4I1BA

Functional implications of interleukin-1beta based on the three-dimensional structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
151
structure length
151
Chain Sequence
VRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional implications of interleukin-1 beta based on the three-dimensional structure.
pubmed doi rcsb
molecule keywords INTERLEUKIN-1 BETA
molecule tags Cytokine
source organism Homo sapiens
total genus 24
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1990-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4i1bA00
4A7KA 3AKIA 3FJAA 5F8YA 4A7ZA 2VXTI 4LO1A 4KC3A 1L2HA 3AKHA 4H9WA 4KEKA 1JQZA 2K4AB 1WBCA 4A7YA 3NBDA 1DLLA 3H6RB 4I8MA 3FJHA 1FV2A 1MC9A 2E4MC 1SR4C 4J23B 1ISVA 2Y9XE 4OEFA 3RMXA 3JUTA 3WINC 2NTDA 3HOMA 4QKRA 1TIEA 3I2AA 1M16A 5F90A 3H6RA 4H04A 1JLXA 3Q7WA 9ILBA 3A07A 4I1EA 3LLPA 5D61A 1XZZA 1HWPB 2X2TA 2DS0A 4J2KA 2J3PA 4KBBA 2AAIB 2MC2A 2F8XC 4X38A 4IHZA 4JQ0A 2YUGA 2F2FC 3RTIB 3A23A 41BIA 1TFMB 3WO2A 4GOYA 3WO3A 3AH4A 1P63A 21BIA 1DZDA 1DJSB 3TC2A 4EB2B 3T8SA 3N7LA 4LO0C 3EF2A 3CQAA 4IQPA 5FNXA 2QN4A 1JT3A 4IZXA 1N4KA 4I1BA 2AFGA 6I1BA 4JRAA 1G82A 2BEAA 4DENA 4X3AA 2IHOA 1AVXB 3IIRA 4GOVA 1II4A 1IOBA 2K8RA 1TP0A 2RG9B 5EG6C 1YTOA 1S0FA 1S0BA 2L5XA 3I2XA 4XFTA 2HZ9A 4I0YA 1HWOB 4I6IA 2MIBA 4ISQA 3QYDA 4QC4A 3CAHA 4LO3C 1FQ9A 1AVAC 1NZKA 3CA3A 5BQUA 3NBEA 3P6IA 1S0DA 1WD4A 2D7IA 5FZYA 3VT0A 1TTUA 1K5UA 1PWAA 4ZGRB 2VLCA 4P0LA 1TWMA 3FGMA 1ISZA 1RY7A 1YBIA 3B9UA 4XFSA 3S8JA 2FO1A 4D0TA 3V0BA 1G9AA 4ZFUB 1BFCA 5G00A 2GZBA 3O4BA 2D7RA 2ZQNA 1M2TB 3IM6A 1EYLA 3UD8A 2ERMA 2D43A 1IILA 3UD9A 4LO2A 4AN6A 4IYBA 4KEJA 1HWMB 3AJ6A 5GAQA 3Q7YA 1SZ6B 4IONA 4OUJA 5DSSB 3BAQA 3OBRA 3ZX7A 3NBCA 4JAWA 3CRIA 1WD3A 3O4AA 2D24A 2NVHA 2BFHA 4P0KA 4EFQA 1JT4A 2FFUA 4AN7B 1V6WA 4J2XA 4J2SA 1J0SA 7I1BA 4IZEA 1HWNB 4HA2A 4QALA 3NJ5A 3RMYA 4EEEB 4G9MA 3ZXDA 1DZCA 2Z48A 3FJFA 4G6JA 3ZC8A 2XOAA 2ZQOA 3POKA 3W9TA 3HALA 1ISWA 4G1RA 4Q91A 3HBWA 1BLDA 2RQ9A 4I4OA 4I4PA 1BA7A 4ZOTA 1G9CA 1QQKA 4USOA 1I1EA 3WMUA 2HW9A 1R8OA 2NZ9A 3A21A 2LIQA 3CRHA 1AFCA 4OW4A 3A22A 3PUBA 4XFUA 1KNMA 1PC8B 4CJMA 5JMCA 4R6UB 1YYNA 1AF9A 4I4XA 3FJIA 2E4MA 2VXRA 1SR4A 4USPA 1AVWB 1BASA 1CVSA 4JKQA 3WINA 1CE7B 1Q04A 1PZZA 3HSMA 4EFRA 3CA4A 3MALA 3AJ5A 1I1BA 4QD2B 3OJMA 4DCKC 2NM1A 2DRZA 1V6XA 4ZBVB 2KH2A 1ISYA 3BRFA 4L4HA 3BB2A 2AQZA 5BVPI 3N0KA 4Z9WB 3FJ8A 1EV2A 3FJEA 4LO7C 2F2FA 4Q9PA 3O4CA 1HIBA 5DUYA 2FFVA 3S8KA 1AXMA 3R4SA 3SNVA 1S0CA 5BXPA 3PMEA 4I7IA 1G9DA 5E24E 2MLLB 4OEGA 4LO0A 3ZXGA 2HWAA 3F1RA 2P39A 5HPZA 4QO3A 4ENDA 3O4DA 4G9NA 8I1BA 4F34A 3VEQA 2RSTA 1FMZA 2KLLA 2UUSA 3V0BB 3UDAA 5BP5C 1TWEA 3BAUA 3FFZA 1FMMS 3BA7A 1FV3A 3BRGC 3WMVA 1DQOA 3OJVA 1FWUA 2Q3NB 3CU1B 4I2SA 1JY0A 3FUOA 4FVVA 4JKXB 1T4QA 4LO3A 4Q9GA 4I4YA 2VSAA 2FDBM 2IWTB 3FJKA 1NUNA 1BFBA 31BIA 3KMVA 3E8LC 1QXMA 1IRPA 4ZFYB 4I4SA 4PC4A 3H6SE 1AVUA 3AKFA 1DFQA 4ISRA 2NYYA 5EC5A 4QKSA 3OGGA 3FJJA 3I29B 1DFCA 5B2HA 5JLVA 3PG0A 3BADA 5I1BA 1T9FA 4ZFWB 1HKNA 3QR5A 5DVHA 1EPWA 4EFPA 3BX1C 3IM5A 4I4UA 2Q9XA 3OJ2A 1BARA 3RSJA 3VWCA 2ZR1B 4HR6C 2VSEA 1V6UA 3WA1A 2D23A 1W3FA 1E0OA 5EHAA 1PUUB 3HMYA 4OEEA 3VSFA 5FNWA 4L4IA 2WBCA 1YF8B 2ET2A 1TOOA 3CRGA 2LIEA 3R4UA 2KI6B 1YXWA 3MPPG 3OBTA 3AKGA 1F31A 3FJCA 1Q03A 3BTAA 1JT5A 2I1BA 3AH1A 1ILR1 3BAVA 1Z2VA 1V6VA 3RTJB 1OQLB 2QYIB 4ZKTB 3O5WB 4OWLA 1IJTA 3O4OA 4IY9A 2K43A 4EKXB 3PHZA 2Z49A 1GGPB 4Z8SB 3O49A 3V0AB 4YOLA 3VT1A 1ABRB 4G6MA 3AH2A 3FUQA 3V0AA 1S0GA 4F83A 4I4RA 4ZA3B 3V79C 2AXMA 3P53A 5BOWA 3CA0A 4J2YA 3NBNA 4D8HA 2VUAA 4P0JA 5FZZA 1XYFA 3VT2A 1JLYA 4QD2C 4I4VA 2GO2A 4GAFA 2P23A 4QBCA 2WRYA 2Y9FA 4D0ZA 1ISXA 1R8NA 1Z4SA 3HN1A 4I96A 3P6JA 2R9KB 4GAIA 3AZWA 1BFGA 1S0EA 4I4QA 4QBVA 3O3QA 4FGFA 4TLPA 1PUMB 4JP0A 4LO7B 4LO8B 4GP0A 4JPZA 1ONKB 1XHBA 1IHKA 2Y9WC 3N7MA 5BQUC 2D20A 4GP3A 