 5M72A 4LRZA 1DNPA 2LAHA 2OVBA 2XRZA 2Y4TA 4UWGA 4UQXA 1FVFA 4AM9A 5T3RA 4UWFA 1UW4B 3CHSA 4JPSA 4I6EA 1SZ9A 3FDHA 2AVPA 4WNEA 1HZ4A 3RO3A 3S7JA 2VGXB 2AXUA 2OOEA 3VTYA 1UJKA 3ASGA 3CQCB 3ML8A 3ONKA 4WNFA 5LX8A 2IOSA 2Q7FA 3ZEFA 3HHMA 3SZ7A 3CVQA 3U3WA 3MJWA 1NP7A 4ILGA 5BPPA 3LVRE 4RG9A 4NQ0A 2KZTB 2IONA 4UI9C 3IBEA 3SD5A 3Q49B 1TJCA 2FEZA 2X3MA 2V4LA 4JHKA 3UX4A 3QNKA 1P5QA 3K9IA 4AV7A 5EDSA 3FTVA 3PUKA 4BTBA 1XNFA 3SFZA 4XX5A 1MQSA 3FTZA 2WXLA 4A1GA 3L54A 2PM7A 4WAFA 4A55A 5JHBA 2NXPA 3KD7A 3NQPA 1HF8A 3ESKA 3CQGB 2XPIA 2DIWA 2WM9A 4JVSA 2KATA 4BWRA 4N3CA 2WXFA 5LOZA 1UG3A 4KZ0A 4U0UA 2XCCA 2IF4A 2C0MA 4A3TA 4WWPA 3APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEV A;  2C0L A;  3HYM B;  3QWP A;  2MHK A;  3JYS A;  4GZ5 A;  1KT0 A;  4JL0 A;  3GZ2 A;  2J9Q A;  2C2L A;  2PL2 A;  3LY7 A;  3CVL A;  3MEK A;  4HOQ A;  4U04 A;  4APO A;  4BT9 A;  5G05 J;  3MV2 B;  4GPK A;  5D0O D;  4Y6C A;  3AS8 A;  3TGO A;  4J0U A;  2UY1 B;  3ZN3 A;  2PQN A;  4GA0 A;  5KJN A;  2VQ2 A;  3S7B A;  2V5F A;  4I17 A;  3CVN A;  5FT9 A;  3E4B A;  3Q15 A;  3VTX A;  4G2V A;  5CCL A;  4XI9 A;  2LSV A;  2L6J A;  5AYW D;  2GW1 A;  1YA0 A;  1QQE A;  3Q4A B;  1ELW A;  2YQ8 A;  3Q47 B;  2VSN A;  4UQZ A;  4WNG A;  3ZFW A;  4ABN A;  5HQ8 A;  4HOR A;  4HOS A;  4GYY A;  1W3B A;  4WUY A;  4KYO B;  4I9C A;  5DBK A;  2HYZ A;  2KCV A;  3RIB A;  2XGO A;  3RKV A;  1ZU2 A;  4I2W A;  3TAX A;  3QWW A;  5HI7 A;  5EKQ D;  4G24 A;  5FZR A;  3RO2 A;  3LYA A;  2FF4 A;  2NC9 A;  3BEE A;  3QDN A;  4O6F A;  4YVO A;  5KJL A;  4RG9 A;  3GW4 A;  4G1T A;  4UI9 K;  3U4T A;  4N3A A;  4B94 A;  4GCO A;  2JLB A;  4GA1 A;  3ZHE A;  2VGX A;  2VGY A;  3CKB A;  4N5C A;  1OUV A;  3N71 A;  4JA7 A;  3FFL A;  3IEG A;  3OXL A;  2I6H A;  4UQY A;  3AS4 A;  2E2E A;  1NA3 A;  2Y4U A;  4KBQ A;  5ARG A;  2OND A;  1NA0 A;  3CK8 A;  3LPZ A;  4U0Z A;  3QKY A;  2PZI A;  2HO1 A;  3SF4 A;  3TG5 A;  3ASF A;  1KT1 A;  2UWJ G;  3UUX A;  4N2S A;  2VSY A;  3QOU A;  4H7Y A;  5JJ7 A;  2VYI A;  1PC2 A;  4GZ6 A;  5FTP A;  2R5S A;  3CK7 A;  3LY8 A;  4IN3 B;  4A1S A;  1A17 A;  1NZN A;  5KJK A;  4U07 A;  1ELR A;  3S7F A;  3PDN A;  5DIZ A;  4GYW A;  2IFU A;  3CVP A;  3CEQ A;  4GA2 A;  2KCK A;  2DBA A;  5LCW J;  5JJ6 A;  4GZ3 A;  5FZS A;  2FBN A;  3LKU A;  1ZBP A;  5D0Q D;  4LEU A;  3QWV A;  5EX3 A;  4G23 A;  5G05 C;  4JHR A;  1E96 B;  4CGW A;  3GZ1 A;  1HXI A;  5CCM A;  1WAO 1;  2WPV A;  2XGM A;  3CV0 A;  3ASH A;  2KCL A;  3NF1 A;  4I2Z A;  5G04 C;  3O48 A;  4H7X A;  5M72 A;  3KS2 A;  4KXK B;  3MKR A;  4AIF A;  2Y4T A;  5FJY A;  4UQX A;  4AM9 A;  3LCA A;  3WXX A;  3GYZ A;  1QZ2 A;  4U0S A;  4G26 A;  3PE4 A;  4J8D A;  2KC7 A;  2HR2 A;  4N3B A;  1B89 A;  2AVP A;  4WNE A;  4XIF A;  5BW8 C;  3ULQ A;  1HZ4 A;  4XI0 A;  3RO3 A;  3S7J A;  2VGX B;  3OXG A;  5A7D B;  4BTA A;  2OOE A;  4J8F A;  5FZQ A;  3VTY A;  4WND A;  3ASG A;  2P58 C;  4I9E A;  3URZ A;  2UY1 A;  3ZGQ A;  3RU0 A;  4ME2 A;  5A6C A;  1KLX A;  5EX0 A;  5KJM A;  1WM5 A;  4JA9 A;  2XGS A;  4WNF A;  4EQF A;  3PE3 A;  3MV3 B;  4G25 A;  2Q7F A;  3S7D A;  5CHE E;  5BNW A;  2FO7 A;  1IHG A;  4W9R A;  2PQR A;  3ASD A;  4CDR A;  4F3V A;  3SZ7 A;  4UI9 J;  4Y6W A;  3CVQ A;  4N39 A;  3U3W A;  