4I1LA

Structural and biological features of foxp3 dimerization relevant to regulatory t cell function
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
62
structure length
62
Chain Sequence
PGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biological features of FOXP3 dimerization relevant to regulatory T cell function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulator
molecule keywords Forkhead box protein P3
total genus 25
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16159 FOXP-CC FOXP coiled-coil domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i1lA00
4ZKUA 4N3YB 2FXMA 2JEEA 3VP9A 1WT6A 1NKNA 4GIFA 4ZKPA 3N4XA 3N7NA 3C9IA 2POHA 3U1AA 5BU8B 4I1LA 3U1CA 3U59A 1X79B 5KTBA 1IC2A 4O9BA 3OJAB 5BVZA 3P8CD 4N78D 5BU5A 3BATA 3VP8A 3BASA 3HRNA
chains in the Genus database with same CATH superfamily
1NTKG 1IK7A 1FAVA 3D6ZA 1JNMA 1NYHA 3C8VA 4CPGA 1FZCC 1LWUB 2AEJA 2FXPA 3RK2B 1NKZB 2XU6A 2E43A 4A7PA 1ZLLA 5TISE 1Q2NA 3S4RA 5E79H 1PPJD 3RL0B 2QEXP 1IK9A 3GHGB 2E75B 5APSA 5CCHC 1QL2A 4RKUJ 2M0BA 2RN0A 4PD4D 3H1HJ 3A3YB 3R4YA 2Y0EA 1L0LE 2K9JA 3H32A 1KB9H 4H44D 4C7NA 2K88A 2QJKC 2KUBA 1JM0A 5C39A 2JWAA 1DD3A 5AVTB 1YJWP 2BEQD 2P10A 5B5EE 2WITA 5AW3B 2IBZD 2AXTH 3L37A 3L73G 1JY3P 3QH9A 5CMZA 1QEXA 3I5CA 4QMAA 1BDDA 4L75A 3HTKA 3AE6C 4XFJA 3SFEC 2WTYA 1T2KD 1S4XA 1L0NK 2K37A 1ZW0A 1KYOD 3M0DA 1KC8Q 1G1IA 4EIJA 1NTMJ 1NTZD 1SFCA 4BRYB 1SQVE 2BCCD 3CX5D 1ZV8A 1BCCE 2AEMA 1J1EC 4JPZB 4PV1C 4W80A 3RK3C 3G3ZA 3H1LG 1GTWA 1AA0A 2QJPC 2FFDC 1S5LE 1FJKA 1HGVA 4L74A 4H13D 3BRVB 3L74G 4HJGH 2XKMA 1M8OB 3T97A 3HE5B 3UIAA 4OWFA 3RGUA 2YMYA 3P7KA 1KB9D 1LTSC 3HUSC 2IBZI 1SQQE 4O9BA 3CCSP 1SQQG 4W7YA 3P32A 3OW2O 4NPDA 1FZFA 2Q9IA 2NPSB 3L74J 1P84H 3CL3D 5AW6B 3RK2D 3AE7C 3HD7A 1USDA 3CWBG 3CCJP 1CZQA 1K73Q 4GOFA 2QJPB 1ZR4A 4U3FJ 1PFIA 1KQFB 1CW5A 1EZVE 1PL5A 2E75D 5CBOA 1EQ7A 3BCCJ 1MFTA 3R2PA 1PGQA 1OMIA 2KK7A 3AEDC 3M9HA 3PJSK 3A0HE 1KYOH 2KI7B 2N9YB 3K5BA 1KILB 2R32A 1OXZA 1Q81Q 2PFXA 2WSFH 1X8YA 1PGPA 2Y0CA 1VDFA 2K1AA 2K9JB 3O6QA 4H44B 4IFMA 1SQXJ 4XA4A 1S5LH 3S1KA 3H1KJ 1BDCA 3V2PA 3BCCD 5E79E 4RESB 1KILE 1R5SA 5AVVB 3CCQP 1H89A 1KQSO 3CI9A 1NU1J 1SFCC 2B87A 3RBXA 4WY4A 1NWQA 1OW6A 3MP7B 4U7JA 1CI6A 1JOCA 1SS1A 3L4FA 3HTKB 2PAJA 3AEAC 4N6JA 5APTA 1URQC 1IFIA 5M1BA 1Q90D 1RQVA 1T8ZA 2HODB 2YNYA 3GG2A 3SWFA 1IZNB 2W90A 4ZKUA 3L73D 1BE3J 3CWBE 2OYIA 1OFCX 2A06E 2R3SA 1KQLA 4JF7A 1VQ8P 1SQBK 4I7ZC 2J5UA 1JEKA 1NKNA 2WVRA 1NTZK 1URQD 5KLIB 4I1LA 2JWDA 2Y0DA 1URQB 5APXA 3BRTB 3B5NC 1GL2D 2Z5HA 3CX5H 3NXSA 3HUSB 1X79B 4DJGA 1FZCA 1GD2E 1USEA 2QVAA 2FYNB 1BE3E 1FDOA 3CWBJ 1K04A 1LTBC 3AEFC 3MD0A 4HH2A 3TNUA 5CJ4A 1BSHA 1L0LK 2H89C 2WPVB 1LTIC 1M56D 2XNDH 3H1HG 3D70A 2AEFA 3P8CD 1Q82Q 1SLQA 3SSUA 3M91A 3WUVA 1G1JA 2O01H 3HE4A 1NU1E 2A45I 1RF0C 1S3JA 3TK1A 2DW3A 5B66H 2BCCG 2M3BA 1RF1B 4RJTA 3B5NB 2Y9ZA 5CCHA 2QJYB 3H1KE 4KHXA 1SQXE 3VYIA 1M1KQ 1VQLP 1YITP 1BCCD 1EDLA 2Z4EA 1U7JA 1J1DB 3GF3A 3P8MC 4H44C 4L76A 3JCUH 1FS0E 1YQ4C 5KJ7C 1S9KE 3A0BE 3H1IJ 2WSCH 3L71G 3AECC 1JUNA 2XZRA 1KYOI 1S2EA 3BCCE 1VQ7P 2LXBA 1NAFA 4HB1A 2Q3IA 2H8PD 2N1TB 4U3FE 5AVSB 4Y99B 2KOGA 2KSJA 1LP1A 3B8EB 1IC2A 3TF5A 4IFDK 5KAIE 1FDMA 2C9NY 2FKWB 1L4AB 4UB8H 2A06G 3CC2P 3LIEA 3L74E 3Q1MA 2YKQA 1T6AA 2YKPA 1SQQJ 1P84I 2ZAEB 3CCVP 1Y8AA 3AE1C 4I7ZB 1EXJA 1SP4A 3H6PA 1KV4A 4NPEA 1N73A 3VP9A 2WQYC 1JY2P 2W6BA 1A02J 1AFOA 4Y99C 3H25A 1LT9C 1VF5C 2QSIA 2RMZA 1GK4A 4GKGA 1M1JA 4TLFA 5AW7B 1SQVJ 1YTZT 1MFZA 2D2CC 1NTME 1X9VA 1YYCA 4PD4H 2LKMA 1KFNA 2W83C 4GT1A 5TISH 1A02F 1GW4A 2KNCA 2FYUG 1P84D 2IX7C 3CXHD 3WUTA 1EDJA 1BSNA 1GU5A 1GW3A 2OGUA 1L0NE 4YTPC 4ZNCA 1FJPA 4ASWA 2ZFCA 2JDIH 1G2CB 1PP9D 2QRXA 3HD7D 3HE5A 2QE7H 1AVYA 1W5CE 1VF5B 3M9QA 4PV1D 2Y9YA 3B5NA 5CHXA 4D6TG 1LWUA 2NPSD 1MV8A 3RK3E 3H1LD 2AXTE 2D2CB 3WU2H 1L0LJ 2H7HA 3M0AA 