4I1PA

Human malt1 (caspase-ig3) in complex with activity based-probe
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
379
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activity-Based Probes for Detection of Active MALT1 Paracaspase in Immune Cells and Lymphomas.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 110
structure length 379
sequence length 379
chains with identical sequence C
ec nomenclature ec 3.4.22.-:
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4i1pA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i1pA01
3RJMA 2H4WA 2FQQA 4QUEA 4QUIA 3BIJA 4AW9A 3GJSA 4PRZA 5IBRA 4EHHA 4D3YA 3KJQA 1RWKA 5IABA 2CDRA 4JR2A 1QTNA 4JJ8A 3NR2A 1PYOA 4NBNA 4QUDA 2J30A 4QUBA 1SHJA 4AWBA 2QLBA 4JR0A 4JJEA 4JJ7A 1K86A 3ITNA 3PD1A 1RWVA 1F1JA 2FP3A 3R7NA 4DCPA 2H48A 5IC4A 5LU9A 1I4OA 1QDUA 2WDPA 1RWWA 4FXOA 3IBFA 4ZVOA 2QL7A 2XYPA 2FUNB 4ZVSA 4NBLA 4EHNA 3V55A 2CJXA 1IBCA 3NS7A 4QUGA 3P4UA 4I1RA 4PS1A 1RWNA 4QU0A 3DEJA 4ZVQA 5I9BA 2XYHA 3H0EA 2H51A 1RWOA 3EDRA 3D6FA 4I1PA 3R7SA 3KJNA 2C2ZA 3D6HA 4NOJA 3D6MA 3GJTA 2C1EA 5IBPA 1RHMA 4EHFA 5IC6A 3KJFA 3H1PA 3V6LA 3V3KA 4FDLA 4QU5A 4NBKA 1RHQA 2Y1LA 2J31A 3R7BA 2AR9A 1CVRA 1RHRA 1SC4A 3DEHA 3UOAB 2HBRA 3QNWA 3SIRA 1NMSA 1KMCA 4JQZA 1SC1A 5JFTA 3H13A 4QU9A 4EHDA 4N6OA 2CNOA 2XYGA 3H11B 4NOKA 3R5KA 1RHUA 2HBZA 4N6NA 5IANA 2CNKA 3GJRA 4N6GA 4QUHA 2HBYA 4EJFA 4QUJA 2C2OA 1SC3A 4FEAA 1NMEA 4M9RA 5IAJA 1SHLA 4QTYA 1RHJA 4ZVUA 4ZVRA 1NW9B 2H65A 4N7JA 5IAEA 4QTXA 3S8EA 2QLJA 3UO8B 4N5DA 5IARA 4FGUA 5IBCA 3IBCA 3V6MA 3PCXA 4JR1A 2C2KA 1RWPA 1RWMA 2QL5A 4HQRA 2HBQA 1F9EA 1RHKA 2J32A 5LUBA 4EHLA 4HVAA 4ZVTA 2C2MA 5IAKA 4DCOA 2Y0BA 3GJQA 5IAGA 4N7MA 5K20A 1CP3A 4EHKA 5LU8A 3DEKA 3R6GA 4DCJA 1I4EB 2XZTA 2K7ZA 1M72A 3SIPA 5IASA 3OD5A 1ICEA 4IEFB 1GQFA 2QL9A 2XZDA 3R6LA 3H11A 1JXQA 3NKFA 3V4OA 1QX3A 3E4CA 2H5IA 4HQ0A 1RWXA 4JB8A 4QULA 1BMQA 4QUAA 2H54A 4AWAA 3K7EA 4NOLA 2QLFA 2J33A 4JQYA 4LSZA 1PAUA 2CJYA 3P45A 2CNNA 5LUAA 1I51A 4QU8A 2CNLA 1K88A 5I9TA 1NMQA 1GFWA 3R5JA 5H0IA 3V4LA 1I3OA 4PS0A 2NN3C 4IYRA 3DEIA 4NOMA 2DKOA 1RE1A 3S70A 3EDQA 3PD0A 4ZVPA 4D3XA 4EHAA 4PRYA 2H4YA 4D3ZA 2P2CA 2H5JA
chains in the Genus database with same CATH superfamily
5I1LA 4XP6H 3IB6A 4Y1AA 2X2OA 1W36C 2WW8A 1D9KD 4PMEA 1UQRA 1XXFC 1BF2A 4EMZA 2HLFC 2IQ9H 5JCXA 5EI5A 1GAFH 1KIPA 2RAMA 4IJQA 5JSFA 4JM0A 2PGIA 2XMQA 2GBLC 3DBLB 2IEGA 3JYOA 3OAUL 3BCRA 3MLXH 5CIPB 4BNUA 2MSEB 4F56A 5FEMA 1ORWA 3C48A 4J23A 1T5DX 4IX9A 5EUOE 1RLTA 4ALKA 1JEYB 1K5NB 4DO6A 4XPGH 3O2DH 1U0NA 1MNQA 3F2LA 4WK0B 4RMIA 1ZINA 4CMEC 4TNVK 3GRVA 1FZJA 5KBDA 1BA3A 1T3FA 2NW2A 5TDNA 3JATA 2P0EA 4ESOA 4NO5B 4FDMA 5T1KB 3WIVA 3S5YA 2ZB7A 4ZXBD 2YQ5A 5IBCA 4DEPC 1L9NA 3C5ZA 4B3XA 1LEKB 3P0IA 3NEYA 3PGA1 3VFSB 3R9XB 2QJRA 2ZREA 2QD5A 3HKBA 4WNYA 2IPNA 4QELA 1UB6A 4MWDA 1MAUA 2KJQA 5IM5A 1HH9B 2BFEB 5HDRA 2G8LA 4KLRA 4G97A 5LGJA 3WLOA 3C85A 3C5CA 2J3QA 3RVWC 4KXWA 3WIHL 3T3PF 1KP3A 1CE8A 3BMXA 1Q1JH 1Y8RA 2EEDA 1ZWKA 1SPBS 4A27A 4CL0A 4AENA 1F1AA 1Y18B 4TKMA 1QHSA 1Z7JA 1ADYA 2VZ1A 1CZKA 3P1VA 2DB3A 5DURD 3D0OA 1A7NL 5I1HH 4PSCA 3KBFA 1O89A 2CNZA 5F93C 4DBLC 3LUHA 3CC1A 1RIUL 3P0EA 3KT6A 5KTTA 3FR8A 4Z6KA 3FYUB 5F0LB 1Q14A 2PKRA 3C4QA 3MV9E 3L7FA 1X8LA 2BNQD 2WXHA 5F2KA 4MS6A 2Q8AL 1OAKH 1NKSA 3QEKA 4P2QD 3LX4A 3U61B 3G1UA 2O20A 1HHJA 3BEVA 4UTZA 2Z2IA 1UJ4A 5FTKA 4LDAA 2ZSIA 4BINA 4NF2A 1AA9A 3VPBA 5CR9A 3FUHA 3SD7A 5IU6A 1QI4A 3A27A 1OGAE 1Q1BA 3IDQA 1PG7W 2O06A 4PJHA 4PGGA 4H1LA 1RULH 3W0WA 2Z04A 4GPBA 4L3CA 5JPNA 1UBOS 2EG5A 3NRPA 3OY2A 3WSQH 2FPGA 1NXXA 2VXVH 3I3SR 3MS2A 2VO8A 4MMXC 3V8RA 1H4TA 2B1OA 1JZDC 2DOCA 3PA6A 1WVZA 2I32A 1PE0A 4FLRA 3UTTB 3MBED 3PITA 4PSDA 3ZTDC 4O1IA 3MODL 3ZGHA 1OZAA 4OJFL 2MCPH 1AMNA 2BIMA 2ZRPA 3P2EA 2VR5A 4FQXC 2G1AA 1AUXA 1JT9A 4B6FA 1EMTH 2QU8A 4LNHA 4DV2B 1SKAA 5HI4D 4BKOA 3TSWA 3MTJA 5IM7B 1SMKA 4HWSA 1U8XX 4UM7A 2R69L 4N0YL 3UACA 3AI2A 2X4UA 1IQWL 4QO1B 4ZAVA 3T7KA 2P44B 2RQ8A 1BE6A 2P7TA 4Q7DA 5HF8A 2OR9H 4XI5C 3K2BA 3HSSA 2VJ8A 2D31B 3HBFA 5JSZB 2DM4A 2B3TA 3FLMA 3E2MA 1N2SA 2YWCA 4CKEB 5DISB 1B15A 1R50A 3VZSA 3T9DA 2OBNA 2O6LA 3IOEA 3VWJC 5JXJA 4NQXA 1B8NA 1KKMA 1UXOA 1NIPA 3MUFA 3WGYA 3TN0C 1T66C 3KH3A 4BCZA 1X74A 3D7MA 3LKPB 3LY6A 1SCBA 4GX2A 5CVVA 4AVHA 5HVWA 2B69A 1XNJA 4DBLE 4P3YA 4Z7WE 1ISJA 4KHTH 5H37H 4NMLA 4UAJA 1ES0A 4BUJA 3G5MA 2LFEA 1UASA 1MUUA 1M74A 3MRGB 1IFGA 3AY7A 3QU2A 2VSKB 4BN0A 1AH2A 1RK7A 2W2OA 3CU5A 4BNIA 4DJDC 1NUQA 1E8YA 4EY6A 4UV4H 4UQ2B 3RVUC 2L0XA 3OJ0A 2A2ZA 4FMCF 1H19A 4QTIH 4GXTA 4KEAA 1PGRB 2IWEA 1XF2A 1EQUA 3SDAC 4XM1A 1Y4UA 3FGNA 3D1LA 1ESDA 3L7CA 1CI3M 2EFEB 4C0JA 1T0MB 3IPAA 4UDTB 4OG2A 3SJZA 2H17A 1A5ZA 2WSPA 1ZN8A 1B6SA 1FTWA 1PD0A 3FRJA 2GYSA 2J8ZA 1B7GO 3ZE2F 1CJKC 4KKZA 4RIGA 1CG6A 2HREA 1LK3H 3B9EA 1QI5A 3VFDA 1ZR2A 4J4PD 2PS3A 2XV6B 5JXAL 3H86A 2W80C 4FXPA 2WIJA 1XSJA 1J70A 4MYUA 2YL2A 3QUXC 2WVGA 3WNPA 1X0XA 4LBZA 4C2BA 3SQRA 4BVFA 3HHPA 1N18A 5JW4M 2F2TA 1PZ5A 4QRHA 3DXAA 2E4ZA 3T9CA 3BEOA 2XA1A 3EA4A 1U0HC 2ZX9A 3QEUB 1X5JA 4M00A 3VACA 4C89A 4TQ9A 