4I1LA

Structural and biological features of foxp3 dimerization relevant to regulatory t cell function
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
62
structure length
62
Chain Sequence
PGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biological features of FOXP3 dimerization relevant to regulatory T cell function.
pubmed doi rcsb
molecule keywords Forkhead box protein P3
molecule tags Transcription regulator
source organism Mus musculus
total genus 25
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16159 FOXP-CC FOXP coiled-coil domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i1lA00
4I1LA 3HRNA 4ZKUA 3BATA 4ZKPA 2JEEA 5BU5A 1IC2A 5BU8B 3C9IA 3U1AA 3P8CD 3VP9A 5BVZA 3U1CA 3N7NA 3VP8A 2POHA 4GIFA 4O9BA 2FXMA 1WT6A 3U59A 3BASA 1X79B 4N78D 1NKNA 3OJAB 5KTBA 4N3YB 3N4XA
chains in the Genus database with same CATH superfamily
2ZT9D 1JY2O 3PH0A 1SQBG 1OVUA 1VQOP 2V7QJ 4HYTB 3GMAA 1VPCA 1EZVE 1JY3P 2YXRB 2FYUD 2KI7B 2IBZE 1K73Q 1QL2A 5AVSB 2V7QH 4YXDC 1NU1K 1JMMA 3G4SP 5AVYB 1NKZB 2D2CB 4GODA 3U1CA 3CI9A 4OGQB 1M57D 2PP6A 1EDJA 1SQBE 3RGUA 1KILA 2W8ZA 3RL0C 3HE4B 2L5GB 2IZ0A 4EOTA 2R44A 1VQ9P 4H13B 2JWDA 1JMBA 3BRVB 2OYHC 1KYOD 4KT0J 5APSA 1BCCE 2IFNA 3A5TA 1PV3A 4WVZA 3BASA 4H44C 3H1KG 3JC22 3BCCG 2E76C 1HGZA 2QVAA 2R5DA 4GDOA 3NMDA 1ZLLA 2P2UA 2QIWA 1SQXJ 1LP1A 1LTIC 3HUSB 3CC4P 1GW4A 2HFED 2LXBA 2P10A 4IL6E 1LWUB 1VQPP 1YJWP 1P84E 2IFMA 3GG2A 3MUDC 4EDFA 5KLIB 4W7ZA 1LJ2A 4XE5B 2WPQA 1OX3A 5AW6B 1SVFA 4L76A 3H1KE 2ZT9B 1M90Q 3BCCE 4Y99B 1N7SD 2H88C 3W68A 1VL2A 1GD2E 2O01N 1NYHA 1KILD 1HF9A 2D2CC 3QWOC 4OGQC 1LTJB 1N8RQ 2QJYB 3B5ND 3F5HA 3JCUH 3V2PA 1SQQJ 1FZCB 1FJPA 2FYNB 4RKUJ 3BATA 1NWQA 4D6TD 5APUA 1NTZJ 1IC2A 1M56D 4AUWA 3E1IA 4H13C 2LXCB 2YIUB 4PD4I 1WT6A 2ZYDA 5AW9B 1HUCA 2ZVOB 3WMM0 1T6AA 2ZVNB 3VTPC 1H0TB 1JCCA 1K9MQ 2W90A 2KXPB 3GW6A 1YYCA 1EQ7A 2K3RA 3O8ZA 1PFIA 2FFDB 1SQXD 3RK2B 1VF5B 3IAOA 1URQA 1IFIA 1LWUC 2CPSA 2WT7B 4GIFA 3MZWB 1GU5A 1KYOE 1EDLA 1BGYD 5AW1B 3CC2P 5KJ7D 3I55P 1DD4A 3VMYA 2KP8A 2M5AB 4XFJA 2A45I 4U7JA 1BDDA 1FJKA 1KB9H 2QE7H 2QJYC 1W5CE 3AEEC 1EZVI 3CPWO 2ZYGA 3H32B 1NTKJ 4D6TG 2H89C 2Q3IA 4RO0A 1FDIA 2YIUC 1PL5A 2I8DA 3B5NB 1GK6A 2WTYA 2IPPA 1X8YA 4BWNA 1HTLC 2E75C 2Y0DA 3CL3D 3VOPA 2QSIA 1GMJA 2JDIH 1URQD 1QGKB 1HGVA 4ZKUA 2AXTE 3TNUB 3Q3DA 4D6TE 4PD4H 2BEZF 3RK2C 1VF5C 3H1JJ 3AE7C 4ASWA 1J1EB 2AXCA 1NJIQ 2JP3A 4PV1C 3CWBG 2HPCA 2C9LY 1KTMA 4DZOA 4CPGA 2N1TB 4C7RA 1M1JB 5DJTB 3AE2C 1FAVA 2E5YA 4NPFX 1VDFA 1N2DC 1HJ0A 4IFDK 3AE6C 2RN0A 1FE6A 2Q1KA 1ZW0A 3CWBE 4H0LD 1N86A 5GTIE 2B89A 2WWWA 5AVUB 4U3FG 1J1DC 5EFWB 2P1JA 3TGUD 1KORA 1NTMD 4UB8E 2B87A 4PD4D 4JYCA 1FZAA 5AVTB 3U59A 3PJSK 3PRJA 3N4XA 3HD7B 2OTJP 1IJDB 1FZEA 4U3FE 1LTBC 3VMZA 3L74D 2K9JB 2WSEJ 2N1TC 2KK7A 2WPVB 4A7PA 1BCCJ 1MFTA 1SQVK 1L0NG 1YIJP 1PPJG 1Y8AA 3RL0D 1FDMA 2WSEH 4GOFA 2AEMA 3LIDA 5BU8B 4ZNCA 1SQPK 2JR8A 1JO5A 3CXHE 4YTPC 1MUUA 1FZGA 3HE4A 5AW7B 1U57A 5KKZB 3CX5E 1H89A 3R2PA 3L71D 2E5TA 1NGMB 2W27A 1S72P 2M8RA 3M9QA 2E76D 3L35A 1L0NE 3E1RA 4Y28J 2Q9IA 1QVGO 4DT0A 1EZVD 3G3ZA 4IL6H 1P84H 4N6JA 1L0LK 3BCCJ 2NZ2A 3KYQA 3TGUG 1IK7A 1SP4A 1YQ3C 3HUSA 1KZUB 5AVWB 2YMYA 4HKZH 3L70G 4RESB 5DJUB 1SQBD 2AEFA 3CCLP 4C46A 3GHGC 3LIEA 1VQNP 1LT1A 1MZ9A 2NPSC 3R4YA 2D2CD 4OGQD 3L74G 2QEXP 2FYUJ 3TGUE 2O1KA 5B5EE 1Q90D 3V2NA 3LW5J 1S4XA 5AW4B 4R4MA 5CCHC 2Z5IA 1KN7A 3P7KA 3ITKA 1LTJA 4H13D 1IFDA 4EI2A 1FZCA 3L70E 3M0DC 3LW5H 4I1LA 3WU2E 3M0AA 3AE5C 4IOIH 4KHXA 3IN6A 5KKZC 3BVHA 1AQ5A 1VQ6P 1PGJA 3SWKA 3RBZA 2W6BA 1KV4A 1N7LA 3L74E 4EYYQ 3L71G 4IFFA 4TLFA 3CCUP 1ZOYC 1G2CB 2OYHB 1H0TA 2A45G 2PFXA 2P67A 3H1KD 5BU5A 4H44B 2ZFCA 1KYOH 3VN0A 2E76B 2G8YA 1AFOA 3A0BE 2FFDA 3V2QA 1S5LE 4M3LA 4NPDA 3ABVC 3L71E 1RF0A 5KLVG 1KFNA 2WQYC 1AVYA 4XA4A 2WT7A 3H1IG 1SFCC 1EC5A 2FYZA 2WPSA 2DW3A 4L73A 1YITP 3M9BA 