4OGQC 2AXCA 3QWOC 2IBZE 4Z1MH 4AUWA 2WPRA 1VQ5P 1SQBE 4KJMA 3A0HH 1DH3A 1KN7A 1SQQK 2WSCJ 5AW5B 3G71P 1H88A 2MJZA 1S9KD 1NTMK 5AVRB 3AE8C 2ITAA 1NTKE 3L72E 3VMXA 3EFGA 3NMDA 1NTZJ 1NTMD 4EYYQ 1L4AD 3FGAD 1YI2P 1OIPA 1YBKA 1KILA 3JCUE 1IFDA 1X22A 3B71A 1SQVG 1U57A 5KLVG 2KZJA 5AVWB 5AW9B 3RL0D 2YIUB 1LT9A 3GF7A 1FZAA 2I1KA 5KLVE 2HFED 1U7MA 2O01N 2KXPB 3P8CE 3PH0A 3V2RA 3L70G 4IOIH 3BATA 3L75E 3BASA 3CC7P 2N1TD 1DEBA 2B9BA 3I55P 5EFWB 1NTKK 1UIIA 1N7LA 3TGUE 4YXWH 1SFCB 2PGDA 4BRYA 1YTZI 5CJ0A 1KMIZ 3CD6P 2V7QJ 4Y28J 2E76C 1LTJA 3RL0C 2KYVA 1WT6A 3CCRP 4GODA 1YIJP 1NH4A 5AW1B 5CBNA 1LTGC 1SQBG 2WT7B 4TT3H 2OTJP 4I6MC 4LC1A 1H0TA 3AE9C 5KLVK 1IFNA 3E1IA 1HJBA 1JY2N 1JTHB 1GL2B 2YXQB 3CC4P 1N7SC 1RHZB 1QX8A 1GMJA 4PD4E 2Q7CA 4GOEA 2ZYAA 2NZ2A 2HYNA 1E79H 3M0DC 1SQXK 2M8RA 2IZ0A 1L0ND 1BGYG 3H1IG 3L71J 3TGUJ 1GU4A 5KLIC 3CCLP 3ITKA 2Q5UA 2YMKA 3L75J 4IFFA 1FZGA 2WSEJ 4N78E 2HR3A 2FYUE 2Z5IA 3EQ2A 1AV1A 3H1JJ 3MUDA 4UB6H 1XTGB 4DT0A 4H0LD 1UIXA 2ZJSE 5KJ7D 2HLOA 4JYCA 3IFMA 1HVVA 1NHLA 1GL2C 3KQGA 4KT0J 1NTMG 3KZIE 3O8ZA 4RO0A 1DD4A 1JCCA 3RL0g 3WU2E 1L2PA 1RE4C 5CCHD 1R8EA 1DIPA 1RY3A 3RK3B 1SQBD 1X0TA 1Z56A 3G4SP 3HE4B 2W8ZA 1M57D 2K9YA 1NTZE 1ZN5A 2WSFJ 4K35A 3L72J 1NTKJ 1EC5A 3O6QB 3V2NA 3TDKA 3FWNA 3CLQA 3VTPC 1JMBA 3NTNA 4ZKPA 5KLVJ 2WPSA 2W6JH 1SQVK 3L36A 1KFMA 1GK6A 5GTHE 2OTKE 3S9OA 1HUCA 1SQBJ 1PP9G 3L72G 3U59A 1PPJG 1K8AQ 2G3AA 2P2UA 3CXHH 1J1DC 3AE2C 3IF4A 3L70J 4W7ZA 3GHGA 1OVVA 2W6AA 4WB4A 2H43A 1SQPG 1IO4A 3L73J 3I56P 2HODA 5KLVD 2FYUK 5L8RJ 2PRRA 2QG4A 5B66E 2A45G 1T3UA 2O1JA 2C9LY 1RQUA 3L75D 1NU1K 5K5GB 3L70D 2QM8A 1L0NJ 3L71D 5KAFE 3USSA 2E76B 2XNXA 5H2FE 1FOSE 3LW5J 2R44A 1IFPA 2YO2A 3PLNA 2E5YA 4D6TE 1OVRA 3W68A 5B5EH 3H1JG 3PTZA 3ABVC 2OYOA 3Q5SA 2IYPA 1L0NG 1SQXD 3H1ID 3OAKA 4GDOA 4ASVA 4EOTA 2FY8A 3CX5I 3H1KG 2MKVA 1FDIA 1Q7YQ 1DEEG 3HD7C 1QLED 1LWUC 3RK2C 2OYIC 4H13B 1KQGB 1PPJE 1BGYJ 1N2DC 2Q3EA 3TGUG 1WMKA 4C46A 3AE4C 2QA4P 1AQTA 1ZRTE 1OVUA 2CPSA 3A0BH 4U3FD 2G8YA 2E75C 1M7LA 4ZMDA 2BEZF 4R4LA 3CPWO 1VF5D 5CCGD 5KAIH 1IFJA 2FFDA 3T97B 3RK3D 2KNCB 3GLMA 2D2CD 1D7MA 2RKLA 3FX0A 2E74C 1TU3F 3VOPA 5KAFH 1YJNP 1N7SA 3CXHI 4H13C 5H2FH 2FBWC 1OX3A 2NPSA 2A06D 4D6TD 4K3AA 3KZIH 1N8RQ 1ZMEC 4UB8E 3RBZA 5GTIH 3JC22 1KZUB 4PD4I 1HJ0A 1RE3A 4DZOA 5CCGC 4IL6E 1JMMA 1SQPD 2XV5A 3KDPB 3VN0A 2L91A 3GW6A 3H1IE 2GUVA 4GIFA 1NTKD 4HKZH 2VRSA 1SQPK 2R5DA 2M3EA 1S5LX 1T3JA 2E74D 2GUSA 3C9IA 3N7NA 3GMAA 4WY4C 3VMYA 1GDTA 2OTLP 1LP1B 3Q3DA 1Y9BA 1KILD 2B87B 3A2AA 3MZWB 2JR8A 1HH0A 2QM7A 1LTJC 1L4AA 3L35A 1J1EB 3L72D 5APQA 1S1CX 5APYA 2BASA 5KTBA 2KIKA 2E76D 3FXEA 3H1JD 3H1LJ 2ZT9B 4LGDE 1K9MQ 3M9BA 1SQXG 5AVXB 1QL1A 1GZLA 2H88C 2ZT9D 1LT1A 3AEGC 3LW5H 1E5WA 3PRJA 2J59M 2ZYGA 2WSEH 3SWKA 1PP9E 1ZP0C 3VP8A 1PIXA 2OYHC 4WY4B 1VQOP 2FYZA 1KORA 1LTAC 1CI6B 2P58A 4N3YB 4OH8B 4L73A 1FOSF 4OVNF 4AQRD 2ZVNB 2J58A 2K3RA 3AE3C 2B89A 3TYYA 3WMM0 3MTUE 1AVOA 1ZOYC 3W67A 1M90Q 3Q5PA 2OYIB 1KTMA 1EZVD 3MHVA 2ZT9C 2M5AA 1FZBA 1NOHA 3HUSA 3N4XA 5AVYB 2L5GB 2UWJE 2N1TC 1JCDA 3VMZA 2R3CA 1YQ3C 4EI2A 4H0LC 3AEEC 3MGNA 3VMAA 1ZR2A 1N73C 1L0LD 1G2CA 3D71A 2ZXXA 1QVGO 1HBWA 1HGZA 1PZQA 1VQ6P 2OQQA 1OWAA 2O01J 3FXDA 1KB9E 3TSIA 1PP9J 1FZCB 4BXLA 2KB7P 3L74D 2XDJA 2WZ7A 2V4HA 2JKVA 1PGJA 5BU5A 5KJ7A 2C0WA 3G9RA 3TNUB 2R5BA 2RH0A 3H1LE 1LTTC 1VQ9P 2IYOA 1KB9I 1BCCG 5AVZB 3PHLA 3GHGC 2ZYDA 3A5TA 3Q5RA 1JB0J 1VL2A 2JEEA 3TGUD 1EDKA 3V4QA 3CCEP 2JO1A 4IL6H 2CPBA 1VQ4P 2O1KA 5GTIE 1RF0A 5APVA 1VQMP 4XE5B 3F89A 5BU8B 4WWIA 5GTHH 2QJKB 2WSSH 4PJ0E 3H32B 4C7NB 1SQQD 1P84E 3IR9A 1MUUA 3MIWA 3V6IA 1T2KC 1RE3C 1YHQP 1NTZG 3EWKA 3OJAB 2KS1A 5AVUB 3Q2YA 3WUUA 2I8DA 2KSEA 1BE3G 3KPEA 2OYHB 4OGQB 2N1TA 4N78D 1QVFO 2FYNC 4IL6X 1YJ9P 3G6EP 1VQKP 1M1JC 2Q6QA 2KLUA 3EFFK 3JSVC 1KYOE 2FXMA 1J2JB 2M5AB 5AW2B 2QIWA 4DOJA 2WMMA 3V2QA 1JTHA 1HTLC 3F5HA 