1W3GA 3FJBA 1IT0A 2D22A 2BEBA 1HCEA 2DRYA 1S0LA 3IAGC 3FJDA 3LTQA 4WBCA 1K5VA 1A8DA 5D62A 3UD7A 3BA5A 2DREA 4X39A 3UJ0A 4ZLBB 2KI4A 3VUOA 1EVTA 3WO4A 3N7JA 1Q1UA 3AZVA 2VU9A 1WBAA 3JRRA 1W3AA 3UJ4A 1FN0A 1RZOB 4LO2C 4I37A 1MD6A 5BP5A 2M49A 3C9ZA 4X37A 3OGFA 1DIWA 3BAOA 5D63A 3ZC9A 1IRAX 5DZUA 3BAGA 1QQLA 1BFFA 2X2SA 5BXSA 2FGFA 1D0HA 1JT7A 5BXTA 2HWMA 3D7WB 1VCLA 3ILAA 1BLAA 3FJ9A 4XKIA 3N7KA 4OWKA 2NP0A 4DEPA 1FGAA 1JTCA 3BAHA 1DQGA 5FZUA 3H6QA 3IM7A 1ITBA 2Y9GA 4OWJA 1RMLA 4I3NA 2KKIA 3CA1A 4KEIA 3VSZA 1HCDA 1RG8A 1XG6A 3BRDA 4LO1C 3Q7XA 5BXRA 1FWVA 3CA6A 3CA5A 4II0A 4HJJA 5F8WA 1Z0HA 2D44A 1G9BA 5F8SA 1UPSA 3BA4A 3K1XA 4P6AA 2D1ZA 3F62B 3O44A 2ESUA 4IY8A
chains in the Genus database with same CATH superfamily
4A7KA 3AKIA 3FJAA 5F8YA 4A7ZA 2VXTI 4LO1A 4KC3A 1L2HA 3AKHA 4H9WA 4KEKA 1JQZA 2K4AB 1WBCA 4A7YA 3NBDA 1DLLA 3H6RB 4I8MA 3FJHA 1FV2A 1MC9A 2E4MC 1SR4C 4J23B 1ISVA 2Y9XE 4OEFA 3RMXA 3JUTA 3WINC 2NTDA 3HOMA 4QKRA 1TIEA 3I2AA 1M16A 5F90A 3H6RA 4H04A 1JLXA 3Q7WA 9ILBA 3A07A 4I1EA 3LLPA 5D61A 1XZZA 1HWPB 2X2TA 2DS0A 4J2KA 2J3PA 4KBBA 2AAIB 2MC2A 2F8XC 4X38A 4IHZA 4JQ0A 2YUGA 2F2FC 3RTIB 3A23A 41BIA 1TFMB 3WO2A 4GOYA 3WO3A 3AH4A 1P63A 21BIA 1DZDA 1DJSB 3TC2A 4EB2B 3T8SA 3N7LA 4LO0C 3EF2A 3CQAA 4IQPA 5FNXA 4MZHA 2QN4A 1JT3A 4IZXA 1N4KA 4I1BA 2AFGA 6I1BA 4JRAA 1G82A 2BEAA 4DENA 4X3AA 2IHOA 1AVXB 3IIRA 4GOVA 1II4A 1IOBA 2K8RA 1TP0A 2RG9B 5EG6C 1YTOA 1S0FA 1S0BA 2L5XA 3I2XA 4XFTA 2HZ9A 4I0YA 1HWOB 4I6IA 2MIBA 4ISQA 3QYDA 4QC4A 3CAHA 4LO3C 1FQ9A 1AVAC 1NZKA 3CA3A 5BQUA 3NBEA 3P6IA 1S0DA 1WD4A 2D7IA 5FZYA 3VT0A 1TTUA 1K5UA 1PWAA 4ZGRB 2VLCA 4P0LA 1TWMA 3FGMA 1ISZA 1RY7A 1YBIA 3B9UA 4XFSA 3S8JA 2FO1A 4D0TA 3V0BA 1G9AA 4ZFUB 1BFCA 5G00A 2GZBA 3O4BA 2D7RA 2ZQNA 1M2TB 3IM6A 1EYLA 3UD8A 2ERMA 2D43A 1IILA 3UD9A 4LO2A 4AN6A 4IYBA 4KEJA 1HWMB 3AJ6A 5GAQA 3Q7YA 1SZ6B 4IONA 4OUJA 5DSSB 3BAQA 3OBRA 3ZX7A 3NBCA 4JAWA 3CRIA 1WD3A 3O4AA 2D24A 2NVHA 2BFHA 4P0KA 4EFQA 1JT4A 2FFUA 4AN7B 1V6WA 4J2XA 4J2SA 1J0SA 7I1BA 4IZEA 1HWNB 4HA2A 4QALA 3NJ5A 3RMYA 4EEEB 4G9MA 3ZXDA 1DZCA 2Z48A 3FJFA 4G6JA 3ZC8A 2XOAA 2ZQOA 3POKA 3W9TA 3HALA 1ISWA 4G1RA 4Q91A 3HBWA 1BLDA 2RQ9A 4I4OA 4I4PA 1BA7A 4ZOTA 1G9CA 1QQKA 4USOA 1I1EA 3WMUA 2HW9A 1R8OA 2NZ9A 3A21A 2LIQA 3CRHA 1AFCA 4OW4A 3A22A 3PUBA 4XFUA 1KNMA 1PC8B 4CJMA 5JMCA 4R6UB 1YYNA 1AF9A 4I4XA 3FJIA 2E4MA 2VXRA 1SR4A 4USPA 1AVWB 1BASA 1CVSA 4JKQA 4MZGB 3WINA 1CE7B 1Q04A 1PZZA 3HSMA 4EFRA 3CA4A 3MALA 2NS2A 3AJ5A 1I1BA 4QD2B 3OJMA 4DCKC 2NM1A 2DRZA 1V6XA 4ZBVB 2KH2A 1ISYA 3BRFA 4L4HA 3BB2A 2AQZA 5BVPI 3N0KA 4Z9WB 3FJ8A 1EV2A 3FJEA 4LO7C 2F2FA 4Q9PA 3O4CA 1HIBA 5DUYA 2FFVA 3S8KA 1AXMA 3R4SA 3SNVA 1S0CA 5BXPA 3PMEA 4I7IA 1G9DA 5E24E 2MLLB 4OEGA 4LO0A 3ZXGA 2HWAA 3F1RA 2P39A 5HPZA 4QO3A 4ENDA 3O4DA 4G9NA 8I1BA 4F34A 3VEQA 2RSTA 1FMZA 2KLLA 2UUSA 3V0BB 3UDAA 5BP5C 1TWEA 3BAUA 3FFZA 1FMMS 3BA7A 1FV3A 3BRGC 3WMVA 1DQOA 3OJVA 1FWUA 2Q3NB 3CU1B 4I2SA 1JY0A 3FUOA 4FVVA 4JKXB 1T4QA 4LO3A 4Q9GA 4I4YA 2VSAA 4UY4A 2FDBM 2IWTB 3FJKA 1NUNA 1BFBA 31BIA 3KMVA 3E8LC 1QXMA 1IRPA 4ZFYB 4I4SA 4PC4A 3H6SE 1AVUA 3AKFA 1DFQA 4ISRA 2NYYA 5EC5A 4QKSA 3OGGA 3FJJA 3I29B 1DFCA 5B2HA 5JLVA 3PG0A 3BADA 5I1BA 1T9FA 4ZFWB 1HKNA 3QR5A 5DVHA 1EPWA 4EFPA 3BX1C 3IM5A 4I4UA 2Q9XA 3OJ2A 1BARA 3RSJA 3VWCA 2ZR1B 4HR6C 2VSEA 1V6UA 3WA1A 2D23A 1W3FA 1E0OA 5EHAA 1PUUB 3HMYA 4OEEA 3VSFA 5FNWA 4L4IA 2WBCA 1YF8B 2ET2A 1TOOA 3CRGA 2LIEA 3R4UA 2KI6B 1YXWA 3MPPG 3OBTA 3AKGA 1F31A 3FJCA 1Q03A 3BTAA 1JT5A 2I1BA 3AH1A 1ILR1 3BAVA 1Z2VA 1V6VA 3RTJB 1OQLB 2QYIB 4ZKTB 3O5WB 4OWLA 1IJTA 3O4OA 4IY9A 2K43A 4EKXB 3PHZA 2Z49A 1GGPB 4Z8SB 3O49A 3V0AB 4YOLA 3VT1A 1ABRB 4G6MA 3AH2A 3FUQA 3V0AA 1S0GA 4F83A 4I4RA 4ZA3B 3V79C 2AXMA 3P53A 5BOWA 3CA0A 4J2YA 3NBNA 4MZFB 4D8HA 2VUAA 4P0JA 5FZZA 1XYFA 3VT2A 1JLYA 4QD2C 4I4VA 2GO2A 4GAFA 2P23A 4QBCA 2WRYA 2Y9FA 