1G66A 4H7FA 4NZRH 5JANA 3BSGA 1I7UB 3SYCA 5T8KA 2QUAA 3R7DA 2G0TA 3ZL2A 2L3BA 3SWWA 2MQ3A 3B6MA 4PB9L 1X7WB 3CFQA 5T3ZE 2UZ1B 1MWAB 2BIQA 3F12A 3EJYD 4PAQA 2R1YB 4BFEA 3QXWA 1T13A 2BFVL 2X0KA 2Y23A 4YT8A 4RGNE 5D7JC 5ALPA 1BU8A 1ZHLB 4QF1A 1M53A 4BO5A 4UB0L 2K6YA 1DJPA 2YMQA 3DF9A 2GHTA 3BVUA 2HHAA 5L7XL 1VL1A 2P40A 2VWHA 4HNAB 4ZS7L 4N1AA 4O2FA 4P82A 3UJTH 1FQKA 2WUCL 5ELIA 3L7KA 1KSHA 1E50A 3QUSA 5IX8A 1TTUA 1U1DA 3TAXA 5IB5A 2AK1H 3H9BA 3MV7E 1SNYA 1C1DB 3ORRA 2XC8A 3TFQA 3V6ZB 3WB2A 1KTKE 4RK4A 1THAA 1PKQE 1U9KA 3RI5K 3OQOA 5F78A 3IETB 3PNVA 2HLEB 2OKCA 1JECA 2W9DH 1XZIA 2WVVA 1P2SA 1A76A 1R74A 3MRXA 1DINA 1T9BA 2K7FA 5D4HA 1EHAA 2ZG6A 1HSOA 1G8GA 3STWA 4ANWA 3V79C 4R3WA 2UKDA 4MASA 4R6WA 5I18H 2OV0A 2AAVA 3CLEL 2PFSA 5CCKL 4EY8A 3S3CB 1ULVA 5KG9A 1UC4B 4RMWA 3VAAA 1ERNA 3HE6C 4GE3A 2RJNA 4PXYA 3DAYA 3NJXA 4Z7OF 3O41B 3HG4A 4OZIA 1AKMA 4IICA 3TNDA 4KRFA 5T8IA 2XE7A 5AM5A 3BM5A 1DJOA 2GC7C 4F2EA 3H99A 3OTTA 1U9JA 3I58A 4NBWA 5GQSA 4NH0A 4OI9A 1NEZB 4AUEA 1XQVA 2XG5B 3RTDA 4DS3A 2ERCA 2UZIL 2FQ1A 3QPQD 5FUXA 2HT3C 4ZMWA 3SBRA 3KEFA 2J3JA 2E5FA 3Q3VA 1O6GA 3CVDA 5LBSA 1BE1A 5FDWA 2X42A 3CBKB 5K59F 1MU0A 3ET5A 4IJMA 4YIQA 2W7TA 4ODWB 1BSIA 4OVKA 4RKFA 2IIBA 3TLMA 4DBVO 4OB6A 4JEUA 4INJA 1VYHA 3NOVA 2H07A 4A7PA 1J2EA 5F2EA 2OSVA 4GL2A 4TQHA 1WUKS 1TT5B 3GJSA 3HABA 2X0VA 3IFOA 3ZJTA 4KJYB 4XCYB 3M6VA 2QM8A 2EW2A 3IIJA 4UDTA 3BWYA 1RLMA 1GH7A 4KIJA 2FRDC 3FN4A 4ZGWA 1KBWA 3D6VA 4KLNA 2XPCA 2OI9C 2PEZA 1MCHA 2OHFA 4EH1A 2PX8A 4ILDA 1MJUL 1BH6A 3GEEA 3FU6A 5A3ID 1LPOA 4P4UA 2FSGA 2R9HD 5KIAA 3RBZA 1MUJB 3RILA 1K8ZB 5HBGA 4ZMYA 1O57A 5JR1H 3RVMA 3E18A 3ABQB 2AV6A 2PBZA 3PHJA 1Q1JL 5FPTA 4NIYE 4JPKL 5HQJA 4A63A 2OL3H 2GM3A 4HDRA 4C58B 4RHXA 3CEJA 4ENRA 2EBFX 4J75A 4JDZA 5I6MA 4BEJA 3GTVA 2IOYA 4PBTA 4OHPA 3Q3EA 1O9BA 4AY0A 3AY4C 4WSOA 3FUWA 1RIVL 4LF5B 4FQ1L 4IBLT 1IMHC 1TYRA 2YD2A 2WWRA 5CJXC 3WBBA 4AC9A 3FDJA 3KE0A 1XWFA 1V16A 2CLIB 2ASEA 2VDKB 3ME0B 3E80A 1VFPA 1QA9B 1PZXA 5K5YA 3B7WA 1YS7A 3N5CA 1CDOA 4M29A 4OH7A 4YXKL 1DO6A 4X44A 5HZHA 2V65A 3RUGF 3RVKA 4PY7B 2QT1A 3S35X 3D7SA 4EIWA 4M0UA 4B45A 3ZTNH 2GO1A 4B46A 1SVLA 3QUYD 1VHQA 2NNAA 3BFJA 1JNHB 4NKIL 3UBXI 1FYTD 3ENNA 4HGZA 4D25A 3UMMA 1H2HA 2P5WA 1V05A 2ZSWA 4MQ5A 3PDOB 2VWQA 5KSVB 2L8AA 1A6UH 4BHUI 3MMZA 3CV3A 3WDHA 4FJYA 4FJ6A 6PCYA 1EFRD 3SU8A 3S6CA 2ZTMA 1ZM3A 5A3SA 1FBIL 5LGHL 4IQHA 3RDPA 2QVFB 4HNAA 2WWVD 1BYUA 5C3UA 4V3BA 4AVIA 2WZBA 3BHBA 2EDEA 4OZFB 3EJCA 4GNKB 4MV8A 2BIOA 4GRWH 4UQDA 4NSNA 4RE6A 1QAMA 4YAWA 4HQNA 1Q95A 2D1FA 4GQIA 2VC2H 3HZYB 1L4IA 3ARRA 3PHCA 4FYSA 1E8WA 3ARBD 3PDIB 4UPDA 3VO2A 3S34H 4MDFA 5EKSA 2IZ7A 4Z77A 2ZQZA 1SHUX 2EADA 4RNCA 4OZHF 3ORJA 4EYEA 4H35A 4U1MB 4M1CC 2H4ZA 4IRUB 5ALYA 4R0MA 5FYKL 1N5MA 1EDZA 4GRMB 1XAKA 5EEWA 1MORA 4CBPA 3V4PA 4ALMA 2EECA 3NESA 1U0GA 1X3DA 1F41A 3M34A 2EUXA 3TASA 3HCVA 2DYPA 3CMMA 1VADA 1R3JB 2Q1YA 3KR0A 3GXFA 3RSOA 3MBEB 5IJWA 1KP9A 2C3XA 4K7PX 4ENPA 2DTXA 3OSUA 3UJCA 4GBMA 1N7IA 2J6EA 3UPAA 1YNLL 1PEAA 2KERA 2P80D 3WEXA 4WIAA 1ZRNA 2DUJA 1VECA 1S7UA 1EQAA 1J1OH 4LO9A 4PJIE 1JYWA 4O2AF 1WCIB 3IEUA 2FUQA 4YSPA 5I48A 3TZVA 3V52L 3WA6A 5JH7F 3PNOA 3SVZA 4FQCH 4K7PH 4DMCA 3CT4A 2YUZA 4EZKA 5BS0A 1MAHA 1UJMA 1KY5A 2UZ0A 1CQIA 2VM9A 3PJEA 4B4VA 4V02A 2D1QA 4AAYA 3QI2A 3H2JA 1YMUA 2IYFA 1B3JA 2QT6A 4X90A 3I0ZA 2A78A 4DK3A 2AC4A 1ZZGA 5DM60 1JHYA 1G9HA 2O2IA 3U39A 1AGFB 1OGAA 1OX4B 2CLMB 4HLQB 5KNCD 1EAJA 5JNVA 2W6MA 4HLDA 3FWYA 1Q9OB 4Q21A 5BOZG 3AWDA 1IL1B 3OD1A 4TM8A 2P49B 3KLHD 3INRA 2Y5TA 2C1PA 3SZMA 2XVGA 1L5RA 1GJIA 3ZXIA 3P3UA 4ZT6A 3IFPA 3RVJA 3V1TC 5J1TC 4POZD 2J6WA 1NJGA 4UIKH 1X1EA 1JZGA 1FNGB 1Y6RA 4NC9A 2HHJA 1XNGA 5KO2A 1ZMTA 5E4TA 1HTYA 5FKPA 1ETHA 4JFDE 5LYYA 3TRFA 2PEYA 3OX4A 5B58T 4MO2A 4L7VA 2VXSH 4ZVTA 3RUFA 2QYOA 2DWYA 3NCJL 4KUGA 3DR5A 1C1EL 2J9XB 4J2XA 2EFJA 4P6VF 5SX5H 1KELL 3SHOA 3JQOB 3ZUCA 3D51A 1E9EA 4FNQA 3NTCL 1YL6A 1BMQA 1BMFA 3RFRA 1AF4A 3N1UA 3SDAA 1G8AA 4U1LA 1D9KB 4BMDA 2RTTA 3NHZA 4FBGA 4H7IA 5A4IS 5HXAA 5F7JA 4N18A 1L9OA 4URXR 4CVXA 3MBXL 2R6GA 5E7IA 4WI2A 3H5RA 1SEPA 4ZCTA 1YS9A 4KTDH 3NEEA 3KQOA 4JP1A 3AB7A 3FDZA 4X92A 3CHSA 4MQSB 1X70A 5DIFA 2F19H 1O7DC 1U6IA 3KPSA 1DVUA 2W2LA 1LSSA 4PHXA 4PWHA 3NXKA 2WHEA 5EYPA 3QF7A 2YSSA 1F1GA 2NLOA 2O8CB 4WO4D 2H5EA 2WV3A 1JD7A 4BSWB 3IGAB 3F90A 2YXVA 1OANA 5ALEA 2G77B 2R62A 3AREA 5CCDA 2OPCA 2FEOA 5DHQA 2CFSA 4IIJB 2J1KA 2F4NA 4F27A 1XZ0A 3W6ZA 2HH0L 2ZXQA 3QY9A 4TUYB 1KEGH 4D0BA 4NYMR 2ZI9A 3TBBA 4TN9A 2FEEI 4GEKA 1RJGA 5KQRA 3EJZC 2FR8C 2Y3AA 3T06B 3L1VA 1SD2A 5CD3A 1CUBA 2GEQA 5ABAA 3MGGA 3KGSA 4N8DA 5DHUA 2I78A 5I1EL 3FFDA 4UQ3B 1U8NA 1PR5A 4MJXA 2DD8L 5KOMC 4Z7VE 1JWSA 3IQFA 4BFIB 4MWGA 2EKSB 4JFTA 5MI0B 5I8EB 5TPWL 1OCWL 3N53A 3VD1A 5JTUA 2PCPB 1TU4A 1CGSL 1AZLA 1E5DA 1TF2A 3OAAA 5F7LB 4HJ0C 3PT5A 1WBZA 4MB3A 4WW2C 1OP9A 1VLXA 3CNNA 4UTAL 2ZE5A 5DLMH 2E46A 2A73B 5I1AA 1ZLUH 3NP4A 5ID1A 4G5YA 1ZHLA 4QF1B 3TBYB 4DQOH 3QELA 1CGYA 1JIJA 2X1VA 5NULA 2W70A 2OJEB 2F53B 1CWVA 3FO0H 2VHWA 5CCHE 3FETA 3DC2A 3PABB 1T43A 3HMXH 2HKFH 4C5AA 2VYND 