2M5AA 1T3UA 1IFJA 4L75A 1JM0A 2YNYA 5KLVE 1JB0J 2YKOA 1GL2B 3H32A 1N7SA 1YTZI 4D6TJ 2LKMA 2E75D 2E42A 3AE3C 4DJGA 4WWIA 3H6PA 2AXTH 3GLMA 1DEEG 2WPRA 3CCMP 3B5NA 3SWYA 4BRYB 2K88A 1MFZA 4QMAA 2OQQA 1Q2NA 3CXHI 5AVZB 4I6MC 3G6EP 4O9BA 4YPCA 2W83C 3RK2D 1VF5D 3CX5I 1Q86Q 1DIPA 1SQPG 3TNUA 3WUTA 1SQXK 3G71P 3AEGC 1UIIA 4PV1D 3AEDC 2E74B 1NAFA 2R5BA 1RE4A 3V4QA 1RHZB 3S9OA 3L73G 3CWBJ 2E43A 2N1TA 1M1JA 5AW2B 3AECC 3L36A 1GK4A 1L0LG 2A06G 1Y9BA 1BGYJ 5GTIH 3EFGA 2IYOA 2WZ7A 1SQQK 2JJLA 1IK9A 5KJ7A 1E79H 1M1KQ 1NTZK 4UB8H 3L73E 1GL2C 2WSSH 2LR2A 4R4LA 1ZR4A 3S1KA 5CBNA 2GUVA 1RQVA 1RF1C 2R3CA 1L0LE 1NAYA 2A06E 4GOEA 3SFDC 1A02J 1KQGB 1NU1D 1W2BO 1LT9B 2P7JA 3IR9A 2E75B 1EXIA 1T2KC 1FOSE 3AEFC 3QH9A 1KQFB 3HD7A 1R5LA 2M3EA 2E74C 2N1TD 1J2JB 5TISE 2FXOA 5APWA 2B88A 3TSIA 2QJPC 4LLHA 5CCGC 2XKMA 3CWBD 3CXHH 3KZIE 3P32A 4PV1B 3P8CE 4OWFA 5E79E 1L0NJ 3CX5H 2QRXA 4WB4A 3NFQA 1AV1A 3B71A 1YJNP 1RY3A 2WVRA 3KPEA 1N73C 3OW2O 2W6AA 1IFPA 3T97B 3VYIA 1NTKK 4JQ0D 2IDBA 3L75G 1Y47A 1NVOA 4U3FD 1E5WA 3D6YA 1X22A 1HH0A 1IFMA 1J1DB 1L4AC 1BDCA 2KNCB 3ZDMA 3TGUJ 1LT9C 1OXZA 1NTMJ 1NU1G 3HD7D 2OYIA 5CHXA 2OTKE 4N78E 1RE3A 2PRRA 1LTSC 1XTGB 3L75E 1ZN5A 5B5EH 3D6ZA 2NPSD 1IZNB 1DEBA 3FGAD 2H7HA 1JEKA 3CXHD 1G1IA 2YMKA 2YKPA 3CX5D 3RK3B 3PP5A 5CCHD 3L74J 3WU2H 1IO4A 5L8RJ 1S5LX 1NU1E 4WY4C 2K1AA 3M9HA 1L0ND 3FWNA 1JCDA 5CBOA 1PPJD 3V2RA 1AVOA 3VP8A 3RK3E 2QG4A 1LNQA 3MD0A 3HTKB 4WBAA 3OJAB 1PP9G 2WITA 2NRGA 2UWJE 4PJ0E 3L71J 3C1LA 3JSVC 3FXDA 3N7NA 3A0BH 3A7OA 3AEAC 2POHA 3O6QB 3VMXA 1G2CA 2J58A 1PIXA 3CMEP 2KSEA 2FXMA 1S5LH 2OYHA 3V5BA 3I56P 2JWAA 3TYYA 1S2EA 1FC2C 2C0WA 4ZKPA 2FY8A 2A45H 1PP9E 2JKVA 1H88A 1YQ4C 4AYCA 2KLUA 2K9YA 1SFCD 3SSUA 2H43A 5KLVJ 3L70D 2V4HA 1SQBJ 3MUDA 3Q5PA 3RK3C 4TT3H 2ITAA 3GHGB 2NPSB 3VMAA 4OVNF 3MGNA 1KQLA 1GW3A 3CD6P 4IL6X 2GM4A 3G9RA 3E7KA 3V6IA 1GL2A 2HODB 1USEA 1YJ9P 1JOCA 2XNDH 5CJ0A 1MV8A 2QJKB 3B4SA 3L37A 1M7LA 1OMIA 4BRYA 4H44D 5AW0B 5AVVB 5APTA 2IYPA 3NXSA 2KOGA 1PPJE 4HJGH 1QVFO 3H1KJ 3CCSP 1CI6B 2XZRA 1KD1Q 5CMZA 1GTWA 3HRNA 3S4RA 1NTKG 1SS1A 1XTCC 1OW6A 3L73J 3H1LG 5KLVD 1VQ4P 1TU3F 1LWUA 3H1ID 4C7NB 4MN4C 1PZQA 2R32A 5KAIE 2P58A 2FYUK 1SFCB 3RL0g 1EXJA 1GL2D 3AE4C 3NTNA 1FBMA 1AA0A 3I5CA 1WMKA 1NTKE 2CPBA 3CLQA 1GU4A 1JTHB 1URQC 5AVXB 3H1LE 2I1KA 1BE3D 1YHQP 1Q81Q 3D70A 1OVRA 1PGQA 2QJKC 1S1CX 3CCRP 3CCQP 3MTUE 2Q6QA 1T2KD 1K8AQ 1DH3A 1T3JA 1OW8A 5AVQB 3PTZA 1SQVD 3PLNA 1LT9A 5TISH 2YXQB 2O3JA 1FU1A 2E74D 1Q82Q 1SQPD 3KZIH 3KDPB 5CCGD 4UB6E 5E79H 4JBZA 1OFCX 3D71A 5GTHE 2O01J 3L73D 1JY2N 2Z5HA 3HE5B 2RMZA 1Z56A 1U7JA 3H25A 2Y9YA 3AE9C 3U1AA 2IBZG 2QA4P 2O01H 3M06A 1L0LD 2A06D 2O1JA 3KHUA 2Y0EA 4AQRD 5APXA 2I1JA 3AE1C 2ZYAA 1YTZT 1VQLP 3SWFA 3F89A 1KFMA 3T97A 3C9IA 3CCEP 3L75J 1L4AD 1M8OB 4IFMA 1KMIZ 2BCCD 1BE3G 3A0HE 3OA7A 3MP7B 2Z4EA 3PHLA 3H1IE 3EFFK 2RKLA 1BCCG 1RF1B 2MKVA 4GT1A 2KNCA 1R8EA 3V4WA 1K04A 3P8CD 1NU1J 2R3SA 1SQVG 1USDA 3RBXA 3H1HD 4I2LC 2IX7C 1BE3E 1NH4A 3EQ2A 2K37A 1HJBA 5APVA 4WY4D 3USSA 1GZLA 2ZAEB 3GF3A 2M0BA 1LTAC 2QJPB 2J5UA 2OGUA 2WSCJ 5KTBA 1SQVE 2Q7CA 4PJ0H 4JPZB 1FZFA 1DD3A 2BEQD 2WSCH 3L72D 3A3YB 1SQPE 2XNXA 1OVVA 3HTKA 1ZRTD 1KB9I 1BSHA 3BRTB 1PP9J 3K5BA 1OIPA 2KLVA 4N78D 1VQ7P 2KS1B 1VQ8P 4N3YB 2HLOA 1N73B 3P8MC 3L75D 5H2FE 1WRGA 3O6QA 2HYNA 2BCCG 2WMMA 2FYUG 4U3FJ 3KQGA 5AW5B 1L4AB 2KSJA 1JUNA 1JNMA 1ZV8A 1VQ5P 1HWTC 1JY3N 3A2AA 3H1HG 3RK3D 1PGOA 4GKGA 3FX0A 4B86A 2PGDA 4HB1A 4I7ZB 2BCCE 1ZP0C 2FYUE 3AEBC 3FWLA 3GHGA 2K9JA 2JEEA 2NPSA 2BASA 1L0NK 1JY3O 3KXDA 2JO1A 1QL1A 4WY4B 1KQSO 1S9KD 4LGDE 3HUSC 5CCHA 2M3BA 3H1HE 2HODA 3L72G 5B66E 1PP9D 5KLIC 3M0DA 5KAFE 2RH0A 3TK1A 1Q7YQ 1CZQA 4EIJA 3AE8C 2ZT9C 2Q3EA 3W67A 4Y99C 4K35A 1NTMK 4K3AA 4RJTA 1LTJC 1ZR2A 1CI6A 3IFMA 3L72E 2XDJA 1FZCC 1LGHB 1SQQD 2FYNC 5KAIH 1ZRTE 3GF7A 1HBWA 2IBZI 1OZHA 1N7SB 1NTZD 2YO3A 2ZXEB 4BXLA 