4I1LA

Structural and biological features of foxp3 dimerization relevant to regulatory t cell function
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
62
structure length
62
Chain Sequence
PGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Forkhead box protein P3
publication title Structural and biological features of FOXP3 dimerization relevant to regulatory T cell function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulator
total genus 25
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16159 FOXP-CC FOXP coiled-coil domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i1lA00
3BATA 4GIFA 4N3YB 1IC2A 3U59A 4O9BA 3OJAB 3VP8A 3N7NA 3P8CD 2POHA 3U1CA 5KTBA 3VP9A 3HRNA 4ZKUA 5BU5A 3N4XA 5BU8B 3C9IA 1WT6A 3BASA 4I1LA 4ZKPA 4N78D 5BVZA 1NKNA 1X79B 3U1AA 2FXMA 2JEEA
chains in the Genus database with same CATH superfamily
1N7SB 5APVA 1NAYA 1JNMA 1ZP0C 5AW3B 2W6JH 2C9LY 2LKMA 1PGPA 3P8MC 2J58A 3B5NA 2K3RA 3IN6A 1IFPA 3L70D 3AEBC 3SFDC 1IK7A 4H13B 2V7QH 3VOPA 4GT1A 1IFMA 3CCVP 1RE3C 1SQVG 5AW5B 4YPCA 1PGQA 3AEDC 2L5GB 1RY3A 4IFFA 3JC22 1FS0E 3AE1C 2FYUK 2E75D 5APTA 5KLVK 3HE5A 3L70J 2C0WA 1RF1B 2KXPB 4PV1C 1LTJB 2H88C 2B87A 2OYHA 2RN0A 2WPRA 1VQPP 3V2QA 3L74D 1Q2NA 3KPEA 3TK1A 3TGUD 3CXHE 3A0BE 3L73D 4OGQB 3HUSB 1IFNA 1M1KQ 3L75G 1KD1Q 2NPSC 1JY2P 1EZVI 1SQBK 1Q7YQ 1OVRA 5AW7B 3L74J 3TGUJ 3B5ND 4H0LC 2KSEA 3L73J 4NPDA 2E76C 4U3FE 3LIEA 1BGYG 1YIJP 3L70E 1EDKA 1VQKP 2R5BA 5M1BA 2FXMA 2KS1A 3TNUB 3R2PA 3BCCJ 1VQ8P 1URQD 1HH0A 2WSEH 4U7JA 1KB9E 2YKPA 1H0TA 1PV3A 2KI7B 1J1DB 4PD4I 1X9VA 5CJ0A 4I1LA 1N7SA 1M1JB 1YITP 3T97B 3TGUE 2Q3EA 2N9BA 1NU1D 4HH2A 3OJAB 2HG5D 1YTZT 3HTKA 1LT1A 2ZFCA 3VMYA 1CI6B 1KYOH 1FC2C 3N4XA 4PJ0E 2XDJA 2GUVA 4EOTA 2FFDC 5GTIE 1NU1J 3M9HA 1FU1A 3BCCE 4N3YB 3S4RA 2PAJA 1SS1A 5KLVD 4JF7A 2OYOA 2QEXP 3NFQA 1BDDA 2BEQD 1YJ9P 2XKMA 3V5BA 3FWNA 1GW4A 3MP7B 4IL6H 1JY3N 4N6JA 1KQSO 2WSCH 2HFED 1VDFA 3TSIA 2O01J 4DOJA 1NGMB 2AXTE 1R5SA 2B9BA 3PP5A 3G6EP 2E75C 3L74G 1NU1E 3BATA 4BRYA 2KOGA 3L73G 2YMYA 5AVUB 4YXDC 1ZLLA 1HVVA 1QVFO 3FGAD 1NTME 2N1TB 2FY8A 3IAOA 3SFEC 2WITA 4JQ0D 1FZAA 1JTHB 3SSUA 5DJUB 2Q6QA 5AVTB 3CX5I 1OIPA 2W6BA 1Q90D 2H7HA 3EQ2A 1EXIA 1CI6A 3KXDA 1T3UA 3WUVA 1WT6A 2KLUA 3V4QA 1NKZB 1URQC 4NPFX 2HPCB 1WRGA 3OAKA 2K9JB 1OW6A 3A0BH 2LR2A 2YXQB 4DT0A 2C0XA 2JWDA 3KYQA 2W27A 3KQGA 4N78D 1YI2P 2IDBA 2DW3A 2ZVNB 2IYOA 3BRTB 5GTHE 1SQPD 1T6AA 4I7ZC 3N7NA 5KLVG 2KYVA 2I8DA 2QJYB 4I6MC 2FBWC 2A45G 1YJNP 1KTMA 1L0NK 3AE8C 3MGNA 1JCCA 1JY3O 2QM7A 3V2RA 1SQPJ 1NWQA 3PRJA 1LGHB 5H2FE 4DZOA 1U57A 1KB9H 1RE3A 4RJTA 1EC5A 2WPVB 1YJWP 1QX8A 1SQBG 4C46A 3IFMA 2BEZF 1BSNA 2KZJA 2WT7B 5B5EH 2QM8A 2Q1KA 1PP9G 4PJ0H 2CPBA 2ZT9D 1HGVA 2BASA 1S9KE 2NPSA 4N78E 2FXPA 2XV5A 3NXSA 1LTTC 3B8EB 2QA4P 1SQPE 3L72D 1N73B 1FZCC 2G8YA 1BE3D 2KB7P 2QRXA 3P8CD 2Q7CA 1G2CA 4KHXA 4MN4C 4R4LA 1CZQA 2E75B 5AW2B 2Q9IA 1FZEA 2ITAA 2ZXEB 3SWFA 5C39A 3L72J 1D7MA 2JEEA 4R4MA 1BE3J 1KYOI 1NO4A 2M3EA 1M56D 3VP9A 2LXBA 4PV1D 2NRGA 2AXTH 3K5BA 1N8RQ 5KKZC 4C7RA 3B5NB 3QH9A 3EFFK 3CCQP 1ZXGA 3H1HD 2NPSD 1IO4A 3HRNA 1S5LX 1K05A 4I2LC 3M06A 1KFMA 5AVWB 4H0LD 1RF0C 3M91A 4WY4D 2FFDA 2IBZE 3H1HJ 1BE3E 4GIFA 4KJMA 1LP1A 4H44D 2OYHB 3FXDA 1KILD 1LTIC 2O01N 1IJDB 1M8OB 3MD0A 2YKOA 2FYNB 1PPJD 3EWKA 2QJKB 1SQVE 3HD7C 1FOSE 5KTBA 3I55P 2KUBA 3RK3D 4DJGA 2Y9ZA 3MTUE 1BDCA 5KAFE 5KLIB 1XTCC 1S2EA 4AQRD 5AVYB 1HGZA 1SQXD 2CPSA 2ZYGA 2GUSA 3CCMP 4A7PA 2KS1B 5BU5A 2YO3A 3L75E 2WSFH 2M5AA 2K88A 3BRVB 2YIUC 2YKQA 3L72G 3CI9A 1JY2O 1OFCX 1P84H 2BCCD 1SQXJ 2R5DA 1NTKK 4IFMA 4XFJA 2P2UA 3L71G 1BGYE 5H2FH 4BXLA 1NH4A 1PIXA 3HTKB 2OTJP 3D6YA 5L8RJ 2KLVA 2BCCJ 3H1KD 4UB8E 2QVAA 2D2CB 1DH3A 1PGOA 3H25A 1N86A 1LTGC 5AVVB 1VQ6P 2JP3A 5CHXA 1FZCB 1T3JA 1G1IA 1Y47A 5APUA 2O1KA 1URQA 2AEFA 1S5LE 1MUUA 3H1KJ 1JB0J 3LIDA 3H1HG 5TISE 2KNCA 2R3SA 