4I1PA

Human malt1 (caspase-ig3) in complex with activity based-probe
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
379
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activity-Based Probes for Detection of Active MALT1 Paracaspase in Immune Cells and Lymphomas.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 110
structure length 379
sequence length 379
chains with identical sequence C
ec nomenclature ec 3.4.22.-:
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4i1pA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i1pA01
2FUNB 4DCJA 3R6GA 5JFTA 2CNLA 2QLFA 4AW9A 3UOAB 3BIJA 1RWOA 2HBYA 4QUEA 1CVRA 4N6NA 1I4EB 3QNWA 4JR1A 4JJEA 4IYRA 3R6LA 3SIPA 2J32A 3PD1A 5IAGA 3R5KA 5IANA 3GJSA 1NMQA 3EDRA 4JB8A 4JJ8A 2NN3C 1BMQA 1I51A 3R7BA 2QL7A 4PS1A 1RHQA 1NMSA 2CJXA 5IABA 1RWXA 5K20A 4EHHA 1JXQA 2J30A 4QU5A 1QDUA 3PD0A 4QTXA 4ZVRA 4QTYA 2CJYA 5I9BA 1K86A 2XYPA 4NOKA 5IARA 2XZDA 5IBPA 1NMEA 1PAUA 3D6FA 4AWAA 3H11B 2HBZA 1ICEA 4EJFA 2XYHA 3GJTA 5IBCA 3KJQA 1RWVA 4NBKA 4DCPA 2C2MA 2FQQA 4EHAA 2H48A 4QU8A 2HBQA 2H4YA 2K7ZA 1I4OA 1RWWA 4FGUA 4EHNA 3NR2A 4QUDA 3KJNA 4IEFB 1KMCA 5LUAA 3PCXA 4QUJA 2H5IA 1F1JA 4N5DA 4ZVSA 3H0EA 3S70A 4NBNA 4PS0A 1RHMA 4ZVTA 2DKOA 4NOMA 3H13A 1I3OA 2XZTA 3GJRA 1SC1A 3EDQA 1RHKA 4EHLA 2C1EA 2QL5A 2Y0BA 1F9EA 3RJMA 4QUIA 5IC4A 3V3KA 4NOLA 3H1PA 4JQZA 3UO8B 2CDRA 1RWMA 3P4UA 4QUAA 3R7SA 4EHDA 1QX3A 3NS7A 1NW9B 1K88A 2H65A 3IBCA 4HVAA 5H0IA 3H11A 3KJFA 5IASA 3DEKA 2QLJA 4LSZA 5IC6A 3R5JA 4JR2A 3V4LA 3V4OA 2QL9A 1IBCA 2J33A 5IBRA 3K7EA 3IBFA 1SC4A 2H54A 4FXOA 3DEHA 1SHJA 2CNNA 3OD5A 5I9TA 4I1RA 2XYGA 4PRYA 4D3YA 4EHKA 4EHFA 3S8EA 5IAEA 1PYOA 3D6HA 3E4CA 4JR0A 4ZVOA 5IAKA 3V6MA 4QUGA 3NKFA 4QULA 5LU9A 4FEAA 2QLBA 4JJ7A 2Y1LA 3SIRA 2HBRA 1RWKA 1SHLA 4PRZA 2J31A 4NBLA 5IAJA 1RWNA 2C2ZA 1GFWA 4JQYA 2P2CA 4QU0A 1GQFA 1CP3A 4D3ZA 2H5JA 3DEIA 4HQRA 4I1PA 2CNKA 3R7NA 1RHUA 4N7JA 1RHJA 4ZVPA 1QTNA 1RHRA 4N7MA 2WDPA 4N6GA 4D3XA 3GJQA 4AWBA 4HQ0A 1RWPA 4ZVUA 3V55A 4ZVQA 4N6OA 2C2OA 3D6MA 2FP3A 2H4WA 2AR9A 2H51A 3ITNA 4DCOA 4FDLA 4QU9A 3V6LA 1M72A 1SC3A 4M9RA 5LUBA 4QUBA 4NOJA 2CNOA 4QUHA 3DEJA 2C2KA 3P45A 5LU8A 1RE1A
chains in the Genus database with same CATH superfamily