2KZJA 2FXPA 1VQKP 1KILB 3H1LJ 1CSBA 2XV5A 5AW3B 4I7ZC 3L70J 1X0TA 4YXWH 2N9YB 1CW5A 4C7NA 5TJHA 1HVVA 1SFCA 1VQMP 1X79B 2KIKA 1NOHA 1W2EA 2B9BA 1KILE 2SPZA 1DX7A 2FFDC 5M1BA 1JTHA 1LTTC 1LP1B 1SQXG 1RF0C 1NKNA 5BVZA 3MIWA 2KZIA 1RH5B 5CJ4A 4JF7A 4UB6H 4ASVA 1LTGC 1KB9D 1FOSF 1BGYG 1SLQA 5GTHH 1S3JA 1P84I 3MHVA 1QX8A 2H8PD 2OTLP 3Q2YA 1S9KE 1H8AA 1SQXE 1FZBA 2FBWC 1K05A 4W7YA 5AW8B 1FS0E 1N7SC 2C0XA 1SQQG 3VP9A 1NTKD 1NO4A 3EWKA 5KLVK 4NPEA 1KILC 1NTZG 3H1LD 3HE5A 1SQBK 3B5NC 3WUVA 1EDKA 3TF5A 1BGYE 2YO2A 1QEXA 2Q5UA 5APYA 1UIXA 3H1IJ 2Y9ZA 3JCUE 2GA1A 4OH8B 3CCVP 3A0HH 1SQQE 3C8VA 1NTZE 3II6A 3OAKA 3H1JD 1J1EC 1RE4C 2KYVA 1URQB 1ZXGA 1BE3J 2L91A 1X9VA 2KUBA 2QM8A 1RQUA 1AJYA 1M1JC 1D7MA 3Q5RA 1EDIA 1AQTA 1RF1A 4KJMA 4LC1A 2WSFJ 1SQVJ 1JY2P 1T8ZA 1OWAA 2W6JH 4HH2A 1MKMA 3CC7P 1KYOI 1SQPJ 5KJ7C 3Q5SA 2WSFH 1YI2P 1YBKA 2KB7P 4L74A 4ZMDA 2N9BA 5AVRB 5CCGA 3B8EB 2AEJA 3CMAP 1KB9E 2IBZD 3CCJP 2FKWB 4H0LB 1NTMG 2OYIB 1L0LJ 1PGPA 3WUUA 5H2FH 2HG5D 2CK3H 2GUSA 3HD7C 1IFNA 4DCKA 1ZMEC 1U7MA 2KS1A 2OYOA 2G3AA 2ZJSE 1N73A 5C39A 2Y0CA 2HR3A 3UIAA 3H1JG 1QLED 2BCCJ 5APQA 3M91A 4DOJA 2HPCB 1NTME 3IF4A 1BCCD 1OW7A 1L4AA 4PD4E 2QM7A 2C9NY 1BSNA 2YKQA 3FXEA 3SFEC 1GDTA 2XU6A 3H1HJ 2VRSA 3L4FA 4JYBA 3H1JE 3RL0B 4W80A 4Z1MH 1A02F 1P84D 1KC8Q 2OARA 1L2PA 5B66H 2PAJA 2MJZA 1EZVG 5KAFH 3BCCD 4H0LC 2J59M 3Q1MA 4WY4A 1NHLA 1FDOA 2OYIC 2B87B 5K5GB 2ZXXA 2IZ1A 1RE3C 3TDKA 3L72J 1G1JA 1R5SA
chains in the Genus database with same CATH topology
1JY2O 1ZV8A 4WY4C 2W27A 3M9HA 2M8RA 3M9QA 1HWTC 1JCDA 3V2RA 3L35A 2Q9IA 1JY3N 3A2AA 4HYTB 3RK3D 3VP8A 3G3ZA 4GKGA 1VPCA 4B86A 3MD0A 4N6JA 1JY3P 1L0LK 3HTKB 4WBAA 3KYQA 3OJAB 1QL2A 5AVSB 2WITA 1SP4A 1NU1K 1JMMA 3GHGA 3HUSA 1KZUB 5AVWB 2JEEA 5AVYB 2NPSA 1NKZB 2BASA 1L0NK 2YMYA 3U1CA 3CI9A 1JY3O 3N7NA 3A7OA 2POHA 3VMXA 4RESB 1G2CA 1QL1A 2PP6A 2J58A 4WY4B 2FXMA 1S9KD 2OYHA 4C46A 3V5BA 1KILA 3GHGC 4LGDE 3HUSC 3RL0C 3HE4B 5CCHA 2L5GB 3LIEA 2M3BA 4EOTA 3TYYA 1MZ9A 2NPSC 2HODA 2C0WA 4ZKPA 2O1KA 3M0DA 2A45H 3BRVB 2OYHC 3V2NA 1H88A 5AW4B 3TK1A 5APSA 4AYCA 2IFNA 3A5TA 5CCHC 1SFCD 1CZQA 2Z5IA 3P7KA 4EIJA 1LTJA 3BASA 2H43A 1IFDA 1FZCA 4Y99C 3M0DC 3LW5H 4I1LA 3M0AA 1HGZA 2R5DA 3MUDA 3NMDA 1ZLLA 2P2UA 4KHXA 3RK3C 3BVHA 3GHGB 1LTIC 3HUSB 1NTMK 1AQ5A 1GW4A 1LTJC 1ZR2A 1CI6A 3IFMA 2HFED 2W6BA 1N7LA 2NPSB 2XDJA 1FZCC 1LGHB 3MGNA 1KQLA 1HBWA 1GW3A 4IFFA 1LWUB 2IFMA 1N7SB 2ZXEB 2YO3A 1G2CB 4W7ZA 4XE5B 2WPQA 2OYHB 2GM4A 1KILB 2A45G 5AW6B 1SVFA 1CSBA 2P67A 2XV5A 5AW3B 5BU5A 1GL2A 2HODB 2ZFCA 4Y99B 1CW5A 3VN0A 1JOCA 4C7NA 1N7SD 5CJ0A 1AFOA 1MV8A 2FFDA 1GD2E 1HVVA 1SFCA 1KILD 1X79B 3L37A 1NOHA 1M7LA 1W2EA 3V2QA 4M3LA 1LTJB 3B5ND 5AW0B 1RF0A 5AVVB 3V2PA 5APTA 1KFNA 1FZCB 1FJPA 3NXSA 3BATA 1NWQA 5APUA 4XA4A 2WT7A 1IC2A 1DX7A 4AUWA 3E1IA 2FFDC 2KOGA 1JTHA 1SFCC 1LTTC 2FYZA 2WPSA 1WT6A 1CI6B 1RF0C 1NKNA 2XZRA 5AW9B 5CMZA 3M9BA 1GTWA 5BVZA 1T3UA 3MIWA 1HUCA 3HRNA 3WMM0 5CJ4A 1IFJA 3VTPC 4JF7A 1XTCC 1JCCA 2YNYA 1LTGC 1FOSF 2YKOA 1SLQA 1GL2B 1LWUA 3H32A 1YYCA 1N7SA 1YTZI 2LKMA 1EQ7A 4C7NB 2H8PD 2R32A 3O8ZA 2E42A 1PFIA 1S9KE 2FFDB 2FYUK 1H8AA 3H6PA 3RK2B 1SFCB 1URQA 2WPRA 1FZBA 3B5NA 3SWYA 4W7YA 5AW8B 1IFIA 1GL2D 1LWUC 2CPSA 1MFZA 1N7SC 2C0XA 3NTNA 3VP9A 1FBMA 3I5CA 1NO4A 5KLVK 5AVZB 2WT7B 1KILC 4GIFA 2CPBA 1GU5A 4I6MC 3CLQA 4O9BA 1GU4A 3RK2D 1JTHB 3HE5A 1URQC 5AVXB 1SQBK 3B5NC 2I1KA 5AW1B 5KJ7D 3TNUA 2YO2A 2Q5UA 5APYA 1SQXK 3VMYA 2KP8A 1NAFA 2A45I 3MTUE 2R5BA 1T2KD 1FJKA 4OH8B 1RE4A 3V4QA 1DH3A 1T3JA 5AVQB 1LT9A 3H32B 2E43A 2N1TA 3II6A 2Q3IA 3OAKA 1M1JA 1FU1A 5AW2B 3L36A 1GK4A 1J1EC 1RE4C 2KYVA 1URQB 3B5NB 3KDPB 5CCGD 1GK6A 2WTYA 2IPPA 3EFGA 1X8YA 1X9VA 1HTLC 2QM8A 2WZ7A 3CL3D 3VOPA 1M1JC 1SQQK 1RF1A 2JJLA 1IK9A 5KJ7A 1JY2N 2Z5HA 1URQD 3HE5B 1NTZK 1Z56A 4LC1A 1HGVA 1GL2C 4ZKUA 3TNUB 1JY2P 1T8ZA 3U1AA 1OWAA 1ZR4A 4HH2A 2GUVA 2O01H 