4LLHA 5AW0B 1BGYE 3OA7A 1RF1C 1BCCJ 2KLVA 2QJYC 5AVQB 1N73B 1FC2C 1BGYD 2NRGA 3BCCG 3E7KA 1JY2O 1FBMA 3U1CA 2NPSC 2SPZA 5DJTB 5APUA 1M1JB 2YO3A 3CCUP 1ZXGA 2ZXEB 5AW4B 1IJDB 3AEBC 1LGHB 3E1RA 4D6TJ 1EDIA 2I1JA 1SVFA 3HD7B 4M3LA 1NO4A 1EXIA 2FYUD 2HPCB 3CXHE 3CCMP 1AJYA 5CCGA 5DJUB 1WRGA 4YXDC 1CSBA 1Q86Q 1NU1D 2C0XA 2YXRB 3LIDA 4WBAA 1OW7A 1IFMA 3L73E 1KILC 3L75G 3SWYA 1L4AC 3IAOA 1HF9A 3L70E 1PV3A 3H1HE 3KXDA 1N7SB 3CMEP 2E74B 3MUDC 1MKMA 1RH5B 1L0LG 2CK3H 2PP6A 2P7JA 3B4SA 5TJHA 2LXCB 4NPFX 2P67A 1LJ2A 1NAYA 3V4WA 1AQ5A 2Q1KA 2POHA 1R5LA 1XTCC 4JBZA 1JO5A 2E42A 1SQVD 2YKOA 1LT9B 3CX5E 4OGQD 4PJ0H 2KS1B 1FU1A 3ZDMA 1VQPP 5KKZC 2JJLA 4JYBA 2OYHA 4WVZA 2W27A 1N86A 1JY3O 1ZRTD 2ZVOB 4R4MA 5AW8B 5BVZA 1JY3N 5APWA 1NGMB 3H1JE 1K05A 4U3FG 2HG5D 2IFMA 3II6A 2IBZG 2FYUJ 4I2LC 4WY4D 1DX7A 4BWNA 4EDFA 1LTJB 2HPCA 3PP5A 4MN4C 4AYCA 1VQNP 1PGOA 3H1KD 3L71E 2WT7A 1H8AA 3D6YA 1H0TB 2O3JA 1W2BO 1FZEA 1LNQA 1Y47A 2N9BA 1OZHA 4JQ0D 2JP3A 1SFCD 5KKZB 3CWBD 4C7RA 4DCKA 3KYQA 1URQA 1SQPE 1W2EA 3H1HD 2E5TA 2BCCJ 1S72P 1VPCA 3IN6A 1FE6A 2V7QH 2IFNA 4B86A 2IZ1A 2BCCE 2P1JA 3U1AA 2B88A 1MZ9A 1SQPJ 3KHUA 1EZVI 1NU1G 1QGKB 2KZIA 1KD1Q 1BE3D 4PV1B 1HWTC 1RE4A 1NJIQ 3AE5C 2OARA 2FFDB 3CMAP 3NFQA 3SFDC 1GL2A 3BVHA 2IDBA 2IPPA 2LR2A 2GA1A 4UB6E 2GM4A 1OW8A 4YPCA 3V5BA 2FXOA 3C1LA 4H0LB 4HYTB 3M06A 1EZVG 2KP8A 2A45H 1RF1A 3FWLA 1N7SD 2WPQA 3A7OA 2YIUC 1NVOA 2WWWA 3HRNA 3B5ND
chains in the Genus database with same CATH topology
1FAVA 1JNMA 1FZCC 1LWUB 3RK2B 1NKZB 2XU6A 2E43A 1ZLLA 3RL0B 1IK9A 3GHGB 5APSA 5CCHC 1QL2A 3A3YB 3H32A 4C7NA 5AVTB 2WITA 5AW3B 3L37A 5CMZA 1JY3P 3I5CA 3HTKA 2WTYA 1T2KD 1L0NK 3M0DA 1G1IA 4EIJA 1SFCA 3VMYA 1ZV8A 4W80A 3RK3C 1J1EC 1GTWA 3G3ZA 2FFDC 1FJKA 1HGVA 3BRVB 2XKMA 3T97A 3UIAA 3HE5B 2YMYA 3P7KA 1LTSC 3HUSC 1HBWA 4O9BA 1FZFA 4W7YA 3P32A 2Q9IA 2NPSB 3CL3D 5AW6B 3RK2D 3HD7A 1CZQA 1ZR4A 1PFIA 1CW5A 1EQ7A 3R2PA 3M9HA 1KILB 2R32A 1OXZA 2WSFH 1X8YA 4IFMA 1VDFA 4XA4A 3V2PA 4RESB 5AVVB 1H89A 3CI9A 1SFCC 4WY4A 1NWQA 1CI6A 1JOCA 3L4FA 5APTA 3HTKB 2PAJA 4N6JA 1URQC 1IFIA 1T8ZA 2HODB 2YNYA 3SWFA 4ZKUA 2OYIA 4JF7A 1KQLA 1SQBK 1NKNA 1NTZK 1URQD 4I1LA 1URQB 5APXA 3BRTB 3B5NC 1GL2D 2Z5HA 1GD2E 3NXSA 3HUSB 1X79B 1FZCA 5CJ4A 1LTBC 3MD0A 4HH2A 3TNUA 1L0LK 1LTIC 3P8CD 1SLQA 3M91A 1G1JA 2O01H 3HE4A 2A45I 1RF0C 3TK1A 2M3BA 1RF1B 3B5NB 5CCHA 4KHXA 3VYIA 2Z4EA 1J1DB 3P8MC 5KJ7C 1S9KE 2WSCH 1JUNA 2XZRA 1NAFA 2Q3IA 2H8PD 2N1TB 5AVSB 4Y99B 2KOGA 2KSJA 3B8EB 1IC2A 4IFDK 1FDMA 2C9NY 2FKWB 1L4AB 3LIEA 2YKQA 2YKPA 1SP4A 3H6PA 1A02J 1N73A 3VP9A 1JY2P 2W6BA 1AFOA 4Y99C 1LT9C 4GKGA 1GK4A 1M1JA 5AW7B 1YTZT 1MFZA 1X9VA 1YYCA 2LKMA 1KFNA 4GT1A 1A02F 1GW4A 2IX7C 1GU5A 1GW3A 1FJPA 2ZFCA 1G2CB 3HD7D 3HE5A 3M9QA 5CHXA 3B5NA 1LWUA 2NPSD 1MV8A 2H7HA 3M0AA 4AUWA 2WPRA 1DH3A 1SQQK 1H88A 2MJZA 1S9KD 1NTMK 5AVRB 3VMXA 3EFGA 3NMDA 1L4AD 1KILA 1IFDA 5AVWB 5AW9B 3RL0D 1LT9A 1FZAA 2I1KA 2HFED 3P8CE 3V2RA 3BATA 3BASA 2N1TD 1DEBA 1NTKK 1N7LA 1SFCB 1YTZI 5CJ0A 1LTJA 3RL0C 2KYVA 1WT6A 1NH4A 5AW1B 1LTGC 2WT7B 4I6MC 4LC1A 5KLVK 1IFNA 3E1IA 1HJBA 1JY2N 1JTHB 1GL2B 1N7SC 2Q7CA 3M0DC 2HYNA 1SQXK 2M8RA 1GU4A 2Q5UA 1FZGA 4IFFA 4N78E 2Z5IA 3EQ2A 3MUDA 1XTGB 5KJ7D 2HLOA 4JYCA 3IFMA 3KQGA 1NHLA 1HVVA 1GL2C 3O8ZA 5CCHD 1JCCA 2HPCA 1RE4C 1RY3A 3RK3B 1Z56A 3HE4B 5AW5B 1ZN5A 3VTPC 3V2NA 4ZKPA 3CLQA 3NTNA 2WPSA 1SQVK 3L36A 1KFMA 1GK6A 1HUCA 3U59A 2P2UA 1J1DC 4W7ZA 4WB4A 2H43A 3GHGA 2W6AA 1IO4A 2HODA 2FYUK 2A45G 1T3UA 2O1JA 2C9LY 1NU1K 2QM8A 2XNXA 1FOSE 2YO2A 3OAKA 4EOTA 3HD7C 1LWUC 3RK2C 2OYIC 1N2DC 4C46A 2CPSA 1M7LA 5CCGD 1IFJA 2FFDA 3RK3D 3VOPA 1N7SA 2NPSA 1KZUB 1RE3A 4DZOA 5CCGC 1JMMA 2XV5A 3KDPB 3VN0A 2GUVA 4GIFA 2VRSA 1SQPK 2R5DA 3N7NA 2GUSA 1T3JA 3C9IA 1GDTA 4WY4C 1KILD 3A2AA 1HH0A 2QM7A 1LTJC 1L4AA 3L35A 1J1EB 5APQA 5KTBA 5APYA 2BASA 4LGDE 3M9BA 5AVXB 1QL1A 1GZLA 3LW5H 