4D0ZA 1ISXA 1R8NA 1Z4SA 3HN1A 4I96A 3P6JA 2R9KB 4GAIA 3AZWA 1BFGA 1S0EA 4I4QA 4QBVA 3O3QA 4FGFA 4TLPA 1PUMB 4JP0A 4LO7B 4LO8B 4GP0A 4JPZA 1ONKB 1XHBA 1IHKA 2Y9WC 3N7MA 5BQUC 2D20A 4GP3A 1W3GA 3FJBA 1IT0A 2D22A 2BEBA 1HCEA 2DRYA 1S0LA 3IAGC 3FJDA 3LTQA 4WBCA 1K5VA 1A8DA 5D62A 3UD7A 3BA5A 2DREA 4X39A 3UJ0A 4ZLBB 2KI4A 3VUOA 1EVTA 3WO4A 3N7JA 1Q1UA 3AZVA 2VU9A 1WBAA 3JRRA 1W3AA 3UJ4A 1FN0A 1RZOB 4LO2C 4I37A 1MD6A 5BP5A 2M49A 3C9ZA 4X37A 3OGFA 1DIWA 3BAOA 5D63A 3ZC9A 1IRAX 5DZUA 3BAGA 1QQLA 1BFFA 2X2SA 5BXSA 2FGFA 1D0HA 1JT7A 4H75A 5BXTA 2HWMA 3D7WB 1VCLA 3ILAA 1BLAA 3FJ9A 4XKIA 3N7KA 4OWKA 2NP0A 4DEPA 1FGAA 1JTCA 3BAHA 1DQGA 5FZUA 3H6QA 3IM7A 1ITBA 2Y9GA 4OWJA 1RMLA 4I3NA 2KKIA 3CA1A 4KEIA 3VSZA 1HCDA 1RG8A 1XG6A 3BRDA 4LO1C 3Q7XA 5BXRA 1FWVA 3CA6A 3CA5A 4II0A 4HJJA 5F8WA 1Z0HA 2D44A 1G9BA 5F8SA 1UPSA 3BA4A 3K1XA 4P6AA 2D1ZA 3F62B 3O44A 2ESUA 4IY8A
chains in the Genus database with same CATH topology
4A7KA 3AKIA 3FJAA 5F8YA 4A7ZA 2VXTI 4LO1A 4KC3A 1L2HA 3AKHA 4H9WA 4KEKA 1JQZA 2K4AB 1WBCA 4A7YA 3NBDA 1DLLA 3H6RB 4I8MA 3FJHA 1FV2A 1MC9A 2E4MC 1SR4C 4J23B 1ISVA 2Y9XE 4OEFA 3RMXA 3JUTA 3WINC 2NTDA 3HOMA 4QKRA 1TIEA 3I2AA 1M16A 5F90A 3H6RA 4H04A 1JLXA 3Q7WA 9ILBA 3A07A 4I1EA 3LLPA 5D61A 1XZZA 1HWPB 2X2TA 2DS0A 4J2KA 2J3PA 4KBBA 2AAIB 2MC2A 2F8XC 4X38A 4IHZA 4JQ0A 2YUGA 2F2FC 3RTIB 3A23A 41BIA 1TFMB 3WO2A 4GOYA 3WO3A 3AH4A 1P63A 21BIA 1DZDA 1DJSB 3TC2A 4EB2B 3T8SA 3N7LA 4LO0C 3EF2A 3CQAA 4IQPA 5FNXA 4MZHA 2QN4A 1JT3A 4IZXA 1N4KA 4I1BA 2AFGA 6I1BA 4JRAA 1G82A 2BEAA 4DENA 4X3AA 2IHOA 1AVXB 3IIRA 4GOVA 1II4A 1IOBA 2K8RA 1TP0A 2RG9B 5EG6C 1YTOA 1S0FA 1S0BA 2L5XA 3I2XA 4XFTA 2HZ9A 4I0YA 1HWOB 4I6IA 2MIBA 4ISQA 3QYDA 4QC4A 3CAHA 4LO3C 1FQ9A 1AVAC 1NZKA 3CA3A 5BQUA 3NBEA 3P6IA 1S0DA 1WD4A 2D7IA 5FZYA 3VT0A 1TTUA 1K5UA 1PWAA 4ZGRB 2VLCA 4P0LA 1TWMA 3FGMA 1ISZA 1RY7A 1YBIA 3B9UA 4XFSA 3S8JA 2FO1A 4D0TA 3V0BA 1G9AA 4ZFUB 1BFCA 5G00A 2GZBA 3O4BA 2D7RA 2ZQNA 1M2TB 3IM6A 1EYLA 3UD8A 2ERMA 2D43A 1IILA 3UD9A 4LO2A 4AN6A 4IYBA 4KEJA 1HWMB 3AJ6A 5GAQA 3Q7YA 1SZ6B 4IONA 4OUJA 5DSSB 3BAQA 3OBRA 3ZX7A 3NBCA 4JAWA 3CRIA 1WD3A 3O4AA 2D24A 2NVHA 2BFHA 4P0KA 4EFQA 1JT4A 2FFUA 4AN7B 1V6WA 4J2XA 4J2SA 1J0SA 7I1BA 4IZEA 1HWNB 4HA2A 4QALA 3NJ5A 3RMYA 4EEEB 4G9MA 3ZXDA 1DZCA 2Z48A 3FJFA 4G6JA 3ZC8A 2XOAA 2ZQOA 3POKA 3W9TA 3HALA 1ISWA 4G1RA 4Q91A 3HBWA 1BLDA 2RQ9A 4I4OA 4I4PA 1BA7A 4ZOTA 1G9CA 1QQKA 4USOA 1I1EA 3WMUA 2HW9A 1R8OA 2NZ9A 3A21A 2LIQA 3CRHA 1AFCA 4OW4A 3A22A 3PUBA 4XFUA 1KNMA 1PC8B 4CJMA 5JMCA 4R6UB 1YYNA 1AF9A 4I4XA 3FJIA 2E4MA 2VXRA 1SR4A 4USPA 1AVWB 1BASA 1CVSA 4JKQA 4MZGB 3WINA 1CE7B 1Q04A 1PZZA 3HSMA 4EFRA 3CA4A 3MALA 2NS2A 3AJ5A 1I1BA 4QD2B 3OJMA 4DCKC 2NM1A 2DRZA 1V6XA 4ZBVB 2KH2A 1ISYA 3BRFA 4L4HA 3BB2A 2AQZA 5BVPI 3N0KA 4Z9WB 3FJ8A 1EV2A 3FJEA 4LO7C 2F2FA 4Q9PA 3O4CA 1HIBA 5DUYA 2FFVA 3S8KA 1AXMA 3R4SA 3SNVA 1S0CA 5BXPA 3PMEA 4I7IA 1G9DA 5E24E 2MLLB 4OEGA 4LO0A 3ZXGA 2HWAA 3F1RA 2P39A 5HPZA 4QO3A 4ENDA 3O4DA 4G9NA 8I1BA 4F34A 3VEQA 2RSTA 1FMZA 2KLLA 2UUSA 3V0BB 3UDAA 5BP5C 1TWEA 3BAUA 3FFZA 1FMMS 3BA7A 1FV3A 3BRGC 3WMVA 1DQOA 3OJVA 1FWUA 2Q3NB 3CU1B 4I2SA 1JY0A 3FUOA 4FVVA 4JKXB 1T4QA 4LO3A 4Q9GA 4I4YA 2VSAA 4UY4A 2FDBM 2IWTB 3FJKA 1NUNA 1BFBA 31BIA 3KMVA 3E8LC 1QXMA 1IRPA 4ZFYB 4I4SA 4PC4A 3H6SE 1AVUA 3AKFA 1DFQA 4ISRA 2NYYA 5EC5A 4QKSA 3OGGA 3FJJA 3I29B 1DFCA 5B2HA 5JLVA 3PG0A 3BADA 5I1BA 1T9FA 4ZFWB 1HKNA 3QR5A 5DVHA 1EPWA 4EFPA 3BX1C 3IM5A 4I4UA 2Q9XA 3OJ2A 1BARA 3RSJA 3VWCA 2ZR1B 4HR6C 2VSEA 1V6UA 3WA1A 2D23A 1W3FA 1E0OA 5EHAA 1PUUB 3HMYA 4OEEA 3VSFA 5FNWA 4L4IA 2WBCA 1YF8B 2ET2A 1TOOA 3CRGA 2LIEA 3R4UA 2KI6B 1YXWA 3MPPG 3OBTA 3AKGA 1F31A 3FJCA 1Q03A 3BTAA 1JT5A 2I1BA 3AH1A 1ILR1 3BAVA 1Z2VA 1V6VA 3RTJB 1OQLB 2QYIB 4ZKTB 3O5WB 4OWLA 1IJTA 3O4OA 4IY9A 2K43A 4EKXB 3PHZA 2Z49A 1GGPB 4Z8SB 3O49A 3V0AB 4YOLA 3VT1A 