3M06A 3RK2C 2O1JA 1RF1C 2R3CA 5KJ7C 2WSFH 1J1EB 4AQRD 1A02J 5APXA 2I1JA 1LT9B 2HPCA 2P7JA 2C9LY 3IR9A 4DZOA 1YTZT 2N1TB 4C7RA 2KB7P 3SWFA 1T2KC 1KFMA 1M1JB 3T97A 3C9IA 2N9BA 5AVRB 1FOSE 1L4AD 5CCGA 3B8EB 4IFMA 1FAVA 1VDFA 1N2DC 4IFDK 2FKWB 3HD7A 3OA7A 2Z4EA 2N1TD 1J2JB 2OYIB 5APWA 3TSIA 1RF1B 2HG5D 4LLHA 5CCGC 4GT1A 2XKMA 3V4WA 3P8CD 2GUSA 3HD7C 3P32A 1IFNA 3P8CE 1N86A 2WWWA 5AVUB 1N73A 4WB4A 1J1DC 4I2LC 3UIAA 3NFQA 2IX7C 2P1JA 1RY3A 5APQA 1NH4A 3EQ2A 3M91A 4DOJA 3KPEA 1HJBA 2HPCB 5APVA 4WY4D 1GZLA 1N73C 2W6AA 1L4AA 3VYIA 1NTKK 4JYCA 1FZAA 2QM7A 1LTAC 2C9NY 2YKQA 5AVTB 3U59A 1GDTA 5KTBA 2XU6A 3N4XA 3HD7B 2Q7CA 1IJDB 1E5WA 1FZEA 1HH0A 1IFMA 2VRSA 1FZFA 1J1DB 1L4AC 1LTBC 3L4FA 4JYBA 3VMZA 3RL0B 2WSCH 3A3YB 2XNXA 4W80A 3HTKA 1LT9C 1OXZA 1A02F 3BRTB 3HD7D 2N1TC 2OYIA 2KLVA 5CHXA 4N78D 1SQVK 4N3YB 4N78E 2OARA 2HLOA 1N73B 3P8MC 2PAJA 1RE3A 3RL0D 1LTSC 1XTGB 1FDMA 1ZN5A 2MJZA 2NPSD 2WSEH 1DEBA 1WRGA 2J59M 3LIDA 2HYNA 5BU8B 1SQPK 4WY4A 2H7HA 1NHLA 1JO5A 2OYIC 1G1IA 3KQGA 5AW5B 1MUUA 1FZGA 2YKPA 3HE4A 5AW7B 1RE3C 3RK3B 3PP5A 5CCHD 1L4AB 1H89A 2KSJA 1G1JA 3R2PA 1JUNA 1IO4A 1JNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1L A;  3HRN A;  4ZKU A;  3BAT A;  4ZKP A;  2JEE A;  5BU5 A;  1IC2 A;  5BU8 B;  3C9I A;  3U1A A;  3P8C D;  3VP9 A;  5BVZ A;  3U1C A;  3N7N A;  3VP8 A;  2POH A;  4GIF A;  4O9B A;  2FXM A;  1WT6 A;  3U59 A;  3BAS A;  1X79 B;  4N78 D;  1NKN A;  3OJA B;  5KTB A;  4N3Y B;  3N4X A; 
#chains in the Genus database with same CATH topology
 2ZT9 D;  1JY2 O;  3PH0 A;  1SQB G;  1OVU A;  1VQO P;  2V7Q J;  4HYT B;  3GMA A;  1VPC A;  1EZV E;  1JY3 P;  2YXR B;  2FYU D;  2KI7 B;  2IBZ E;  1K73 Q;  1QL2 A;  5AVS B;  2V7Q H;  4YXD C;  1NU1 K;  1JMM A;  3G4S P;  5AVY B;  1NKZ B;  2D2C B;  4GOD A;  3U1C A;  3CI9 A;  4OGQ B;  1M57 D;  2PP6 A;  1EDJ A;  1SQB E;  3RGU A;  1KIL A;  2W8Z A;  3RL0 C;  3HE4 B;  2L5G B;  2IZ0 A;  4EOT A;  2R44 A;  1VQ9 P;  4H13 B;  2JWD A;  1JMB A;  3BRV B;  2OYH C;  1KYO D;  4KT0 J;  5APS A;  1BCC E;  2IFN A;  3A5T A;  1PV3 A;  4WVZ A;  3BAS A;  4H44 C;  3H1K G;  3JC2 2;  3BCC G;  2E76 C;  1HGZ A;  2QVA A;  2R5D A;  4GDO A;  3NMD A;  1ZLL A;  2P2U A;  2QIW A;  1SQX J;  1LP1 A;  1LTI C;  3HUS B;  3CC4 P;  1GW4 A;  2HFE D;  2LXB A;  2P10 A;  4IL6 E;  1LWU B;  1VQP P;  1YJW P;  1P84 E;  2IFM A;  3GG2 A;  3MUD C;  4EDF A;  5KLI B;  4W7Z A;  1LJ2 A;  4XE5 B;  2WPQ A;  1OX3 A;  5AW6 B;  1SVF A;  4L76 A;  3H1K E;  2ZT9 B;  1M90 Q;  3BCC E;  4Y99 B;  1N7S D;  2H88 C;  3W68 A;  1VL2 A;  1GD2 E;  2O01 N;  1NYH A;  1KIL D;  1HF9 A;  2D2C C;  3QWO C;  4OGQ C;  1LTJ B;  1N8R Q;  2QJY B;  3B5N D;  3F5H A;  3JCU H;  3V2P A;  1SQQ J;  1FZC B;  1FJP A;  2FYN B;  4RKU J;  3BAT A;  1NWQ A;  4D6T D;  5APU A;  1NTZ J;  1IC2 A;  1M56 D;  4AUW A;  3E1I A;  4H13 C;  2LXC B;  2YIU B;  4PD4 I;  1WT6 A;  2ZYD A;  5AW9 B;  1HUC A;  2ZVO B;  3WMM 0;  1T6A A;  2ZVN B;  3VTP C;  1H0T B;  1JCC A;  1K9M Q;  2W90 A;  2KXP B;  3GW6 A;  1YYC A;  1EQ7 A;  2K3R A;  3O8Z A;  1PFI A;  2FFD B;  1SQX D;  3RK2 B;  1VF5 B;  3IAO A;  1URQ A;  1IFI A;  1LWU C;  2CPS A;  2WT7 B;  4GIF A;  3MZW B;  1GU5 A;  1KYO E;  1EDL A;  1BGY D;  5AW1 B;  3CC2 P;  5KJ7 D;  3I55 P;  1DD4 A;  3VMY A;  2KP8 A;  2M5A B;  4XFJ A;  2A45 I;  4U7J A;  1BDD A;  1FJK A;  1KB9 H;  2QE7 H;  2QJY C;  1W5C E;  3AEE C;  1EZV I;  3CPW O;  2ZYG A;  3H32 B;  1NTK J;  4D6T G;  2H89 C;  2Q3I A;  4RO0 A;  1FDI A;  2YIU C;  1PL5 A;  2I8D A;  3B5N B;  1GK6 A;  2WTY A;  2IPP A;  1X8Y A;  4BWN A;  1HTL C;  2E75 C;  2Y0D A;  3CL3 D;  3VOP A;  2QSI A;  1GMJ A;  2JDI H;  1URQ D;  1QGK B;  1HGV A;  4ZKU A;  2AXT E;  3TNU B;  3Q3D A;  4D6T E;  4PD4 H;  2BEZ F;  3RK2 C;  1VF5 C;  3H1J J;  3AE7 C;  4ASW A;  1J1E B;  2AXC A;  1NJI Q;  2JP3 A;  4PV1 C;  3CWB G;  2HPC A;  2C9L Y;  