4RG6 A;  3ZPJ A;  4HOT A;  3MA5 A;  4J8E A;  4N2Q A;  3LY9 A;  4YVQ C;  4CGV A;  4AY6 A;  3UQ3 A;  3FWV A;  4NQ0 A;  4NRH B;  4UI9 C;  3CK9 A;  3UPV A;  2BUG A;  2YHC A;  1TJC A;  3AS5 A;  3Q49 B;  2FEZ A;  4YND A;  4BT8 A;  5LCW C;  1P5Q A;  3K9I A;  4HOU A;  1HH8 A;  1FCH A;  4AY5 A;  1XNF A;  4BTB A;  2LSU A;  3ZHE B;  3CKC A;  5ARF A;  2XCB A;  5BT1 A;  2LNI A;  2QFC A;  3TG4 A;  5C1D A;  4GYO A;  3EDT B;  3KD7 A;  3ESK A;  3FP3 A;  2FI7 A;  2XPI A;  3Q5M A;  3R9A B;  2KAT A;  1IYG A;  4BWR A;  4N3C A;  1Y8M A;  3RJV A;  4I1A A;  3KAE A;  4U0U A;  2XCC A;  3OXF A;  2IF4 A;  2C0M A;  4GCN A;  5JJT A;  5G04 J;  2WQH A; 
#chains in the Genus database with same CATH topology
 1D8D A;  3JQ0 A;  3B7S A;  2Y1L E;  3T8M A;  3VTX A;  3FHE A;  4WWN A;  4NIK A;  5AN8 A;  2VSN A;  1N52 A;  3ULE G;  2HYZ A;  3ZYK A;  3QWW A;  1TNU A;  4G24 A;  3FTX A;  3QC1 A;  4ATG A;  4JB8 P;  5EN5 D;  1IQR A;  2R03 A;  3D9K A;  4O1O A;  2P9N G;  3UI2 A;  3QOU A;  2IY0 C;  4A1S A;  4XEI G;  4IRU A;  4M7C A;  3AU5 A;  2ZIS A;  3FEX A;  1N54 A;  1TN8 A;  4DI3 A;  3D9O A;  3W9F A;  2KC7 A;  5LP0 A;  4PS7 A;  5A6C A;  3RU0 A;  1E90 A;  4EQF A;  2CG2 A;  5CCM A;  1KPS B;  3MV3 B;  4JW1 A;  3S7D A;  4F3V A;  4XE0 A;  4HI9 A;  2NYJ A;  5AQB A;  4CDM A;  1FVH A;  1H2V C;  4J8S A;  2BUG A;  3DPD A;  3CHQ A;  4ACK A;  1JCS A;  1H6K A;  2DYS E;  3KEZ A;  4C0E A;  3FU6 A;  4CEM A;  5C1D A;  4GU5 A;  3ZIM A;  4I6J A;  1TR4 A;  3D9N A;  3HVE A;  1KT0 A;  4L1B A;  3MV2 B;  4GZD A;  1OWO A;  4U95 D;  4C0M A;  5KJN A;  3FU0 A;  4KYO B;  4CT4 A;  2XGO A;  2I9C A;  2V5Q C;  3LYA A;  3BEE A;  4O6F A;  1H6O A;  1UN9 A;  3E33 A;  2JLB A;  3ULY A;  4JHJ A;  4B8C B;  3Q75 A;  2OND A;  4GAA A;  2WXG A;  3FH5 A;  4GTT A;  2WXN A;  1A5E A;  3IHY A;  4EZK A;  4K5B A;  2KCK A;  2Y3A A;  2FBN A;  1ZBP A;  4GTS A;  3EUV A;  1WAO 1;  2WPV A;  2XGM A;  2KCL A;  3UMV A;  4CRW A;  1K3Z D;  3UM3 A;  3FUK A;  3ULQ A;  4EPZ A;  4YDO A;  3T8K A;  5KJM A;  3AJI A;  3FUJ A;  4CDN A;  5AQA A;  2JAB A;  4RG6 A;  2F37 A;  3JQ1 A;  2CHX A;  1DCE A;  3AS5 A;  4MRU A;  2L9B A;  3TL5 A;  1SA4 A;  3APD A;  2WXM A;  3CKC A;  4LSZ E;  2EIN E;  2J09 A;  3TG4 A;  2AXZ A;  4BSZ B;  4B89 A;  3EJN A;  2H6G A;  2WQ6 A;  3JXI A;  4D10 C;  3DXM G;  2WQH A;  5ENP D;  3EU5 A;  4N5Q A;  4NUR A;  5G05 J;  2OEW A;  3NOG D;  3CVV A;  1V55 E;  3HXF A;  4K03 A;  3UIP C;  2XS8 A;  2V5F A;  2GW1 A;  3ZFW A;  3KEA A;  4BES A;  3FEY A;  1PY1 A;  3L17 A;  3AG3 E;  1HG5 A;  2J4B A;  4YVO A;  4B94 A;  2VJ8 A;  3U64 A;  2VGX A;  2VGY A;  4GMJ A;  4ILI A;  4HLE A;  3AS4 A;  3SF4 A;  3QKY A;  5AEN A;  1A17 A;  1FT2 A;  3NZS A;  4KVM A;  3QAR A;  1TN7 A;  3CST A;  3B7U X;  4JD2 G;  3G2U A;  4MBG A;  4PS8 A;  4DLQ A;  2F8X K;  5ENN A;  3CHP A;  1TN6 A;  1WY6 A;  4B93 B;  1H2T C;  5AQ9 A;  4AIF A;  4UWH A;  4GTV A;  4FC8 A;  2LO6 A;  3LXU X;  1TJF A;  2UY1 A;  5EX0 A;  5CHE E;  2J4D A;  5EYP F;  4Y6W A;  2XRY A;  4DPR A;  2LSU A;  2XCB A;  3FY4 A;  4Q96 A;  3D9J A;  2GRL A;  2MRI A;  3TWV A;  2C0L A;  3QWP A;  4FU3 A;  4GZ5 A;  3GZ2 A;  3HXD A;  4U04 A;  1O1S A;  1TYQ G;  3AG4 E;  4LNU D;  2J07 A;  2LUH A;  3SY2 A;  4DLO A;  5ENR D;  3DSW A;  3FUF