4RMSA 5BSWA 2Z2XA 1Y9EA 4LV8B 3C5SA 5HYIA 5DWUL 5FBQB 3ZXSA 3ELBA 1IXSB 5FLKA 1SOQA 3TLJA 1PEWA 3ND9A 3M5DA 2NY5C 1EBFA 5JNTA 4A67A 1MIOA 1NLBH 2BO0A 5B1HA 3OFSA 1DAMA 2V7HA 3TCLA 1OTSD 3WE1A 4AXWA 3GBLA 3I28A 3RWJB 2XMPA 2GF9A 2DEXX 2NXCA 3TFOA 4FYWA 4WZBE 2PR4H 4NCHA 2LAGB 2BY4A 2WUGA 4XUEA 3ZHZA 2VDPB 4ZMLA 1GMEA 1U2GC 4C0KA 4QQRA 1IC1A 1JKMA 3RNQA 5K01A 4PJEA 1QMPA 2HA3A 4G9FA 1RVFH 2LTAA 5AK4A 3SPIA 2XT9A 1CE6B 4YC7A 4JBNA 1M71A 1JF6A 3SZUA 2PKCA 3GLGE 4QOIA 4ABYA 1BOFA 4HNTA 4D3XA 1G7LA 3NHSA 5E6IC 1KEKA 3ZVKA 3FUNA 3TURA 2OLEA 3UW1A 3NN8B 1T80A 2W2KA 3LKOB 4H2AA 5IEKA 1TUEA 3CLRD 5F52A 4HVLA 1ZD1A 5HTKA 4W9NC 3N1FC 1A1SA 4GDFA 3BDXA 1AQJA 4QJ4B 4UOJA 4OAOA 1AKUA 3L95A 4Y88A 4XCCL 1KQFA 3J07A 3LT5A 1MCFA 3ESCA 2FWJA 3DOCA 1FYHB 2EIZB 3OKKB 2WJGA 4E68A 4PN7A 1XEUA 1E1CA 3V2HA 3DOHA 4BVGA 1YRAA 4RYDA 5F8QC 4K1XA 1T0IA 3EH2A 3RBAA 5C18A 1L0YA 4N6NA 1H5QA 5D7IA 3RUIA 2J9FB 3KYMB 2VITA 4RA0C 1HE4A 2OW7A 5FQNA 5KZMB 4TTDD 2P4SA 5FUOL 3HCVB 2NXYB 1XZ8A 4JFXB 3AB0B 4XRRA 3RWHA 4R8LA 2EUWA 4MCYB 4B4KA 4MQ4A 1AOZA 5HZKA 2ZIEA 4O5LH 4D9RE 2OR3A 1MHEA 4M76B 1PFYA 4DPMA 1J00A 4U0RB 4X5LA 2WKOA 4QYIB 1U0QA 1BMTA 4OUUB 4NJAL 2FT8A 1VZHA 1CLVA 5BV8A 3LLVA 5TS2A 3OFND 3H2ZA 1FU8A 3K09A 4BNDA 3K8QA 3SLRA 3PAVA 4KWIA 1KNOA 1O0CA 3DLIA 2C97A 2WLZA 3W39A 3VYRB 3I75A 3ASVA 3SF8B 3FVQA 3NCFB 3I6BA 2OR7A 3BDYH 2Y66A 4A8HA 1G7IA 2XDWA 2EC8A 2EP7A 4E41A 4P48A 1U93A 5DCYA 1WP9A 3ARBC 1WFIA 4ZGBA 1G8SA 1QOKA 3RHTA 1TMQA 3TTUA 5MI0C 1A7OL 1JPSL 1NVFA 5DOVA 3UPDA 3PIQA 2GCGA 3HB0A 1Q92A 3TBYA 5J2UF 1MTOA 3SGJC 1SULA 4FXGA 3BH8B 2EDQA 3EODA 1J0ZA 3TBKA 3FU3A 4ZSOE 3L8MA 5A1JA 2VTEA 1UOVA 2JJSA 4EN2A 2JGFA 2AF4C 1IBGH 1J48A 3SE9H 1L5LA 1N5AB 2FVNA 1XH1A 2CUZA 5DBEX 3MTDA 3CQFA 3S36H 1M7UA 4QHNB 4LCYA 1FFNB 3WZMA 3S3SA 4NC1C 4ZI2A 2YR0A 1IMJA 3O8XA 2X5JO 4ZFNA 3OZCA 4BRSA 4A6YH 3KPLA 1U8IA 3SBQA 1NEZA 4BK4A 5EFOA 2R96A 3RWIA 4P3CL 2VXVL 4K4KA 1IC4H 1II8B 3TV3H 4MVJM 4PV8A 4U7MA 1MQ8B 3RABA 1QRRA 4UIKL 4JBXA 3UAWA 2IPUG 1H6DA 4EELA 1P6QA 1M1NB 2EU8A 4P5TB 5A2KH 3FKJA 1ZNWA 3EUEA 3VX3A 1W75A 2A9FA 4B43A 4GH7B 4HV4A 2ZOLA 5C0EA 3OUTA 2HYMA 3JQBA 5FUQA 4DR4B 1IK6A 2N7SA 2FPIB 2G40A 3NSFA 1N6RA 5TB5A 4X20A 5I7OA 2ESVD 1AGBA 3BP5A 4YXLL 4HOXA 4XN2A 1A1OB 4MCMA 1UT6A 1OXBB 4YHOL 1DOZA 3U4GA 2XPZA 4S1SH 3P8ZA 1VE5A 4PJAE 2RHOA 2PGLA 3FSJX 4AVJA 4LA4A 1QPXA 4HUWB 3GXPA 1WZ2A 1PK9A 4KBGA 1K97A 5HIKA 2FA9A 5SZHB 2FK8A 1A3LL 4GW5B 1NUNB 3IN0A 2VQTA 1F51E 2NDFA 1U2RA 3JARB 3L3HB 1EFPA 2VBIA 4Q14A 5IEKB 5TFSH 5T6BA 1QYVA 5JHGB 2R0QC 2HRHA 1XVAA 5EMNA 1AE6L 4F6RB 2AF2A 1IL1A 1YNLH 1HDOA 1PVVA 2V9PA 5T1DL 3AUTA 1UJ3A 4LIQL 1FUUA 5AAPA 1TQCB 2QUHA 5C6TL 4UM8A 3ZWPA 1E6EA 1ZKDA 1VGEH 3LX5A 4HT1L 5I16B 2DD8H 1E1CB 4OQ1A 2FBRA 1LA2A 4IM7A 1AG9A 4OFWA 5D1ZC 4KZDH 2OQIA 3NPZB 3UEQA 3BGSA 4JY5L 2QKIB 3ZTYA 4OQNA 1GADO 3VPSA 2WZDA 3U9LA 1N19A 3VXOA 5LQUA 5C92A 4G5GA 2R6DA 1DIOB 2GBVA 3AEXA 3N06B 5CT9A 3UHPA 1MIMH 4G6JH 3PNMA 3OZXA 1CJVC 1D6EA 5I5RA 1TI7A 3OZGA 1F2UA 3C3JA 1FO0H 2HQSA 1BOOA 3KUUA 2QK4A 4MAYC 4WV3A 5AVKA 4ZYWA 1NRJB 4JUSA 5C7XL 4MR9B 2GCIA 4OAWA 3I4LA 2Z34A 1JHDA 1AMYA 4TSCL 3WYNA 1YN7A 3IMGA 3KOUA 1OSZB 1HZZA 3U1VA 1AANA 2YOCA 6YASA 5C2BH 4LLUB 3PYMA 4XC3L 4YUVA 3NFRA 1QE3A 4LTMA 4ANXA 3IT8D 2J09A 4HDMB 4B1FA 2ZTHA 2W4QA 3ZCPA 5ELXA 4AZ3A 4G1MB 1BEYH 4R0LA 4L3EB 1G5AA 5D2NE 2HAZA 1EP9A 1YD7A 4IIJA 3X2QB 3IU4L 2YGQA 1FNEB 1OHHD 1AXGA 4FXGB 3B8HA 4MA7H 1THCA 4YDRA 3IE2A 1AS6A 3U5ZB 3DZBA 1W581 4RA3A 1QR2A 3JS5A 4XWGA 1NJFA 1TKRA 1JLHA 3MBKA 2X1WL 2HMYB 4NQCD 1J9TA 2GCOB 3LPAA 2VLME 5CLQA 2FU5C 2YS4A 3T77A 1U9IC 1KERA 2OA9A 4L3OA 4XH9B 2B21A 2VYRE 3C60D 2RCSH 3AR2A 5SX5K 2CWRA 3T61A 3PTLA 4FOMA 2PZKA 4PD4K 2PR7A 3LHAA 3Q5TA 3UB3A 3CVHL 5DOZA 2I76A 4KK5D 4IBSA 4K7PY 3N1PC 3QJZA 3RF6A 1P0CA 5DK4A 5EJ2A 1GEGA 5ESWA 1GKKA 2BP5M 1M75A 4O51B 4A2EA 3SPVB 2JVIA 4I2VA 4Z3HA 1QHEA 3KQVA 3GXUB 3H7IA 1OB1A 1IJFA 5CH5A 5K3SA 1MFCH 7FABL 3CINA 3BP5B 2DFDA 3E7DA 2AC2A 3HW7A 4JLJA 1KKUA 1WIPA 2OW6A 3D07A 4MI3A 1DEEA 2AZDA 3ZHRA 3I6GB 2BKEA 4XUCA 4DP5X 2WJIA 2VUOA 4APQC 1WG3A 1NW9B 4M4RB 1P7KA 3F7NA 2W92A 4B3SB 2P9BA 3LBHA 4HAOA 5L2KD 3I3BA 3L3HA 2XN0A 4WV1A 1ZIYA 3H75A 4AXXA 1J21A 1NM4A 3FFBA 3OJOA 4PBXA 2Y1CA 4GRAA 1F1BA 2XCLA 4FYRA 4BVBA 1WFNA 1HWYA 1HDGO 3CSFA 1FN4B 4QXUL 1MAML 2PKWA 5G4KB 4PJGB 2G07A 1QTYT 4TUJB 4RQAA 3CVIH 4DZZA 1EG2A 3IEIA 3W5UA 3KVQA 4FQIL 3CFJB 4KVNL 2HADA 3JQGB 4MRMA 1FJ1B 2G75A 2QVXX 4U3SB 3NHFA 3LRLA 2VE6A 3MRVA 4X3CA 2GSIB 3HJTA 2ZWLT 5SY9A 4EW1A 3TR5A 1HYGA 3I6KB 3UC2A 1E27B 1P18A 5JUEL 4PLJD 5REQA 1CIUA 2CO4A 1V5JA 3RT9A 2CEKA 4EA6A 1QBAA 1TO5A 1HOXA 3VTZA 4ZOLB 1AGEB 1G4MA 3PC7A 4P93A 1HG1A 4WHDA 3N2ZB 3L4VA 3HDTA 4QLOA 1V2HE 4AYTA 1SQGA 3A67H 4H88H 2IGFH 2Z1PA 5JBQA 5J6HB 3MGOA 2BBWA 2GETA 2OZ4A 1DVZA 2P30A 2QTHA 1ZJ4A 1E6UA 5CP7B 5IWCA 4C83A 1NUHA 3QVTA 2FYYB 3WYBA 4MHHI 3VDBA 1Z5WA 3PFFA 3SBXA 2CO1A 3DDWA 2WXRA 3ZQUA 2CR0A 4UTOA 3AIIA 3LZOA 5ABDE 5J9FA 5ADOH 3HB3D 3FIJA 3T4XA 4PJ5E 2Z92A 3C2SA 4M89A 2YPKA 1QLEH 2NY2C 3OOHA 2H52A 4Q93A 1QNFA 