1KTM A;  4DZO A;  4CPG A;  2N1T B;  4C7R A;  1M1J B;  5DJT B;  3AE2 C;  1FAV A;  2E5Y A;  4NPF X;  1VDF A;  1N2D C;  1HJ0 A;  4IFD K;  3AE6 C;  2RN0 A;  1FE6 A;  2Q1K A;  1ZW0 A;  3CWB E;  4H0L D;  1N86 A;  5GTI E;  2B89 A;  2WWW A;  5AVU B;  4U3F G;  1J1D C;  5EFW B;  2P1J A;  3TGU D;  1KOR A;  1NTM D;  4UB8 E;  2B87 A;  4PD4 D;  4JYC A;  1FZA A;  5AVT B;  3U59 A;  3PJS K;  3PRJ A;  3N4X A;  3HD7 B;  2OTJ P;  1IJD B;  1FZE A;  4U3F E;  1LTB C;  3VMZ A;  3L74 D;  2K9J B;  2WSE J;  2N1T C;  2KK7 A;  2WPV B;  4A7P A;  1BCC J;  1MFT A;  1SQV K;  1L0N G;  1YIJ P;  1PPJ G;  1Y8A A;  3RL0 D;  1FDM A;  2WSE H;  4GOF A;  2AEM A;  3LID A;  5BU8 B;  4ZNC A;  1SQP K;  2JR8 A;  1JO5 A;  3CXH E;  4YTP C;  1MUU A;  1FZG A;  3HE4 A;  5AW7 B;  1U57 A;  5KKZ B;  3CX5 E;  1H89 A;  3R2P A;  3L71 D;  2E5T A;  1NGM B;  2W27 A;  1S72 P;  2M8R A;  3M9Q A;  2E76 D;  3L35 A;  1L0N E;  3E1R A;  4Y28 J;  2Q9I A;  1QVG O;  4DT0 A;  1EZV D;  3G3Z A;  4IL6 H;  1P84 H;  4N6J A;  1L0L K;  3BCC J;  2NZ2 A;  3KYQ A;  3TGU G;  1IK7 A;  1SP4 A;  1YQ3 C;  3HUS A;  1KZU B;  5AVW B;  2YMY A;  4HKZ H;  3L70 G;  4RES B;  5DJU B;  1SQB D;  2AEF A;  3CCL P;  4C46 A;  3GHG C;  3LIE A;  1VQN P;  1LT1 A;  1MZ9 A;  2NPS C;  3R4Y A;  2D2C D;  4OGQ D;  3L74 G;  2QEX P;  2FYU J;  3TGU E;  2O1K A;  5B5E E;  1Q90 D;  3V2N A;  3LW5 J;  1S4X A;  5AW4 B;  4R4M A;  5CCH C;  2Z5I A;  1KN7 A;  3P7K A;  3ITK A;  1LTJ A;  4H13 D;  1IFD A;  4EI2 A;  1FZC A;  3L70 E;  3M0D C;  3LW5 H;  4I1L A;  3WU2 E;  3M0A A;  3AE5 C;  4IOI H;  4KHX A;  3IN6 A;  5KKZ C;  3BVH A;  1AQ5 A;  1VQ6 P;  1PGJ A;  3SWK A;  3RBZ A;  2W6B A;  1KV4 A;  1N7L A;  3L74 E;  4EYY Q;  3L71 G;  4IFF A;  4TLF A;  3CCU P;  1ZOY C;  1G2C B;  2OYH B;  1H0T A;  2A45 G;  2PFX A;  2P67 A;  3H1K D;  5BU5 A;  4H44 B;  2ZFC A;  1KYO H;  3VN0 A;  2E76 B;  2G8Y A;  1AFO A;  3A0B E;  2FFD A;  3V2Q A;  1S5L E;  4M3L A;  4NPD A;  3ABV C;  3L71 E;  1RF0 A;  5KLV G;  1KFN A;  2WQY C;  1AVY A;  4XA4 A;  2WT7 A;  3H1I G;  1SFC C;  1EC5 A;  2FYZ A;  2WPS A;  2DW3 A;  4L73 A;  1YIT P;  3M9B A;  2M5A A;  1T3U A;  1IFJ A;  4L75 A;  1JM0 A;  2YNY A;  5KLV E;  1JB0 J;  2YKO A;  1GL2 B;  3H32 A;  1N7S A;  1YTZ I;  4D6T J;  2LKM A;  2E75 D;  2E42 A;  3AE3 C;  4DJG A;  4WWI A;  3H6P A;  2AXT H;  3GLM A;  1DEE G;  2WPR A;  3CCM P;  3B5N A;  3SWY A;  4BRY B;  2K88 A;  1MFZ A;  4QMA A;  2OQQ A;  1Q2N A;  3CXH I;  5AVZ B;  4I6M C;  3G6E P;  4O9B A;  4YPC A;  2W83 C;  3RK2 D;  1VF5 D;  3CX5 I;  1Q86 Q;  1DIP A;  1SQP G;  3TNU A;  3WUT A;  1SQX K;  3G71 P;  3AEG C;  1UII A;  4PV1 D;  3AED C;  2E74 B;  1NAF A;  2R5B A;  1RE4 A;  3V4Q A;  1RHZ B;  3S9O A;  3L73 G;  3CWB J;  2E43 A;  2N1T A;  1M1J A;  5AW2 B;  3AEC C;  3L36 A;  1GK4 A;  1L0L G;  2A06 G;  1Y9B A;  1BGY J;  5GTI H;  3EFG A;  2IYO A;  2WZ7 A;  1SQQ K;  2JJL A;  1IK9 A;  5KJ7 A;  1E79 H;  1M1K Q;  1NTZ K;  4UB8 H;  3L73 E;  1GL2 C;  2WSS H;  2LR2 A;  4R4L A;  1ZR4 A;  3S1K A;  5CBN A;  2GUV A;  1RQV A;  1RF1 C;  2R3C A;  1L0L E;  1NAY A;  2A06 E;  4GOE A;  3SFD C;  1A02 J;  1KQG B;  1NU1 D;  1W2B O;  1LT9 B;  2P7J A;  3IR9 A;  2E75 B;  1EXI A;  1T2K C;  1FOS E;  3AEF C;  3QH9 A;  1KQF B;  3HD7 A;  1R5L A;  2M3E A;  2E74 C;  2N1T D;  1J2J B;  5TIS E;  2FXO A;  5APW A;  2B88 A;  3TSI A;  2QJP C;  4LLH A;  5CCG C;  2XKM A;  3CWB D;  3CXH H;  3KZI E;  3P32 A;  4PV1 B;  3P8C E;  4OWF A;  5E79 E;  1L0N J;  3CX5 H;  2QRX A;  4WB4 A;  3NFQ A;  1AV1 A;  3B71 A;  1YJN P;  1RY3 A;  2WVR A;  3KPE A;  1N73 C;  3OW2 O;  2W6A A;  1IFP A;  3T97 B;  3VYI A;  1NTK K;  4JQ0 D;  2IDB A;  3L75 G;  1Y47 A;  1NVO A;  4U3F D;  1E5W A;  3D6Y A;  1X22 A;  1HH0 A;  1IFM A;  1J1D B;  1L4A C;  1BDC A;  2KNC B;  3ZDM A;  3TGU J;  1LT9 C;  1OXZ A;  1NTM J;  1NU1 G;  3HD7 D;  2OYI A;  5CHX A;  2OTK E;  4N78 