1E5WA 2J59M 3VP8A 2WSEH 2OYHC 4WY4B 2FYZA 1LTAC 4OH8B 1CI6B 4N3YB 1FOSF 4AQRD 2J58A 3TYYA 3WMM0 3MTUE 2OYIB 3N4XA 1FZBA 1NOHA 3HUSA 5AVYB 2L5GB 2N1TC 1JCDA 3VMZA 2R3CA 3MGNA 1ZR2A 1N73C 1G2CA 1HGZA 1OWAA 3TSIA 1FZCB 2KB7P 5KJ7A 2XDJA 2WZ7A 5BU5A 2C0WA 3TNUB 2R5BA 1LTTC 5AVZB 3GHGC 3A5TA 2JEEA 3V4QA 2CPBA 2O1KA 1RF0A 5APVA 4XE5B 5BU8B 3H32B 4C7NB 3IR9A 1MUUA 3MIWA 1T2KC 1RE3C 5AVUB 3OJAB 3KPEA 2OYHB 2N1TA 4N78D 1M1JC 2FXMA 1J2JB 5AW2B 4DOJA 3V2QA 1JTHA 1HTLC 4LLHA 5AW0B 3OA7A 1RF1C 2KLVA 5AVQB 1N73B 1JY2O 1FBMA 3U1CA 2NPSC 5APUA 1M1JB 2YO3A 2ZXEB 5AW4B 1IJDB 1LGHB 2I1JA 1SVFA 3HD7B 4M3LA 1NO4A 2HPCB 5CCGA 1WRGA 1CSBA 2C0XA 3LIDA 4WBAA 1IFMA 1KILC 3SWYA 1L4AC 1N7SB 1H8AA 2PP6A 2P7JA 2P67A 3V4WA 1AQ5A 2POHA 1XTCC 1JO5A 2E42A 2YKOA 1LT9B 1FU1A 2OYHA 2JJLA 4JYBA 2W27A 1N86A 1JY3O 5AW8B 5BVZA 1JY3N 5APWA 2HG5D 2IFMA 3II6A 4I2LC 4WY4D 1DX7A 1LTJB 3PP5A 4AYCA 2WT7A 1FZEA 2N9BA 1SFCD 4C7RA 3KYQA 1URQA 1W2EA 1VPCA 4B86A 2IFNA 2P1JA 3U1AA 1MZ9A 1HWTC 1RE4A 2OARA 2FFDB 3NFQA 1GL2A 3BVHA 2IPPA 2GM4A 3V5BA 4HYTB 3M06A 2KP8A 2A45H 1RF1A 1N7SD 2WPQA 3A7OA 2WWWA 3HRNA 3B5ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKU A;  4N3Y B;  2FXM A;  2JEE A;  3VP9 A;  1WT6 A;  1NKN A;  4GIF A;  4ZKP A;  3N4X A;  3N7N A;  3C9I A;  2POH A;  3U1A A;  5BU8 B;  4I1L A;  3U1C A;  3U59 A;  1X79 B;  5KTB A;  1IC2 A;  4O9B A;  3OJA B;  5BVZ A;  3P8C D;  4N78 D;  5BU5 A;  3BAT A;  3VP8 A;  3BAS A;  3HRN A; 
#chains in the Genus database with same CATH topology
 1NTK G;  1IK7 A;  1FAV A;  3D6Z A;  1JNM A;  1NYH A;  3C8V A;  4CPG A;  1FZC C;  1LWU B;  2AEJ A;  2FXP A;  3RK2 B;  1NKZ B;  2XU6 A;  2E43 A;  4A7P A;  1ZLL A;  5TIS E;  1Q2N A;  3S4R A;  5E79 H;  1PPJ D;  3RL0 B;  2QEX P;  1IK9 A;  3GHG B;  2E75 B;  5APS A;  5CCH C;  1QL2 A;  4RKU J;  2M0B A;  2RN0 A;  4PD4 D;  3H1H J;  3A3Y B;  3R4Y A;  2Y0E A;  1L0L E;  2K9J A;  3H32 A;  1KB9 H;  4H44 D;  4C7N A;  2K88 A;  2QJK C;  2KUB A;  1JM0 A;  5C39 A;  2JWA A;  1DD3 A;  5AVT B;  1YJW P;  2BEQ D;  2P10 A;  5B5E E;  2WIT A;  5AW3 B;  2IBZ D;  2AXT H;  3L37 A;  3L73 G;  1JY3 P;  3QH9 A;  5CMZ A;  1QEX A;  3I5C A;  4QMA A;  1BDD A;  4L75 A;  3HTK A;  3AE6 C;  4XFJ A;  3SFE C;  2WTY A;  1T2K D;  1S4X A;  1L0N K;  2K37 A;  1ZW0 A;  1KYO D;  3M0D A;  1KC8 Q;  1G1I A;  4EIJ A;  1NTM J;  1NTZ D;  1SFC A;  4BRY B;  1SQV E;  2BCC D;  3CX5 D;  1ZV8 A;  1BCC E;  2AEM A;  1J1E C;  4JPZ B;  4PV1 C;  4W80 A;  3RK3 C;  3G3Z A;  3H1L G;  1GTW A;  1AA0 A;  2QJP C;  2FFD C;  1S5L E;  1FJK A;  1HGV A;  4L74 A;  4H13 D;  3BRV B;  3L74 G;  4HJG H;  2XKM A;  1M8O B;  3T97 A;  3HE5 B;  3UIA A;  4OWF A;  3RGU A;  2YMY A;  3P7K A;  1KB9 D;  1LTS C;  3HUS C;  2IBZ I;  1SQQ E;  4O9B A;  3CCS P;  1SQQ G;  4W7Y A;  3P32 A;  3OW2 O;  4NPD A;  1FZF A;  2Q9I A;  2NPS B;  3L74 J;  1P84 H;  3CL3 D;  5AW6 B;  3RK2 D;  3AE7 C;  3HD7 A;  1USD A;  3CWB G;  3CCJ P;  1CZQ A;  1K73 Q;  4GOF A;  2QJP B;  1ZR4 A;  4U3F J;  1PFI A;  1KQF B;  1CW5 A;  1EZV E;  1PL5 A;  2E75 D;  5CBO A;  1EQ7 A;  3BCC J;  1MFT A;  3R2P A;  1PGQ A;  1OMI A;  2KK7 A;  3AED C;  3M9H A;  3PJS K;  3A0H E;  1KYO H;  2KI7 B;  2N9Y B;  3K5B A;  1KIL B;  2R32 A;  1OXZ A;  1Q81 Q;  2PFX A;  2WSF H;  1X8Y A;  1PGP A;  2Y0C A;  1VDF A;  2K1A A;  2K9J B;  3O6Q A;  4H44 B;  4IFM A;  1SQX J;  4XA4 A;  1S5L H;  3S1K A;  3H1K J;  1BDC A;  3V2P A;  3BCC D;  5E79 E;  4RES B;  1KIL E;  1R5S A;  5AVV B;  3CCQ P;  1H89 A;  1KQS O;  3CI9 A;  1NU1 J;  1SFC C;  2B87 A;  3RBX A;  4WY4 A;  1NWQ A;  1OW6 A;  3MP7 B;  4U7J A;  1CI6 A;  1JOC A;  1SS1 A;  3L4F A;  3HTK B;  2PAJ A;  3AEA C;  4N6J A;  5APT A;  1URQ C;  1IFI A;  5M1B A;  1Q90 D;  1RQV A;  1T8Z A;  2HOD B;  2YNY A;  3GG2 A;  3SWF A;  1IZN B;  2W90 A;  4ZKU A;  3L73 D;  1BE3 J;  3CWB E;  2OYI A;  1OFC X;  2A06 E;  2R3S