1MJFA 4X99B 3GUTA 1XBTA 5CMAB 3L13A 1A97A 3R24A 2Y07L 1EZVY 1N34B 2EH8H 1ZSVA 3LZRA 1KU0A 4C8XA 4ZZFA 1HTTA 4RZHA 2EKDA 3NVQA 2W07B 2A6KA 1O0VA 3IR5A 1MCCA 2AFVA 4Y5VC 2H1PL 3TYXA 3T0VA 3LLMA 3AWGA 2BUAA 4CV0A 4YQFA 5IYZB 1RXEA 1K9TA 2NVWA 2NYUA 3VSQA 3FNQA 3U0TA 3K8YA 1AXTH 4Z0BH 4DO4A 5KUTA 5F1IA 4NJOA 2IYVA 4EA9A 3I02A 3OGOE 3S4YA 5EU5B 2DR3A 5DJDB 4NC1E 2VAAA 4OUUA 3OQ1A 3TCNA 1TTGA 3R0IA 2ILLA 4JOBA 2WUVA 4G7QB 1W87A 2V5RA 4G4SP 3AT0A 2VHXA 3BIKA 1DBKL 1G7PA 1VLMA 1IQDB 2O8DB 2QQKL 1B0AA 1XTBA 5F9HA 1VOTA 1I6WA 2ADFA 2ZNWA 1CFBA 2E7ZA 3MLWL 3KOXA 1IGYB 3HHSB 2VF8A 3PS6A 5BXFA 2BMWA 2C9YA 4TSBH 5HYJA 3T2OA 2BT4A 1B0GB 2Q29A 2ZZMA 2Y6VA 3PGJA 3A6GA 4UARA 4TV9F 4C4ZA 1KTDA 1J0EA 1KFCB 5AW0B 3VGGA 2O2YA 3UWKA 3IELA 4PP2B 3NQ41 5DSCB 3LG2A 3GU3A 5DJ6A 2A9OA 3RL2B 5T5QA 4Y98A 1TCVA 2B9BA 2ZJ4A 4OQFA 4X7DC 5DGXA 4WNQA 2FYTA 1XTLA 2KZ1B 1E1QD 2Q28A 5H0IA 3FN0L 1ET8A 3N85H 3ANNA 2CN1A 4BB0A 1E2VA 1RT9A 3HO8A 2VCYA 3LVRE 3PKJA 3PPVA 4YT5A 4X4ZA 5AJVB 4WFFD 4FLOA 3UV6A 2FGZA 3TWOA 3MNVB 1XF4A 5LNK6 5ALQA 2WBJC 3VKVA 5ERXA 3KTFA 5AI0A 1R8XA 3KUKA 3G0DA 1OAOC 1TM2A 1W85B 4AW4A 1Z4JA 4X6FB 3OLYA 1AS0A 4RFEA 3MQ4A 1K92A 1TZAA 4HQOA 4UCXA 2WIBA 1U0TA 1D6VH 3ME0A 4ZBJA 1LQUA 1P9MA 3BT2H 2FE4A 4FG6D 3A23A 3O47A 4CFSA 4GKSA 2W4MA 3FB6A 4Q7EA 2ZCLL 4EHDA 4EPWA 1XPOA 4N9GA 1U3HC 2XKBA 3TXYA 1Q20A 5AZ2H 3RU9A 4G0VA 3D6JA 1VYUA 2VJBA 4OBXA 1NCIA 2OCLA 2YHIA 4C54A 2ZYTX 5BRPA 1MW9X 2ODWA 2BFNA 1QP7A 3LK7A 1VJ1A 2NT1A 3HMQA 3PEWA 1PJ3A 2Y06L 1OYVA 5EPOA 3VR3A 5K9KB 4V0ME 1OVGA 4IL5A 1QHHA 1V8ZA 1BSVA 1UDAA 3EYVB 2EE6A 2YJTD 2BJHA 4YMSA 3AFMA 1G8MA 3D7KA 2BHTA 4PSAA 3P2YA 3EPJA 2GVZC 4JL8A 4YDQA 1K72A 1Z16A 3BJEA 4KRPC 1DP4A 3QY0A 3V0AC 2A92A 5A03A 5KSAB 1K06A 3ZU6A 3VVBA 2Y5QA 3RRXA 5FUZH 2RAFA 4O4HA 2Z6VA 1IULA 4KWHA 2CL7X 1B6UA 1SHXA 4HQQH 2WCPA 5HJ3B 1NN0A 1PFWA 3RYCA 5GRJL 2L04A 3O2QB 5CILL 4UBJA 2COKA 1E2JA 4ZMVA 3WFZA 3TCXA 1TTQB 4MMZC 1BGXH 1FFPA 2AX3A 2FJUB 2QB5A 3SCZA 4ZT1A 4LRQA 1KH3A 4HJTA 3AXSA 4RPKA 5B64A 1BF8A 4MRAA 3UMSA 1ZVSB 4KH9A 1KGUA 4YZFE 3CNBA 5E95A 1RK0B 3UTTE 1IXRC 3Q8XB 3QQDA 5JNLA 2FATL 3FTPA 1UPAA 4OK5A 1D8TA 4PX9A 1ODFA 2BVPA 4PQRA 1VJCA 4DNLA 2PLTA 2G1PA 1PSWA 1NVTA 2J9ZB 3DBHA 1GLNA 1MLDA 4RORA 2WLYA 5C1IA 4WI9A 3GRRA 5HG0A 3ZQJA 5I7SA 5LUBA 3OOJA 1PZGA 1PDWA 2FN3A 1WHTA 1U8IB 4DW8A 4OCMC 2HG5B 2AQ2A 2C4VA 2FPPA 4D0NA 1OWWA 3AS3A 3T09A 9LDTA 3MLAA 3JQ9A 3ZWVA 4K46A 3F00A 1N6UA 4GQBA 4HH3C 1I3CA 1OH6A 4PNHA 1GUFA 1VHWA 1ZHKA 2B59B 4MA4A 4CADB 3HB1A 4RCAA 1TM3E 5A1TA 4U1KA 2OOKA 2ORED 4QGTA 4JQVC 5BMOA 1GGBL 4UEJA 3WL4A 3U7YL 3TBWB 2R0KH 2GCOA 4E3ZA 2NSYA 1MJGA 3TIVA 5E7BA 4B83A 3LLSA 3NSJA 3FH0A 4K1LA 1NZFA 2WAOA 3FQRA 3SCMC 1RZGA 4A7SA 1F3LA 5IMMB 1V4NA 5FOQA 3OGCA 3H0EA 2DMHA 3WYRA 2O48X 5D3KA 3MJVA 4ND4A 1U94A 4R4FL 4OB7A 2MCG1 4WJG3 3VYVA 4TM7A 1NDMA 4BFFA 4MUBA 3WSWA 4O2BB 1J86A 2IWGA 2WBXA 4U0RC 2AZMA 1SHLA 3A6BH 2FPXA 1EO7A 2TECE 4LPKA 4MPTA 3G5VB 1X8KA 2JH3A 5CYGA 3GLGA 3E5NA 4XLZA 2VXQA 1KZ9A 1AE1A 3L1UA 4MJ7A 2X9NA 4NM4L 4Z7WB 1D5IL 3RBSA 2AMLA 2Y0BA 2EVGA 1WQ1R 4RABA 1V1MB 3PWNA 2ZI6A 2V7UA 1AJ7L 1J0DA 2VERA 121PA 4GKSB 1J9EA 1JTFA 3UUEA 4NCKA 1B26A 2C07A 4EZIA 3RTBA 2WZ6A 3Q9LA 1SDDA 5DJ0A 5HGXA 1E1QA 2FJSA 5ENWB 5CGZA 5J4VA 1HZJA 1N57A 5IB4B 5CA0B 5DJ2A 1HO3A 3I9GH 1EFDN 1BOYA 4KIWA 4Y5VB 5HDBF 3GNTA 4JG1H 3RNOA 2WSBA 4DOHB 1O6ZA 2OAQ1 3EXEA 3ZKMC 2QSZA 4YDIH 4UTXA 4L8BB 4H1LH 1GNSA 4ZFZB 5FEUA 2C4HA 3GX1A 2XOKD 4R68A 4MR9A 5ISZB 3PGCB 1UOQA 5A4JA 5B3JF 4TUJA 4G5XA 4IIQC 3CFJA 4FQXA 3GXMA 1CW2B 2QPTA 1S1CA 4PZYA 2ADIA 5B53A 4F7KA 3HNVL 4QTHB 5D5MF 1AGXA 1AO7A 1GGHA 3WV4A 5MERB 3FOCA 2VISA 1ZI6A 1JAIA 2Q9CA 4B8WA 5J23A 1WAMA 4ALIA 3QZBA 5AW1B 3WUWB 3C6LB 1JDVA 2HK9A 2JCGA 1QFWH 3GD7A 3V8MA 2VLJB 3FT1A 3GLEA 1NWHA 1MNUL 1C2YA 2JARA 1R15A 2A73A 5I1AB 3MLZL 4C0SA 4PG7A 4BVEA 2QGCA 1CICB 1L5OA 3FPCA 2ILTA 3PXJA 3WTWA 4BO4A 2IBMA 1XGPA 2QQ0A 1EZZA 2PGXA 3ASZA 3H9HA 4XMUA 2QZJA 1D2RA 2VK1A 4Q05A 1SHTX 4C83B 3IDSA 4UHDA 5SY4A 2R59A 3RRZA 1M3JA 4R4NC 5JLZB 4F58L 4JYZA 4C6TA 2BVPB 2VSOA 2PMEA 1CURA 4E3WA 3ACCA 3E5RA 4Z9XA 3HEBA 2AAAA 4ODUA 3FJOA 2UXVA 3TSYA 4QATA 1CY7A 4C56D 1SBZA 3U2SB 3RF7A 2UVDA 1YQTA 2YD7A 4UILL 1XDBA 2DL2A 3INNA 4X9FA 3FF1A 1ODJA 1LI4A 4E9YA 1IUPA 4YFLI 1OTUC 1PJCA 4OD3L 3Q72A 4R7XA 4LYFA 1C5KA 4TSRA 2FTKE 4AB1A 4Z7VA 5T5NG 1Y9ZA 3B2VH 1FFTB 1CZNA 1EWYA 3UL4A 1M54A 3QFTA 3HHRB 4B6ZA 1G64A 1MNNA 2IBGA 1E9RA 3WGVA 4R2IA 4BP3A 4OD1L 5F1IB 4BZYA 1XGYH 2MYTA 2TSBA 1HYQA 3DFZA 4BZXA 4K73A 3FAXA 3OHXA 5FOXA 1A4JA 2IANB 2A1UB 5T4BA 1G3MA 1WBJB 1YOBA 4WXMA 2YBRB 1JRHI 3D0LA 5JV5A 4D56A 1PKEA 4YJ3B 4DPBX 4LCIH 3AABA 2WU4A 2NP6A 4ZQBA 4LYDA 1NFIB 2M1XA 4X6BB 2H29A 3Q8AA 4C4KT 2DJUA 4L3ED 3RIYA 3QCVH 3C60B 3UFIA 2D7QA 3KVNA 1B0RA 3E2HC 1AQ6A 3UUWA 4QRPE 1CTOA 3DVAB 3DFMA 1BZ8A 1NQ5A 4ZZKA 1HY3A 3RRNA 3ZQXA 3HXTA 2XV2A 3ARFC 3M6LA 4I8IA 3KFVA 1U3WA 3UZVB 1JG1A 1M7BA 4PAWA 4QDKA 5GZOD 3BKJL 1UVQB 3IQDB 4RZ3A 1YCDA 4O0MA 4URZR 5FGSA 3GAAA 4ZI7B 4TTVA 4IY1A 3BMCA 1BDIA 3FTDA 4CHGA 2P35A 1SVWA 4XPFH 2FL5B 