1ABRB 4G6MA 3AH2A 3FUQA 3V0AA 1S0GA 4F83A 4I4RA 4ZA3B 3V79C 2AXMA 3P53A 5BOWA 3CA0A 4J2YA 3NBNA 4MZFB 4D8HA 2VUAA 4P0JA 5FZZA 1XYFA 3VT2A 1JLYA 4QD2C 4I4VA 2GO2A 4GAFA 2P23A 4QBCA 2WRYA 2Y9FA 4D0ZA 1ISXA 1R8NA 1Z4SA 3HN1A 4I96A 3P6JA 2R9KB 4GAIA 3AZWA 1BFGA 1S0EA 4I4QA 4QBVA 3O3QA 4FGFA 4TLPA 1PUMB 4JP0A 4LO7B 4LO8B 4GP0A 4JPZA 1ONKB 1XHBA 1IHKA 2Y9WC 3N7MA 5BQUC 2D20A 4GP3A 1W3GA 3FJBA 1IT0A 2D22A 2BEBA 1HCEA 2DRYA 1S0LA 3IAGC 3FJDA 3LTQA 4WBCA 1K5VA 1A8DA 5D62A 3UD7A 3BA5A 2DREA 4X39A 3UJ0A 4ZLBB 2KI4A 3VUOA 1EVTA 3WO4A 3N7JA 1Q1UA 3AZVA 2VU9A 1WBAA 3JRRA 1W3AA 3UJ4A 1FN0A 1RZOB 4LO2C 4I37A 1MD6A 5BP5A 2M49A 3C9ZA 4X37A 3OGFA 1DIWA 3BAOA 5D63A 3ZC9A 1IRAX 5DZUA 3BAGA 1QQLA 1BFFA 2X2SA 5BXSA 2FGFA 1D0HA 1JT7A 4H75A 5BXTA 2HWMA 3D7WB 1VCLA 3ILAA 1BLAA 3FJ9A 4XKIA 3N7KA 4OWKA 2NP0A 4DEPA 1FGAA 1JTCA 3BAHA 1DQGA 5FZUA 3H6QA 3IM7A 1ITBA 2Y9GA 4OWJA 1RMLA 4I3NA 2KKIA 3CA1A 4KEIA 3VSZA 1HCDA 1RG8A 1XG6A 3BRDA 4LO1C 3Q7XA 5BXRA 1FWVA 3CA6A 3CA5A 4II0A 4HJJA 5F8WA 1Z0HA 2D44A 1G9BA 5F8SA 1UPSA 3BA4A 3K1XA 4P6AA 2D1ZA 3F62B 3O44A 2ESUA 4IY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A7K A;  3AKI A;  3FJA A;  5F8Y A;  4A7Z A;  2VXT I;  4LO1 A;  4KC3 A;  1L2H A;  3AKH A;  4H9W A;  4KEK A;  1JQZ A;  2K4A B;  1WBC A;  4A7Y A;  3NBD A;  1DLL A;  3H6R B;  4I8M A;  3FJH A;  1FV2 A;  1MC9 A;  2E4M C;  1SR4 C;  4J23 B;  1ISV A;  2Y9X E;  4OEF A;  3RMX A;  3JUT A;  3WIN C;  2NTD A;  3HOM A;  4QKR A;  1TIE A;  3I2A A;  1M16 A;  5F90 A;  3H6R A;  4H04 A;  1JLX A;  3Q7W A;  9ILB A;  3A07 A;  4I1E A;  3LLP A;  5D61 A;  1XZZ A;  1HWP B;  2X2T A;  2DS0 A;  4J2K A;  2J3P A;  4KBB A;  2AAI B;  2MC2 A;  2F8X C;  4X38 A;  4IHZ A;  4JQ0 A;  2YUG A;  2F2F C;  3RTI B;  3A23 A;  41BI A;  1TFM B;  3WO2 A;  4GOY A;  3WO3 A;  3AH4 A;  1P63 A;  21BI A;  1DZD A;  1DJS B;  3TC2 A;  4EB2 B;  3T8S A;  3N7L A;  4LO0 C;  3EF2 A;  3CQA A;  4IQP A;  5FNX A;  2QN4 A;  1JT3 A;  4IZX A;  1N4K A;  4I1B A;  2AFG A;  6I1B A;  4JRA A;  1G82 A;  2BEA A;  4DEN A;  4X3A A;  2IHO A;  1AVX B;  3IIR A;  4GOV A;  1II4 A;  1IOB A;  2K8R A;  1TP0 A;  2RG9 B;  5EG6 C;  1YTO A;  1S0F A;  1S0B A;  2L5X A;  3I2X A;  4XFT A;  2HZ9 A;  4I0Y A;  1HWO B;  4I6I A;  2MIB A;  4ISQ A;  3QYD A;  4QC4 A;  3CAH A;  4LO3 C;  1FQ9 A;  1AVA C;  1NZK A;  3CA3 A;  5BQU A;  3NBE A;  3P6I A;  1S0D A;  1WD4 A;  2D7I A;  5FZY A;  3VT0 A;  1TTU A;  1K5U A;  1PWA A;  4ZGR B;  2VLC A;  4P0L A;  1TWM A;  3FGM A;  1ISZ A;  1RY7 A;  1YBI A;  3B9U A;  4XFS A;  3S8J A;  2FO1 A;  4D0T A;  3V0B A;  1G9A A;  4ZFU B;  1BFC A;  5G00 A;  2GZB A;  3O4B A;  2D7R A;  2ZQN A;  1M2T B;  3IM6 A;  1EYL A;  3UD8 A;  2ERM A;  2D43 A;  1IIL A;  3UD9 A;  4LO2 A;  4AN6 A;  4IYB A;  4KEJ A;  1HWM B;  3AJ6 A;  5GAQ A;  3Q7Y A;  1SZ6 B;  4ION A;  4OUJ A;  5DSS B;  3BAQ A;  3OBR A;  3ZX7 A;  3NBC A;  4JAW A;  3CRI A;  1WD3 A;  3O4A A;  2D24 A;  2NVH A;  2BFH A;  4P0K A;  4EFQ A;  1JT4 A;  2FFU A;  4AN7 B;  1V6W A;  4J2X A;  4J2S A;  1J0S A;  7I1B A;  4IZE A;  1HWN B;  4HA2 A;  4QAL A;  3NJ5 A;  3RMY A;  4EEE B;  4G9M A;  3ZXD A;  1DZC A;  2Z48 A;  3FJF A;  4G6J A;  3ZC8 A;  2XOA A;  2ZQO A;  3POK A;  3W9T A;  3HAL A;  1ISW A;  4G1R A;  4Q91 A;  3HBW A;  1BLD A;  2RQ9 A;  4I4O A;  4I4P A;  1BA7 A;  4ZOT A;  1G9C A;  1QQK A;  4USO A;  1I1E A;  3WMU A;  2HW9 A;  1R8O A;  2NZ9 A;  3A21 A;  2LIQ A;  3CRH A;  1AFC A;  4OW4 A;  3A22 A;  3PUB A;  4XFU A;  1KNM A;  1PC8 B;  4CJM A;  5JMC A;  4R6U B;  1YYN A;  1AF9 A;  4I4X A;  3FJI A;  2E4M A;  2VXR A;  1SR4 A;  4USP A;  1AVW B;  1BAS A;  1CVS A;  4JKQ A;  3WIN A;  1CE7 B;  1Q04 A;  1PZZ A;  3HSM A;  4EFR A;  3CA4 A;  3MAL A;  3AJ5 A;  1I1B A;  4QD2 B;  3OJM A;  4DCK C;  2NM1 A;  2DRZ A;  1V6X A;  4ZBV B;  2KH2 A;  1ISY A;  3BRF A;  4L4H A;  3BB2 A;  2AQZ A;  