3U1CA 3Q5PA 5TJHA 2UWJE 3R4YA 3PJSK 3M9QA 1NTZK 1KB9I 1OX3A 1VPCA 3IR9A 3CWBD 2R44A 3WU2E 3CPWO 2FYZA 4ASWA 2N9YB 2CK3H 4WY4C 2MKVA 4D6TD 1EDIA 4BRYB 4GDOA 4H44C 3CWBJ 3FWLA 1KILC 1LNQA 1PPJG 1PFIA 1L4AD 1W2EA 2WZ7A 4PD4D 1VQ4P 2OTLP 2XNDH 4D6TJ 1S4XA 1L0LK 4GOFA 5CBOA 2R3CA 1T2KC 4HB1A 3RK3C 3AE3C 3L74E 2FKWB 2Y9YA 1OXZA 4JPZB 1SQXG 3O8ZA 2MJZA 2Z4EA 3L73E 2C9NY 3E1IA 3KZIE 3BASA 1SFCD 3V2NA 2XU6A 1MKMA 3V4WA 1A02F 2BCCG 3H1LG 1FZCA 2QJPC 1FZBA 4GOEA 2Y0CA 5CCHA 2PFXA 4RO0A 2FYUD 2B88A 3C9IA 5APXA 3CL3D 3KHUA 3IF4A 2WQYC 3H1KG 5AW8B 1FDMA 3AEFC 2FYUJ 3W67A 5KLVJ 2ZT9B 3W68A 2Z5IA 2HODA 3LW5H 1FE6A 1SQBD 2KZIA 4ZMDA 1AVOA 2I1JA 3H32A 5APYA 2E74C 1PP9D 2H89C 3VP8A 1EZVG 3A3YB 1SQBJ 2K1AA 1X79B 3CWBG 5AW1B 1RF0A 1EXJA 5CCHD 4H13D 1IFIA 2RKLA 5APWA 1PP9J 3GHGC 2KK7A 1HBWA 3M0DC 3CX5D 4PV1B 2POHA 5KLVE 4D6TG 3E1RA 1UIIA 3AE9C 1GK4A 1FJPA 2JWAA 2NPSB 3E7KA 3F5HA 1IFDA 1MFTA 3HD7A 4K3AA 1NHLA 1JMMA 1ZV8A 1S5LH 1L4AC 1VQNP 1P84I 4H0LB 1SQBE 1VQ5P 4WY4B 1LJ2A 3JCUE 1G2CB 2JKVA 1SQQK 3CCJP 2WPSA 5TISH 1NTKG 2E76B 4H44B 3CXHH 1PP9E 1J1EC 1JO5A 1YQ4C 1KILB 2V4HA 4Y28J 4EI2A 2WPQA 1AQ5A 3AEEC 4RKUJ 1RHZB 3FXEA 1J2JB 2XNXA 3A7OA 4AYCA 3D71A 2V7QJ 1LTAC 1SFCC 3NTNA 1SQVK 2FYUG 1IZNB 5AW4B 4IFDK 4C7NA 1T8ZA 2E5TA 3H6PA 4W80A 5AW0B 1X22A 4Y99C 1PZQA 1R5LA 3HD7D 3UIAA 1SLQA 4L73A 4YXWH 4XA4A 3MHVA 2FFDB 1W5CE 1NTZG 1R8EA 3V6IA 1LP1B 1K04A 4HJGH 3OA7A 4CPGA 1FZGA 3CCRP 1JMBA 5B66E 1IC2A 4NPEA 1DIPA 5CCGD 4OWFA 1HJ0A 1H89A 1LWUC 1KMIZ 1AFOA 5GTIH 1Q81Q 3WUUA 4L76A 5KAIE 3M0AA 1DD3A 3P32A 2HLOA 3A2AA 2GM4A 4JYCA 1KC8Q 1L0LG 2Y0EA 5CCHC 3ABVC 4WY4A 1HWTC 3MZWB 4H13C 2WSEJ 1HUCA 3USSA 1YBKA 5AVZB 1SQQD 3L71D 1KYOD 5AW6B 1KILA 1ZMEC 2W6AA 2M5AB 1K8AQ 3ITKA 1KFNA 1RF1C 3H1JD 3RK2D 3AE7C 4OH8B 2IBZI 1LTJC 3H1ID 1N7LA 2E5YA 1YTZI 1SQQJ 4YTPC 3L71J 5CBNA 4ZKPA 1LT9C 1ZW0A 1PGJA 2Q3IA 4OGQC 3HUSC 3CC2P 3BVHA 3H1JJ 2QG4A 4O9BA 4EIJA 4XE5B 1UIXA 1X0TA 3H1IJ 4ZKUA 1L0ND 2A06G 3B71A 3A5TA 2ZYAA 3II6A 3EFGA 3GLMA 5E79E 1L4AB 4LLHA 3L72E 2RMZA 3HE4B 1URQB 3RL0D 1FDOA 2A45H 2QSIA 3P8CE 1L0NJ 2O01H 1GL2D 1RQVA 3L71E 3F89A 1OVVA 4DCKA 1YQ3C 2KNCB 5AVSB 3U1AA 3RGUA 1J1DC 5CMZA 1EDJA 3D6ZA 1TU3F 4L75A 1T2KD 3JCUH 1QL1A 2AEMA 1SFCB 4I7ZB 1RH5B 1DEBA 2W90A 3MUDC 2QE7H 3TDKA 1K73Q 2ZYDA 3U59A 3H1HE 3AE6C 4IL6E 1OW8A 2JDIH 1JCDA 2J59M 1OWAA 2PP6A 3C1LA 1QLED 1EDLA 5CCGC 1NAFA 5GTHH 3Q5SA 3AE5C 3Q2YA 3S9OA 4UB6E 1GD2E 3CC7P 3GHGA 3VMZA 3H1LD 3M0DA 1DX7A 2M8RA 1KILE 2GA1A 3AEGC 3WMM0 1VQMP 1MZ9A 1SQQG 1EQ7A 2QIWA 1RE4C 2WSSH 3CXHI 1FDIA 2O1JA 1VQ9P 1KQGB 1LWUB 2Q5UA 3H1LJ 4JBZA 1PPJE 1SP4A 4WVZA 3AE2C 3H1JG 4ASVA 1BCCG 1NU1K 3H1IG 3RK3E 4U3FD 1L4AA 2NZ2A 2WTYA 3RK2C 3HE4A 5KJ7D 2E74D 2LXCB 5B66H 1GU4A 1NTMK 1W2BO 3ZDMA 1SQXE 1QL2A 1KB9D 1L0NG 4U3FJ 1EZVD 2OGUA 2H43A 5KAIH 1U7JA 2N1TC 4K35A 2HODB 2BCCE 1NVOA 4B86A 3H1LE 1LT9B 1SFCA 4ZNCA 5KKZB 1E79H 2OYIC 3H32B 1GW3A 2YNYA 4JYBA 3RL0C 4TT3H 4BWNA 4KT0J 1MV8A 3AEAC 1AJYA 2OTKE 1GL2C 3H1KE 2I1KA 2FXOA 3BCCD 1S72P 3CCUP 3I5CA 4OVNF 3FX0A 5APQA 2ZJSE 1YHQP 1FZFA 2IPPA 1OVUA 3L37A 1AV1A 1NKNA 2WVRA 3TF5A 1NTKD 3L35A 2ZVOB 2ZXXA 1EZVE 1FOSF 1MFZA 3WUTA 2R32A 1QEXA 1CSBA 1LWUA 5E79H 3HD7B 1QVGO 1JOCA 3CWBE 4WB4A 2YO2A 1NTKJ 1LTBC 2QJYC 1OW7A 4WWIA 4EDFA 5B5EE 3Q3DA 2E43A 1HTLC 2JJLA 1NOHA 1GU5A 3I56P 4D6TE 4RESB 1BSHA 3O6QB 1GMJA 1NTMD 2PGDA 3M9BA 3CCSP 1M7LA 1VF5D 3CC4P 3GMAA 4LC1A 1SVFA 3B4SA 1RF1A 2YIUB 4PD4E 1IFJA 2W8ZA 1LTJA 1WMKA 2Z5HA 4U3FG 1K9MQ 1NTZD 5KAFH 1AQTA 3L70G 1NTMJ 1LT9A 2A45I 1S3JA 4C7NB 3HUSA 1NTKE 1M57D 1ZR2A 1ZRTD 4IOIH 1M90Q 5KJ7C 1SQPK 1JEKA 2IFNA 1N7SD 1ZOYC 1KQLA 1N2DC 2IFMA 1NTZJ 1N73C 4W7ZA 4UB6H 3C8VA 2P58A 1IK9A 2RH0A 2KIKA 3Q5RA 3TGUG 3RK2B 2D2CD 4M3LA 1GTWA 4HKZH 1L0LD 2FYUE 1X8YA 1VQLP 3TNUA 3S1KA 2OQQA 1FJKA 3TYYA 5AW9B 4UB8H 3CMAP 3GF7A 1USEA 3OW2O 3PLNA 3BCCG 4GODA 3PH0A 