2B20A 1Y34E 5B2EA 3ESOA 1FORH 2BI4A 4N48A 2R9HC 1NVWQ 1YJQA 4WUUB 4F4FA 1MCZA 4J3OC 4YRZA 2VP5A 3SDCC 5DEGB 1B4JH 5K8CA 4EI5C 1IBZA 1UP6A 1CKEA 1T0PA 4X62B 2PO5A 3PJRA 3FO9B 3BL6A 3I85A 3L48A 3BE5A 3NBFA 3CX6A 5AK6A 3P9CA 4WTZG 5JLJA 2NXEA 3U9PL 3G79A 5J6HA 3ZKQD 2V1UA 3B3IB 1CUJA 3MJCA 1KYZA 3SEZA 5JFTA 2Z1DA 1QJCA 4BC1A 4O4IF 1V8PA 3TPUB 2RJ3A 2B8OT 5DTFA 4XNQA 1N2CB 4R2KA 2F7OA 1K5WA 2ZRQA 4E2OA 5JXIA 3DV6B 3TT3L 1SU6A 4KKCD 2CGRH 4J7CA 1DEOA 1CFMA 3KPPA 5BSFA 3QMPA 2OC4A 4GP7A 5MEOA 2OG2A 4GMGA 1H6BA 1CZOA 5FUBA 5DS8B 2LQRA 3IGAA 2WSSA 4IYKA 3V0HA 1YL5A 5EERA 1FFRA 5BQDA 4QNMA 2J1ZA 1IGIH 1OGTB 1VHPA 4M03A 1DUZA 4JUBA 3M6MD 5I1JL 2DM2A 3R8XA 4FNUA 1IZ0A 4RPCA 4DCNA 4MLCA 2JKLA 2AEOA 3VKWA 2EXYD 3U7QB 3GS0A 1U58B 4TL4A 1D07A 4FA6A 5K33A 4XQGA 4B97A 5AOVA 3NAZA 2AEQH 3QYJA 4IMLA 2F00A 1L1FA 5LBIA 3TQIA 1Q91A 2J30A 3GV0A 4X6DF 3B38A 4R69A 5CCBA 1JPJA 10MHA 4JZOB 4RHEA 2BXYA 4ZI3A 1A0QH 1D04A 5EU5A 4J27A 2H6OA 2QXUA 2BPBA 4ZRGA 4M21A 4YRLA 1L9MA 3NS7A 2EERA 2RFXB 1GTFA 2JCYA 2ICWI 3KT0A 1C7QA 4YRPA 4TVSa 1YR8A 3Q1KA 2EKSA 2IBBA 4ZHQA 5CVDA 3KPLB 1RC8A 4WENB 4YLBA 2J7PA 4QNRA 2C9XA 5LKAA 3CDFA 4D2IA 3BSFA 1DJYA 2EDRA 1SEVA 1GQSA 3BX1A 4S1VA 1U0BB 3QSGA 3ZX1A 2C2OA 1DJSA 4MICA 1XAHA 1K5GA 4J0JA 3UZUA 4A91A 2Y69B 1IY1A 1E7WA 4MCAA 4N5IX 3A6BL 3NZUA 1CXIA 5F12A 1QYGH 5J57B 5ENDA 4HVBA 5KJEA 3UICA 3QVXA 3H0TB 3L5WB 4L23A 1SQ5A 4B6PA 2A9PA 2DQCH 4OD2B 5FOWA 5DT2A 2PUAA 5IGXH 2BS9A 4GKKB 4RRPA 2TMYA 1XXLA 2BFGA 5FA8A 5DRZA 4AIIA 3VU9B 4F96A 4JMPA 1ZSDA 4F85A 4DV7B 3UPUA 4K0OA 3VM7A 5BN3A 5K9JL 2Y6UA 5F9MA 5HBRA 1H2FA 4NRZB 9GPBA 2F1AA 1V1RB 4MVCA 2FRDA 3U30C 3VNRA 4OYYA 1H8LA 3WY1A 4GW5A 1HLFA 2WTAA 3JV6B 3N40F 3Q6GH 4OYRA 3SLGA 1U92B 1BPLB 5IEJA 4JC5A 3A1NA 1KEPA 1MC1A 1R6BX 5LZ8A 4DIMA 3LI2A 8AT1A 4OFVA 1TKCA 3LQAL 4O25A 3ZR6A 5IDXA 1RUAL 1CGTA 3Q6GL 1ZM2A 2EARA 1FNNA 1SWWA 1ZRUA 1PSDA 4TZ6A 4YPJA 4JFEA 5B21A 1ZAKA 4R05A 4AKTA 3CG8A 3GK8L 1R3LB 3NAMA 32C2A 1LEHA 4M5SA 3B51X 2WJ4A 1JILA 1JSLA 3JWPA 3EH5B 3HKZA 1QGUA 3CO5A 3QNYA 5E1AA 4TLTA 5D6DC 2JKXA 5HEKA 5IHLB 5AOZA 3EDCA 3CFBB 4QY8A 4DEYA 2JB6B 2G30A 1TQTA 1PS0A 5F88A 4KVFA 2PP9A 1BKSB 3SQOL 4PPFA 5I7AA 4W9HC 3GLKA 5I24A 2PGJA 1KYIA 4QA9A 3IJHA 5D7HA 4Q66C 2WK2A 2QZ4A 3B2QA 1XGPB 2CSUA 3KPRD 3RHWF 3FUIA 4FZ8L 1T15A 5IEHB 2R1VA 5MF6A 1EBPA 1E2GA 5J2UA 3PC2A 5JH7B 3VR5H 2V6HA 1FMLA 2XQBL 4EVNA 2DWSA 5MFPA 1G18A 4PGCA 4QYAA 3OJDA 5DLYA 3HN8A 5I6NA 1PQ4A 3FKUS 1DQVA 2H7VA 4NZYA 2NU7A 3BGOS 3KYBA 3D0AA 1CMOA 3RX8A 3K1KC 2H4HA 4IWNA 2ZG2A 5TGTA 1GKUB 4E9SA 5E7QA 2FXVA 1QU2A 3B7RL 1D3AA 4GUPA 2CJFA 1ODUA 3TDMA 4Y2QA 5K2OA 3EGSA 1Y3CE 1JGDB 3UCEA 1YQVH 4RIFA 2DWDB 3RWDB 2XQKA 5T64A 1H0KA 3L40A 3AGVA 1OD6A 4QT4A 2VMCA 5FLVA 2PX2A 5KYKA 5IULC 5EE5B 2XTZA 4AITA 4DKDC 3NAAL 5HYEA 3K9LA 4WOKA 3W05A 1A4JB 4WJ5A 1OFIA 3GUYA 2O7RA 2YD9A 3NHUA 2H65A 4YHZL 2JGMA 4W70A 3P4OA 4RRPG 5JO0A 2VT7A 3P9ZA 2KMWA 1T8TA 1R4MA 3K94A 4MJ2A 4Q19A 4RPHA 2ECQA 3FTEA 2IUSA 1QV9A 4TVKA 2IGFL 5AICA 4KQ6A 5CJ8A 3ARYA 3BAJA 1MG3C 1QX3A 2ZETA 4HS6A 1O54A 3OZWA 2BFWA 2EH8L 4O4JB 2XB8A 3KUDA 4A7GA 3UTTA 1WCQA 4UHHA 1VP9A 5AW3B 3W5CA 2XN9B 4ONHA 1I3LA 4ZTUB 1FRFS 1Q2XA 1B6TA 3WNMA 4H1UA 1OP4A 4YRQA 5HYSA 3WDSA 3W2DL 4K8RC 4PG2A 4GY4A 1NFFA 5I30L 2OM2A 5G4LA 1QIGA 2EIEA 2E9SA 3ZZMA 2FG6C 3BXFA 1OOWA 1AN0A 1NURA 4Z95L 3ISVA 3V7NA 4NNOA 2QL7A 3K30A 1AAJA 5JW3L 4KHXH 3FQRB 2KYIA 1GG5A 4XMVA 1D9ZA 2ZT9C 5FHRA 2VZ3A 1FC1A 1MNUH 1AS7A 2CIIA 1MOQA 1NOJA 4HDIB 1TEHA 3A0UA 5AI9A 5C53B 1T3ZA 4PGBB 1IRIA 4GKNA 1BBJA 1H2RS 3H1PA 1UOOA 4X8GA 1KYXA 4ZAKB 4JS0A 4KI5F 1CFSA 3E6HB 2XWSA 2I4RA 4N0RA 1M5TA 5A62A 2OUIA 2YSTA 3MRFA 1YZYA 3PAZA 4GS7C 2C2WA 3ZLJA 1U9CA 5KYVA 2KLTA 1G1MA 2X4TB 3VW3L 1H2AS 3MV8D 5C0BB 1QFXA 2GR9A 5FOBB 3PI6A 1OL0A 1NAKL 2OYMA 2REBA 2HTKC 1ZL0A 2DWPA 2FPIA 5K20A 2ORVA 3MXOA 3HR5B 3IF1A 2AQ1A 1IEHA 1ZM7A 2ZSVB 2ZWMA 1JHAA 4HRAA 2FSVA 1OB0A 4NQED 4S1SL 1J39A 1V7CA 3THYA 2JZOA 2NW3A 3QPCA 4FOSA 1Q0RA 4GQ9L 4NOLA 1PX8A 5ADPL 4X5WA 4N0MA 2LCQA 2WY2D 3VO1A 1YUHA 3BGWA 5DYYA 2CSPA 5DC2A 4HUJA 4B81A 2YV2A 2Q0QA 3EEIA 4DA0A 3A1VA 3GZNA 1G43A 1JUDA 1N4DA 3IS0X 4J1QA 4YLEA 4W5OA 1U8YA 1PJ2A 2X89A 5E9DA 1CGWA 4GW4A 1C7JA 1UBRS 1WUYA 3CN4A 3CCCA 5D1ZI 3PDWA 2JHFA 3U16A 1WFUA 3FQXB 3ARFA 4ZAZA 3SO3B 3HACA 3EAKA 3DYBA 2CJUH 1YT5A 4GAJL 4QKQA 4MP3A 3F9RA 1IFXA 1UM6H 4IKKA 1EAOA 2DB8A 4KIGA 4EJ6A 1GGJA 2BIFA 4EUKA 2R2GA 2D1RA 2IDJA 4KHTL 1H6TA 1JYVA 3LUAA 3RVNA 1NNEA 4TQEH 3T7IA 2W07A 2ZEJA 5KDDA 4HEMA 2P80A 1SLUA 4RJTA 3U7HB 4X8XA 5I75B 1KI9A 4HS3B 1N36B 1JHTB 5I1KL 5IHPA 3WYEA 4YMTA 3F2VA 4CLOA 5BCAA 1DANT 4P5RA 3IAUA 3K5SA 1IM3D 5DEIA 4IRJB 2I91A 1HRKA 5GRUL 2A58A 5EE1A 2ZG3A 3E53A 5AI6A 2ZSEA 3VTMA 3NQKA 3JUYA 1JV2B 3UYRL 2R69A 2V17L 3GSVB 2IYPA 3KOZA 4FXKA 4RWZA 3ERCA 1NLFA 4B0MM 2WOOA 1XJWA 1KG0B 3H1TA 4ZALA 2QMJA 3G82C 1EQWA 1D1PA 5B3AA 2I27N 2QVTA 4GZMA 5HGAA 1SIWA 1USKA 3S2CA 3KSRA 2C9AA 2J67A 5IB1B 2Y2VA 1C8LA 4L4SA 4IGBA 1VFOA 1QH9A 4KZKA 2O1SA 3Q8FA 2P91A 3CGGA 1FDVA 4NQCE 2V7WA 2WDPA 3U6KA 4MWFB 1U33A 2OZ4H 5FYLH 