A;  1KQL A;  4JF7 A;  1VQ8 P;  1SQB K;  4I7Z C;  2J5U A;  1JEK A;  1NKN A;  2WVR A;  1NTZ K;  1URQ D;  5KLI B;  4I1L A;  2JWD A;  2Y0D A;  1URQ B;  5APX A;  3BRT B;  3B5N C;  1GL2 D;  2Z5H A;  3CX5 H;  3NXS A;  3HUS B;  1X79 B;  4DJG A;  1FZC A;  1GD2 E;  1USE A;  2QVA A;  2FYN B;  1BE3 E;  1FDO A;  3CWB J;  1K04 A;  1LTB C;  3AEF C;  3MD0 A;  4HH2 A;  3TNU A;  5CJ4 A;  1BSH A;  1L0L K;  2H89 C;  2WPV B;  1LTI C;  1M56 D;  2XND H;  3H1H G;  3D70 A;  2AEF A;  3P8C D;  1Q82 Q;  1SLQ A;  3SSU A;  3M91 A;  3WUV A;  1G1J A;  2O01 H;  3HE4 A;  1NU1 E;  2A45 I;  1RF0 C;  1S3J A;  3TK1 A;  2DW3 A;  5B66 H;  2BCC G;  2M3B A;  1RF1 B;  4RJT A;  3B5N B;  2Y9Z A;  5CCH A;  2QJY B;  3H1K E;  4KHX A;  1SQX E;  3VYI A;  1M1K Q;  1VQL P;  1YIT P;  1BCC D;  1EDL A;  2Z4E A;  1U7J A;  1J1D B;  3GF3 A;  3P8M C;  4H44 C;  4L76 A;  3JCU H;  1FS0 E;  1YQ4 C;  5KJ7 C;  1S9K E;  3A0B E;  3H1I J;  2WSC H;  3L71 G;  3AEC C;  1JUN A;  2XZR A;  1KYO I;  1S2E A;  3BCC E;  1VQ7 P;  2LXB A;  1NAF A;  4HB1 A;  2Q3I A;  2H8P D;  2N1T B;  4U3F E;  5AVS B;  4Y99 B;  2KOG A;  2KSJ A;  1LP1 A;  3B8E B;  1IC2 A;  3TF5 A;  4IFD K;  5KAI E;  1FDM A;  2C9N Y;  2FKW B;  1L4A B;  4UB8 H;  2A06 G;  3CC2 P;  3LIE A;  3L74 E;  3Q1M A;  2YKQ A;  1T6A A;  2YKP A;  1SQQ J;  1P84 I;  2ZAE B;  3CCV P;  1Y8A A;  3AE1 C;  4I7Z B;  1EXJ A;  1SP4 A;  3H6P A;  1KV4 A;  4NPE A;  1N73 A;  3VP9 A;  2WQY C;  1JY2 P;  2W6B A;  1A02 J;  1AFO A;  4Y99 C;  3H25 A;  1LT9 C;  1VF5 C;  2QSI A;  2RMZ A;  1GK4 A;  4GKG A;  1M1J A;  4TLF A;  5AW7 B;  1SQV J;  1YTZ T;  1MFZ A;  2D2C C;  1NTM E;  1X9V A;  1YYC A;  4PD4 H;  2LKM A;  1KFN A;  2W83 C;  4GT1 A;  5TIS H;  1A02 F;  1GW4 A;  2KNC A;  2FYU G;  1P84 D;  2IX7 C;  3CXH D;  3WUT A;  1EDJ A;  1BSN A;  1GU5 A;  1GW3 A;  2OGU A;  1L0N E;  4YTP C;  4ZNC A;  1FJP A;  4ASW A;  2ZFC A;  2JDI H;  1G2C B;  1PP9 D;  2QRX A;  3HD7 D;  3HE5 A;  2QE7 H;  1AVY A;  1W5C E;  1VF5 B;  3M9Q A;  4PV1 D;  2Y9Y A;  3B5N A;  5CHX A;  4D6T G;  1LWU A;  2NPS D;  1MV8 A;  3RK3 E;  3H1L D;  2AXT E;  2D2C B;  3WU2 H;  1L0L J;  2H7H A;  3M0A A;  4OGQ C;  2AXC A;  3QWO C;  2IBZ E;  4Z1M H;  4AUW A;  2WPR A;  1VQ5 P;  1SQB E;  4KJM A;  3A0H H;  1DH3 A;  1KN7 A;  1SQQ K;  2WSC J;  5AW5 B;  3G71 P;  1H88 A;  2MJZ A;  1S9K D;  1NTM K;  5AVR B;  3AE8 C;  2ITA A;  1NTK E;  3L72 E;  3VMX A;  3EFG A;  3NMD A;  1NTZ J;  1NTM D;  4EYY Q;  1L4A D;  3FGA D;  1YI2 P;  1OIP A;  1YBK A;  1KIL A;  3JCU E;  1IFD A;  1X22 A;  3B71 A;  1SQV G;  1U57 A;  5KLV G;  2KZJ A;  5AVW B;  5AW9 B;  3RL0 D;  2YIU B;  1LT9 A;  3GF7 A;  1FZA A;  2I1K A;  5KLV E;  2HFE D;  1U7M A;  2O01 N;  2KXP B;  3P8C E;  3PH0 A;  3V2R A;  3L70 G;  4IOI H;  3BAT A;  3L75 E;  3BAS A;  3CC7 P;  2N1T D;  1DEB A;  2B9B A;  3I55 P;  5EFW B;  1NTK K;  1UII A;  1N7L A;  3TGU E;  4YXW H;  1SFC B;  2PGD A;  4BRY A;  1YTZ I;  5CJ0 A;  1KMI Z;  3CD6 P;  2V7Q J;  4Y28 J;  2E76 C;  1LTJ A;  3RL0 C;  2KYV A;  1WT6 A;  3CCR P;  4GOD A;  1YIJ P;  1NH4 A;  5AW1 B;  5CBN A;  1LTG C;  1SQB G;  2WT7 B;  4TT3 H;  2OTJ P;  4I6M C;  4LC1 A;  1H0T A;  3AE9 C;  5KLV K;  1IFN A;  3E1I A;  1HJB A;  1JY2 N;  1JTH B;  1GL2 B;  2YXQ B;  3CC4 P;  1N7S C;  1RHZ B;  1QX8 A;  1GMJ A;  4PD4 E;  2Q7C A;  4GOE A;  2ZYA A;  2NZ2 A;  2HYN A;  1E79 H;  3M0D C;  1SQX K;  2M8R A;  2IZ0 A;  1L0N D;  1BGY G;  3H1I G;  3L71 J;  3TGU J;  1GU4 A;  5KLI C;  3CCL P;  3ITK A;  2Q5U A;  2YMK A;  3L75 J;  4IFF A;  1FZG A;  2WSE J;  4N78 E;  2HR3 A;  2FYU E;  2Z5I A;  3EQ2 A;  1AV1 A;  3H1J J;  3MUD A;  4UB6 H;  1XTG B;  4DT0 A;  4H0L D;  1UIX A;  2ZJS E;  5KJ7 D;  2HLO A;  4JYC A;  3IFM A;  1HVV A;  1NHL A;  1GL2 C;  3KQG A;  4KT0 J;  1NTM G;  3KZI E;  3O8Z A;  4RO0 A;  1DD4 A;  1JCC A;  3RL0 g;  3WU2 E;  1L2P A;  1RE4 C;  5CCH D;  1R8E A;  1DIP