A;  3S2A A;  3SBT B;  3DEP A;  5HQ8 A;  5DBK A;  2KCV A;  4TV3 A;  4GTO A;  3OTN A;  4BER A;  4EZL A;  3L08 A;  3RO2 A;  1TNO A;  3QDN A;  2RFA A;  4GA1 A;  5CER B;  2MYO A;  1OUV A;  3N71 A;  3OXL A;  3NOC D;  4L2Y A;  4N2S A;  3G2S A;  5FTP A;  5E76 A;  3UM2 A;  3NAW A;  2IFU A;  5BV1 A;  5FZS A;  5EX3 A;  3QWV A;  4G23 A;  1D8E A;  5J90 A;  2H6H A;  3BQO A;  4LRZ A;  1N9A A;  2Y4T A;  4UWG A;  5T3R A;  3FDH A;  3Q73 A;  2VGX B;  3SFX A;  4J7W A;  3ONK A;  3EU9 A;  3ZEF A;  1MZC A;  3HHM A;  2LXM A;  3CVQ A;  3U3W A;  3MJW A;  3J5Q B;  5BPP A;  4U8V D;  3LVR E;  4NQ0 A;  3SD5 A;  2XZT G;  5B1A E;  1TJC A;  1P5Q A;  3UTM A;  3FTV A;  3PUK A;  4A55 A;  2Y69 E;  4YDY A;  1HF8 A;  3C3O A;  3CQG B;  3ESK A;  2WM9 A;  2KAT A;  2WXF A;  1O5M A;  4U0U A;  3APC A;  3ML9 A;  3G2V A;  3MEK A;  4RQI A;  1NL4 A;  1N4S A;  4Y6C A;  3TGO A;  4QFV A;  2JEK A;  4M3O A;  3R7R A;  3S7B A;  2EQX A;  3SNX A;  1DCQ A;  1JWG A;  4HOS A;  3TAX A;  2I2O A;  1AWC B;  4BX8 A;  3CLJ A;  4TUU A;  3UIN C;  4UI9 K;  1E7V A;  4U8Y D;  1LF8 A;  3FFL A;  4DI4 A;  2I6H A;  2Y4U A;  4KBQ A;  1ELK A;  4R7L A;  1NA0 A;  3CK8 A;  2PZI A;  4PS3 A;  4DX2 A;  4H7Y A;  5JJ7 A;  4PDX A;  5KJK A;  3C3Q A;  4U07 A;  4GPM A;  5ITZ F;  1V54 E;  4B0Z A;  1QYM A;  5JJ6 A;  3B13 A;  3C3R A;  3FTW A;  3Q7A A;  3SBS A;  3ZVV A;  1K1A A;  3SQV A;  4GTR A;  5G55 A;  3C72 A;  1WG0 A;  4KXK B;  3UT4 A;  3DSU A;  4F7A A;  2ETC A;  3PE4 A;  1YMP A;  3DST A;  3PZ3 A;  4C48 B;  2R02 A;  3ZNG A;  3VLE A;  5ENO D;  2BF0 X;  1EYH A;  4N39 A;  1KZO A;  4J8E A;  4N2Q A;  1N95 A;  1HS6 A;  2MOW A;  1HU3 A;  3DPY A;  3QB2 A;  1N0Q A;  4WWO A;  4GYO A;  4UWK A;  3Q5M A;  3R9A B;  3SHF A;  4CYM D;  3RJV A;  3Q79 A;  3KAE A;  3PZD A;  2WMN A;  2X6H A;  4GCN A;  3E32 A;  2X6F A;  4WNG A;  3DBS A;  4N3A A;  2J9Q A;  4MLP A;  4TXP A;  3I4R B;  3KSQ A;  4I17 A;  2L6J A;  3B7R L;  2YQ8 A;  4LG6 A;  2RFM A;  3ZRH A;  3RRU A;  4I9C A;  4CZ2 D;  3LJ3 A;  3ZYL A;  3IXE A;  1E8W A;  3JCK C;  2WMO A;  2BED A;  2WXH A;  4Q94 A;  4RG9 A;  2CHW A;  3GW4 A;  2WXR A;  3BG1 B;  4GML A;  4GCO A;  5B3S E;  1INZ A;  2XHE A;  5FQ7 A;  1OCC E;  3MCX A;  3FUH A;  4AXH A;  2X38 A;  5CRV A;  5D0Q D;  4ATZ D;  3CV0 A;  4IUL A;  2AWI A;  5J08 A;  1JWF A;  2ZXW E;  4PUC A;  3ASN E;  2P58 C;  3ZXS A;  4UI9 J;  3AAA C;  1BI8 B;  2Y0B G;  3W9G A;  3LEW A;  4BT8 A;  3LVQ E;  2R05 A;  5FIN A;  3MKQ A;  4I1A A;  2ZGG A;  5KWD A;  4HBD A;  2X6K A;  2KBX A;  2P9U G;  3T5V A;  3FUI A;  2KM4 A;  4BT9 A;  1LD7 A;  2QYJ A;  5FT9 A;  2EIK E;  4ABN A;  2DWZ A;  2X6J A;  4G11 A;  1EF1 C;  1IKN D;  5D66 A;  3T5X A;  3U4T A;  5ANR A;  3TXN A;  2A5E A;  4UQY A;  3QK0 A;  4F1S A;  3LPZ A;  5BUZ A;  2HO1 A;  2UWJ G;  3CK7 A;  3HVE B;  3S7F A;  3PDN A;  4EEC A;  2DBA A;  4LUN U;  2H6I A;  1LD8 A;  1X5B A;  3EIQ C;  5HRY A;  1Z5S C;  4CGW A;  3FH8 A;  4DRX E;  3PRE A;  5JA4 D;  3QJZ A;  2IO3 C;  3WXX A;  5KCM A;  3GYZ A;  4FA6 A;  1E8Y A;  4FLH A;  4UWL A;  1DVP A;  4HRN A;  5A7D B;  3SGH A;  4I9E A;  1KLX A;  2FO7 A;  4F1P A;  2WXK A;  1GW6 A;  3LY9 A;  4CGV A;  3CHR A;  2NSZ A;  2OVF A;  1N0R A;  3PZ1 A;  1OWN A;  3ZHE B;  2GGF A;  1YYH A;  5CEC B;  4HVB A;  1IYG