3PEEA 3GUHA 4NT6B 1KQPA 3O8XC 5T5FL 1N3IA 1J1IA 5G0TA 4K9DA 2I7VA 1H94A 5L3ZA 1AIPA 2XT0A 4DV3B 2XZQH 1ESZA 3WDKA 1QOZA 4CIAA 5CFPA 1Y81A 3G6DH 1B0PA 2WXOA 3D39E 1JSRA 4FD2A 5K1JA 2B2CA 4GEIA 2ROXA 4G09A 2B8WA 2PUBA 1Q77A 2XT1B 4FQ5A 4L5JA 1FSZA 5L3SA 4X00A 2SECE 4PSRA 3ZGXA 3B43A 3Q2LA 1D6JA 1DC6A 4G4SO 4CQMD 1M7HA 3BP4B 4UINH 2Q6WA 4UOW0 3V5DB 2F74A 4FYKA 4DEPB 4CMEA 4HDIA 5IHXA 2OGUA 3I92A 2NY6D 3PHHA 2PUEA 1RE0A 3BL8A 5K5EA 4XVOA 4FQ2H 3HUJE 1JIQA 5GINE 3PF2A 1V7PC 3O3MB 3MVSA 2DKFA 5FV4A 2PWGA 1IEWA 3QIWB 1Q11A 2VTVA 1JZ5A 2X0FA 1SQSA 4JPWH 5KTNA 4G6FB 3T7RA 2EIXA 2VKTA 5G41A 1AQUA 3FB8A 2NY4D 1VHDA 1KJ8A 3QUMA 1QZUA 1N7HA 1YQXA 2BSED 3O2NA 1VZ3A 1OWNA 4Z7NE 5ALBL 5IK3A 4QREA 3H7BB 5KNBA 3SE3A 1V4BA 5BOPA 1UK7A 3N6XA 2APJA 2PZFA 4GZ3A 1LPPA 3BLBA 3MJGX 3V0EA 1AQDB 2WD7A 3EE6A 3FLBA 3U4DA 3B1KA 3VPCA 4I1OA 2OX5B 3I6GA 1WTCA 4HDNA 5TDPB 1SHKA 4UDNA 4D43A 1CVSC 1EK3A 4X0KA 4BXVA 1PR0A 4HDOB 1I1AC 1VCNA 2P9HA 5DHEA 3U1PA 1BCSB 1IBCA 4RD3A 1NIBA 3MA0A 1NAMB 1WD8A 2NY0D 5E9WA 4ADJA 5T3XL 2B0SH 4FUTA 2GSGB 3D6FA 3TUJC 1VYTA 3BAEL 2DWUA 5U1PA 1GZ3A 4PZUA 2E47A 5GJSL 4M0CA 3VFWA 1U3NA 4WWKA 4D2NA 5H82A 3UM9A 1C7SA 2GTPA 5KSYA 4IJ3C 1F14A 2BVQA 5ELLA 3MRDA 5IVDA 5BMVB 5EKDA 2JFFA 2Z2YA 3WLSA 3TI7A 4EB8A 3MRHA 1QLFB 3BUIA 3V2IA 1PT8A 1RRPA 3TIGA 2JB9A 1NHWA 4CL2A 3VPGA 3LFTA 1GL7A 4Q4CA 1NJ9A 1HI6B 3MCLH 5DHXB 4BV1A 3F49S 3T5CA 2MNWA 1ABBA 5A9TA 2OV1A 4PTLA 4W9NA 2XAUA 1RQPA 3FFTA 2WU1A 1NBZA 4G6ML 1R0LA 3QA9A 1EHCA 3CXDL 5LNGA 4ZUSB 2ZJ0A 4Y4HA 3GEBA 1CF8L 4WW2F 2QG9A 3DOSA 4PN3A 1DTSA 3LV8A 3HBLA 1DFGA 1YEDB 1CJYA 3TJRA 3DEIA 4J3JA 4U4IA 4JZJC 5I47A 3FN9A 2GVNA 4KNQA 3VA6A 3FPYA 1NDUA 4ARZB 4YLYA 5HHVH 1NBHA 1TR7A 3MQIA 2FCRA 5BN4B 3CRRA 4BX0A 2EJUA 1LDYA 3KQSA 2BCJQ 4N68A 3W9SA 1YOVA 4IGBC 4QOHA 1KPIA 3BAZA 3BRQA 4N1HB 1H3FA 4F7TB 2MSNA 4U1JA 2PWFA 1OR8A 3ZEIA 1BJMA 3VMMA 3C3AA 4RNDB 3OJDB 1D5WA 2ISSD 5A3RA 4KQMA 5H4ZA 1DBPA 1GGTA 4PXAA 2HUNA 4L0DA 2QPEB 2AZUA 4NO2A 3R7LA 1R6XA 3RTLA 1HINH 3VKGA 4ZAKC 3V80A 2QKYA 2Z43A 1P3JA 5E1IA 1LE9B 4I36A 3MW8A 4N41A 3UEZA 1NPJA 1KK3A 4B27A 3V5HB 4YDJB 1DAFA 1GZ6A 5I9QB 4CCSA 3TWCH 4BZ2L 4PHZA 3VVMA 1HXMB 2QF7A 5D7EA 4PAOA 1VPOL 2OCJA 3BAFA 3FUUA 1QGZA 2BNUB 2ALAA 2XQYA 3TJEH 4IGIA 5CB0A 4HLNA 4Z0BL 2Q2OA 2HX1A 4DVJA 1GKEA 2AVGA 3C09C 4HN4B 1KI7A 3N2YA 4LKXB 3HS0C 1K6EA 3N44B 4PJ8B 1X1CA 3GCXA 2FZGA 1QNZL 1YZFA 1ZSDB 4Q4IA 3THOA 3UMGA 3N04A 2GH1A 4O4LF 3HCRA 1VCAA 3ORHA 1UMBA 5K8LA 1XXDC 2Y71A 2WJVA 3QJOA 3OKLB 3Q44A 3TE6A 4J3NA 3LL7A 2G08A 3JV6A 3TW4A 1INDH 3FQTA 1T5HX 4NQVA 2NAPA 4H5SB 1RMFH 1QH0A 1UDWA 2RAPA 2O2JA 1WW8A 3RWCA 2BXZA 3S2FA 5M2QA 2WTRA 3RWGB 4GWKA 3GRZA 4AKQA 4ONHB 2FN8A 4BMVA 2JAWA 1HEYA 1KRHA 2VRKA 2XMDA 1Z12A 4DDWA 2C5HA 5B1CA 3WGZA 1XVVA 1Y6GA 4JEGB 1KTDB 2OCXA 5LR6A 1EANA 4X4XB 4PGDA 5L53A 1B0ZA 1NHGA 4R5MA 3QUKA 1A5FH 4Z0XA 3FHLA 4MNGB 1BVKA 2GKOA 3O6VA 5GY7A 1RU3A 4X6XA 4ZJYA 2H16A 2YQGA 3SKVA 1ZA3B 3DV0B 4FEAA 5DJZB 1KEWA 4IIZA 1USUA 4DL9A 1CTMA 3CU7A 4PBDA 2FJHB 3LEXA 1KO4A 5IKEA 4BNXA 1TTPB 4HKJA 4RA9A 4CMAA 3G6AA 1J9RA 4PZ9A 1GAXA 2K6WA 4WZBB 1BBJB 2QN2A 5D1XC 4R8VA 3DEKA 3SJAA 1QFOA 4CT0A 1T2FA 5I7UA 4JUDX 1Q3TA 1IFRA 3MNVA 1QGED 1X7HA 4JP2A 5I9IA 3G0CA 4N2OA 2QNIA 2V4ZA 3M1LA 3VH4A 3TLGB 5A2BA 1EEZA 2QD3A 4REOA 1KN2H 1QH1A 2PFKA 2ZPKH 1I2BA 2CJWA 1YB7A 1KDRA 3FBTA 1ZTXE 2V17H 2FPOA 4HUTA 3ARWA 3OG9A 1HEJC 4JEMA 4OXIA 1UEMA 1HHGB 5F9JA 2HF9A 2C3PA 3QXGA 1CLZH 3HR5A 3IF1B 1KPHA 3DXXA 2QLMA 1NU6A 2QN7A 3QG1A 2V6IA 3A04A 1UXMA 3PLYA 4ZG1A 2P5WE 3IBSA 1PZBA 4PRIA 3CISA 5AW1A 4ZOBA 4HOMA 5AUNB 1S2EA 4JFYB 3V32A 3UP1A 1KAMA 1R0BA 1VQ1A 1VERA 2MFNA 5CN2A 2GSMB 2FLMA 1IJEA 2X0DA 3DLBA 5T1KD 4DQVA 1WXXA 4IGFA 5FKAA 3UJHA 5BZXA 1YMMB 2ZUYA 2PZAA 3NTVA 2WWMD 4HF7A 2VLKA 2WZQA 1QRSA 4FEMA 4NZRL 1ADQA 3T15A 2VQSA 2YUTA 3WJJA 1IT9L 1QBLH 3L6RA 3DTVB 2W00A 4ODHH 1YZKA 4HZLB 2DTEA 1SFHA 3OC6A 2JDID 3BFWA 3LHPH 4HISA 4MD4B 1HQYE 2DIJA 5DK0A 2WHPA 1VIDA 3GNLA 1E7UA 3RG2A 4JHXA 1T2EA 1WBXB 2IDFA 2J7LA 2X1PA 1JI1A 4N1CA 3L8FA 3JD2A 2P47B 3LZFH 4EQ2A 3NBZC 2ZTUA 2CUHA 1FP7A 2QS9A 3QX8A 5DMIH 4NS1A 1F3RB 2V2XB 4JDUA 5EWIH 4HS6B 4O4JA 3S4SB 1EEHA 2ESVA 1WA2X 1T1ZA 2G2RA 2WQWA 2MOVA 3LY9A 1CDBA 2ZPTX 3IDUA 1FVOA 4XWWA 4K9EH 3V4PL 4D8PB 4OGAC 2CA4A 1WLSA 1JZ3A 1X5FA 4U7HA 2WJ6A 2XOTA 4H6VA 3W2HA 1Q1AA 2BZSA 4YXWA 1PL7A 4ETQA 4LKRA 1L4LA 1FVXA 1OKKA 3DEFA 1G84A 4EUPH 4DJ5X 1LLQA 5GGVL 2PLRA 1KJVB 1X9RA 1K6JA 1DLHB 1JCVA 4O2BF 1P1BA 3H3KA 4UM9D 3VXRE 3MV9B 1HEUA 4LTNA 1BVHA 1NRIA 1QIMA 1D5XB 2WPGA 3PICA 4OUOA 4KY1L 4IOSD 1SEQL 1UKQA 4IBQA 4P4SA 3PRKE 4FTDA 1DEDA 4TYNA 1Z2DA 3ZGLA 4EO7A 4Y0NA 2WVJA 3ZKWA 4NT6A 5ICZA 4J3XA 5FR1A 4JFFB 3O6FA 5DA0B 3B2MA 4MW4A 1A8IA 2B59A 3E5HA 3ANMA 3D0KA 5B7EA 1P9OA 4N90D 4ITVA 3RU8H 4KO9A 4PZCA 1I0ZA 1PKOA 2XICA 3DMGA 2HKFL 1JP5A 3LQMA 4GL4A 3WE6B 1PZEA 2A33A 1KY4A 3PPIA 3WOHA 4D4JA 1V8DA 3FRHA 2PXYC 3ISTA 3SS8A 1FP1D 4YBQC 3O03A 2R83A 4DQOL 4TQGA 1ZD3A 5DIZA 3TCTA 3K6DA 4G0UA 5IVHA 5ICCA 2H2SC 2RK3A 1ZT4A 3MA7A 3UTTD 2HF8A 2AC0A 2XKKA 5GADl 5CUQA 5D7LB 