5BVP I;  3N0K A;  4Z9W B;  3FJ8 A;  1EV2 A;  3FJE A;  4LO7 C;  2F2F A;  4Q9P A;  3O4C A;  1HIB A;  5DUY A;  2FFV A;  3S8K A;  1AXM A;  3R4S A;  3SNV A;  1S0C A;  5BXP A;  3PME A;  4I7I A;  1G9D A;  5E24 E;  2MLL B;  4OEG A;  4LO0 A;  3ZXG A;  2HWA A;  3F1R A;  2P39 A;  5HPZ A;  4QO3 A;  4END A;  3O4D A;  4G9N A;  8I1B A;  4F34 A;  3VEQ A;  2RST A;  1FMZ A;  2KLL A;  2UUS A;  3V0B B;  3UDA A;  5BP5 C;  1TWE A;  3BAU A;  3FFZ A;  1FMM S;  3BA7 A;  1FV3 A;  3BRG C;  3WMV A;  1DQO A;  3OJV A;  1FWU A;  2Q3N B;  3CU1 B;  4I2S A;  1JY0 A;  3FUO A;  4FVV A;  4JKX B;  1T4Q A;  4LO3 A;  4Q9G A;  4I4Y A;  2VSA A;  2FDB M;  2IWT B;  3FJK A;  1NUN A;  1BFB A;  31BI A;  3KMV A;  3E8L C;  1QXM A;  1IRP A;  4ZFY B;  4I4S A;  4PC4 A;  3H6S E;  1AVU A;  3AKF A;  1DFQ A;  4ISR A;  2NYY A;  5EC5 A;  4QKS A;  3OGG A;  3FJJ A;  3I29 B;  1DFC A;  5B2H A;  5JLV A;  3PG0 A;  3BAD A;  5I1B A;  1T9F A;  4ZFW B;  1HKN A;  3QR5 A;  5DVH A;  1EPW A;  4EFP A;  3BX1 C;  3IM5 A;  4I4U A;  2Q9X A;  3OJ2 A;  1BAR A;  3RSJ A;  3VWC A;  2ZR1 B;  4HR6 C;  2VSE A;  1V6U A;  3WA1 A;  2D23 A;  1W3F A;  1E0O A;  5EHA A;  1PUU B;  3HMY A;  4OEE A;  3VSF A;  5FNW A;  4L4I A;  2WBC A;  1YF8 B;  2ET2 A;  1TOO A;  3CRG A;  2LIE A;  3R4U A;  2KI6 B;  1YXW A;  3MPP G;  3OBT A;  3AKG A;  1F31 A;  3FJC A;  1Q03 A;  3BTA A;  1JT5 A;  2I1B A;  3AH1 A;  1ILR 1;  3BAV A;  1Z2V A;  1V6V A;  3RTJ B;  1OQL B;  2QYI B;  4ZKT B;  3O5W B;  4OWL A;  1IJT A;  3O4O A;  4IY9 A;  2K43 A;  4EKX B;  3PHZ A;  2Z49 A;  1GGP B;  4Z8S B;  3O49 A;  3V0A B;  4YOL A;  3VT1 A;  1ABR B;  4G6M A;  3AH2 A;  3FUQ A;  3V0A A;  1S0G A;  4F83 A;  4I4R A;  4ZA3 B;  3V79 C;  2AXM A;  3P53 A;  5BOW A;  3CA0 A;  4J2Y A;  3NBN A;  4D8H A;  2VUA A;  4P0J A;  5FZZ A;  1XYF A;  3VT2 A;  1JLY A;  4QD2 C;  4I4V A;  2GO2 A;  4GAF A;  2P23 A;  4QBC A;  2WRY A;  2Y9F A;  4D0Z A;  1ISX A;  1R8N A;  1Z4S A;  3HN1 A;  4I96 A;  3P6J A;  2R9K B;  4GAI A;  3AZW A;  1BFG A;  1S0E A;  4I4Q A;  4QBV A;  3O3Q A;  4FGF A;  4TLP A;  1PUM B;  4JP0 A;  4LO7 B;  4LO8 B;  4GP0 A;  4JPZ A;  1ONK B;  1XHB A;  1IHK A;  2Y9W C;  3N7M A;  5BQU C;  2D20 A;  4GP3 A;  1W3G A;  3FJB A;  1IT0 A;  2D22 A;  2BEB A;  1HCE A;  2DRY A;  1S0L A;  3IAG C;  3FJD A;  3LTQ A;  4WBC A;  1K5V A;  1A8D A;  5D62 A;  3UD7 A;  3BA5 A;  2DRE A;  4X39 A;  3UJ0 A;  4ZLB B;  2KI4 A;  3VUO A;  1EVT A;  3WO4 A;  3N7J A;  1Q1U A;  3AZV A;  2VU9 A;  1WBA A;  3JRR A;  1W3A A;  3UJ4 A;  1FN0 A;  1RZO B;  4LO2 C;  4I37 A;  1MD6 A;  5BP5 A;  2M49 A;  3C9Z A;  4X37 A;  3OGF A;  1DIW A;  3BAO A;  5D63 A;  3ZC9 A;  1IRA X;  5DZU A;  3BAG A;  1QQL A;  1BFF A;  2X2S A;  5BXS A;  2FGF A;  1D0H A;  1JT7 A;  5BXT A;  2HWM A;  3D7W B;  1VCL A;  3ILA A;  1BLA A;  3FJ9 A;  4XKI A;  3N7K A;  4OWK A;  2NP0 A;  4DEP A;  1FGA A;  1JTC A;  3BAH A;  1DQG A;  5FZU A;  3H6Q A;  3IM7 A;  1ITB A;  2Y9G A;  4OWJ A;  1RML A;  4I3N A;  2KKI A;  3CA1 A;  4KEI A;  3VSZ A;  1HCD A;  1RG8 A;  1XG6 A;  3BRD A;  4LO1 C;  3Q7X A;  5BXR A;  1FWV A;  3CA6 A;  3CA5 A;  4II0 A;  4HJJ A;  5F8W A;  1Z0H A;  2D44 A;  1G9B A;  5F8S A;  1UPS A;  3BA4 A;  3K1X A;  4P6A A;  2D1Z A;  3F62 B;  3O44 A;  2ESU A;  4IY8 A; 
#chains in the Genus database with same CATH topology