E;  1RE3 A;  2PRR A;  1LTS C;  1XTG B;  3L75 E;  1ZN5 A;  5B5E H;  3D6Z A;  2NPS D;  1IZN B;  1DEB A;  3FGA D;  2H7H A;  1JEK A;  3CXH D;  1G1I A;  2YMK A;  2YKP A;  3CX5 D;  3RK3 B;  3PP5 A;  5CCH D;  3L74 J;  3WU2 H;  1IO4 A;  5L8R J;  1S5L X;  1NU1 E;  4WY4 C;  2K1A A;  3M9H A;  1L0N D;  3FWN A;  1JCD A;  5CBO A;  1PPJ D;  3V2R A;  1AVO A;  3VP8 A;  3RK3 E;  2QG4 A;  1LNQ A;  3MD0 A;  3HTK B;  4WBA A;  3OJA B;  1PP9 G;  2WIT A;  2NRG A;  2UWJ E;  4PJ0 E;  3L71 J;  3C1L A;  3JSV C;  3FXD A;  3N7N A;  3A0B H;  3A7O A;  3AEA C;  2POH A;  3O6Q B;  3VMX A;  1G2C A;  2J58 A;  1PIX A;  3CME P;  2KSE A;  2FXM A;  1S5L H;  2OYH A;  3V5B A;  3I56 P;  2JWA A;  3TYY A;  1S2E A;  1FC2 C;  2C0W A;  4ZKP A;  2FY8 A;  2A45 H;  1PP9 E;  2JKV A;  1H88 A;  1YQ4 C;  4AYC A;  2KLU A;  2K9Y A;  1SFC D;  3SSU A;  2H43 A;  5KLV J;  3L70 D;  2V4H A;  1SQB J;  3MUD A;  3Q5P A;  3RK3 C;  4TT3 H;  2ITA A;  3GHG B;  2NPS B;  3VMA A;  4OVN F;  3MGN A;  1KQL A;  1GW3 A;  3CD6 P;  4IL6 X;  2GM4 A;  3G9R A;  3E7K A;  3V6I A;  1GL2 A;  2HOD B;  1USE A;  1YJ9 P;  1JOC A;  2XND H;  5CJ0 A;  1MV8 A;  2QJK B;  3B4S A;  3L37 A;  1M7L A;  1OMI A;  4BRY A;  4H44 D;  5AW0 B;  5AVV B;  5APT A;  2IYP A;  3NXS A;  2KOG A;  1PPJ E;  4HJG H;  1QVF O;  3H1K J;  3CCS P;  1CI6 B;  2XZR A;  1KD1 Q;  5CMZ A;  1GTW A;  3HRN A;  3S4R A;  1NTK G;  1SS1 A;  1XTC C;  1OW6 A;  3L73 J;  3H1L G;  5KLV D;  1VQ4 P;  1TU3 F;  1LWU A;  3H1I D;  4C7N B;  4MN4 C;  1PZQ A;  2R32 A;  5KAI E;  2P58 A;  2FYU K;  1SFC B;  3RL0 g;  1EXJ A;  1GL2 D;  3AE4 C;  3NTN A;  1FBM A;  1AA0 A;  3I5C A;  1WMK A;  1NTK E;  2CPB A;  3CLQ A;  1GU4 A;  1JTH B;  1URQ C;  5AVX B;  3H1L E;  2I1K A;  1BE3 D;  1YHQ P;  1Q81 Q;  3D70 A;  1OVR A;  1PGQ A;  2QJK C;  1S1C X;  3CCR P;  3CCQ P;  3MTU E;  2Q6Q A;  1T2K D;  1K8A Q;  1DH3 A;  1T3J A;  1OW8 A;  5AVQ B;  3PTZ A;  1SQV D;  3PLN A;  1LT9 A;  5TIS H;  2YXQ B;  2O3J A;  1FU1 A;  2E74 D;  1Q82 Q;  1SQP D;  3KZI H;  3KDP B;  5CCG D;  4UB6 E;  5E79 H;  4JBZ A;  1OFC X;  3D71 A;  5GTH E;  2O01 J;  3L73 D;  1JY2 N;  2Z5H A;  3HE5 B;  2RMZ A;  1Z56 A;  1U7J A;  3H25 A;  2Y9Y A;  3AE9 C;  3U1A A;  2IBZ G;  2QA4 P;  2O01 H;  3M06 A;  1L0L D;  2A06 D;  2O1J A;  3KHU A;  2Y0E A;  4AQR D;  5APX A;  2I1J A;  3AE1 C;  2ZYA A;  1YTZ T;  1VQL P;  3SWF A;  3F89 A;  1KFM A;  3T97 A;  3C9I A;  3CCE P;  3L75 J;  1L4A D;  1M8O B;  4IFM A;  1KMI Z;  2BCC D;  1BE3 G;  3A0H E;  3OA7 A;  3MP7 B;  2Z4E A;  3PHL A;  3H1I E;  3EFF K;  2RKL A;  1BCC G;  1RF1 B;  2MKV A;  4GT1 A;  2KNC A;  1R8E A;  3V4W A;  1K04 A;  3P8C D;  1NU1 J;  2R3S A;  1SQV G;  1USD A;  3RBX A;  3H1H D;  4I2L C;  2IX7 C;  1BE3 E;  1NH4 A;  3EQ2 A;  2K37 A;  1HJB A;  5APV A;  4WY4 D;  3USS A;  1GZL A;  2ZAE B;  3GF3 A;  2M0B A;  1LTA C;  2QJP B;  2J5U A;  2OGU A;  2WSC J;  5KTB A;  1SQV E;  2Q7C A;  4PJ0 H;  4JPZ B;  1FZF A;  1DD3 A;  2BEQ D;  2WSC H;  3L72 D;  3A3Y B;  1SQP E;  2XNX A;  1OVV A;  3HTK A;  1ZRT D;  1KB9 I;  1BSH A;  3BRT B;  1PP9 J;  3K5B A;  1OIP A;  2KLV A;  4N78 D;  1VQ7 P;  2KS1 B;  1VQ8 P;  4N3Y B;  2HLO A;  1N73 B;  3P8M C;  3L75 D;  5H2F E;  1WRG A;  3O6Q A;  2HYN A;  2BCC G;  2WMM A;  2FYU G;  4U3F J;  3KQG A;  5AW5 B;  1L4A B;  2KSJ A;  1JUN A;  1JNM A;  1ZV8 A;  1VQ5 P;  1HWT C;  1JY3 N;  3A2A A;  3H1H G;  3RK3 D;  1PGO A;  4GKG A;  3FX0 A;  4B86 A;  2PGD A;  4HB1 A;  4I7Z B;  2BCC E;  1ZP0 C;  2FYU E;  3AEB C;  3FWL A;  3GHG A;  2K9J A;  2JEE A;  2NPS A;  2BAS A;  1L0N K;  1JY3 O;  3KXD A;  2JO1 A;  1QL1 A;  4WY4 B;  1KQS O;  1S9K D;  4LGD E;  3HUS C;  5CCH A;  2M3B A;  3H1H E;  2HOD A;  3L72 G;  5B66 E;  1PP9 D;  5KLI C;  3M0D A;  5KAF E;  2RH0 A;  3TK1 A;  1Q7Y Q;  1CZQ A;  4EIJ A;  3AE8 C;  2ZT9 C;  2Q3E A;  3W67 A;  4Y99 C;  4K35 A;  1NTM K;  4K3A A;  4RJT A;  1LTJ C;  