2K37A 1P84D 1L0LJ 4EYYQ 5AVXB 1M1JA 1NTZE 3B5NC 2P10A 4OGQD 5DJTB 2H8PD 3T97A 3G71P 3RBZA 1H8AA 2WSFJ 1HJBA 1KN7A 2OYIB 3MUDA 3A0HE 1ZRTE 3RL0B 1XTGB 1AVYA 3VYIA 1HF9A 3O6QA 3CD6P 1GL2B 3GF3A 3SWKA 3PTZA 2YXRB 2A06D 3VN0A 1PL5A 2W83C 4W7YA 5BVZA 1DEEG 3WU2H 5CCGA 3GG2A 2OYHC 1JM0A 2B89A 2PRRA 1L2PA 1NU1G 2P67A 3CX5E 4GKGA 1VQOP 2KSJA 3RK3B 1L0LE 2FYNC 2HR3A 1E5WA 1S9KD 4WBAA 1NYHA 1RE4A 5APSA 2QJKC 1NTMG 3GW6A 5AVQB 4TLFA 3QWOC 1P84E 1KZUB 5KLIC 1VF5C 1U7MA 3NMDA 2QJPB 1KV4A 3CCLP 1ZR4A 2SPZA 1USDA 2J5UA 2KP8A 2ZAEB 3MIWA 3KZIH 2JR8A 5EFWB 5K5GB 2A06E 5AVRB 2N1TA 5CJ4A 1N7SC 1JTHA 1VQ7P 2AEJA 4IL6X 3RL0g 2K9YA 2IZ1A 3P7KA 2OYIA 4Z1MH 2E74B 2Y0DA 2OARA 1GZLA 2D2CC 1S1CX 1Q82Q 4L74A 2IBZD 3VMXA 1GL2A 4PD4H 3SWYA 3KDPB 1FBMA 1JY2N 2HPCA 1BCCD 1SQXK 1JY3P 2K9JA 2G3AA 3GHGB 2M3BA 2M0BA 3V2PA 1GK6A 1KQFB 1FAVA 2HYNA 3Q1MA 1SQVD 2N1TD 3CMEP 1BCCJ 1NJIQ 2IYPA 2AXCA 2VRSA 1AA0A 1VL2A 3PHLA 3G4SP 1Y8AA 2WWWA 1OZHA 2IZ0A 1SQVJ 3CCEP 3D70A 1KORA 2L91A 1G1JA 5BU8B 3L75D 1J1EB 1SQQE 2WSCJ 1A02J 4QMAA 1KYOE 3LW5J 3CLQA 1SQPG 3HE5B 4AUWA 2E76D 2B87B 3H1JE 2IX7C 2P1JA 1BCCE 2WT7A 3H1IE 3L75J 1Y9BA 1M1JC 4HYTB 1YYCA 1BGYD 3A0HH 3JSVC 1H88A 2YMKA 1QGKB 1JUNA 2O3JA 2WMMA 2P7JA 4Y99B 5KJ7A 1Q86Q 1OMIA 3VMAA 1DD4A 1L0NE 3AECC 1BGYJ 1N73A 1ZN5A 2XZRA 2E42A 1RQUA 1VF5B 1GDTA 1LTSC 3CX5H 3G3ZA 1CW5A 3AE4C 1Z56A 3G9RA 4LGDE 3CXHD 3L4FA 3VTPC 2JO1A 1H0TB 2ZT9C 3RBXA 2IBZG 3L36A 1BE3G
chains in the Genus database with same CATH topology
2E43A 1J1EC 1N7SB 5APVA 1JO5A 1HTLC 1NO4A 1JNMA 2JJLA 1KILB 1NOHA 1GU5A 5AW3B 3VP9A 2WPQA 2LKMA 2C9LY 1AQ5A 3P8MC 2J58A 3B5NA 4RESB 1J2JB 2XNXA 3A7OA 4AYCA 3M9BA 1M7LA 4C7RA 3B5NB 3VOPA 4GT1A 4LC1A 1LTAC 1IFMA 1RE3C 1SVFA 5AW5B 2NPSD 1SFCC 1IO4A 1RF1A 3NTNA 1SQVK 2L5GB 1IFJA 1RY3A 3HRNA 4IFFA 5AW4B 4IFDK 1LTJA 4C7NA 1T8ZA 2Z5HA 3H6PA 4W80A 2FYUK 5APTA 5KLVK 5AW0B 3HE5A 2C0WA 1RF1B 4I2LC 3M06A 4Y99C 1KFMA 1LT9A 5AVWB 1RF0C 3HD7D 3M91A 1LTJB 2A45I 3UIAA 1SLQA 4WY4D 4C7NB 2OYHA 2WPRA 2FFDA 3HUSA 3V2QA 1ZR2A 3KPEA 3TK1A 4GIFA 5KJ7C 1SQPK 4XA4A 2IFNA 1N7SD 2OYHB 2FFDB 1KQLA 1N2DC 1KILD 1LTIC 2IFMA 3HUSB 1IFNA 1N73C 2NPSC 1JY2P 4W7ZA 1IJDB 3OA7A 1IK9A 1SQBK 3MD0A 1FZGA 5AW7B 2YKOA 3B5ND 3RK2B 1IC2A 3HD7C 1FOSE 4M3LA 1GTWA 5CCGD 5KTBA 3RK3D 1X8YA 1H89A 3MTUE 1LWUC 3LIEA 3TNUA 1AFOA 1FJKA 3TYYA 1XTCC 5AW9B 4AQRD 5AVYB 2R5BA 3M0AA 2FXMA 3TNUB 3P32A 2HLOA 3A2AA 3R2PA 2GM4A 1HGZA 4JYCA 1URQD 1HH0A 2WSEH 2CPSA 5CCHC 2GUSA 4WY4A 1HWTC 2YKPA 5BU5A 5AVXB 1M1JA 3B5NC 2YO3A 1J1DB 2H8PD 1HUCA 2WSFH 5AVZB 3T97A 1X9VA 5CJ0A 4I1LA 1H8AA 1N7SA 5AW6B 1HJBA 3BRVB 2YKQA 2OYIB 1KILA 1M1JB 3MUDA 3CI9A 1JY2O 2W6AA 3RL0B 2N9BA 1XTGB 4HH2A 2R5DA 1NTKK 1KFNA 1RF1C 3RK2D 3OJAB 2HG5D 3VYIA 1YTZT 4IFMA 3HTKA 4OH8B 1LTJC 2ZFCA 1GL2B 1N7LA 3VMYA 1CI6B 1YTZI 2P2UA 3N4XA 2XDJA 3VN0A 2GUVA 4W7YA 4ZKPA 1NH4A 1LT9C 5BVZA 3HTKB 5CCGA 4EOTA 2OYHC 2FFDC 2Q3IA 2KLVA 3HUSC 3M9HA 1FU1A 2P67A 3BVHA 1DH3A 4N3YB 4GKGA 4O9BA 1N86A 4EIJA 1LTGC 4XE5B 5AVVB 2KSJA 2PAJA 3RK3B 5CHXA 4ZKUA 1FZCB 4JF7A 3A5TA 1T3JA 1G1IA 1E5WA 1S9KD 4WBAA 3II6A 1RE4A 5APSA 5APUA 3EFGA 3NFQA 2O1KA 1URQA 5AVQB 1MUUA 2XKMA 3V5BA 1L4AB 4LLHA 1GW4A 3HE4B 3LIDA 1JY3N 1URQB 3RL0D 4N6JA 2A45H 1KZUB 3P8CE 3U1CA 2O01H 2WSCH 2HFED 1VDFA 3TSIA 3NMDA 1GL2D 4DOJA 3M9QA 1NTZK 1VPCA 3IR9A 5AVSB 3PP5A 3U1AA 1ZR4A 1J1DC 2FYZA 3BATA 5CMZA 2KOGA 2KP8A 2YMYA 4WY4C 5AVUB 1ZLLA 3MIWA 1T2KD 1QL1A 1HVVA 5AVRB 1SFCB 2N1TA 5CJ4A 1N7SC 1JTHA 1KILC 1DEBA 2N1TB 1PFIA 1L4AD 2WITA 3U59A 1W2EA 1FZAA 1JTHB 3P7KA 2WZ7A 1JCDA 2J59M 2OYIA 5AVTB 1L0LK 2W6BA 1OWAA 2PP6A 2OARA 1GZLA 5CCGC 1NAFA 2R3CA 1T2KC 2H7HA 3EQ2A 3RK3C 1GD2E 3VMXA 1GL2A 1CI6A 3GHGA 3KDPB 3SWYA 2FKWB 3VMZA 1FBMA 1OXZA 3M0DA 1DX7A 3O8ZA 2MJZA 2Z4EA 1JY2N 2HPCA 1T3UA 2M8RA 1SQXK 1JY3P 3GHGB 3WMM0 2C9NY 1MZ9A 2M3BA 3E1IA 1WT6A 1EQ7A 1RE4C 3V4QA 1NKZB 