2JKWA 1RIHL 4EMBA 3CJJA 5BORA 3P77A 3MCZA 4N6RB 2ZCHH 1EDHA 1H9VA 2Z5GA 2DM6A 5FYLE 4NFLA 5C37A 4HCIA 4OF6A 3FPBA 3GBNL 2YFYA 4BO0A 1CJTC 3VYTB 3GUZA 4OIIH 4CODB 1K68A 1EVTC 3L4ZA 2JGLA 2I3DA 2HV8A 3PWNB 5FF6B 5H68A 2VLLB 3WQBA 1BMGA 2HA0A 1QX1A 5KAQG 5T1KA 2GEFA 5H4GA 5K0LA 3MHTA 5E4JA 3ZV7A 1QPKA 4IZIA 2PX5A 2Q1TA 1RU9H 3KHOA 4M7PA 3SDDA 1OGTA 4LSDA 5GSVA 1TMCB 3GFOA 1T6VN 2H0AA 1JRLA 3NI2A 4G5FA 4JANB 5IOPB 1LO2L 1P5UB 3TM6A 2AS5M 1SXCA 1L5HB 3MRCA 4LIQE 1OQOA 4LDZA 3DMMD 3EHBB 1J8MF 3RWHB 1S9KC 2PRKA 2JZCA 3X3GL 4LC1A 4XZUA 3QI9A 2QUBA 4P4KB 3D2TA 3R6WA 1U4EA 1TJPB 3K46A 2MKLC 1ZK1A 1NMAL 2PRZA 3CZ5A 3HYCA 3G13A 3A70A 2X0WA 5CX1A 4XP4L 5T5FA 2R2AA 4RSVA 4QTHA 2HJWA 4LCUA 4PWGA 3RBXA 1B42A 3M6WA 2VH5R 1P80A 2KQUA 3CG0A 3T0BA 3TL6A 3NR2A 1G1YA 4X42A 1P6XA 3AY4A 1JA9A 2ZJSH 3C6LA 3OZRA 1ZMOA 3ZJ5A 5JS8A 1EWHA 5L6YH 3T0AA 1XRRA 1QFYA 2YXNA 1YR3A 1LJMA 4A2PA 3DKKA 3N0PB 1W47A 3OT4A 3R7SA 3K0FA 4GT7A 2DLDA 4JXZA 3MV7B 1WAAF 4W6WB 3ZZQA 5L6YL 3BUQA 1RR6A 5CXXA 1Z0AA 1G0XA 2OM6A 4A8JC 1Z5LB 4M7LT 3UBXG 4JV5B 4FNPA 2P8LB 4DP1X 5TK4A 4M0KA 4YPFA 1YYLH 4Z7JA 2F58H 3AERA 1TEGA 1JDUA 4L75A 1G19A 4OLYH 3MNWA 4DF3A 2ZKLA 3GWJA 1U0JA 4DTCA 4Q3LA 1RWPA 3DA8A 4ZK8A 2IH4A 1ZA1A 5FORA 3ZBTA 4F9FA 1YEHL 1ZMXA 2W0KA 5DM2A 2WGXA 4QHUB 4KQ3H 4Z5RA 4TLLB 5AQ0A 1D7BA 4US2R 2VATA 5D93B 5C8ZA 2EE0A 3EFDH 2HWZL 3DE3X 3WMWA 2AJXL 4RMRA 1HRDA 1T6WA 1OH8A 4ODXA 3WMSA 1UC9A 1HIML 3PQYA 1TUBB 2NX5D 3ZXAC 5IZ4A 4MRRA 4BFNA 2Y72A 4EAAA 4RETA 4TN5A 1P84K 2XYRA 3BTUA 5B2ZA 3E7WA 4J7XA 1SAYA 1SK9A 4JR0A 5KVQA 3RIXA 4ZAXA 2WOBA 3DBVO 3DW3X 4WFED 3JQ7B 1IEBA 3SKJH 4L1SA 1C9YA 2X9QA 1WZIA 3VSDA 3IU3B 5F88B 1EA7A 3KPJA 1VRWA 4E5YA 3WL8A 3L8DA 3ICVA 2FNBA 4L6IA 2YRWA 2X0RA 4QFMA 2KDGA 3R3JA 1EHKB 2QRGA 5FWXA 3DULA 1VBMA 1YQUA 2WSMA 3ZY3A 3ZKND 4YA6A 5ALXA 1NANH 3KXFB 4QSMA 4UEKA 4RGOH 3KYNB 2DT5A 3PV0A 4BA8A 3DKVA 2VSYA 2BMVA 3DTVA 2PBRA 1KDIA 1XQWA 3N2KB 4Q1EA 2P4AB 3PQFA 1JTPA 3ME5A 3GDBA 2GWRA 1JHMA 2ZJ7A 3QO1A 3EY4A 2VDNB 1Z37A 4OFBA 2AS0A 3CHQA 1IG3A 1YMHA 1JJVA 3FBWA 2DH6A 5KSBE 3QP9A 4PFQA 2UZYA 5EHXA 4ZEVA 3FYEB 4DNQA 3NYQA 4XPBL 3VR4H 4AM0A 4URVR 4PJ7E 4H7VA 5D1QD 1M1SA 2LE9A 4PVNA 4RZ2A 1P4LA 1IN1A 3O45A 5TK2A 1EUDB 5JPMA 1HOCB 4I3SL 4HWZB 1YDMA 2R2BA 1NJ5A 4W9DC 4BEBA 1JE0A 3LBYA 3JPWA 1JP7A 3E9CA 1QHNA 4K28A 5KQGA 1ZHOA 3KSUA 2ZI4A 1NPUA 1HF3A 3QXUA 5D7KD 5CXPA 3OA2A 1M34A 4V1DB 2PQ2A 4B82A 3TONA 1Y8CA 1UOEA 1C4XA 3TLYA 5JLAA 4PRPE 1EJOH 4Z2AA 3POCA 1XTIA 3DTVD 3LVQE 1NVXQ 3DXZA 3FROA 3BHNA 4UFPA 3WGLA 2UZ1A 3W06A 3MRBA 4JLKA 3U09A 4K3HA 2C5FA 2GY5A 4G1MA 3NGBC 2W91A 1PLKA 4AS1A 1T04B 1NFRA 4XNYL 3WY4A 3S2UA 4DSTA 5E9DD 5CLTA 3QBTB 1MC4A 1E1RA 2PTHA 5EKXA 3MAGA 3AU8A 1YQEA 3UK6A 3TXAA 5GSRA 1Z5LA 1ZPDA 4H3KB 2ASVA 4YJGB 3WXWL 3KL4A 1KY3A 1XDDA 2WLIB 1ITBB 3HE6B 1W72L 4JB9H 2GO7A 3WL9B 4ORZC 1CGSH 5LDUA 4UE3S 1N0IA 4ILKA 1B2WL 3K9GA 1GPH1 1QUPA 5FECB 1YSCA 2Y7NA 2WWTA 1PV4A 3L7JA 4XP1L 3PJDA 1L9RA 3HMWL 4N0UE 2B99A 4FOTA 2Z9DA 4YASA 4HB0A 2NX5A 1DN0B 3A4FA 3N9IA 3OX8B 5GV8A 2R2CA 2BSSA 1UM8A 3FQTB 1CFSB 1U7WA 4UHJA 4GXUN 1XHLA 1RJLA 2CPCA 5FJIA 5JHMA 1G5HA 1U3JA 3U7WH 43C9A 2A7QA 2VEOA 2P43B 3K71A 3HG7A 2RHJA 3QW4B 2P9EA 3QIVA 3UTCA 4HH9A 1N75A 5A16B 4XXWA 3FZGA 3APFA 3VWKC 2H26A 4LJAA 1TEZA 4MJ6A 3A8TA 2EICA 3D25A 1B1AA 3EO9H 3ZDZF 2ZF8A 3RY5A 1UBGA 1VMDA 3V33A 2RC5A 3EYOA 1LK2B 1FEZA 3U6RB 3FI9A 1XMOB 2O1XA 5KTKA 3KQMA 4WI8A 3N6VA 2L42A 5IIEB 1QFZA 4EENA 4UBOA 3V8PA 3FH8A 1Q72L 4L4RA 4TVPH 1AQNA 4OI2A 3KDPB 1PWHA 2UUDH 3R5SA 3I84A 1D0IA 2XZTA 2PXYD 1UFUA 1QIJA 4H4DA 4PX2A 4FD0A 5AVXA 3QJQB 3TIXB 5K3FB 4BKQA 1QDEA 3LIZA 2D8KA 4KKVA 4MDHA 3W6NA 2ZKWA 1I51A 1XV5A 2OT3B 1F6DA 1VPWA 3DE7X 4AY2A 3AKEA 5L6MB 2I3BA 2OCAA 1RZRD 4OJKA 2F90A 2AJDA 3OLWA 5FGRA 4M9SA 3N0WA 5DULA 1YDPB 1QHGA 6PFKA 1E27A 1QACA 1RD4A 3GRWL 5C08B 5AXBA 3CZLA 1REQA 3BLKA 2ZWAA 2AK1L 4DCPA 3L7EB 4F8NA 2B4QA 3AFHA 3B2EA 3ZDCA 1T0JB 1O6TA 3TEYA 3DMTA 5HI3D 1NDGA 4HWOA 1UWXK 3EDMA 1YBFA 3P3SA 3QG7L 1KI4A 2PPCA 4MK4A 5JNYA 1QZTA 2Z2JA 1LXCA 3K0FB 3OKAA 3V0GA 4RK0A 4RY8A 3VJRA 1J9CT 2AN1A 2YRLA 1Q1NA 3MOQA 2FZCA 1A27A 2ATXA 4QAMB 2DWOA 5G1OA 3GLZA 4TOYH 2CF5A 1TZHB 5EBMA 3KX2A 1CUAA 4MLDA 3V6FB 3BF8A 3NZ8B 3LOUA 1EXNA 3MRLB 3V8NA 2YGPA 4PY7A 1WOMA 5E9DE 1FNCA 4GI3A 9ATCA 3NIGF 1B16A 1QHIA 1GAEO 4QXAA 3X12B 5FHAH 4CVWA 3DUFA 4C06A 1PUIA 4N0CD 4OZIE 3V7MA 1C16A 3OM3B 4QXMA 2DYKA 1YY9C 1FRZA 1G7JB 1RPTA 4LZAA 4NCJA 2DTSA 3BO8A 4MS3A 3SC6A 4FHDA 4XAWL 5MEQA 3PD0A 2PCJA 3RVPA 1M1YB 5TQ0L 1FCJA 1EO8H 3FQYA 3WD5L 2Q3LA 5HDQA 2AHIA 2B8JA 3GBNH 1QWOA 5FD8A 2C8JA 4EPTA 1DFHA 1NMZA 4F8EA 3TBVB 3GZ4A 5ELMA 3JZIA 3QEUA 4G6KH 4A5SA 4FAAB 3FPFA 4AZWA 4JXJA 2PYFB 5ILTH 1IC7H 3K6RA 5CEXA 3SM9A 1HN1A 1A64A 4YJHB 1WUNT 1TZ8A 8ADHA 4FFWC 2KWIA 3UJIH 1BLIA 2X7XA 2JIMA 4GMSL 4KRPD 1I82A 5F6IC 4Z99A 4U4AA 1M7DB 1NDQA 3HYSA 3BXGA 2QFPA 2P6OA 4F71A 5G5DA 2ZWYA 5LIPA 1RWBA 4CQMA 3LUBA 5CYPA 1S7XB 2X2UA 4RMJA 4ZVLA 3WGUA 2YC1A 2YWHA 4CU2A 3GI9L 4PTUB 1WW2A 2ZPKL 1FA4A 1NSYA 2AL7A 2GVDC 5F1KC 1N6NA 2YRZA 4QOEA 2H26B 4BH8B 