 4A7K A;  3AKI A;  3FJA A;  5F8Y A;  4A7Z A;  2VXT I;  4LO1 A;  4KC3 A;  1L2H A;  3AKH A;  4H9W A;  4KEK A;  1JQZ A;  2K4A B;  1WBC A;  4A7Y A;  3NBD A;  1DLL A;  3H6R B;  4I8M A;  3FJH A;  1FV2 A;  1MC9 A;  2E4M C;  1SR4 C;  4J23 B;  1ISV A;  2Y9X E;  4OEF A;  3RMX A;  3JUT A;  3WIN C;  2NTD A;  3HOM A;  4QKR A;  1TIE A;  3I2A A;  1M16 A;  5F90 A;  3H6R A;  4H04 A;  1JLX A;  3Q7W A;  9ILB A;  3A07 A;  4I1E A;  3LLP A;  5D61 A;  1XZZ A;  1HWP B;  2X2T A;  2DS0 A;  4J2K A;  2J3P A;  4KBB A;  2AAI B;  2MC2 A;  2F8X C;  4X38 A;  4IHZ A;  4JQ0 A;  2YUG A;  2F2F C;  3RTI B;  3A23 A;  41BI A;  1TFM B;  3WO2 A;  4GOY A;  3WO3 A;  3AH4 A;  1P63 A;  21BI A;  1DZD A;  1DJS B;  3TC2 A;  4EB2 B;  3T8S A;  3N7L A;  4LO0 C;  3EF2 A;  3CQA A;  4IQP A;  5FNX A;  4MZH A;  2QN4 A;  1JT3 A;  4IZX A;  1N4K A;  4I1B A;  2AFG A;  6I1B A;  4JRA A;  1G82 A;  2BEA A;  4DEN A;  4X3A A;  2IHO A;  1AVX B;  3IIR A;  4GOV A;  1II4 A;  1IOB A;  2K8R A;  1TP0 A;  2RG9 B;  5EG6 C;  1YTO A;  1S0F A;  1S0B A;  2L5X A;  3I2X A;  4XFT A;  2HZ9 A;  4I0Y A;  1HWO B;  4I6I A;  2MIB A;  4ISQ A;  3QYD A;  4QC4 A;  3CAH A;  4LO3 C;  1FQ9 A;  1AVA C;  1NZK A;  3CA3 A;  5BQU A;  3NBE A;  3P6I A;  1S0D A;  1WD4 A;  2D7I A;  5FZY A;  3VT0 A;  1TTU A;  1K5U A;  1PWA A;  4ZGR B;  2VLC A;  4P0L A;  1TWM A;  3FGM A;  1ISZ A;  1RY7 A;  1YBI A;  3B9U A;  4XFS A;  3S8J A;  2FO1 A;  4D0T A;  3V0B A;  1G9A A;  4ZFU B;  1BFC A;  5G00 A;  2GZB A;  3O4B A;  2D7R A;  2ZQN A;  1M2T B;  3IM6 A;  1EYL A;  3UD8 A;  2ERM A;  2D43 A;  1IIL A;  3UD9 A;  4LO2 A;  4AN6 A;  4IYB A;  4KEJ A;  1HWM B;  3AJ6 A;  5GAQ A;  3Q7Y A;  1SZ6 B;  4ION A;  4OUJ A;  5DSS B;  3BAQ A;  3OBR A;  3ZX7 A;  3NBC A;  4JAW A;  3CRI A;  1WD3 A;  3O4A A;  2D24 A;  2NVH A;  2BFH A;  4P0K A;  4EFQ A;  1JT4 A;  2FFU A;  4AN7 B;  1V6W A;  4J2X A;  4J2S A;  1J0S A;  7I1B A;  4IZE A;  1HWN B;  4HA2 A;  4QAL A;  3NJ5 A;  3RMY A;  4EEE B;  4G9M A;  3ZXD A;  1DZC A;  2Z48 A;  3FJF A;  4G6J A;  3ZC8 A;  2XOA A;  2ZQO A;  3POK A;  3W9T A;  3HAL A;  1ISW A;  4G1R A;  4Q91 A;  3HBW A;  1BLD A;  2RQ9 A;  4I4O A;  4I4P A;  1BA7 A;  4ZOT A;  1G9C A;  1QQK A;  4USO A;  1I1E A;  3WMU A;  2HW9 A;  1R8O A;  2NZ9 A;  3A21 A;  2LIQ A;  3CRH A;  1AFC A;  4OW4 A;  3A22 A;  3PUB A;  4XFU A;  1KNM A;  1PC8 B;  4CJM A;  5JMC A;  4R6U B;  1YYN A;  1AF9 A;  4I4X A;  3FJI A;  2E4M A;  2VXR A;  1SR4 A;  4USP A;  1AVW B;  1BAS A;  1CVS A;  4JKQ A;  4MZG B;  3WIN A;  1CE7 B;  1Q04 A;  1PZZ A;  3HSM A;  4EFR A;  3CA4 A;  3MAL A;  2NS2 A;  3AJ5 A;  1I1B A;  4QD2 B;  3OJM A;  4DCK C;  2NM1 A;  2DRZ A;  1V6X A;  4ZBV B;  2KH2 A;  1ISY A;  3BRF A;  4L4H A;  3BB2 A;  2AQZ A;  5BVP I;  3N0K A;  4Z9W B;  3FJ8 A;  1EV2 A;  3FJE A;  4LO7 C;  2F2F A;  4Q9P A;  3O4C A;  1HIB A;  5DUY A;  2FFV A;  3S8K A;  1AXM A;  3R4S A;  3SNV A;  1S0C A;  5BXP A;  3PME A;  4I7I A;  1G9D A;  5E24 E;  2MLL B;  4OEG A;  4LO0 A;  3ZXG A;  2HWA A;  3F1R A;  2P39 A;  5HPZ A;  4QO3 A;  4END A;  3O4D A;  4G9N A;  8I1B A;  4F34 A;  3VEQ A;  2RST A;  1FMZ A;  2KLL A;  2UUS A;  3V0B B;  3UDA A;  5BP5 C;  1TWE A;  3BAU A;  3FFZ A;  1FMM S;  3BA7 A;  1FV3 A;  3BRG C;  3WMV A;  1DQO A;  3OJV A;  1FWU A;  2Q3N B;  3CU1 B;  4I2S A;  1JY0 A;  3FUO A;  4FVV A;  4JKX B;  1T4Q A;  4LO3 A;  4Q9G A;  4I4Y A;  2VSA A;  4UY4 A;  2FDB M;  2IWT B;  3FJK A;  1NUN A;  1BFB A;  31BI A;  3KMV A;  3E8L C;  1QXM A;  1IRP A;  4ZFY B;  4I4S A;  4PC4 A;  3H6S E;  1AVU A;  3AKF A;  1DFQ A;  4ISR A;  2NYY A;  5EC5 A;  4QKS A;  3OGG A;  3FJJ A;  3I29 B;  1DFC A;  5B2H A;  5JLV A;  3PG0 A;  3BAD A;  5I1B A;  1T9F A;  4ZFW B;  1HKN A;  3QR5 A;  5DVH A;  1EPW A;  4EFP A;  3BX1 C;  3IM5 A;  4I4U A;  2Q9X A;  3OJ2 A;  1BAR A;  3RSJ A;  3VWC A;  2ZR1 B;  4HR6 C;  2VSE A;  1V6U A;  3WA1 A;  2D23 A;  1W3F A;  1E0O A;  5EHA A;  1PUU B;  3HMY A;  4OEE A;  3VSF A;  5FNW A;  4L4I A;  2WBC A;  1YF8 B;  2ET2 A;  1TOO A;  3CRG A;  2LIE A;  3R4U A;  2KI6 B;  1YXW A;  3MPP G;  3OBT A;  3AKG A;  1F31 A;  3FJC A;  1Q03 A;  3BTA A;  1JT5 A;  2I1B A;  3AH1 A;  1ILR 1;  3BAV A;  1Z2V A;  1V6V A;  3RTJ B;  1OQL B;  2QYI B;  4ZKT B;  3O5W B;  4OWL A;  1IJT A;  3O4O A;  4IY9 A;  2K43 A;  4EKX B;  3PHZ A;  2Z49 A;  1GGP B;  4Z8S B;  3O49 A;  3V0A B;  4YOL A;  3VT1 A;  1ABR B;  4G6M A;  3AH2 A;  3FUQ A;  3V0A A;  1S0G A;  