A;  1RY3 A;  3RK3 B;  1SQB D;  1X0T A;  1Z56 A;  3G4S P;  3HE4 B;  2W8Z A;  1M57 D;  2K9Y A;  1NTZ E;  1ZN5 A;  2WSF J;  4K35 A;  3L72 J;  1NTK J;  1EC5 A;  3O6Q B;  3V2N A;  3TDK A;  3FWN A;  3CLQ A;  3VTP C;  1JMB A;  3NTN A;  4ZKP A;  5KLV J;  2WPS A;  2W6J H;  1SQV K;  3L36 A;  1KFM A;  1GK6 A;  5GTH E;  2OTK E;  3S9O A;  1HUC A;  1SQB J;  1PP9 G;  3L72 G;  3U59 A;  1PPJ G;  1K8A Q;  2G3A A;  2P2U A;  3CXH H;  1J1D C;  3AE2 C;  3IF4 A;  3L70 J;  4W7Z A;  3GHG A;  1OVV A;  2W6A A;  4WB4 A;  2H43 A;  1SQP G;  1IO4 A;  3L73 J;  3I56 P;  2HOD A;  5KLV D;  2FYU K;  5L8R J;  2PRR A;  2QG4 A;  5B66 E;  2A45 G;  1T3U A;  2O1J A;  2C9L Y;  1RQU A;  3L75 D;  1NU1 K;  5K5G B;  3L70 D;  2QM8 A;  1L0N J;  3L71 D;  5KAF E;  3USS A;  2E76 B;  2XNX A;  5H2F E;  1FOS E;  3LW5 J;  2R44 A;  1IFP A;  2YO2 A;  3PLN A;  2E5Y A;  4D6T E;  1OVR A;  3W68 A;  5B5E H;  3H1J G;  3PTZ A;  3ABV C;  2OYO A;  3Q5S A;  2IYP A;  1L0N G;  1SQX D;  3H1I D;  3OAK A;  4GDO A;  4ASV A;  4EOT A;  2FY8 A;  3CX5 I;  3H1K G;  2MKV A;  1FDI A;  1Q7Y Q;  1DEE G;  3HD7 C;  1QLE D;  1LWU C;  3RK2 C;  2OYI C;  4H13 B;  1KQG B;  1PPJ E;  1BGY J;  1N2D C;  2Q3E A;  3TGU G;  1WMK A;  4C46 A;  3AE4 C;  2QA4 P;  1AQT A;  1ZRT E;  1OVU A;  2CPS A;  3A0B H;  4U3F D;  2G8Y A;  2E75 C;  1M7L A;  4ZMD A;  2BEZ F;  4R4L A;  3CPW O;  1VF5 D;  5CCG D;  5KAI H;  1IFJ A;  2FFD A;  3T97 B;  3RK3 D;  2KNC B;  3GLM A;  2D2C D;  1D7M A;  2RKL A;  3FX0 A;  2E74 C;  1TU3 F;  3VOP A;  5KAF H;  1YJN P;  1N7S A;  3CXH I;  4H13 C;  5H2F H;  2FBW C;  1OX3 A;  2NPS A;  2A06 D;  4D6T D;  4K3A A;  3KZI H;  1N8R Q;  1ZME C;  4UB8 E;  3RBZ A;  5GTI H;  3JC2 2;  1KZU B;  4PD4 I;  1HJ0 A;  1RE3 A;  4DZO A;  5CCG C;  4IL6 E;  1JMM A;  1SQP D;  2XV5 A;  3KDP B;  3VN0 A;  2L91 A;  3GW6 A;  3H1I E;  2GUV A;  4GIF A;  1NTK D;  4HKZ H;  2VRS A;  1SQP K;  2R5D A;  2M3E A;  1S5L X;  1T3J A;  2E74 D;  2GUS A;  3C9I A;  3N7N A;  3GMA A;  4WY4 C;  3VMY A;  1GDT A;  2OTL P;  1LP1 B;  3Q3D A;  1Y9B A;  1KIL D;  2B87 B;  3A2A A;  3MZW B;  2JR8 A;  1HH0 A;  2QM7 A;  1LTJ C;  1L4A A;  3L35 A;  1J1E B;  3L72 D;  5APQ A;  1S1C X;  5APY A;  2BAS A;  5KTB A;  2KIK A;  2E76 D;  3FXE A;  3H1J D;  3H1L J;  2ZT9 B;  4LGD E;  1K9M Q;  3M9B A;  1SQX G;  5AVX B;  1QL1 A;  1GZL A;  2H88 C;  2ZT9 D;  1LT1 A;  3AEG C;  3LW5 H;  1E5W A;  3PRJ A;  2J59 M;  2ZYG A;  2WSE H;  3SWK A;  1PP9 E;  1ZP0 C;  3VP8 A;  1PIX A;  2OYH C;  4WY4 B;  1VQO P;  2FYZ A;  1KOR A;  1LTA C;  1CI6 B;  2P58 A;  4N3Y B;  4OH8 B;  4L73 A;  1FOS F;  4OVN F;  4AQR D;  2ZVN B;  2J58 A;  2K3R A;  3AE3 C;  2B89 A;  3TYY A;  3WMM 0;  3MTU E;  1AVO A;  1ZOY C;  3W67 A;  1M90 Q;  3Q5P A;  2OYI B;  1KTM A;  1EZV D;  3MHV A;  2ZT9 C;  2M5A A;  1FZB A;  1NOH A;  3HUS A;  3N4X A;  5AVY B;  2L5G B;  2UWJ E;  2N1T C;  1JCD A;  3VMZ A;  2R3C A;  1YQ3 C;  4EI2 A;  4H0L C;  3AEE C;  3MGN A;  3VMA A;  1ZR2 A;  1N73 C;  1L0L D;  1G2C A;  3D71 A;  2ZXX A;  1QVG O;  1HBW A;  1HGZ A;  1PZQ A;  1VQ6 P;  2OQQ A;  1OWA A;  2O01 J;  3FXD A;  1KB9 E;  3TSI A;  1PP9 J;  1FZC B;  4BXL A;  2KB7 P;  3L74 D;  2XDJ A;  2WZ7 A;  2V4H A;  2JKV A;  1PGJ A;  5BU5 A;  5KJ7 A;  2C0W A;  3G9R A;  3TNU B;  2R5B A;  2RH0 A;  3H1L E;  1LTT C;  1VQ9 P;  2IYO A;  1KB9 I;  1BCC G;  5AVZ B;  3PHL A;  3GHG C;  2ZYD A;  3A5T A;  3Q5R A;  1JB0 J;  1VL2 A;  2JEE A;  3TGU D;  1EDK A;  3V4Q A;  3CCE P;  2JO1 A;  4IL6 H;  2CPB A;  1VQ4 P;  2O1K A;  5GTI E;  1RF0 A;  5APV A;  1VQM P;  4XE5 B;  3F89 A;  5BU8 B;  4WWI A;  5GTH H;  2QJK B;  2WSS H;  4PJ0 E;  3H32 B;  4C7N B;  1SQQ D;  1P84 E;  3IR9 A;  1MUU A;  3MIW A;  3V6I A;  1T2K C;  1RE3 C;  1YHQ P;  1NTZ G;  3EWK A;  3OJA B;  2KS1 A;  5AVU B;  3Q2Y A;  3WUU A;  2I8D A;  2KSE A;  1BE3 G;  3KPE A;  2OYH B;  4OGQ B;  2N1T A;  4N78 D;  1QVF