3CN2A 3CLWA 3M5CA 4X6EB 2P8JA 4CU6A 2HLHA 2GAIA 4GX5A 3A6EA 4QJBA 5EWMA 1URZA 3OF3A 1VDGA 3M45A 3W7AA 1K75A 1YA4A 4EARA 4PZAA 4MDRA 4ETNA 2EABA 1V27A 5HJGA 4XYMA 4PV7A 5AKTA 2B5WA 2NU6A 3PIDA 4YFVA 4FP8L 4YP9A 4LG1A 1V37A 4M5ZL 3ZPXA 3V0WL 5A02A 3QSKB 1LGVA 5FBWB 2ODBA 2C9CA 3PL5A 3E7FA 3PUKA 2JFOA 2R6HA 1IRXA 1Z5NA 3BD8A 1J0KA 2LV8A 1I4TD 1MIHA 3AKDA 3LOPA 4QFBA 4JHBA 3LXMA 3Q85A 1G4AE 1NCAH 3U4QA 3M46A 3BW9B 4TNEA 5B4UA 3BGDA 3HCWA 2X13A 3OM9A 2Q5EA 5LQAA 4XZ4A 3H42B 5KJ1A 4OP3A 3LGXA 3M1IA 4WL0A 2OMZA 3KQQA 5KVAA 3ZL1A 4M8UA 2AOWA 2MCPL 1NGQH 2VH1A 4NU6A 2PBFA 3RUCA 3UG4A 4J8RA 2NIPA 4C22A 1VJRA 1E63A 1X39A 1Y3FE 3PPXA 3NBNA 1E99A 3GMOB 1M2WA 4N8VA 2D3NA 3AIOA 2CVFA 3WYCA 5A4KA 3UIYA 5AOBA 2AP2A 4MQMA 5TSDA 2FOXA 3VXSA 3TZVD 3G08A 3IU3A 2PRSA 1L7EA 4U6YB 5JALA 4UNQA 3FF7A 4RF5A 2AI1A 5AI8A 4PAZA 2VYVA 3LW7A 3EQ2A 3H4VA 1N77A 3VG9B 2B0JA 2GK0A 1N12A 1C5BH 1JJIA 3BPNB 2WKSA 1V55B 1ZQ9A 4TV9A 1VBNA 2IHBA 4I4TF 4JQIL 4DVGA 4DA7A 4ZPTB 4W7SA 4RLSA 3CSTA 3P30H 4LVOB 3KJXA 5IMSA 2Z0MA 5JWRA 3OZBA 4XXDB 2E7LA 2VNKA 3MVEA 1MRZA 1YQ2A 1Q7TA 1R3KB 1T20B 1N2EA 3FB5B 2OWDA 2ZITA 3U0PA 3ZNNA 4HC1H 2XUHA 2B5OA 2FSHA 3ZNOA 1E2DA 2Y05A 5EH1A 5JC1A 2JAOA 4LSQL 1UKAA 5JW6A 3H5IA 1ZWIA 1FL3A 3G3LA 2X88A 4JB9L 1RLOA 4X8LA 4YMGA 3VXMD 1VA9A 1AOHA 5ERWA 2JTDA 1V8HA 1QKIA 5FPYA 5EHFA 1U2TA 4JPVH 1E9OA 4AG3A 3WGGA 3UH0A 5J4MA 2VRWA 4EYOA 5KSBA 5F1YA 2R1TA 4UZFA 1FX0A 1PR2A 4MA8L 4GYJA 3WBFA 1VPEA 4RH1A 3HEMA 5HHMD 3MLVL 3A4DA 1JZ2A 1H93A 4UMFA 5C52B 3CB2A 1UB5A 4R3UC 1U7HA 4M8NE 2D2XA 4P23B 3L2NA 2PLNA 4ZAKD 4PV9B 3MUJA 4QMEA 4GP5B 3WRYC 1DQDH 1G9NC 3UMCA 1KOLA 4DV0B 3U9PH 1VFAB 5JIMA 1E3JA 5BT8A 4G1EB 4CFZA 1UD8A 1KJIA 3LECA 2FJGA 2CGZA 4TKWA 1BJRE 4HSGA 4F06A 1G0NA 3INUH 2VXSL 3AUKA 3QDGD 1HKUA 3QX9A 3ZJVA 1R12A 5EKTA 2O2GA 4GW1A 4N4AA 1P2GA 4NZOA 1TRKA 1I4FA 5TE6L 4Y8AA 3JV0A 2Q4TA 1F5WA 4UT7L 3Q7PA 1FTQA 2OXEA 3H4MA 1U3ZA 2JRCA 4KPEC 2ROYA 5FWYA 1DS6A 4PJAF 4TYMA 2UXTA 3WMGA 1HSBB 4EF3A 4BIMA 3P4MB 4H1LG 5I8ZA 3R7RA 3BOVA 3BGFB 4MXQD 4M1WA 2BM8A 2ZR9A 4FTWA 3FC8A 1D0SA 4DG5A 3R8QA 5BV1A 2C57A 3H2HA 1KORA 4KZDL 1IE3A 2H51A 2B2XL 1XOIA 3DWFA 5AP9A 3BL5A 5JATA 3PL6D 3E81A 3RIEA 3ONWA 4QU5A 4JLAA 4NN6C 2P5WD 3JT2A 1SH7A 1ACLA 3VR5A 5KAMA 1KEEA 1AKJB 4OLJA 1OSNA 4Z8XA 4Q9RL 1XSOA 3O2WL 1TQ2A 4LFAB 3DHVA 4LE8A 2YWZA 4WECA 4D44A 1NY5A 1DVFB 2K3HA 2UXBB 4FGLA 3O4IA 3QJSB 4FXLA 4X84A 4N0UA 1TCUA 1PR4A 3TBHA 2C9SA 1FZKB 5DFVD 4G9DB 3OR7A 2FX9L 2DBJA 2IPAB 3B1TA 4BKRA 2OXGB 2FW9A 1T3FB 2NW2B 5TDNB 1X5MA 4RNRB 3OX2A 3SGDH 1FNLA 1BZ9A 1O97C 4XTRD 5BWMA 1AG0A 1CNMA 4N5EC 1N0UA 2H1LM 2DWEB 4KXUA 2HYDA 3CNKA 3GLUA 5E8RA 2A4CA 5FGCE 3UYPB 2KH2B 1P1RA 1Z5VA 1NTDA 2DYSB 1NVEA 3U7RA 4K3EH 2J5LC 5G1PA 4IQ4A 4PGFA 4F5DA 4HUXA 1EFKA 4NBRA 1ICTA 1YMMA 4ZKDA 1H1LA 2P26A 5FIUA 4QEGA 3MRNB 1YJ5A 4KRGA 3M4ZA 3Q3IA 3WIIL 1K4KA 2VDOL 3VGAB 5KU1A 4Y6LA 2PVSA 2BBSA 4X45A 3WV0A 1W0WA 1QLFA 3FTCA 3L46A 3USES 1BQHA 3H83A 1MN4A 3SYMA 4CUKA 3F58L 5CJXA 5FOJA 1H9BA 5HILA 1J5XA 2YW2A 1WA0X 3OKOB 1KIRA 2PTVA 3JYHA 4PRHD 1AUQA 2R8BA 4CMIB 5CFQA 3CPLA 3DB2A 2CNOA 4HDKA 3A67L 4H88L 1XJQA 2GZMA 5LQMA 4EJFA 2A30A 3ZU3A 1N0LA 5HIIA 3EVTA 4OZFG 3BIFA 4NICA 3AWIA 1WV0A 2MRYA 5KQMA 5IMOB 5CAEB 4LSTL 1M6OA 4YC2C 2DYRB 5DNUA 1UZMA 3OHPA 5EOTB 2HLFD 3C7DB 4YDHB 3WGJA 2X05A 4PS3A 3UCQA 3T7JA 3DGFC 5M7EA 1ZUNB 3ODPA 5EZPA 5FA4A 2G2NA 3R06B 2BDUA 3S2AA 3K1YA 3GBSA 5B3NA 3HKCA 1WSWA 5KOJB 5DJXA 2FCAA 4R26L 4IXDA 4OTXH 4HGWA 1BEXA 5H8WA 3VYSB 1OLSB 1EXUB 4EUPG 3QENA 1DBKH 3S0JA 3RG1C 3VZQA 2IFFL 5DXWA 5DUBB 4GLLA 4ESHA 1Z22A 2FDXA 4D0CB 1EGJA 5CT6A 4YP1A 1VCHA 2HFEB 4PP1D 2B9AA 4AJNA 4CBZA 1ORQA 5DD0L 3HPRA 3NJFA 2KL6A 2EYTA 1P2FA 1W0YT 2JHPA 1DUIA 2RE8A 1F42A 1HKHA 2ZYWX 1U3VA 5GZ1A 3A6OA 5EEZA 1CG9B 1NJ1A 1BBDH 1R5NA 5FUOH 4QGBA 1ZAGA 1KEMH 2FG7C 1PY0A 3A4LA 3EOAI 2XTJC 4O58L 5BO5A 1OB5A 4XX0B 3GJRA 4TSAL 5F7BA 4BAZA 4BGUA 2G2PA 1P4UA 3Q06A 3DX7B 4C05A 2JLYA 2BP8A 5GIOE 5KKCA 5HHOB 3GUFA 5D1ZA 1YS1X 5BV2P 2TYSB 1P3Y1 1UMBB 4MR7A 5DSTA 1IEAB 3B20A 1FC2D 1PLAA 4O58H 5ARDA 1UKBA 2VQUA 3APDA 5C70A 1CBJA 4PO1A 3IDNB 4K94C 3QVGB 3EEQA 3KYDB 3KKQA 2DUNA 3S1LA 3X1NA 2X2JA 4A0SA 2HMID 1XLWA 2QTZA 4PTUA 4PLKD 1V11A 4GXFA 1M6VB 1EK5A 3QKRB 2M83A 3R3ZA 1U2QA 4LEXL 2YOFA 3RIMA 3OHMA 5CP3A 2WMNB 1SUPA 3RQSA 1F13A 2E9WA 4KX9A 2O4UX 4XRCA 1XTZA 3HMKA 2PWAA 3AY3A 5DGCA 4WKXA 4RMUA 2G71A 2ODPA 2HHLA 3L0SA 3A25A 3GNML 1MCWW 5CEZL 2NLJB 4TLUA 4EM6A 5GSVB 3L0DA 4MEBA 4L4JA 3KHTA 1ZGLA 3NNSA 3NIDB 1FL3B 2GD0A 2FFRA 2IUUA 3W8RA 4W4OA 3MSPA 3KLLA 4GKLA 3JTEA 4FYTA 1M76A 1MH5A 1V3VA 3KPVA 5ENZA 4NABA 3OKMB 1NUDA 1KVTA 4NB7A 2PX0A 1XCTA 5L2KB 4JY7A 4E9VA 3W11C 3WTCA 1RKBA 3OLEA 2Z95A 4Z3EA 1GEEA 3VISA 3PJSB 3PFCA 3NGLA 2P9JA 1TCCA 3NXSA 1I3GL 1Z82A 4YHKH 4AQEB 3V6BR 4UTBA 5JPNB 2WZPD 1FZTA 4LDNA 4RHTA 5MENB 4F8LA 1BW9B 2YTZA 4K8RB 1AI1H 4X4MA 1NJSA 2ZJYA 2PMBA 3M88A 1GO2A 4PGJA 3HZOA 3UYKA 4DIFA 1P0QA 4NO5A 4YB8A 4PREA 4YZWA 4AUMA 3I23A 4CJ0A 3VTAA 1IY2A 2C0PA 4GG6F 4A8PA 5C08D 5AOKA 3ZKSD 2I6GA 3P3YA 2DLEA 1E58A 3P9LB