1ZR2 A;  1CI6 A;  3IFM A;  3L72 E;  2XDJ A;  1FZC C;  1LGH B;  1SQQ D;  2FYN C;  5KAI H;  1ZRT E;  3GF7 A;  1HBW A;  2IBZ I;  1OZH A;  1N7S B;  1NTZ D;  2YO3 A;  2ZXE B;  4BXL A;  2KZJ A;  2FXP A;  1VQK P;  1KIL B;  3H1L J;  1CSB A;  2XV5 A;  5AW3 B;  4I7Z C;  3L70 J;  1X0T A;  4YXW H;  2N9Y B;  1CW5 A;  4C7N A;  5TJH A;  1HVV A;  1SFC A;  1VQM P;  1X79 B;  2KIK A;  1NOH A;  1W2E A;  2B9B A;  1KIL E;  2SPZ A;  1DX7 A;  2FFD C;  5M1B A;  1JTH A;  1LTT C;  1LP1 B;  1SQX G;  1RF0 C;  1NKN A;  5BVZ A;  3MIW A;  2KZI A;  1RH5 B;  5CJ4 A;  4JF7 A;  4UB6 H;  4ASV A;  1LTG C;  1KB9 D;  1FOS F;  1BGY G;  1SLQ A;  5GTH H;  1S3J A;  1P84 I;  3MHV A;  1QX8 A;  2H8P D;  2OTL P;  3Q2Y A;  1S9K E;  1H8A A;  1SQX E;  1FZB A;  2FBW C;  1K05 A;  4W7Y A;  5AW8 B;  1FS0 E;  1N7S C;  2C0X A;  1SQQ G;  3VP9 A;  1NTK D;  1NO4 A;  3EWK A;  5KLV K;  4NPE A;  1KIL C;  1NTZ G;  3H1L D;  3HE5 A;  1SQB K;  3B5N C;  3WUV A;  1EDK A;  3TF5 A;  1BGY E;  2YO2 A;  1QEX A;  2Q5U A;  5APY A;  1UIX A;  3H1I J;  2Y9Z A;  3JCU E;  2GA1 A;  4OH8 B;  3CCV P;  3A0H H;  1SQQ E;  3C8V A;  1NTZ E;  3II6 A;  3OAK A;  3H1J D;  1J1E C;  1RE4 C;  2KYV A;  1URQ B;  1ZXG A;  1BE3 J;  2L91 A;  1X9V A;  2KUB A;  2QM8 A;  1RQU A;  1AJY A;  1M1J C;  1D7M A;  3Q5R A;  1EDI A;  1AQT A;  1RF1 A;  4KJM A;  4LC1 A;  2WSF J;  1SQV J;  1JY2 P;  1T8Z A;  1OWA A;  2W6J H;  4HH2 A;  1MKM A;  3CC7 P;  1KYO I;  1SQP J;  5KJ7 C;  3Q5S A;  2WSF H;  1YI2 P;  1YBK A;  2KB7 P;  4L74 A;  4ZMD A;  2N9B A;  5AVR B;  5CCG A;  3B8E B;  2AEJ A;  3CMA P;  1KB9 E;  2IBZ D;  3CCJ P;  2FKW B;  4H0L B;  1NTM G;  2OYI B;  1L0L J;  1PGP A;  3WUU A;  5H2F H;  2HG5 D;  2CK3 H;  2GUS A;  3HD7 C;  1IFN A;  4DCK A;  1ZME C;  1U7M A;  2KS1 A;  2OYO A;  2G3A A;  2ZJS E;  1N73 A;  5C39 A;  2Y0C A;  2HR3 A;  3UIA A;  3H1J G;  1QLE D;  2BCC J;  5APQ A;  3M91 A;  4DOJ A;  2HPC B;  1NTM E;  3IF4 A;  1BCC D;  1OW7 A;  1L4A A;  4PD4 E;  2QM7 A;  2C9N Y;  1BSN A;  2YKQ A;  3FXE A;  3SFE C;  1GDT A;  2XU6 A;  3H1H J;  2VRS A;  3L4F A;  4JYB A;  3H1J E;  3RL0 B;  4W80 A;  4Z1M H;  1A02 F;  1P84 D;  1KC8 Q;  2OAR A;  1L2P A;  5B66 H;  2PAJ A;  2MJZ A;  1EZV G;  5KAF H;  3BCC D;  4H0L C;  2J59 M;  3Q1M A;  4WY4 A;  1NHL A;  1FDO A;  2OYI C;  2B87 B;  5K5G B;  2ZXX A;  2IZ1 A;  1RE3 C;  3TDK A;  3L72 J;  1G1J A;  1R5S A; 
#chains in the Genus database with same CATH homology
 1JY2 O;  1ZV8 A;  4WY4 C;  2W27 A;  3M9H A;  2M8R A;  3M9Q A;  1HWT C;  1JCD A;  3V2R A;  3L35 A;  2Q9I A;  1JY3 N;  3A2A A;  4HYT B;  3RK3 D;  3VP8 A;  3G3Z A;  4GKG A;  1VPC A;  4B86 A;  3MD0 A;  4N6J A;  1JY3 P;  1L0L K;  3HTK B;  4WBA A;  3KYQ A;  3OJA B;  1QL2 A;  5AVS B;  2WIT A;  1SP4 A;  1NU1 K;  1JMM A;  3GHG A;  3HUS A;  1KZU B;  5AVW B;  2JEE A;  5AVY B;  2NPS A;  1NKZ B;  2BAS A;  1L0N K;  2YMY A;  3U1C A;  3CI9 A;  1JY3 O;  3N7N A;  3A7O A;  2POH A;  3VMX A;  4RES B;  1G2C A;  1QL1 A;  2PP6 A;  2J58 A;  4WY4 B;  2FXM A;  1S9K D;  2OYH A;  4C46 A;  3V5B A;  1KIL A;  3GHG C;  4LGD E;  3HUS C;  3RL0 C;  3HE4 B;  5CCH A;  2L5G B;  3LIE A;  2M3B A;  4EOT A;  3TYY A;  1MZ9 A;  2NPS C;  2HOD A;  2C0W A;  4ZKP A;  2O1K A;  3M0D A;  2A45 H;  3BRV B;  2OYH C;  3V2N A;  1H88 A;  5AW4 B;  3TK1 A;  5APS A;  4AYC A;  2IFN A;  3A5T A;  5CCH C;  1SFC D;  1CZQ A;  2Z5I A;  3P7K A;  4EIJ A;  1LTJ A;  3BAS A;  2H43 A;  1IFD A;  1FZC A;  4Y99 C;  3M0D C;  3LW5 H;  4I1L A;  3M0A A;  1HGZ A;  2R5D A;  3MUD A;  3NMD A;  1ZLL A;  2P2U A;  4KHX A;  3RK3 C;  3BVH A;  3GHG B;  1LTI C;  3HUS B;  1NTM K;  1AQ5 A;  1GW4 A;  1LTJ C;  1ZR2 A;  1CI6 A;  3IFM A;  2HFE D;  2W6B A;  1N7L A;  2NPS B;  2XDJ A;  1FZC C;  1LGH B;  3MGN A;  1KQL A;  1HBW A;  1GW3 A;  4IFF A;  1LWU B;  2IFM A;  1N7S B;  2ZXE B;  2YO3 A;  1G2C B;  4W7Z A;  4XE5 B;  2WPQ A;  2OYH B;  