1URQC 3BASA 3V2PA 2HPCB 1GK6A 1SFCD 3V2NA 2O1JA 1WRGA 3OAKA 2XU6A 1FAVA 3V4WA 1LWUB 1A02F 2HYNA 2Q5UA 1FZCA 1SP4A 1FZBA 2N1TD 1NU1K 5CCHA 2C0XA 3C9IA 2VRSA 1L4AA 5APXA 3KYQA 2W27A 2WTYA 3KQGA 3RK2C 3HE4A 5KJ7D 3CL3D 4N78D 2WWWA 1GU4A 1NTMK 3BRTB 5AW8B 1FDMA 3N7NA 1QL2A 2KYVA 2Z5IA 4I6MC 2A45G 1G1JA 2H43A 5BU8B 2HODA 1L0NK 1J1EB 2N1TC 3MGNA 3LW5H 1JCCA 1A02J 1JY3O 2QM7A 3V2RA 3CLQA 1NWQA 2I1JA 1LGHB 2HODB 3HE5B 4DZOA 4AUWA 3H32A 5APYA 4B86A 1LT9B 1RE3A 1SFCA 2IX7C 3VP8A 2P1JA 2WT7A 2OYIC 1M1JC 3H32B 4HYTB 1GW3A 3A3YB 2YNYA 1YYCA 4JYBA 3RL0C 4C46A 1MV8A 3IFMA 2WT7B 1X79B 1H88A 5AW1B 1RF0A 5CCHD 2QM8A 1JUNA 1IFIA 2P7JA 1GL2C 5APWA 3GHGC 2I1KA 1HBWA 3M0DC 4Y99B 5KJ7A 3I5CA 2POHA 5APQA 2CPBA 1FZFA 1HGVA 2IPPA 2BASA 1N73A 1S9KE 2NPSA 1ZN5A 4N78E 2XV5A 2XZRA 3NXSA 3L37A 2E42A 1NKNA 1LTTC 1GDTA 1LTSC 3B8EB 1GK4A 1FJPA 3G3ZA 1N73B 1FZCC 2NPSB 1CW5A 1Z56A 1IFDA 3L35A 2KB7P 3HD7A 3P8CD 2Q7CA 4LGDE 1G2CA 4KHXA 1NHLA 1CZQA 1JMMA 1FOSF 3L4FA 5AW2B 1MFZA 2Q9IA 2R32A 3VTPC 1FZEA 2ZXEB 1CSBA 1ZV8A 1L4AC 1LWUA 3HD7B 4WY4B 1G2CB 1JOCA 3SWFA 1SQQK 4WB4A 2WPSA 2YO2A 1LTBC 2JEEA 3L36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAT A;  4GIF A;  4N3Y B;  1IC2 A;  3U59 A;  4O9B A;  3OJA B;  3VP8 A;  3N7N A;  3P8C D;  2POH A;  3U1C A;  5KTB A;  3VP9 A;  3HRN A;  4ZKU A;  5BU5 A;  3N4X A;  5BU8 B;  3C9I A;  1WT6 A;  3BAS A;  4I1L A;  4ZKP A;  4N78 D;  5BVZ A;  1NKN A;  1X79 B;  3U1A A;  2FXM A;  2JEE A; 
#chains in the Genus database with same CATH topology
 1N7S B;  5APV A;  1NAY A;  1JNM A;  1ZP0 C;  5AW3 B;  2W6J H;  2C9L Y;  2LKM A;  1PGP A;  3P8M C;  2J58 A;  3B5N A;  2K3R A;  3IN6 A;  1IFP A;  3L70 D;  3AEB C;  3SFD C;  1IK7 A;  4H13 B;  2V7Q H;  3VOP A;  4GT1 A;  1IFM A;  3CCV P;  1RE3 C;  1SQV G;  5AW5 B;  4YPC A;  1PGQ A;  3AED C;  2L5G B;  1RY3 A;  4IFF A;  3JC2 2;  1FS0 E;  3AE1 C;  2FYU K;  2E75 D;  5APT A;  5KLV K;  3HE5 A;  3L70 J;  2C0W A;  1RF1 B;  2KXP B;  4PV1 C;  1LTJ B;  2H88 C;  2B87 A;  2OYH A;  2RN0 A;  2WPR A;  1VQP P;  3V2Q A;  3L74 D;  1Q2N A;  3KPE A;  3TK1 A;  3TGU D;  3CXH E;  3A0B E;  3L73 D;  4OGQ B;  3HUS B;  1IFN A;  1M1K Q;  3L75 G;  1KD1 Q;  2NPS C;  1JY2 P;  1EZV I;  1SQB K;  1Q7Y Q;  1OVR A;  5AW7 B;  3L74 J;  3TGU J;  3B5N D;  4H0L C;  2KSE A;  3L73 J;  4NPD A;  2E76 C;  4U3F E;  3LIE A;  1BGY G;  1YIJ P;  3L70 E;  1EDK A;  1VQK P;  2R5B A;  5M1B A;  2FXM A;  2KS1 A;  3TNU B;  3R2P A;  3BCC J;  1VQ8 P;  1URQ D;  1HH0 A;  2WSE H;  4U7J A;  1KB9 E;  2YKP A;  1H0T A;  1PV3 A;  2KI7 B;  1J1D B;  4PD4 I;  1X9V A;  5CJ0 A;  4I1L A;  1N7S A;  1M1J B;  1YIT P;  3T97 B;  3TGU E;  2Q3E A;  2N9B A;  1NU1 D;  4HH2 A;  3OJA B;  2HG5 D;  1YTZ T;  3HTK A;  1LT1 A;  2ZFC A;  3VMY A;  1CI6 B;  1KYO H;  1FC2 C;  3N4X A;  4PJ0 E;  2XDJ A;  2GUV A;  4EOT A;  2FFD C;  5GTI E;  1NU1 J;  3M9H A;  1FU1 A;  3BCC E;  4N3Y B;  3S4R A;  2PAJ A;  1SS1 A;  5KLV D;  4JF7 A;  2OYO A;  2QEX P;  3NFQ A;  1BDD A;  2BEQ D;  1YJ9 P;  2XKM A;  3V5B A;  3FWN A;  1GW4 A;  3MP7 B;  4IL6 H;  1JY3 N;  4N6J A;  1KQS O;  2WSC H;  2HFE D;  1VDF A;  3TSI A;  2O01 J;  4DOJ A;  1NGM B;  2AXT E;  1R5S A;  2B9B A;  3PP5 A;  3G6E P;  2E75 C;  3L74 G;  1NU1 E;  3BAT A;  4BRY A;  2KOG A;  3L73 G;  2YMY A;  5AVU B;  4YXD C;  1ZLL A;  1HVV A;  1QVF O;  3FGA D;  1NTM E;  2N1T B;  2FY8 A;  3IAO A;  3SFE C;  2WIT A;  4JQ0 D;  1FZA A;  1JTH B;  3SSU A;  5DJU B;  2Q6Q A;  5AVT B;  3CX5 I;  1OIP A;  2W6B A;  1Q90 D;  2H7H A;  3EQ2 A;  1EXI A;  1CI6 A;  3KXD A;  1T3U A;  3WUV A;  1WT6 A;  2KLU A;  3V4Q A;  1NKZ B;  1URQ C;  4NPF X;  2HPC B;  1WRG A;  3OAK A;  2K9J B;  1OW6 A;  3A0B H;  2LR2 A;  2YXQ B;  4DT0 A;  2C0X A;  2JWD A;  3KYQ A;  2W27 A;  3KQG A;  4N78 D;  1YI2 P;  2IDB A;  2DW3 A;  2ZVN B;  2IYO A;  3BRT B;  5GTH E;  1SQP D;  1T6A A;  4I7Z