A;  5E75 A;  4X8Q A;  1S64 A;  3CVW A;  1FT1 A;  4DX5 D;  1TEZ A;  5D2M C;  4F6R D;  4BSX A;  3L16 A;  3HXE A;  5EIL A;  4KZC A;  3C98 A;  4I2W A;  1HE8 A;  2EIL E;  2CFZ A;  3PS6 A;  3MKQ B;  1LTX A;  4AEZ C;  4K5C A;  2GRP B;  3IKO B;  4IN3 B;  3UIO C;  4ACL A;  1U3D A;  4HB5 A;  4EHM A;  3P1U A;  4GTQ A;  1X81 A;  5FWQ A;  4KVO A;  2RKK A;  1Z6T A;  3ABK E;  3PVL A;  3UM1 A;  1SVX A;  5M72 A;  1DNP A;  2LAH A;  2F8Y A;  2XRZ A;  4AM9 A;  1SZ9 A;  2EIM E;  4DX7 D;  4YDW A;  1UJK A;  4O1P A;  3ASG A;  3CQC B;  3ML8 A;  4WNF A;  5LX8 A;  3TWU A;  4HLL A;  4QQI A;  3SZ7 A;  5KNG A;  2ION A;  3Q49 B;  3UX4 A;  2X3M A;  4JHK A;  3ZKJ A;  3UKR G;  3DSV A;  3FTZ A;  2WXL A;  4WAF A;  3L9T A;  3LJN A;  2XCC A;  2IF4 A;  3DWL G;  3HYM B;  4XZ4 A;  4DK5 A;  5CBO A;  4U63 A;  2A5U A;  2PL2 A;  4J0U A;  2P2C P;  2UY1 B;  4TUM A;  5G2N A;  4LER A;  2VQ2 A;  4J8Y A;  3PEV B;  5JHA A;  5AYW D;  3Q7F A;  1YA0 A;  1QQE A;  4OVV A;  3APF A;  3PZ2 A;  3DEO A;  2V4H C;  2CG3 A;  3TWQ A;  2YHE A;  3CKB A;  4Q69 A;  4NAC A;  4JXT A;  3CHO A;  4JC8 A;  3TG5 A;  4GTM A;  4IYP A;  5AIJ A;  3CSF A;  3AG2 E;  3RK6 A;  3SI5 A;  2RG8 A;  5CBN A;  2L0T B;  4RSY A;  3CVP A;  3HXC A;  2P9S G;  2XPY A;  5BV0 A;  2XEH A;  4ZFH A;  3CVX A;  2CFU A;  3FUM A;  1JUQ A;  4EBA A;  3MKR A;  4A3V A;  2KXP C;  4N3B A;  3RRM B;  1B89 A;  3FUE A;  3L13 A;  4J8F A;  4K5A B;  1MJ0 A;  4ME2 A;  5EID A;  3EIJ A;  1IHG A;  2PQR A;  1OWP A;  5AAO A;  4P29 A;  4NRH B;  3E37 A;  5BXU A;  2YHC A;  5LCW C;  4B8A A;  1UOH A;  4HNA D;  3EHN A;  4HOU A;  4OAU C;  2XPZ A;  1VDY A;  3Q9U C;  2LNI A;  2QFC A;  1N11 A;  3CGH A;  5B1B E;  3B7T A;  2B6C A;  4K0R A;  2HM8 A;  3B7B A;  2BKG A;  5FQ8 A;  3ISM C;  2XEV A;  4AY5 A;  4JL0 A;  3U9W A;  3LY7 A;  5D0O D;  1SW6 A;  4FHK A;  5FIO A;  3FTS A;  2VTB A;  2XS1 A;  2PM6 A;  4J6I A;  1ELW A;  3Q47 B;  1YCS B;  4UQZ A;  4GYY A;  3ZUV B;  3RKV A;  2XZD G;  3EHM A;  5KJL A;  4AP2 A;  5CMY A;  3AU4 A;  4OVU A;  2R17 C;  3RAU A;  4DX1 A;  3ESL A;  3Q78 A;  2ZGD A;  4LNB A;  2FO1 E;  3D9M A;  4APF A;  2OEV A;  1E8Z A;  2XEN A;  1QZ2 A;  1JPL A;  2HR2 A;  3FUD A;  2RD0 A;  3OXG A;  1U3C A;  3TWT A;  2XGS A;  4FAD A;  4FHJ A;  3VLF A;  1MX6 A;  3FWV A;  4HI8 A;  3I4G A;  2R2L A;  5FQ6 A;  1O1R A;  5ARF A;  4HRM B;  1S70 B;  4U7E B;  3V79 K;  3VLD A;  4GMR A;  1IHB A;  2V0P A;  1TNB A;  2WQ7 A;  4L2L A;  3PNT B;  4EZJ A;  1RZ4 A;  3JUI A;  1XGW A;  2WXI A;  4LCT A;  1ZB1 A;  1D9S A;  3IEG A;  2GRO B;  2X6I A;  4UUC A;  4DX6 D;  1H2U A;  1EPU A;  3ASF A;  1H19 A;  4GTP A;  1PC2 A;  3KSL A;  1DC2 A;  3WG7 E;  1E7U A;  2WXQ A;  2KZT A;  2QZA A;  4I43 A;  1IXV A;  5CED B;  4PH4 B;  3I5P A;  2VTB B;  3TWR A;  1Q2Z A;  3GZ1 A;  3MGB A;  3ASH A;  4H7X A;  4URK A;  2BKK B;  4YDE A;  1N4Q A;  3F6Q A;  1Z3X A;  3V2X A;  3ZGQ A;  4JA9 A;  3ZYM A;  4TXQ A;  4W9R A;  2P9I G;  3ASD A;  5ENT D;  4HOT A;  3MX3 A;  1HX8 A;  1MX2 A;  2DZN A;  3CK9 A;  3UPV A;  4FJY A;  3PEU B;  1HH8 A;  5BT1 A;  3UT7 A;  2AW6 A;  3NZU A;  2GRM A;  3FTY A;  2GRQ B;  5JJT A;  2QYU A;  1OWL A;  4FLB A;  1K8K G;  1BU9 A;  2WXP A;  4GPK A;  3EHQ A;  4ANX A;  2WVI A;  4DUI A;  3MZL B;  2PQN A;  4I1M A;  