4F83 A;  4I4R A;  4ZA3 B;  3V79 C;  2AXM A;  3P53 A;  5BOW A;  3CA0 A;  4J2Y A;  3NBN A;  4MZF B;  4D8H A;  2VUA A;  4P0J A;  5FZZ A;  1XYF A;  3VT2 A;  1JLY A;  4QD2 C;  4I4V A;  2GO2 A;  4GAF A;  2P23 A;  4QBC A;  2WRY A;  2Y9F A;  4D0Z A;  1ISX A;  1R8N A;  1Z4S A;  3HN1 A;  4I96 A;  3P6J A;  2R9K B;  4GAI A;  3AZW A;  1BFG A;  1S0E A;  4I4Q A;  4QBV A;  3O3Q A;  4FGF A;  4TLP A;  1PUM B;  4JP0 A;  4LO7 B;  4LO8 B;  4GP0 A;  4JPZ A;  1ONK B;  1XHB A;  1IHK A;  2Y9W C;  3N7M A;  5BQU C;  2D20 A;  4GP3 A;  1W3G A;  3FJB A;  1IT0 A;  2D22 A;  2BEB A;  1HCE A;  2DRY A;  1S0L A;  3IAG C;  3FJD A;  3LTQ A;  4WBC A;  1K5V A;  1A8D A;  5D62 A;  3UD7 A;  3BA5 A;  2DRE A;  4X39 A;  3UJ0 A;  4ZLB B;  2KI4 A;  3VUO A;  1EVT A;  3WO4 A;  3N7J A;  1Q1U A;  3AZV A;  2VU9 A;  1WBA A;  3JRR A;  1W3A A;  3UJ4 A;  1FN0 A;  1RZO B;  4LO2 C;  4I37 A;  1MD6 A;  5BP5 A;  2M49 A;  3C9Z A;  4X37 A;  3OGF A;  1DIW A;  3BAO A;  5D63 A;  3ZC9 A;  1IRA X;  5DZU A;  3BAG A;  1QQL A;  1BFF A;  2X2S A;  5BXS A;  2FGF A;  1D0H A;  1JT7 A;  4H75 A;  5BXT A;  2HWM A;  3D7W B;  1VCL A;  3ILA A;  1BLA A;  3FJ9 A;  4XKI A;  3N7K A;  4OWK A;  2NP0 A;  4DEP A;  1FGA A;  1JTC A;  3BAH A;  1DQG A;  5FZU A;  3H6Q A;  3IM7 A;  1ITB A;  2Y9G A;  4OWJ A;  1RML A;  4I3N A;  2KKI A;  3CA1 A;  4KEI A;  3VSZ A;  1HCD A;  1RG8 A;  1XG6 A;  3BRD A;  4LO1 C;  3Q7X A;  5BXR A;  1FWV A;  3CA6 A;  3CA5 A;  4II0 A;  4HJJ A;  5F8W A;  1Z0H A;  2D44 A;  1G9B A;  5F8S A;  1UPS A;  3BA4 A;  3K1X A;  4P6A A;  2D1Z A;  3F62 B;  3O44 A;  2ESU A;  4IY8 A; 
#chains in the Genus database with same CATH homology
 4A7K A;  3AKI A;  3FJA A;  5F8Y A;  4A7Z A;  2VXT I;  4LO1 A;  4KC3 A;  1L2H A;  3AKH A;  4H9W A;  4KEK A;  1JQZ A;  2K4A B;  1WBC A;  4A7Y A;  3NBD A;  1DLL A;  3H6R B;  4I8M A;  3FJH A;  1FV2 A;  1MC9 A;  2E4M C;  1SR4 C;  4J23 B;  1ISV A;  2Y9X E;  4OEF A;  3RMX A;  3JUT A;  3WIN C;  2NTD A;  3HOM A;  4QKR A;  1TIE A;  3I2A A;  1M16 A;  5F90 A;  3H6R A;  4H04 A;  1JLX A;  3Q7W A;  9ILB A;  3A07 A;  4I1E A;  3LLP A;  5D61 A;  1XZZ A;  1HWP B;  2X2T A;  2DS0 A;  4J2K A;  2J3P A;  4KBB A;  2AAI B;  2MC2 A;  2F8X C;  4X38 A;  4IHZ A;  4JQ0 A;  2YUG A;  2F2F C;  3RTI B;  3A23 A;  41BI A;  1TFM B;  3WO2 A;  4GOY A;  3WO3 A;  3AH4 A;  1P63 A;  21BI A;  1DZD A;  1DJS B;  3TC2 A;  4EB2 B;  3T8S A;  3N7L A;  4LO0 C;  3EF2 A;  3CQA A;  4IQP A;  5FNX A;  4MZH A;  2QN4 A;  1JT3 A;  4IZX A;  1N4K A;  4I1B A;  2AFG A;  6I1B A;  4JRA A;  1G82 A;  2BEA A;  4DEN A;  4X3A A;  2IHO A;  1AVX B;  3IIR A;  4GOV A;  1II4 A;  1IOB A;  2K8R A;  1TP0 A;  2RG9 B;  5EG6 C;  1YTO A;  1S0F A;  1S0B A;  2L5X A;  3I2X A;  4XFT A;  2HZ9 A;  4I0Y A;  1HWO B;  4I6I A;  2MIB A;  4ISQ A;  3QYD A;  4QC4 A;  3CAH A;  4LO3 C;  1FQ9 A;  1AVA C;  1NZK A;  3CA3 A;  5BQU A;  3NBE A;  3P6I A;  1S0D A;  1WD4 A;  2D7I A;  5FZY A;  3VT0 A;  1TTU A;  1K5U A;  1PWA A;  4ZGR B;  2VLC A;  4P0L A;  1TWM A;  3FGM A;  1ISZ A;  1RY7 A;  1YBI A;  3B9U A;  4XFS A;  3S8J A;  2FO1 A;  4D0T A;  3V0B A;  1G9A A;  4ZFU B;  1BFC A;  5G00 A;  2GZB A;  3O4B A;  2D7R A;  2ZQN A;  1M2T B;  3IM6 A;  1EYL A;  3UD8 A;  2ERM A;  2D43 A;  1IIL A;  3UD9 A;  4LO2 A;  4AN6 A;  4IYB A;  4KEJ A;  1HWM B;  3AJ6 A;  5GAQ A;  3Q7Y A;  1SZ6 B;  4ION A;  4OUJ A;  5DSS B;  3BAQ A;  3OBR A;  3ZX7 A;  3NBC A;  4JAW A;  3CRI A;  1WD3 A;  3O4A A;  2D24 A;  2NVH A;  2BFH A;  4P0K A;  4EFQ A;  1JT4 A;  2FFU A;  4AN7 B;  1V6W A;  4J2X A;  4J2S A;  1J0S A;  7I1B A;  4IZE A;  1HWN B;  4HA2 A;  4QAL A;  3NJ5 A;  3RMY A;  4EEE B;  4G9M A;  3ZXD A;  1DZC A;  2Z48 A;  3FJF A;  4G6J A;  3ZC8 A;  2XOA A;  2ZQO A;  3POK A;  3W9T A;  3HAL A;  1ISW A;  4G1R A;  4Q91 A;  3HBW A;  1BLD A;  2RQ9 A;  4I4O A;  4I4P A;  1BA7 A;  4ZOT A;  1G9C A;  1QQK A;  4USO