C;  3N7N A;  5KLV G;  2KYV A;  2I8D A;  2QJY B;  4I6M C;  2FBW C;  2A45 G;  1YJN P;  1KTM A;  1L0N K;  3AE8 C;  3MGN A;  1JCC A;  1JY3 O;  2QM7 A;  3V2R A;  1SQP J;  1NWQ A;  3PRJ A;  1LGH B;  5H2F E;  4DZO A;  1U57 A;  1KB9 H;  1RE3 A;  4RJT A;  1EC5 A;  2WPV B;  1YJW P;  1QX8 A;  1SQB G;  4C46 A;  3IFM A;  2BEZ F;  1BSN A;  2KZJ A;  2WT7 B;  5B5E H;  2QM8 A;  2Q1K A;  1PP9 G;  4PJ0 H;  2CPB A;  2ZT9 D;  1HGV A;  2BAS A;  1S9K E;  2NPS A;  4N78 E;  2FXP A;  2XV5 A;  3NXS A;  1LTT C;  3B8E B;  2QA4 P;  1SQP E;  3L72 D;  1N73 B;  1FZC C;  2G8Y A;  1BE3 D;  2KB7 P;  2QRX A;  3P8C D;  2Q7C A;  1G2C A;  4KHX A;  4MN4 C;  4R4L A;  1CZQ A;  2E75 B;  5AW2 B;  2Q9I A;  1FZE A;  2ITA A;  2ZXE B;  3SWF A;  5C39 A;  3L72 J;  1D7M A;  2JEE A;  4R4M A;  1BE3 J;  1KYO I;  1NO4 A;  2M3E A;  1M56 D;  3VP9 A;  2LXB A;  4PV1 D;  2NRG A;  2AXT H;  3K5B A;  1N8R Q;  5KKZ C;  4C7R A;  3B5N B;  3QH9 A;  3EFF K;  3CCQ P;  1ZXG A;  3H1H D;  2NPS D;  1IO4 A;  3HRN A;  1S5L X;  1K05 A;  4I2L C;  3M06 A;  1KFM A;  5AVW B;  4H0L D;  1RF0 C;  3M91 A;  4WY4 D;  2FFD A;  2IBZ E;  3H1H J;  1BE3 E;  4GIF A;  4KJM A;  1LP1 A;  4H44 D;  2OYH B;  3FXD A;  1KIL D;  1LTI C;  2O01 N;  1IJD B;  1M8O B;  3MD0 A;  2YKO A;  2FYN B;  1PPJ D;  3EWK A;  2QJK B;  1SQV E;  3HD7 C;  1FOS E;  5KTB A;  3I55 P;  2KUB A;  3RK3 D;  4DJG A;  2Y9Z A;  3MTU E;  1BDC A;  5KAF E;  5KLI B;  1XTC C;  1S2E A;  4AQR D;  5AVY B;  1HGZ A;  1SQX D;  2CPS A;  2ZYG A;  2GUS A;  3CCM P;  4A7P A;  2KS1 B;  5BU5 A;  2YO3 A;  3L75 E;  2WSF H;  2M5A A;  2K88 A;  3BRV B;  2YIU C;  2YKQ A;  3L72 G;  3CI9 A;  1JY2 O;  1OFC X;  1P84 H;  2BCC D;  1SQX J;  2R5D A;  1NTK K;  4IFM A;  4XFJ A;  2P2U A;  3L71 G;  1BGY E;  5H2F H;  4BXL A;  1NH4 A;  1PIX A;  3HTK B;  2OTJ P;  3D6Y A;  5L8R J;  2KLV A;  2BCC J;  3H1K D;  4UB8 E;  2QVA A;  2D2C B;  1DH3 A;  1PGO A;  3H25 A;  1N86 A;  1LTG C;  5AVV B;  1VQ6 P;  2JP3 A;  5CHX A;  1FZC B;  1T3J A;  1G1I A;  1Y47 A;  5APU A;  2O1K A;  1URQ A;  2AEF A;  1S5L E;  1MUU A;  3H1K J;  1JB0 J;  3LID A;  3H1H G;  5TIS E;  2KNC A;  2R3S A;  3U1C A;  3Q5P A;  5TJH A;  2UWJ E;  3R4Y A;  3PJS K;  3M9Q A;  1NTZ K;  1KB9 I;  1OX3 A;  1VPC A;  3IR9 A;  3CWB D;  2R44 A;  3WU2 E;  3CPW O;  2FYZ A;  4ASW A;  2N9Y B;  2CK3 H;  4WY4 C;  2MKV A;  4D6T D;  1EDI A;  4BRY B;  4GDO A;  4H44 C;  3CWB J;  3FWL A;  1KIL C;  1LNQ A;  1PPJ G;  1PFI A;  1L4A D;  1W2E A;  2WZ7 A;  4PD4 D;  1VQ4 P;  2OTL P;  2XND H;  4D6T J;  1S4X A;  1L0L K;  4GOF A;  5CBO A;  2R3C A;  1T2K C;  4HB1 A;  3RK3 C;  3AE3 C;  3L74 E;  2FKW B;  2Y9Y A;  1OXZ A;  4JPZ B;  1SQX G;  3O8Z A;  2MJZ A;  2Z4E A;  3L73 E;  2C9N Y;  3E1I A;  3KZI E;  3BAS A;  1SFC D;  3V2N A;  2XU6 A;  1MKM A;  3V4W A;  1A02 F;  2BCC G;  3H1L G;  1FZC A;  2QJP C;  1FZB A;  4GOE A;  2Y0C A;  5CCH A;  2PFX A;  4RO0 A;  2FYU D;  2B88 A;  3C9I A;  5APX A;  3CL3 D;  3KHU A;  3IF4 A;  2WQY C;  3H1K G;  5AW8 B;  1FDM A;  3AEF C;  2FYU J;  3W67 A;  5KLV J;  2ZT9 B;  3W68 A;  2Z5I A;  2HOD A;  3LW5 H;  1FE6 A;  1SQB D;  2KZI A;  4ZMD A;  1AVO A;  2I1J A;  3H32 A;  5APY A;  2E74 C;  1PP9 D;  2H89 C;  3VP8 A;  1EZV G;  3A3Y B;  1SQB J;  2K1A A;  1X79 B;  3CWB G;  5AW1 B;  1RF0 A;  1EXJ A;  5CCH D;  4H13 D;  1IFI A;  2RKL A;  5APW A;  1PP9 J;  3GHG C;  2KK7 A;  1HBW A;  3M0D C;  3CX5 D;  4PV1 B;  2POH A;  5KLV E;  4D6T G;  3E1R A;  1UII A;  3AE9 C;  1GK4 A;  1FJP A;  2JWA A;  2NPS B;  3E7K A;  3F5H A;  1IFD A;  1MFT A;  3HD7 A;  4K3A A;  1NHL A;  1JMM A;  1ZV8 A;  1S5L H;  1L4A C;  1VQN P;  1P84 I;  4H0L B;  1SQB E;  1VQ5 P;  4WY4 B;  1LJ2 A;  3JCU E;  1G2C B;  2JKV A;  1SQQ K;  3CCJ P;  2WPS A;  5TIS H;  1NTK G;  2E76 B;  4H44 B;  3CXH H;  1PP9 E;  1J1E C;  1JO5 A;  1YQ4 C;  1KIL B;  2V4H A;  4Y28 J;  4EI2 A;  2WPQ A;  1AQ5 A;  3AEE C;  