3CVN A;  4L9P A;  3FU3 A;  5EIB E;  4HS2 A;  1EDU A;  4G8L A;  3ENE A;  1UN8 A;  2FF4 A;  1NI1 A;  3HIZ A;  5KNH D;  5H7P A;  2ZIR A;  3BU8 A;  5ARG A;  3PZ4 A;  3CIA A;  2WB2 A;  4ANW A;  3Q9N C;  3TXM A;  4GZ6 A;  1BLX B;  1NZN A;  5EYL A;  3C5R A;  4U8H A;  2WXO A;  4GYW A;  2IJG X;  3CEQ A;  3PH0 C;  4GZ3 A;  4LEU A;  5G05 C;  1FPP A;  1HXI A;  3RRN B;  5ENS D;  3NB2 A;  4UWF A;  1UW4 B;  4JPS A;  4I6E A;  4WNE A;  1OY3 D;  3S7J A;  2AXU A;  1SA5 A;  2IOS A;  5AQ7 A;  3RSE G;  3V30 A;  4ILG A;  2KZT B;  3IBE A;  2FEZ A;  5HKP A;  2V4L A;  4AV7 A;  3QNK A;  5CRU A;  3K9I A;  5EDS A;  4BTB A;  1XNF A;  3SFZ A;  4XX5 A;  1MQS A;  5BXO A;  3L54 A;  2PM7 A;  4HRL A;  3KD7 A;  3NQP A;  4JVS A;  4BWR A;  2XEE A;  4O60 A;  5LOZ A;  4KZ0 A;  2C0M A;  3LS8 A;  5G04 J;  2QY7 A;  3JYS A;  3CVL A;  3V2O A;  3ABL E;  3NBN B;  2AJA A;  4BY6 A;  2P9K G;  3CHM A;  3UXG A;  1W3B A;  4WUY A;  4L7T A;  5AJL A;  2M63 A;  5HI7 A;  5EKQ D;  1KZP A;  2NC9 A;  5ENQ D;  3UKU G;  2DYR E;  3ZHE A;  1N4R A;  4N5C A;  2GRR B;  3D9L A;  2WXJ A;  4L23 A;  1KT1 A;  2R59 A;  3V31 A;  3HXB A;  4RLY A;  2IO2 C;  2J8S D;  1HFA A;  3PRZ A;  2CHZ A;  3R7Q A;  3D9P A;  4JEU A;  4JHR A;  3NF1 A;  5G04 C;  4E6H A;  3FTU A;  1OCR E;  4JEH A;  5FJY A;  4HFG A;  3I3N A;  1UJJ A;  4G26 A;  4J8D A;  4ILH B;  1OCZ E;  5FZQ A;  3ZW3 A;  5LCW J;  2E0I A;  4GB9 A;  2FUL A;  4ANU A;  4YVQ C;  3UT8 A;  1AP7 A;  1QBQ A;  1OWM A;  4EBA G;  2A4Z A;  3UM0 A;  4HXI A;  3LDZ A;  2DZO A;  1MHQ A;  3EDT B;  3D9I A;  3IV0 A;  5T4Y A;  1Y8M A;  5T8I A;  2IQC A;  1TNZ A;  2MHK A;  2H6F A;  3ZXP A;  5C2Y A;  4MKT A;  3ZN3 A;  4GA0 A;  1E8X A;  3E4B A;  1MX4 A;  4RVB A;  5HS0 A;  3RIB A;  2LAI A;  3MYV A;  1ZU2 A;  3JUE A;  4V3I A;  5FZR A;  2DVW A;  4KMO A;  1MYO A;  1IQU A;  1H0A A;  2YIN A;  1S0P A;  1SZA A;  3TWW A;  3OAW A;  4FUL A;  4U0Z A;  3DSX A;  1QNF A;  3UUX A;  5IY5 E;  2GRN B;  2VSY A;  2VYI A;  1ELR A;  5DIZ A;  2DCP A;  4GA2 A;  3ABM E;  4AOF A;  2VSX E;  5AAR A;  3EHR A;  4BX9 A;  5LFA A;  3SO8 A;  4GZC A;  3AG1 E;  2HE0 A;  3PUJ A;  3TWX A;  2ETB A;  3L82 A;  3KS2 A;  2PNN A;  3LCA A;  1Z3Y A;  3PNL B;  1SQM A;  3E30 A;  4XI0 A;  2BTD A;  2ILR A;  1N94 A;  4WND A;  2J08 A;  3HDX A;  1S63 A;  1WM5 A;  3D3M A;  4AY6 A;  1HO8 A;  4AJW A;  4KT6 B;  4YND A;  3L6A A;  2I1K A;  1FCH A;  1K1B A;  5CMW A;  5ANL A;  1HG2 A;  1U2V G;  3FUL A;  3SFY A;  3FP3 A;  1N4P A;  1OCO E;  3OXF A;  4FP7 A;  2VSO E;  2P9P G;  3FH7 A;  3TJP A;  3AS8 A;  3E34 A;  4FJZ A;  3T9K A;  3DSS A;  3Q15 A;  4G2V A;  2LSV A;  3Q4A B;  3ZU7 B;  2AXV A;  4DJA A;  2IOL A;  2QC9 A;  4OAV B;  1OT8 A;  4Z68 A;  2VGE A;  2E2E A;  4ANV A;  3GZS A;  5FQ4 A;  3L22 A;  2L6B A;  2R5S A;  3QAQ A;  2V8S E;  3ONL A;  4JZY A;  1Y6I A;  3BG0 B;  3FU5 A;  3BUA A;  3LKU A;  4AVX A;  4F53 A;  5A23 A;  4E85 A;  4LNG A;  3CVU A;  3ZYQ A;  4I2Z A;  5AJD A;  3O48 A;  2OCC E;  3HRA A;  4TXR A;  4C9B B;  3FUN A;  4U0S A;  3D9H A;  4OYS A;  4XIF A;  5BW8 C;  2I1J A;  4BTA A;  1PAQ A;  3URZ A;  2IEJ A;  1G3N B;  3PE3 A;  4G25 A;  5BNW A;  1RW2 A;  4CDR A;  1BPO A;  1O1T A;  5JMN D;  3ZPJ A;  2LXL A;  3MA5 A;  3UQ3 A;  3B95 A;  4BFR A;  2J49 A;  2FI7 