O;  2FYN C;  4IL6 X;  1YJ9 P;  3G6E P;  1VQK P;  1M1J C;  2Q6Q A;  2KLU A;  3EFF K;  3JSV C;  1KYO E;  2FXM A;  1J2J B;  2M5A B;  5AW2 B;  2QIW A;  4DOJ A;  2WMM A;  3V2Q A;  1JTH A;  1HTL C;  3F5H A;  4LLH A;  5AW0 B;  1BGY E;  3OA7 A;  1RF1 C;  1BCC J;  2KLV A;  2QJY C;  5AVQ B;  1N73 B;  1FC2 C;  1BGY D;  2NRG A;  3BCC G;  3E7K A;  1JY2 O;  1FBM A;  3U1C A;  2NPS C;  2SPZ A;  5DJT B;  5APU A;  1M1J B;  2YO3 A;  3CCU P;  1ZXG A;  2ZXE B;  5AW4 B;  1IJD B;  3AEB C;  1LGH B;  3E1R A;  4D6T J;  1EDI A;  2I1J A;  1SVF A;  3HD7 B;  4M3L A;  1NO4 A;  1EXI A;  2FYU D;  2HPC B;  3CXH E;  3CCM P;  1AJY A;  5CCG A;  5DJU B;  1WRG A;  4YXD C;  1CSB A;  1Q86 Q;  1NU1 D;  2C0X A;  2YXR B;  3LID A;  4WBA A;  1OW7 A;  1IFM A;  3L73 E;  1KIL C;  3L75 G;  3SWY A;  1L4A C;  3IAO A;  1HF9 A;  3L70 E;  1PV3 A;  3H1H E;  3KXD A;  1N7S B;  3CME P;  2E74 B;  3MUD C;  1MKM A;  1RH5 B;  1L0L G;  2CK3 H;  2PP6 A;  2P7J A;  3B4S A;  5TJH A;  2LXC B;  4NPF X;  2P67 A;  1LJ2 A;  1NAY A;  3V4W A;  1AQ5 A;  2Q1K A;  2POH A;  1R5L A;  1XTC C;  4JBZ A;  1JO5 A;  2E42 A;  1SQV D;  2YKO A;  1LT9 B;  3CX5 E;  4OGQ D;  4PJ0 H;  2KS1 B;  1FU1 A;  3ZDM A;  1VQP P;  5KKZ C;  2JJL A;  4JYB A;  2OYH A;  4WVZ A;  2W27 A;  1N86 A;  1JY3 O;  1ZRT D;  2ZVO B;  4R4M A;  5AW8 B;  5BVZ A;  1JY3 N;  5APW A;  1NGM B;  3H1J E;  1K05 A;  4U3F G;  2HG5 D;  2IFM A;  3II6 A;  2IBZ G;  2FYU J;  4I2L C;  4WY4 D;  1DX7 A;  4BWN A;  4EDF A;  1LTJ B;  2HPC A;  3PP5 A;  4MN4 C;  4AYC A;  1VQN P;  1PGO A;  3H1K D;  3L71 E;  2WT7 A;  1H8A A;  3D6Y A;  1H0T B;  2O3J A;  1W2B O;  1FZE A;  1LNQ A;  1Y47 A;  2N9B A;  1OZH A;  4JQ0 D;  2JP3 A;  1SFC D;  5KKZ B;  3CWB D;  4C7R A;  4DCK A;  3KYQ A;  1URQ A;  1SQP E;  1W2E A;  3H1H D;  2E5T A;  2BCC J;  1S72 P;  1VPC A;  3IN6 A;  1FE6 A;  2V7Q H;  2IFN A;  4B86 A;  2IZ1 A;  2BCC E;  2P1J A;  3U1A A;  2B88 A;  1MZ9 A;  1SQP J;  3KHU A;  1EZV I;  1NU1 G;  1QGK B;  2KZI A;  1KD1 Q;  1BE3 D;  4PV1 B;  1HWT C;  1RE4 A;  1NJI Q;  3AE5 C;  2OAR A;  2FFD B;  3CMA P;  3NFQ A;  3SFD C;  1GL2 A;  3BVH A;  2IDB A;  2IPP A;  2LR2 A;  2GA1 A;  4UB6 E;  2GM4 A;  1OW8 A;  4YPC A;  3V5B A;  2FXO A;  3C1L A;  4H0L B;  4HYT B;  3M06 A;  1EZV G;  2KP8 A;  2A45 H;  1RF1 A;  3FWL A;  1N7S D;  2WPQ A;  3A7O A;  2YIU C;  1NVO A;  2WWW A;  3HRN A;  3B5N D; 
#chains in the Genus database with same CATH homology
 1FAV A;  1JNM A;  1FZC C;  1LWU B;  3RK2 B;  1NKZ B;  2XU6 A;  2E43 A;  1ZLL A;  3RL0 B;  1IK9 A;  3GHG B;  5APS A;  5CCH C;  1QL2 A;  3A3Y B;  3H32 A;  4C7N A;  5AVT B;  2WIT A;  5AW3 B;  3L37 A;  5CMZ A;  1JY3 P;  3I5C A;  3HTK A;  2WTY A;  1T2K D;  1L0N K;  3M0D A;  1G1I A;  4EIJ A;  1SFC A;  3VMY A;  1ZV8 A;  4W80 A;  3RK3 C;  1J1E C;  1GTW A;  3G3Z A;  2FFD C;  1FJK A;  1HGV A;  3BRV B;  2XKM A;  3T97 A;  3UIA A;  3HE5 B;  2YMY A;  3P7K A;  1LTS C;  3HUS C;  1HBW A;  4O9B A;  1FZF A;  4W7Y A;  3P32 A;  2Q9I A;  2NPS B;  3CL3 D;  5AW6 B;  3RK2 D;  3HD7 A;  1CZQ A;  1ZR4 A;  1PFI A;  1CW5 A;  1EQ7 A;  3R2P A;  3M9H A;  1KIL B;  2R32 A;  1OXZ A;  2WSF H;  1X8Y A;  4IFM A;  1VDF A;  4XA4 A;  3V2P A;  4RES B;  5AVV B;  1H89 A;  3CI9 A;  1SFC C;  4WY4 A;  1NWQ A;  1CI6 A;  1JOC A;  3L4F A;  5APT A;  3HTK B;  2PAJ A;  4N6J A;  1URQ C;  1IFI A;  1T8Z A;  2HOD B;  2YNY A;  3SWF A;  4ZKU A;  2OYI A;  4JF7 A;  1KQL A;  1SQB K;  1NKN A;  1NTZ K;  1URQ D;  4I1L A;  1URQ B;  5APX A;  3BRT B;  3B5N C;  1GL2 D;  2Z5H A;  1GD2 E;  3NXS A;  3HUS B;  1X79 B;  1FZC A;  5CJ4 A;  1LTB C;  3MD0 A;  4HH2 A;  3TNU A;  1L0L K;  1LTI C;  3P8C D;  1SLQ A;  3M91 A;  1G1J A;  2O01 H;  3HE4 A;  2A45 I;  1RF0 C;  3TK1 A;  2M3B A;  1RF1 B;  3B5N B;  5CCH A;  4KHX A;  3VYI A;  2Z4E A;  1J1D B;  3P8M C;  5KJ7 C;  1S9K E;  2WSC H;  1JUN A;  2XZR A;  1NAF A;  2Q3I A;  2H8P