4RKU J;  1RHZ B;  3FXE A;  1J2J B;  2XNX A;  3A7O A;  4AYC A;  3D71 A;  2V7Q J;  1LTA C;  1SFC C;  3NTN A;  1SQV K;  2FYU G;  1IZN B;  5AW4 B;  4IFD K;  4C7N A;  1T8Z A;  2E5T A;  3H6P A;  4W80 A;  5AW0 B;  1X22 A;  4Y99 C;  1PZQ A;  1R5L A;  3HD7 D;  3UIA A;  1SLQ A;  4L73 A;  4YXW H;  4XA4 A;  3MHV A;  2FFD B;  1W5C E;  1NTZ G;  1R8E A;  3V6I A;  1LP1 B;  1K04 A;  4HJG H;  3OA7 A;  4CPG A;  1FZG A;  3CCR P;  1JMB A;  5B66 E;  1IC2 A;  4NPE A;  1DIP A;  5CCG D;  4OWF A;  1HJ0 A;  1H89 A;  1LWU C;  1KMI Z;  1AFO A;  5GTI H;  1Q81 Q;  3WUU A;  4L76 A;  5KAI E;  3M0A A;  1DD3 A;  3P32 A;  2HLO A;  3A2A A;  2GM4 A;  4JYC A;  1KC8 Q;  1L0L G;  2Y0E A;  5CCH C;  3ABV C;  4WY4 A;  1HWT C;  3MZW B;  4H13 C;  2WSE J;  1HUC A;  3USS A;  1YBK A;  5AVZ B;  1SQQ D;  3L71 D;  1KYO D;  5AW6 B;  1KIL A;  1ZME C;  2W6A A;  2M5A B;  1K8A Q;  3ITK A;  1KFN A;  1RF1 C;  3H1J D;  3RK2 D;  3AE7 C;  4OH8 B;  2IBZ I;  1LTJ C;  3H1I D;  1N7L A;  2E5Y A;  1YTZ I;  1SQQ J;  4YTP C;  3L71 J;  5CBN A;  4ZKP A;  1LT9 C;  1ZW0 A;  1PGJ A;  2Q3I A;  4OGQ C;  3HUS C;  3CC2 P;  3BVH A;  3H1J J;  2QG4 A;  4O9B A;  4EIJ A;  4XE5 B;  1UIX A;  1X0T A;  3H1I J;  4ZKU A;  1L0N D;  2A06 G;  3B71 A;  3A5T A;  2ZYA A;  3II6 A;  3EFG A;  3GLM A;  5E79 E;  1L4A B;  4LLH A;  3L72 E;  2RMZ A;  3HE4 B;  1URQ B;  3RL0 D;  1FDO A;  2A45 H;  2QSI A;  3P8C E;  1L0N J;  2O01 H;  1GL2 D;  1RQV A;  3L71 E;  3F89 A;  1OVV A;  4DCK A;  1YQ3 C;  2KNC B;  5AVS B;  3U1A A;  3RGU A;  1J1D C;  5CMZ A;  1EDJ A;  3D6Z A;  1TU3 F;  4L75 A;  1T2K D;  3JCU H;  1QL1 A;  2AEM A;  1SFC B;  4I7Z B;  1RH5 B;  1DEB A;  2W90 A;  3MUD C;  2QE7 H;  3TDK A;  1K73 Q;  2ZYD A;  3U59 A;  3H1H E;  3AE6 C;  4IL6 E;  1OW8 A;  2JDI H;  1JCD A;  2J59 M;  1OWA A;  2PP6 A;  3C1L A;  1QLE D;  1EDL A;  5CCG C;  1NAF A;  5GTH H;  3Q5S A;  3AE5 C;  3Q2Y A;  3S9O A;  4UB6 E;  1GD2 E;  3CC7 P;  3GHG A;  3VMZ A;  3H1L D;  3M0D A;  1DX7 A;  2M8R A;  1KIL E;  2GA1 A;  3AEG C;  3WMM 0;  1VQM P;  1MZ9 A;  1SQQ G;  1EQ7 A;  2QIW A;  1RE4 C;  2WSS H;  3CXH I;  1FDI A;  2O1J A;  1VQ9 P;  1KQG B;  1LWU B;  2Q5U A;  3H1L J;  4JBZ A;  1PPJ E;  1SP4 A;  4WVZ A;  3AE2 C;  3H1J G;  4ASV A;  1BCC G;  1NU1 K;  3H1I G;  3RK3 E;  4U3F D;  1L4A A;  2NZ2 A;  2WTY A;  3RK2 C;  3HE4 A;  5KJ7 D;  2E74 D;  2LXC B;  5B66 H;  1GU4 A;  1NTM K;  1W2B O;  3ZDM A;  1SQX E;  1QL2 A;  1KB9 D;  1L0N G;  4U3F J;  1EZV D;  2OGU A;  2H43 A;  5KAI H;  1U7J A;  2N1T C;  4K35 A;  2HOD B;  2BCC E;  1NVO A;  4B86 A;  3H1L E;  1LT9 B;  1SFC A;  4ZNC A;  5KKZ B;  1E79 H;  2OYI C;  3H32 B;  1GW3 A;  2YNY A;  4JYB A;  3RL0 C;  4TT3 H;  4BWN A;  4KT0 J;  1MV8 A;  3AEA C;  1AJY A;  2OTK E;  1GL2 C;  3H1K E;  2I1K A;  2FXO A;  3BCC D;  1S72 P;  3CCU P;  3I5C A;  4OVN F;  3FX0 A;  5APQ A;  2ZJS E;  1YHQ P;  1FZF A;  2IPP A;  1OVU A;  3L37 A;  1AV1 A;  1NKN A;  2WVR A;  3TF5 A;  1NTK D;  3L35 A;  2ZVO B;  2ZXX A;  1EZV E;  1FOS F;  1MFZ A;  3WUT A;  2R32 A;  1QEX A;  1CSB A;  1LWU A;  5E79 H;  3HD7 B;  1QVG O;  1JOC A;  3CWB E;  4WB4 A;  2YO2 A;  1NTK J;  1LTB C;  2QJY C;  1OW7 A;  4WWI A;  4EDF A;  5B5E E;  3Q3D A;  2E43 A;  1HTL C;  2JJL A;  1NOH A;  1GU5 A;  3I56 P;  4D6T E;  4RES B;  1BSH A;  3O6Q B;  1GMJ A;  1NTM D;  2PGD A;  3M9B A;  3CCS P;  1M7L A;  1VF5 D;  3CC4 P;  3GMA A;  4LC1 A;  1SVF A;  3B4S A;  1RF1 A;  2YIU B;  4PD4 E;  1IFJ A;  2W8Z A;  1LTJ A;  1WMK A;  2Z5H A;  4U3F G;  1K9M Q;  1NTZ D;  5KAF H;  1AQT A;  3L70 G;  1NTM J;  1LT9 A;  2A45 I;  1S3J A;  4C7N B;  3HUS A;  1NTK E;  1M57 D;  1ZR2 A;  1ZRT D;  4IOI H;  1M90 Q;  5KJ7 C;  1SQP K;  1JEK A;  2IFN A;  1N7S D;  1ZOY C;  1KQL A;  1N2D C;  2IFM A;  1NTZ J;  1N73 C;  4W7Z A;  4UB6 H;  3C8V A;  2P58 A;  1IK9 A;  2RH0 A;  2KIK A;  3Q5R A;  3TGU G;  3RK2 B;  2D2C D;  4M3L A;  