A;  2OV8 A;  2YNQ A;  4BET A;  4I6G A;  1L5J A;  2XQ0 A;  4HOQ A;  2C2L A;  3R9M A;  4APO A;  1JCQ A;  3O4Z A;  2L0I A;  3G2T A;  4A63 B;  4XKB A;  5CCL A;  3ASO E;  4XI9 A;  3CR3 A;  4G8K A;  4HOR A;  2EIJ E;  2IU1 A;  3U66 A;  2F0Y A;  3CVY A;  2ETA A;  4U96 D;  3DXK G;  4G1T A;  2ZU6 B;  4I1O B;  4TRQ A;  3X2Q E;  4CT0 A;  4JA7 A;  1BD8 A;  5KBA A;  3JXJ A;  4CCA A;  1NA3 A;  3J5P A;  3LY8 A;  1JCR A;  3G2W A;  3IHV A;  1TNY A;  1BI7 B;  4XKC A;  1E96 B;  4MS6 A;  3P2B A;  1WDY A;  2OVB A;  4UQX A;  1FVF A;  3CHS A;  2AVP A;  1HZ4 A;  3RO3 A;  2OOE A;  3VTY A;  2Q7F A;  4ZHB A;  1NP7 A;  1H6P A;  1OXJ A;  4UI9 C;  3HG0 D;  2B0O E;  3DRA A;  3TWS A;  1NFI E;  4A1G A;  5JHB A;  2NXP A;  2XPI A;  5CEA A;  2DIW A;  4N3C A;  4HQD A;  1UG3 A;  4A3T A;  2P9L G;  4WWP A;  4BEP A; 
#chains in the Genus database with same CATH homology
 3ML9 A;  3HYM B;  4XZ4 A;  2QY7 A;  4DK5 A;  3JYS A;  4U63 A;  2A5U A;  3G2V A;  2PL2 A;  3JQ0 A;  3CVL A;  3MEK A;  3B7S A;  4Y6C A;  3TGO A;  4J0U A;  2UY1 B;  5G2N A;  3T8M A;  4QFV A;  2JEK A;  4LER A;  2VQ2 A;  4M3O A;  3R7R A;  3S7B A;  2EQX A;  3PEV B;  3SNX A;  3VTX A;  5JHA A;  1JWG A;  4BY6 A;  3FHE A;  5AYW D;  4WWN A;  1YA0 A;  1QQE A;  3CHM A;  2VSN A;  1N52 A;  4HOS A;  4OVV A;  3APF A;  1W3B A;  4WUY A;  4L7T A;  2HYZ A;  3ZYK A;  5AJL A;  3TAX A;  2I2O A;  2M63 A;  3QWW A;  4BX8 A;  3CLJ A;  5EKQ D;  4G24 A;  3FTX A;  4TUU A;  5HI7 A;  2CG3 A;  2NC9 A;  3QC1 A;  4ATG A;  4UI9 K;  1E7V A;  2YHE A;  3ZHE A;  3CKB A;  4N5C A;  4Q69 A;  3D9L A;  1LF8 A;  3FFL A;  4DI4 A;  2I6H A;  4NAC A;  1IQR A;  2Y4U A;  4JXT A;  1ELK A;  4KBQ A;  3CHO A;  3D9K A;  1NA0 A;  3CK8 A;  4JC8 A;  2WXJ A;  4L23 A;  4R7L A;  3TG5 A;  2PZI A;  4IYP A;  4PS3 A;  1KT1 A;  5AIJ A;  2R59 A;  3CSF A;  3QOU A;  4H7Y A;  5JJ7 A;  3RK6 A;  4PDX A;  4A1S A;  3SI5 A;  5KJK A;  2RG8 A;  4U07 A;  4IRU A;  2L0T B;  3AU5 A;  3CVP A;  4RSY A;  4B0Z A;  1HFA A;  5JJ6 A;  3PRZ A;  3B13 A;  2XPY A;  2CHZ A;  3ZVV A;  3FTW A;  5BV0 A;  3R7Q A;  3SBS A;  3CVX A;  3D9P A;  2CFU A;  4JEU A;  4JHR A;  3FEX A;  3FUM A;  3NF1 A;  5G04 C;  1JUQ A;  1N54 A;  5G55 A;  3FTU A;  4E6H A;  3UT4 A;  4KXK B;  3MKR A;  4EBA A;  4JEH A;  4A3V A;  5FJY A;  4DI3 A;  4HFG A;  3D9O A;  3I3N A;  1UJJ A;  4F7A A;  4G26 A;  3PE4 A;  4J8D A;  2KC7 A;  4N3B A;  3RRM B;  1B89 A;  3FUE A;  3L13 A;  5LP0 A;  4ILH B;  4PS7 A;  5FZQ A;  4J8F A;  3VLE A;  3ZW3 A;  5A6C A;  3RU0 A;  4ME2 A;  1E90 A;  4EQF A;  2CG2 A;  5CCM A;  3EIJ A;  2E0I A;  3MV3 B;  4JW1 A;  3S7D A;  5LCW J;  1IHG A;  4GB9 A;  2PQR A;  4F3V A;  4XE0 A;  2BF0 X;  1EYH A;  4N39 A;  1OWP A;  2FUL A;  4J8E A;  4N2Q A;  4ANU A;  4YVQ C;  4CDM A;  4P29 A;  1HS6 A;  1FVH A;  1H2V C;  4J8S A;  4NRH B;  3UT8 A;  2MOW A;  1HU3 A;  3DPD A;  1OWM A;  2BUG A;  2YHC A;  2A4Z A;  3QB2 A;  4B8A A;  3CHQ A;  4ACK A;  5LCW C;  3EHN A;  4HOU A;  4HXI A;  1H6K A;  4WWO A;  2XPZ A;  3KEZ A;  1VDY A;  3LDZ A;  2LNI A;  2QFC A;  4C0E A;  3FU6 A;  1MHQ A;  4CEM A;  3CGH A;  4GYO A;  3EDT B;  5C1D A;  3B7T A;  3D9I A;  3IV0 A;  4K0R A;  4UWK A;  3Q5M A;  5T4Y A;  3R9A B;  3SHF A;  2HM8 A;  4GU5 A;  3RJV A;  1Y8M A;  3ZIM A;  5T8I A;  