2GM4 A;  1KIL B;  2A45 G;  5AW6 B;  1SVF A;  1CSB A;  2P67 A;  2XV5 A;  5AW3 B;  5BU5 A;  1GL2 A;  2HOD B;  2ZFC A;  4Y99 B;  1CW5 A;  3VN0 A;  1JOC A;  4C7N A;  1N7S D;  5CJ0 A;  1AFO A;  1MV8 A;  2FFD A;  1GD2 E;  1HVV A;  1SFC A;  1KIL D;  1X79 B;  3L37 A;  1NOH A;  1M7L A;  1W2E A;  3V2Q A;  4M3L A;  1LTJ B;  3B5N D;  5AW0 B;  1RF0 A;  5AVV B;  3V2P A;  5APT A;  1KFN A;  1FZC B;  1FJP A;  3NXS A;  3BAT A;  1NWQ A;  5APU A;  4XA4 A;  2WT7 A;  1IC2 A;  1DX7 A;  4AUW A;  3E1I A;  2FFD C;  2KOG A;  1JTH A;  1SFC C;  1LTT C;  2FYZ A;  2WPS A;  1WT6 A;  1CI6 B;  1RF0 C;  1NKN A;  2XZR A;  5AW9 B;  5CMZ A;  3M9B A;  1GTW A;  5BVZ A;  1T3U A;  3MIW A;  1HUC A;  3HRN A;  3WMM 0;  5CJ4 A;  1IFJ A;  3VTP C;  4JF7 A;  1XTC C;  1JCC A;  2YNY A;  1LTG C;  1FOS F;  2YKO A;  1SLQ A;  1GL2 B;  1LWU A;  3H32 A;  1YYC A;  1N7S A;  1YTZ I;  2LKM A;  1EQ7 A;  4C7N B;  2H8P D;  2R32 A;  3O8Z A;  2E42 A;  1PFI A;  1S9K E;  2FFD B;  2FYU K;  1H8A A;  3H6P A;  3RK2 B;  1SFC B;  1URQ A;  2WPR A;  1FZB A;  3B5N A;  3SWY A;  4W7Y A;  5AW8 B;  1IFI A;  1GL2 D;  1LWU C;  2CPS A;  1MFZ A;  1N7S C;  2C0X A;  3NTN A;  3VP9 A;  1FBM A;  3I5C A;  1NO4 A;  5KLV K;  5AVZ B;  2WT7 B;  1KIL C;  4GIF A;  2CPB A;  1GU5 A;  4I6M C;  3CLQ A;  4O9B A;  1GU4 A;  3RK2 D;  1JTH B;  3HE5 A;  1URQ C;  5AVX B;  1SQB K;  3B5N C;  2I1K A;  5AW1 B;  5KJ7 D;  3TNU A;  2YO2 A;  2Q5U A;  5APY A;  1SQX K;  3VMY A;  2KP8 A;  1NAF A;  2A45 I;  3MTU E;  2R5B A;  1T2K D;  1FJK A;  4OH8 B;  1RE4 A;  3V4Q A;  1DH3 A;  1T3J A;  5AVQ B;  1LT9 A;  3H32 B;  2E43 A;  2N1T A;  3II6 A;  2Q3I A;  3OAK A;  1M1J A;  1FU1 A;  5AW2 B;  3L36 A;  1GK4 A;  1J1E C;  1RE4 C;  2KYV A;  1URQ B;  3B5N B;  3KDP B;  5CCG D;  1GK6 A;  2WTY A;  2IPP A;  3EFG A;  1X8Y A;  1X9V A;  1HTL C;  2QM8 A;  2WZ7 A;  3CL3 D;  3VOP A;  1M1J C;  1SQQ K;  1RF1 A;  2JJL A;  1IK9 A;  5KJ7 A;  1JY2 N;  2Z5H A;  1URQ D;  3HE5 B;  1NTZ K;  1Z56 A;  4LC1 A;  1HGV A;  1GL2 C;  4ZKU A;  3TNU B;  1JY2 P;  1T8Z A;  3U1A A;  1OWA A;  1ZR4 A;  4HH2 A;  2GUV A;  2O01 H;  3M06 A;  3RK2 C;  2O1J A;  1RF1 C;  2R3C A;  5KJ7 C;  2WSF H;  1J1E B;  4AQR D;  1A02 J;  5APX A;  2I1J A;  1LT9 B;  2HPC A;  2P7J A;  2C9L Y;  3IR9 A;  4DZO A;  1YTZ T;  2N1T B;  4C7R A;  2KB7 P;  3SWF A;  1T2K C;  1KFM A;  1M1J B;  3T97 A;  3C9I A;  2N9B A;  5AVR B;  1FOS E;  1L4A D;  5CCG A;  3B8E B;  4IFM A;  1FAV A;  1VDF A;  1N2D C;  4IFD K;  2FKW B;  3HD7 A;  3OA7 A;  2Z4E A;  2N1T D;  1J2J B;  2OYI B;  5APW A;  3TSI A;  1RF1 B;  2HG5 D;  4LLH A;  5CCG C;  4GT1 A;  2XKM A;  3V4W A;  3P8C D;  2GUS A;  3HD7 C;  3P32 A;  1IFN A;  3P8C E;  1N86 A;  2WWW A;  5AVU B;  1N73 A;  4WB4 A;  1J1D C;  4I2L C;  3UIA A;  3NFQ A;  2IX7 C;  2P1J A;  1RY3 A;  5APQ A;  1NH4 A;  3EQ2 A;  3M91 A;  4DOJ A;  3KPE A;  1HJB A;  2HPC B;  5APV A;  4WY4 D;  1GZL A;  1N73 C;  2W6A A;  1L4A A;  3VYI A;  1NTK K;  4JYC A;  1FZA A;  2QM7 A;  1LTA C;  2C9N Y;  2YKQ A;  5AVT B;  3U59 A;  1GDT A;  5KTB A;  2XU6 A;  3N4X A;  3HD7 B;  2Q7C A;  1IJD B;  1E5W A;  1FZE A;  1HH0 A;  1IFM A;  2VRS A;  1FZF A;  1J1D B;  1L4A C;  1LTB C;  3L4F A;  4JYB A;  3VMZ A;  3RL0 B;  2WSC H;  3A3Y B;  2XNX A;  4W80 A;  3HTK A;  1LT9 C;  1OXZ A;  1A02 F;  3BRT B;  3HD7 D;  2N1T C;  2OYI A;  2KLV A;  5CHX A;  4N78 D;  1SQV K;  4N3Y B;  4N78 E;  2OAR A;  2HLO A;  1N73 B;  3P8M C;  2PAJ A;  1RE3 A;  3RL0 D;  1LTS C;  1XTG B;  1FDM A;  1ZN5 A;  2MJZ A;  2NPS D;  2WSE H;  1DEB A;  1WRG A;  2J59 M;  3LID A;  2HYN A;  5BU8 B;  1SQP K;  4WY4 A;  2H7H A;  1NHL A;  1JO5 A;  2OYI C;  1G1I A;  3KQG A;  5AW5 B;  1MUU A;  1FZG A;  2YKP A;  3HE4 A;  5AW7 B;  1RE3 C;  3RK3 B;  3PP5 A;  5CCH D;  1L4A B;  1H89 A;  2KSJ A;  1G1J A;  3R2P A;  1JUN A;  1IO4 A;  1JNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...