1GTW A;  4HKZ H;  1L0L D;  2FYU E;  1X8Y A;  1VQL P;  3TNU A;  3S1K A;  2OQQ A;  1FJK A;  3TYY A;  5AW9 B;  4UB8 H;  3CMA P;  3GF7 A;  1USE A;  3OW2 O;  3PLN A;  3BCC G;  4GOD A;  3PH0 A;  2K37 A;  1P84 D;  1L0L J;  4EYY Q;  5AVX B;  1M1J A;  1NTZ E;  3B5N C;  2P10 A;  4OGQ D;  5DJT B;  2H8P D;  3T97 A;  3G71 P;  3RBZ A;  1H8A A;  2WSF J;  1HJB A;  1KN7 A;  2OYI B;  3MUD A;  3A0H E;  1ZRT E;  3RL0 B;  1XTG B;  1AVY A;  3VYI A;  1HF9 A;  3O6Q A;  3CD6 P;  1GL2 B;  3GF3 A;  3SWK A;  3PTZ A;  2YXR B;  2A06 D;  3VN0 A;  1PL5 A;  2W83 C;  4W7Y A;  5BVZ A;  1DEE G;  3WU2 H;  5CCG A;  3GG2 A;  2OYH C;  1JM0 A;  2B89 A;  2PRR A;  1L2P A;  1NU1 G;  2P67 A;  3CX5 E;  4GKG A;  1VQO P;  2KSJ A;  3RK3 B;  1L0L E;  2FYN C;  2HR3 A;  1E5W A;  1S9K D;  4WBA A;  1NYH A;  1RE4 A;  5APS A;  2QJK C;  1NTM G;  3GW6 A;  5AVQ B;  4TLF A;  3QWO C;  1P84 E;  1KZU B;  5KLI C;  1VF5 C;  1U7M A;  3NMD A;  2QJP B;  1KV4 A;  3CCL P;  1ZR4 A;  2SPZ A;  1USD A;  2J5U A;  2KP8 A;  2ZAE B;  3MIW A;  3KZI H;  2JR8 A;  5EFW B;  5K5G B;  2A06 E;  5AVR B;  2N1T A;  5CJ4 A;  1N7S C;  1JTH A;  1VQ7 P;  2AEJ A;  4IL6 X;  3RL0 g;  2K9Y A;  2IZ1 A;  3P7K A;  2OYI A;  4Z1M H;  2E74 B;  2Y0D A;  2OAR A;  1GZL A;  2D2C C;  1S1C X;  1Q82 Q;  4L74 A;  2IBZ D;  3VMX A;  1GL2 A;  4PD4 H;  3SWY A;  3KDP B;  1FBM A;  1JY2 N;  2HPC A;  1BCC D;  1SQX K;  1JY3 P;  2K9J A;  2G3A A;  3GHG B;  2M3B A;  2M0B A;  3V2P A;  1GK6 A;  1KQF B;  1FAV A;  2HYN A;  3Q1M A;  1SQV D;  2N1T D;  3CME P;  1BCC J;  1NJI Q;  2IYP A;  2AXC A;  2VRS A;  1AA0 A;  1VL2 A;  3PHL A;  3G4S P;  1Y8A A;  2WWW A;  1OZH A;  2IZ0 A;  1SQV J;  3CCE P;  3D70 A;  1KOR A;  2L91 A;  1G1J A;  5BU8 B;  3L75 D;  1J1E B;  1SQQ E;  2WSC J;  1A02 J;  4QMA A;  1KYO E;  3LW5 J;  3CLQ A;  1SQP G;  3HE5 B;  4AUW A;  2E76 D;  2B87 B;  3H1J E;  2IX7 C;  2P1J A;  1BCC E;  2WT7 A;  3H1I E;  3L75 J;  1Y9B A;  1M1J C;  4HYT B;  1YYC A;  1BGY D;  3A0H H;  3JSV C;  1H88 A;  2YMK A;  1QGK B;  1JUN A;  2O3J A;  2WMM A;  2P7J A;  4Y99 B;  5KJ7 A;  1Q86 Q;  1OMI A;  3VMA A;  1DD4 A;  1L0N E;  3AEC C;  1BGY J;  1N73 A;  1ZN5 A;  2XZR A;  2E42 A;  1RQU A;  1VF5 B;  1GDT A;  1LTS C;  3CX5 H;  3G3Z A;  1CW5 A;  3AE4 C;  1Z56 A;  3G9R A;  4LGD E;  3CXH D;  3L4F A;  3VTP C;  2JO1 A;  1H0T B;  2ZT9 C;  3RBX A;  2IBZ G;  3L36 A;  1BE3 G; 
#chains in the Genus database with same CATH homology
 2E43 A;  1J1E C;  1N7S B;  5APV A;  1JO5 A;  1HTL C;  1NO4 A;  1JNM A;  2JJL A;  1KIL B;  1NOH A;  1GU5 A;  5AW3 B;  3VP9 A;  2WPQ A;  2LKM A;  2C9L Y;  1AQ5 A;  3P8M C;  2J58 A;  3B5N A;  4RES B;  1J2J B;  2XNX A;  3A7O A;  4AYC A;  3M9B A;  1M7L A;  4C7R A;  3B5N B;  3VOP A;  4GT1 A;  4LC1 A;  1LTA C;  1IFM A;  1RE3 C;  1SVF A;  5AW5 B;  2NPS D;  1SFC C;  1IO4 A;  1RF1 A;  3NTN A;  1SQV K;  2L5G B;  1IFJ A;  1RY3 A;  3HRN A;  4IFF A;  5AW4 B;  4IFD K;  1LTJ A;  4C7N A;  1T8Z A;  2Z5H A;  3H6P A;  4W80 A;  2FYU K;  5APT A;  5KLV K;  5AW0 B;  3HE5 A;  2C0W A;  1RF1 B;  4I2L C;  3M06 A;  4Y99 C;  1KFM A;  1LT9 A;  5AVW B;  1RF0 C;  3HD7 D;  3M91 A;  1LTJ B;  2A45 I;  3UIA A;  1SLQ A;  4WY4 D;  4C7N B;  2OYH A;  2WPR A;  2FFD A;  3HUS A;  3V2Q A;  1ZR2 A;  3KPE A;  3TK1 A;  4GIF A;  5KJ7 C;  1SQP K;  4XA4 A;  2IFN A;  1N7S D;  2OYH B;  2FFD B;  1KQL A;  1N2D C;  1KIL D;  1LTI C;  2IFM A;  3HUS B;  1IFN A;  1N73 C;  2NPS C;  1JY2 P;  4W7Z A;  1IJD B;  3OA7 A;  1IK9 A;  1SQB K;  3MD0 A;  1FZG A;  5AW7 B;  2YKO A;  3B5N D;  3RK2 B;  1IC2 A;  3HD7 C;  1FOS E;  4M3L A;  1GTW A;  5CCG D;  5KTB A;  3RK3 D;  1X8Y A;  1H89 A;  3MTU E;  1LWU C;  3LIE A;  3TNU A;  1AFO A;  1FJK A;  3TYY A;  1XTC C;  5AW9 B;  4AQR D;  5AVY B;  2R5B A;  3M0A A;  2FXM A;  3TNU B;  3P32 A;  2HLO A;  3A2A A;  3R2P A;  2GM4 A;  1HGZ A;  4JYC A;  1URQ D;  1HH0 A;  2WSE H;  2CPS