3KAE A;  2IQC A;  2WMN A;  3PZD A;  2X6H A;  4GCN A;  4I6J A;  3D9N A;  5FQ8 A;  3HVE A;  2X6F A;  2XEV A;  4WNG A;  2MHK A;  4EBA G;  3DBS A;  1KT0 A;  4JL0 A;  4N3A A;  2J9Q A;  4L1B A;  3LY7 A;  3U9W A;  4AY5 A;  5C2Y A;  4MLP A;  3MV2 B;  4GZD A;  1OWO A;  5D0O D;  4MKT A;  3I4R B;  4C0M A;  3ZN3 A;  4FHK A;  4GA0 A;  5KJN A;  3FTS A;  1E8X A;  2VTB A;  4I17 A;  3E4B A;  3FU0 A;  4RVB A;  2L6J A;  3B7R L;  2PM6 A;  4J6I A;  1ELW A;  2YQ8 A;  3Q47 B;  4UQZ A;  3ZRH A;  4GYY A;  3RRU A;  4KYO B;  4I9C A;  3LJ3 A;  2LAI A;  2XGO A;  3MYV A;  1ZU2 A;  3RIB A;  4V3I A;  3RKV A;  3ZYL A;  4CT4 A;  5FZR A;  1E8W A;  3JCK C;  2I9C A;  3LYA A;  2WMO A;  3BEE A;  3EHM A;  2WXH A;  4O6F A;  5KJL A;  1UN9 A;  4Q94 A;  2CHW A;  3GW4 A;  4KMO A;  2WXR A;  3BG1 B;  4GML A;  4GCO A;  1IQU A;  2JLB A;  4AP2 A;  1INZ A;  1H0A A;  5CMY A;  2YIN A;  2XHE A;  1S0P A;  1SZA A;  2R17 C;  3AU4 A;  4OVU A;  5FQ7 A;  4JHJ A;  3OAW A;  4B8C B;  4FUL A;  2OND A;  4GAA A;  4U0Z A;  1QNF A;  3UUX A;  2VSY A;  3ESL A;  2VYI A;  2WXG A;  3MCX A;  3FUH A;  3FH5 A;  2WXN A;  1ELR A;  5DIZ A;  2DCP A;  3IHY A;  4AXH A;  4EZK A;  4GA2 A;  2KCK A;  2Y3A A;  2X38 A;  2FBN A;  4AOF A;  2VSX E;  1ZBP A;  5D0Q D;  4BX9 A;  5LFA A;  3D9M A;  4GZC A;  4APF A;  3PUJ A;  1WAO 1;  2WPV A;  2XGM A;  3CV0 A;  2KCL A;  4IUL A;  2AWI A;  3KS2 A;  3UMV A;  1E8Z A;  3LCA A;  4CRW A;  5J08 A;  1Z3Y A;  1QZ2 A;  1JPL A;  3FUK A;  3PNL B;  1SQM A;  1JWF A;  2HR2 A;  3ULQ A;  3FUD A;  4EPZ A;  4PUC A;  2RD0 A;  4XI0 A;  3OXG A;  1U3C A;  2BTD A;  2ILR A;  4WND A;  2P58 C;  2J08 A;  5KJM A;  3HDX A;  1WM5 A;  2XGS A;  3FUJ A;  4CDN A;  3ZXS A;  4UI9 J;  4FAD A;  4RG6 A;  3D3M A;  3JQ1 A;  4FHJ A;  2CHX A;  3VLF A;  4AY6 A;  3FWV A;  1HO8 A;  4AJW A;  3I4G A;  5FQ6 A;  3LEW A;  4KT6 B;  3AS5 A;  4MRU A;  4YND A;  4BT8 A;  3L6A A;  2I1K A;  2L9B A;  3TL5 A;  1FCH A;  5CMW A;  3APD A;  2WXM A;  3LVQ E;  3CKC A;  5ANL A;  5ARF A;  2J09 A;  3TG4 A;  1HG2 A;  2AXZ A;  3FUL A;  3MKQ A;  4B89 A;  3FP3 A;  3EJN A;  2WQ6 A;  4I1A A;  4D10 C;  3VLD A;  3OXF A;  4FP7 A;  2V0P A;  2VSO E;  2WQH A;  2X6K A;  3FH7 A;  3T5V A;  3FUI A;  2KM4 A;  2WQ7 A;  4NUR A;  3TJP A;  4BT9 A;  5G05 J;  3AS8 A;  4FJZ A;  3CVV A;  4K03 A;  2V5F A;  5FT9 A;  3Q15 A;  4L2L A;  4G2V A;  3PNT B;  2LSV A;  2GW1 A;  3ZFW A;  3Q4A B;  4EZJ A;  3JUI A;  4ABN A;  3FEY A;  1XGW A;  1PY1 A;  2WXI A;  3L17 A;  2AXV A;  4LCT A;  2X6J A;  4G11 A;  1EF1 C;  4DJA A;  1HG5 A;  2J4B A;  4YVO A;  2IOL A;  3T5X A;  3U4T A;  4B94 A;  2VJ8 A;  3U64 A;  2VGX A;  2VGY A;  4GMJ A;  5ANR A;  3TXN A;  4ILI A;  3IEG A;  4HLE A;  4UQY A;  3QK0 A;  2X6I A;  3AS4 A;  2E2E A;  4F1S A;  4ANV A;  1H2U A;  3LPZ A;  3SF4 A;  3QKY A;  3GZS A;  2HO1 A;  1EPU A;  5FQ4 A;  3ASF A;  5BUZ A;  1H19 A;  2UWJ G;  3L22 A;  1PC2 A;  2R5S A;  3CK7 A;  3QAQ A;  5AEN A;  2V8S E;  1A17 A;  3HVE B;  3S7F A;  3PDN A;  3NZS A;  4EEC A;  1E7U A;  2WXQ A;  2KZT A;  3ONL A;  3QAR A;  4I43 A;  4KVM A;  4JZY A;  1Y6I A;  3BG0 B;  3CST A;  2DBA A;  3FU5 A;  3B7U X;  4LUN U;  3LKU A;  4AVX A;  1X5B A;  3G2U A;  4PH4 B;  4PS8 A;  4DLQ A;  4F53 A;  3I5P A;  5A23 A;  2VTB B;  3EIQ C;  4E85 A;  