A;  1I1E A;  3WMU A;  2HW9 A;  1R8O A;  2NZ9 A;  3A21 A;  2LIQ A;  3CRH A;  1AFC A;  4OW4 A;  3A22 A;  3PUB A;  4XFU A;  1KNM A;  1PC8 B;  4CJM A;  5JMC A;  4R6U B;  1YYN A;  1AF9 A;  4I4X A;  3FJI A;  2E4M A;  2VXR A;  1SR4 A;  4USP A;  1AVW B;  1BAS A;  1CVS A;  4JKQ A;  4MZG B;  3WIN A;  1CE7 B;  1Q04 A;  1PZZ A;  3HSM A;  4EFR A;  3CA4 A;  3MAL A;  2NS2 A;  3AJ5 A;  1I1B A;  4QD2 B;  3OJM A;  4DCK C;  2NM1 A;  2DRZ A;  1V6X A;  4ZBV B;  2KH2 A;  1ISY A;  3BRF A;  4L4H A;  3BB2 A;  2AQZ A;  5BVP I;  3N0K A;  4Z9W B;  3FJ8 A;  1EV2 A;  3FJE A;  4LO7 C;  2F2F A;  4Q9P A;  3O4C A;  1HIB A;  5DUY A;  2FFV A;  3S8K A;  1AXM A;  3R4S A;  3SNV A;  1S0C A;  5BXP A;  3PME A;  4I7I A;  1G9D A;  5E24 E;  2MLL B;  4OEG A;  4LO0 A;  3ZXG A;  2HWA A;  3F1R A;  2P39 A;  5HPZ A;  4QO3 A;  4END A;  3O4D A;  4G9N A;  8I1B A;  4F34 A;  3VEQ A;  2RST A;  1FMZ A;  2KLL A;  2UUS A;  3V0B B;  3UDA A;  5BP5 C;  1TWE A;  3BAU A;  3FFZ A;  1FMM S;  3BA7 A;  1FV3 A;  3BRG C;  3WMV A;  1DQO A;  3OJV A;  1FWU A;  2Q3N B;  3CU1 B;  4I2S A;  1JY0 A;  3FUO A;  4FVV A;  4JKX B;  1T4Q A;  4LO3 A;  4Q9G A;  4I4Y A;  2VSA A;  4UY4 A;  2FDB M;  2IWT B;  3FJK A;  1NUN A;  1BFB A;  31BI A;  3KMV A;  3E8L C;  1QXM A;  1IRP A;  4ZFY B;  4I4S A;  4PC4 A;  3H6S E;  1AVU A;  3AKF A;  1DFQ A;  4ISR A;  2NYY A;  5EC5 A;  4QKS A;  3OGG A;  3FJJ A;  3I29 B;  1DFC A;  5B2H A;  5JLV A;  3PG0 A;  3BAD A;  5I1B A;  1T9F A;  4ZFW B;  1HKN A;  3QR5 A;  5DVH A;  1EPW A;  4EFP A;  3BX1 C;  3IM5 A;  4I4U A;  2Q9X A;  3OJ2 A;  1BAR A;  3RSJ A;  3VWC A;  2ZR1 B;  4HR6 C;  2VSE A;  1V6U A;  3WA1 A;  2D23 A;  1W3F A;  1E0O A;  5EHA A;  1PUU B;  3HMY A;  4OEE A;  3VSF A;  5FNW A;  4L4I A;  2WBC A;  1YF8 B;  2ET2 A;  1TOO A;  3CRG A;  2LIE A;  3R4U A;  2KI6 B;  1YXW A;  3MPP G;  3OBT A;  3AKG A;  1F31 A;  3FJC A;  1Q03 A;  3BTA A;  1JT5 A;  2I1B A;  3AH1 A;  1ILR 1;  3BAV A;  1Z2V A;  1V6V A;  3RTJ B;  1OQL B;  2QYI B;  4ZKT B;  3O5W B;  4OWL A;  1IJT A;  3O4O A;  4IY9 A;  2K43 A;  4EKX B;  3PHZ A;  2Z49 A;  1GGP B;  4Z8S B;  3O49 A;  3V0A B;  4YOL A;  3VT1 A;  1ABR B;  4G6M A;  3AH2 A;  3FUQ A;  3V0A A;  1S0G A;  4F83 A;  4I4R A;  4ZA3 B;  3V79 C;  2AXM A;  3P53 A;  5BOW A;  3CA0 A;  4J2Y A;  3NBN A;  4MZF B;  4D8H A;  2VUA A;  4P0J A;  5FZZ A;  1XYF A;  3VT2 A;  1JLY A;  4QD2 C;  4I4V A;  2GO2 A;  4GAF A;  2P23 A;  4QBC A;  2WRY A;  2Y9F A;  4D0Z A;  1ISX A;  1R8N A;  1Z4S A;  3HN1 A;  4I96 A;  3P6J A;  2R9K B;  4GAI A;  3AZW A;  1BFG A;  1S0E A;  4I4Q A;  4QBV A;  3O3Q A;  4FGF A;  4TLP A;  1PUM B;  4JP0 A;  4LO7 B;  4LO8 B;  4GP0 A;  4JPZ A;  1ONK B;  1XHB A;  1IHK A;  2Y9W C;  3N7M A;  5BQU C;  2D20 A;  4GP3 A;  1W3G A;  3FJB A;  1IT0 A;  2D22 A;  2BEB A;  1HCE A;  2DRY A;  1S0L A;  3IAG C;  3FJD A;  3LTQ A;  4WBC A;  1K5V A;  1A8D A;  5D62 A;  3UD7 A;  3BA5 A;  2DRE A;  4X39 A;  3UJ0 A;  4ZLB B;  2KI4 A;  3VUO A;  1EVT A;  3WO4 A;  3N7J A;  1Q1U A;  3AZV A;  2VU9 A;  1WBA A;  3JRR A;  1W3A A;  3UJ4 A;  1FN0 A;  1RZO B;  4LO2 C;  4I37 A;  1MD6 A;  5BP5 A;  2M49 A;  3C9Z A;  4X37 A;  3OGF A;  1DIW A;  3BAO A;  5D63 A;  3ZC9 A;  1IRA X;  5DZU A;  3BAG A;  1QQL A;  1BFF A;  2X2S A;  5BXS A;  2FGF A;  1D0H A;  1JT7 A;  4H75 A;  5BXT A;  2HWM A;  3D7W B;  1VCL A;  3ILA A;  1BLA A;  3FJ9 A;  4XKI A;  3N7K A;  4OWK A;  2NP0 A;  4DEP A;  1FGA A;  1JTC A;  3BAH A;  1DQG A;  5FZU A;  3H6Q A;  3IM7 A;  1ITB A;  2Y9G A;  4OWJ A;  1RML A;  4I3N A;  2KKI A;  3CA1 A;  4KEI A;  3VSZ A;  1HCD A;  1RG8 A;  1XG6 A;  3BRD A;  4LO1 C;  3Q7X A;  5BXR A;  1FWV A;  3CA6 A;  3CA5 A;  4II0 A;  4HJJ A;  5F8W A;  1Z0H A;  2D44 A;  1G9B A;  5F8S A;  1UPS A;  3BA4 A;  3K1X A;  4P6A A;  2D1Z A;  3F62 B;  3O44 A;  2ESU A;  4IY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...