D;  2N1T B;  5AVS B;  4Y99 B;  2KOG A;  2KSJ A;  3B8E B;  1IC2 A;  4IFD K;  1FDM A;  2C9N Y;  2FKW B;  1L4A B;  3LIE A;  2YKQ A;  2YKP A;  1SP4 A;  3H6P A;  1A02 J;  1N73 A;  3VP9 A;  1JY2 P;  2W6B A;  1AFO A;  4Y99 C;  1LT9 C;  4GKG A;  1GK4 A;  1M1J A;  5AW7 B;  1YTZ T;  1MFZ A;  1X9V A;  1YYC A;  2LKM A;  1KFN A;  4GT1 A;  1A02 F;  1GW4 A;  2IX7 C;  1GU5 A;  1GW3 A;  1FJP A;  2ZFC A;  1G2C B;  3HD7 D;  3HE5 A;  3M9Q A;  5CHX A;  3B5N A;  1LWU A;  2NPS D;  1MV8 A;  2H7H A;  3M0A A;  4AUW A;  2WPR A;  1DH3 A;  1SQQ K;  1H88 A;  2MJZ A;  1S9K D;  1NTM K;  5AVR B;  3VMX A;  3EFG A;  3NMD A;  1L4A D;  1KIL A;  1IFD A;  5AVW B;  5AW9 B;  3RL0 D;  1LT9 A;  1FZA A;  2I1K A;  2HFE D;  3P8C E;  3V2R A;  3BAT A;  3BAS A;  2N1T D;  1DEB A;  1NTK K;  1N7L A;  1SFC B;  1YTZ I;  5CJ0 A;  1LTJ A;  3RL0 C;  2KYV A;  1WT6 A;  1NH4 A;  5AW1 B;  1LTG C;  2WT7 B;  4I6M C;  4LC1 A;  5KLV K;  1IFN A;  3E1I A;  1HJB A;  1JY2 N;  1JTH B;  1GL2 B;  1N7S C;  2Q7C A;  3M0D C;  2HYN A;  1SQX K;  2M8R A;  1GU4 A;  2Q5U A;  1FZG A;  4IFF A;  4N78 E;  2Z5I A;  3EQ2 A;  3MUD A;  1XTG B;  5KJ7 D;  2HLO A;  4JYC A;  3IFM A;  3KQG A;  1NHL A;  1HVV A;  1GL2 C;  3O8Z A;  5CCH D;  1JCC A;  2HPC A;  1RE4 C;  1RY3 A;  3RK3 B;  1Z56 A;  3HE4 B;  5AW5 B;  1ZN5 A;  3VTP C;  3V2N A;  4ZKP A;  3CLQ A;  3NTN A;  2WPS A;  1SQV K;  3L36 A;  1KFM A;  1GK6 A;  1HUC A;  3U59 A;  2P2U A;  1J1D C;  4W7Z A;  4WB4 A;  2H43 A;  3GHG A;  2W6A A;  1IO4 A;  2HOD A;  2FYU K;  2A45 G;  1T3U A;  2O1J A;  2C9L Y;  1NU1 K;  2QM8 A;  2XNX A;  1FOS E;  2YO2 A;  3OAK A;  4EOT A;  3HD7 C;  1LWU C;  3RK2 C;  2OYI C;  1N2D C;  4C46 A;  2CPS A;  1M7L A;  5CCG D;  1IFJ A;  2FFD A;  3RK3 D;  3VOP A;  1N7S A;  2NPS A;  1KZU B;  1RE3 A;  4DZO A;  5CCG C;  1JMM A;  2XV5 A;  3KDP B;  3VN0 A;  2GUV A;  4GIF A;  2VRS A;  1SQP K;  2R5D A;  3N7N A;  2GUS A;  1T3J A;  3C9I A;  1GDT A;  4WY4 C;  1KIL D;  3A2A A;  1HH0 A;  2QM7 A;  1LTJ C;  1L4A A;  3L35 A;  1J1E B;  5APQ A;  5KTB A;  5APY A;  2BAS A;  4LGD E;  3M9B A;  5AVX B;  1QL1 A;  1GZL A;  3LW5 H;  1E5W A;  2J59 M;  3VP8 A;  2WSE H;  2OYH C;  4WY4 B;  2FYZ A;  1LTA C;  4OH8 B;  1CI6 B;  4N3Y B;  1FOS F;  4AQR D;  2J58 A;  3TYY A;  3WMM 0;  3MTU E;  2OYI B;  3N4X A;  1FZB A;  1NOH A;  3HUS A;  5AVY B;  2L5G B;  2N1T C;  1JCD A;  3VMZ A;  2R3C A;  3MGN A;  1ZR2 A;  1N73 C;  1G2C A;  1HGZ A;  1OWA A;  3TSI A;  1FZC B;  2KB7 P;  5KJ7 A;  2XDJ A;  2WZ7 A;  5BU5 A;  2C0W A;  3TNU B;  2R5B A;  1LTT C;  5AVZ B;  3GHG C;  3A5T A;  2JEE A;  3V4Q A;  2CPB A;  2O1K A;  1RF0 A;  5APV A;  4XE5 B;  5BU8 B;  3H32 B;  4C7N B;  3IR9 A;  1MUU A;  3MIW A;  1T2K C;  1RE3 C;  5AVU B;  3OJA B;  3KPE A;  2OYH B;  2N1T A;  4N78 D;  1M1J C;  2FXM A;  1J2J B;  5AW2 B;  4DOJ A;  3V2Q A;  1JTH A;  1HTL C;  4LLH A;  5AW0 B;  3OA7 A;  1RF1 C;  2KLV A;  5AVQ B;  1N73 B;  1JY2 O;  1FBM A;  3U1C A;  2NPS C;  5APU A;  1M1J B;  2YO3 A;  2ZXE B;  5AW4 B;  1IJD B;  1LGH B;  2I1J A;  1SVF A;  3HD7 B;  4M3L A;  1NO4 A;  2HPC B;  5CCG A;  1WRG A;  1CSB A;  2C0X A;  3LID A;  4WBA A;  1IFM A;  1KIL C;  3SWY A;  1L4A C;  1N7S B;  1H8A A;  2PP6 A;  2P7J A;  2P67 A;  3V4W A;  1AQ5 A;  2POH A;  1XTC C;  1JO5 A;  2E42 A;  2YKO A;  1LT9 B;  1FU1 A;  2OYH A;  2JJL A;  4JYB A;  2W27 A;  1N86 A;  1JY3 O;  5AW8 B;  5BVZ A;  1JY3 N;  5APW A;  2HG5 D;  2IFM A;  3II6 A;  4I2L C;  4WY4 D;  1DX7 A;  1LTJ B;  3PP5 A;  4AYC A;  2WT7 A;  1FZE A;  2N9B A;  1SFC D;  4C7R A;  3KYQ A;  1URQ A;  1W2E A;  1VPC A;  4B86 A;  2IFN A;  2P1J A;  3U1A A;  1MZ9 A;  1HWT C;  1RE4 A;  2OAR A;  2FFD B;  3NFQ A;  1GL2 A;  3BVH A;  2IPP A;  2GM4 A;  3V5B A;  4HYT B;  3M06 A;  2KP8 A;  2A45 H;  1RF1 A;  1N7S D;  2WPQ A;  3A7O A;  2WWW A;  3HRN A;  3B5N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...