4CGW A;  3CVU A;  3ZYQ A;  3GZ1 A;  3MGB A;  5ENN A;  3ASH A;  4I2Z A;  3CHP A;  5AJD A;  3FH8 A;  3O48 A;  4H7X A;  1WY6 A;  3PRE A;  1H2T C;  4AIF A;  3QJZ A;  4URK A;  3WXX A;  4C9B B;  5KCM A;  4UWH A;  3FUN A;  3GYZ A;  4U0S A;  4FA6 A;  1E8Y A;  4FLH A;  4OYS A;  4UWL A;  4FC8 A;  4XIF A;  5BW8 C;  2LO6 A;  1DVP A;  3LXU X;  2I1J A;  1Z3X A;  5A7D B;  4BTA A;  1PAQ A;  1TJF A;  3SGH A;  4I9E A;  3URZ A;  2UY1 A;  3ZGQ A;  1KLX A;  5EX0 A;  4JA9 A;  3ZYM A;  3PE3 A;  4G25 A;  5BNW A;  5CHE E;  2FO7 A;  4W9R A;  2J4D A;  3ASD A;  4CDR A;  2WXK A;  1BPO A;  1GW6 A;  4Y6W A;  3ZPJ A;  4HOT A;  3MA5 A;  3MX3 A;  3LY9 A;  1HX8 A;  4CGV A;  3CHR A;  3UQ3 A;  2NSZ A;  3CK9 A;  3UPV A;  2OVF A;  4FJY A;  2XRY A;  3PEU B;  1HH8 A;  3LS8 A;  5G04 J;  4DPR A;  2LSU A;  1OWN A;  3ZHE B;  5BT1 A;  2GGF A;  2XCB A;  3UT7 A;  4BFR A;  2AW6 A;  3FY4 A;  4Q96 A;  2J49 A;  4HVB A;  3D9J A;  2FI7 A;  2GRL A;  3NZU A;  1IYG A;  2OV8 A;  2YNQ A;  5E75 A;  2GRM A;  2MRI A;  3FTY A;  5JJT A;  1OWL A;  4I6G A;  1L5J A;  4FLB A;  2C0L A;  2XQ0 A;  3QWP A;  4FU3 A;  4GZ5 A;  3GZ2 A;  2WXP A;  2C2L A;  4HOQ A;  4U04 A;  4GPK A;  4APO A;  3CVW A;  4ANX A;  2WVI A;  3MZL B;  2PQN A;  3O4Z A;  2L0I A;  4I1M A;  2J07 A;  3G2T A;  3CVN A;  1TEZ A;  4DLO A;  4XKB A;  4BSX A;  5CCL A;  3L16 A;  3FU3 A;  3S2A A;  3FUF A;  4XI9 A;  3SBT B;  4KZC A;  4HS2 A;  3CR3 A;  5HQ8 A;  4HOR A;  3C98 A;  5DBK A;  2IU1 A;  2KCV A;  1EDU A;  4TV3 A;  4I2W A;  3U66 A;  3OTN A;  4EZL A;  3L08 A;  3RO2 A;  3CVY A;  3ENE A;  1UN8 A;  2FF4 A;  1HE8 A;  3QDN A;  3HIZ A;  4G1T A;  2ZU6 B;  4I1O B;  4GA1 A;  4TRQ A;  4CT0 A;  2CFZ A;  3PS6 A;  1OUV A;  3N71 A;  4JA7 A;  3OXL A;  4CCA A;  5ARG A;  1NA3 A;  3CIA A;  2WB2 A;  3MKQ B;  4ANW A;  4L2Y A;  4AEZ C;  4N2S A;  3G2S A;  3TXM A;  4GZ6 A;  3IKO B;  5FTP A;  3LY8 A;  4IN3 B;  4ACL A;  1U3D A;  5E76 A;  1NZN A;  4U8H A;  2WXO A;  3G2W A;  4GYW A;  3IHV A;  2IFU A;  2IJG X;  3CEQ A;  3P1U A;  5BV1 A;  3PH0 C;  4GZ3 A;  5FZS A;  4LEU A;  3QWV A;  5EX3 A;  4G23 A;  5G05 C;  4XKC A;  4KVO A;  1E96 B;  5FWQ A;  5J90 A;  1Z6T A;  1HXI A;  3P2B A;  3PVL A;  4MS6 A;  3RRN B;  5M72 A;  4LRZ A;  1DNP A;  2LAH A;  2OVB A;  2XRZ A;  2Y4T A;  4UWG A;  4UQX A;  1FVF A;  4AM9 A;  5T3R A;  4UWF A;  1UW4 B;  3CHS A;  4JPS A;  4I6E A;  1SZ9 A;  3FDH A;  2AVP A;  4WNE A;  1HZ4 A;  3RO3 A;  3S7J A;  2VGX B;  2AXU A;  2OOE A;  3VTY A;  1UJK A;  3ASG A;  3CQC B;  3ML8 A;  3ONK A;  4WNF A;  5LX8 A;  2IOS A;  2Q7F A;  3ZEF A;  3HHM A;  3SZ7 A;  3CVQ A;  3U3W A;  3MJW A;  1NP7 A;  4ILG A;  5BPP A;  3LVR E;  4RG9 A;  4NQ0 A;  2KZT B;  2ION A;  4UI9 C;  3IBE A;  3SD5 A;  3Q49 B;  1TJC A;  2FEZ A;  2X3M A;  2V4L A;  4JHK A;  3UX4 A;  3QNK A;  1P5Q A;  3K9I A;  4AV7 A;  5EDS A;  3FTV A;  3PUK A;  4BTB A;  1XNF A;  3SFZ A;  4XX5 A;  1MQS A;  3FTZ A;  2WXL A;  4A1G A;  3L54 A;  2PM7 A;  4WAF A;  4A55 A;  5JHB A;  2NXP A;  3KD7 A;  3NQP A;  1HF8 A;  3ESK A;  3CQG B;  2XPI A;  2DIW A;  2WM9 A;  4JVS A;  2KAT A;  4BWR A;  4N3C A;  2WXF A;  5LOZ A;  1UG3 A;  4KZ0 A;  4U0U A;  2XCC A;  2IF4 A;  2C0M A;  4A3T A;  4WWP A;  3APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...