A;  5CCH C;  2GUS A;  4WY4 A;  1HWT C;  2YKP A;  5BU5 A;  5AVX B;  1M1J A;  3B5N C;  2YO3 A;  1J1D B;  2H8P D;  1HUC A;  2WSF H;  5AVZ B;  3T97 A;  1X9V A;  5CJ0 A;  4I1L A;  1H8A A;  1N7S A;  5AW6 B;  1HJB A;  3BRV B;  2YKQ A;  2OYI B;  1KIL A;  1M1J B;  3MUD A;  3CI9 A;  1JY2 O;  2W6A A;  3RL0 B;  2N9B A;  1XTG B;  4HH2 A;  2R5D A;  1NTK K;  1KFN A;  1RF1 C;  3RK2 D;  3OJA B;  2HG5 D;  3VYI A;  1YTZ T;  4IFM A;  3HTK A;  4OH8 B;  1LTJ C;  2ZFC A;  1GL2 B;  1N7L A;  3VMY A;  1CI6 B;  1YTZ I;  2P2U A;  3N4X A;  2XDJ A;  3VN0 A;  2GUV A;  4W7Y A;  4ZKP A;  1NH4 A;  1LT9 C;  5BVZ A;  3HTK B;  5CCG A;  4EOT A;  2OYH C;  2FFD C;  2Q3I A;  2KLV A;  3HUS C;  3M9H A;  1FU1 A;  2P67 A;  3BVH A;  1DH3 A;  4N3Y B;  4GKG A;  4O9B A;  1N86 A;  4EIJ A;  1LTG C;  4XE5 B;  5AVV B;  2KSJ A;  2PAJ A;  3RK3 B;  5CHX A;  4ZKU A;  1FZC B;  4JF7 A;  3A5T A;  1T3J A;  1G1I A;  1E5W A;  1S9K D;  4WBA A;  3II6 A;  1RE4 A;  5APS A;  5APU A;  3EFG A;  3NFQ A;  2O1K A;  1URQ A;  5AVQ B;  1MUU A;  2XKM A;  3V5B A;  1L4A B;  4LLH A;  1GW4 A;  3HE4 B;  3LID A;  1JY3 N;  1URQ B;  3RL0 D;  4N6J A;  2A45 H;  1KZU B;  3P8C E;  3U1C A;  2O01 H;  2WSC H;  2HFE D;  1VDF A;  3TSI A;  3NMD A;  1GL2 D;  4DOJ A;  3M9Q A;  1NTZ K;  1VPC A;  3IR9 A;  5AVS B;  3PP5 A;  3U1A A;  1ZR4 A;  1J1D C;  2FYZ A;  3BAT A;  5CMZ A;  2KOG A;  2KP8 A;  2YMY A;  4WY4 C;  5AVU B;  1ZLL A;  3MIW A;  1T2K D;  1QL1 A;  1HVV A;  5AVR B;  1SFC B;  2N1T A;  5CJ4 A;  1N7S C;  1JTH A;  1KIL C;  1DEB A;  2N1T B;  1PFI A;  1L4A D;  2WIT A;  3U59 A;  1W2E A;  1FZA A;  1JTH B;  3P7K A;  2WZ7 A;  1JCD A;  2J59 M;  2OYI A;  5AVT B;  1L0L K;  2W6B A;  1OWA A;  2PP6 A;  2OAR A;  1GZL A;  5CCG C;  1NAF A;  2R3C A;  1T2K C;  2H7H A;  3EQ2 A;  3RK3 C;  1GD2 E;  3VMX A;  1GL2 A;  1CI6 A;  3GHG A;  3KDP B;  3SWY A;  2FKW B;  3VMZ A;  1FBM A;  1OXZ A;  3M0D A;  1DX7 A;  3O8Z A;  2MJZ A;  2Z4E A;  1JY2 N;  2HPC A;  1T3U A;  2M8R A;  1SQX K;  1JY3 P;  3GHG B;  3WMM 0;  2C9N Y;  1MZ9 A;  2M3B A;  3E1I A;  1WT6 A;  1EQ7 A;  1RE4 C;  3V4Q A;  1NKZ B;  1URQ C;  3BAS A;  3V2P A;  2HPC B;  1GK6 A;  1SFC D;  3V2N A;  2O1J A;  1WRG A;  3OAK A;  2XU6 A;  1FAV A;  3V4W A;  1LWU B;  1A02 F;  2HYN A;  2Q5U A;  1FZC A;  1SP4 A;  1FZB A;  2N1T D;  1NU1 K;  5CCH A;  2C0X A;  3C9I A;  2VRS A;  1L4A A;  5APX A;  3KYQ A;  2W27 A;  2WTY A;  3KQG A;  3RK2 C;  3HE4 A;  5KJ7 D;  3CL3 D;  4N78 D;  2WWW A;  1GU4 A;  1NTM K;  3BRT B;  5AW8 B;  1FDM A;  3N7N A;  1QL2 A;  2KYV A;  2Z5I A;  4I6M C;  2A45 G;  1G1J A;  2H43 A;  5BU8 B;  2HOD A;  1L0N K;  1J1E B;  2N1T C;  3MGN A;  3LW5 H;  1JCC A;  1A02 J;  1JY3 O;  2QM7 A;  3V2R A;  3CLQ A;  1NWQ A;  2I1J A;  1LGH B;  2HOD B;  3HE5 B;  4DZO A;  4AUW A;  3H32 A;  5APY A;  4B86 A;  1LT9 B;  1RE3 A;  1SFC A;  2IX7 C;  3VP8 A;  2P1J A;  2WT7 A;  2OYI C;  1M1J C;  3H32 B;  4HYT B;  1GW3 A;  3A3Y B;  2YNY A;  1YYC A;  4JYB A;  3RL0 C;  4C46 A;  1MV8 A;  3IFM A;  2WT7 B;  1X79 B;  1H88 A;  5AW1 B;  1RF0 A;  5CCH D;  2QM8 A;  1JUN A;  1IFI A;  2P7J A;  1GL2 C;  5APW A;  3GHG C;  2I1K A;  1HBW A;  3M0D C;  4Y99 B;  5KJ7 A;  3I5C A;  2POH A;  5APQ A;  2CPB A;  1FZF A;  1HGV A;  2IPP A;  2BAS A;  1N73 A;  1S9K E;  2NPS A;  1ZN5 A;  4N78 E;  2XV5 A;  2XZR A;  3NXS A;  3L37 A;  2E42 A;  1NKN A;  1LTT C;  1GDT A;  1LTS C;  3B8E B;  1GK4 A;  1FJP A;  3G3Z A;  1N73 B;  1FZC C;  2NPS B;  1CW5 A;  1Z56 A;  1IFD A;  3L35 A;  2KB7 P;  3HD7 A;  3P8C D;  2Q7C A;  4LGD E;  1G2C A;  4KHX A;  1NHL A;  1CZQ A;  1JMM A;  1FOS F;  3L4F A;  5AW2 B;  1MFZ A;  2Q9I A;  2R32 A;  3VTP C;  1FZE A;  2ZXE B;  1CSB A;  1ZV8 A;  1L4A C;  1LWU A;  3HD7 B;  4WY4 B;  1G2C B;  1JOC A;  3SWF A;  1SQQ K;  4WB4 A;  2WPS A;  2YO2 A;  1LTB C;  2JEE A;  3L36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...