2BOBA 2CO7B 2XKNA 3FULA 2RD2A 1H8HA 3FONB 3RGVB 4M1EA 1CL7H 4PLKD 1GJUA 2GM5A 3H5WA 2FG5A 5DMKA 3U1BA 3V52L 2PX3A 1ANUA 1XAHA 4B4DA 4YONB 4A2QA 4IOFD 3L0ZA 4JGNA 1IGTA 4MDEA 2P11A 1ZD5A 3UXEA 1SUPA 2IOQA 3OB8A 3QH3B 4GKOA 4V1DB 1EVIA 4B0MM 3VO2A 4EI6B 3MXWH 1G7QA 1QNFA 2WIMA 4C0JA 4E5XG 5F97E 2H59A 2RHCA 4WECA 3QWRD 3U7RA 5B6PA 2VZ8A 4XN1A 3E8XA 2AV7B 4B81A 5I3ZA 4JCOA 5B5SA 4HPOL 3P4UA 3DSRA 4NIKB 5FR2A 4QM6A 1FDTA 4LYDA 1E2UA 3HKDB 4RWEA 3JATB 1FTSA 1PJCA 3ULUD 4EMSA 3EDYA 2A9QA 4YHBA 1ADWA 4AY4A 4WW1A 3R1GH 5CYOA 4OD3H 4QFDA 3W7VA 1IHYA 1NANH 3BWUC 1IRAY 4WJG3 4MA7H 3VFMA 2GZ1A 1CLYL 3FOCA 1WPXA 2P0AA 1EZLA 1XHEA 5EP1A 2X38A 4F6LA 2WIGA 3ZDYF 5IEHB 3CUYA 2EKQA 3QELB 3I0MA 3W38A 4DSYA 1PDVA 4UNRA 2A77H 2IEGA 4DGYL 3ANMA 3TOXA 4UHFA 2DB8A 1CVRA 3SX4A 5J5AA 4LCIL 5TD4A 1SBIA 4LIQH 3VI3A 4L28A 3SLRA 4ZV7A 1KJ3H 3NQ41 1NP3A 1VKRA 1PVOA 4UOEA 4MAYC 2DDQL 1F6AB 1CTOA 4MA5A 2WA2A 2ZR0A 4PTLA 3ZE1B 1BW8A 1V5IA 1FL3B 2XADA 1A5FL 2LVEA 3AF1A 2VP4A 1MCJA 2W8CA 4IAOA 2OBGA 4A5OA 4NVRA 3OKKA 1C4WA 2M98A 4WFQA 1KCVL 5KTEL 5K4HA 1S9WB 3HE7C 2Q4RA 3GUFA 3QFHA 4PSAA 4DETA 4KRGA 4UUAA 2VM4A 3PHAA 1A50B 3OUTA 3FLEA 3K0AA 4ZUWA 3QUQA 5ANME 2CHXA 4BNNA 3RL2B 2XECA 4AMYA 1V5EA 4LSQL 1G5GA 4K55A 1RXWA 4R0MA 3IPRA 4QDUA 2V0NA 3KJ6H 4PW9A 2PQ6A 3HYLA 3NUGA 4XO3A 3INTA 4C3VA 4Q2ZA 1UP7A 2I3DA 3MGKA 3EUDA 1CULC 3RBSA 3ML9A 2IMNA 1WVMA 4XQ9A 4M7LL 1K6XA 4P54A 3UTSE 4FXGB 4II7A 4MUKA 2IAMC 4LHWA 4HGNA 2DYPD 3ETSA 5D5ME 3TBSB 1E9PB 2ID4A 3GDFA 5GIOE 1ZVSA 4G5YA 1M2HA 5EJAA 5FCSH 1ZVNA 5DMYA 2D7OA 1JXFA 2ADGA 2A1WL 1ODKA 1U8UA 2QK4A 5AOJA 4G8AC 1US8B 3KPWA 1FH5L 3VYNA 3PKZA 5E6UB 3M4YA 2LHAA 2YMPA 5ELXA 2PKRA 3TP4A 3S96A 1SVCP 1CCZA 5KN5B 4YK4C 1PLGH 3BRSA 1CD0A 5I7WA 3HC7A 2GF2A 2Y1XA 4Y5VC 4QODA 2WTPA 3ZGOA 3E58A 1I6LA 5AKLA 4P2RE 4OLBA 5HUQA 1FZQA 2ZROA 3LY5A 4ZSOA 3CLEL 4FNSA 1GS6X 1QC5A 2EBFX 5HF8A 1Z32X 3CU5A 1CU1A 2BVNA 3OU7A 1R6VA 5CM9C 2EQBA 1E0SA 3NCWA 3SCMB 3RSZA 4UZGA 4HNAA 3VDAA 2GYVA 3D4CA 1ODIA 4O59O 3BORA 1M4KA 1G94A 4G8FA 2VHYA 2JKXA 2LE9A 3HG1E 2IADB 3V0VB 4PCKA 4XFDA 4NENB 4HISA 4KKPA 3U4KA 2NVWA 2XZOA 3TBFA 3U4BL 3IPAA 1XDZA 4LLYA 4JYCA 5IVKA 1NOIA 1KYFA 5EEHA 2QN2A 1NMAH 5CW1A 3OD5A 2N75A 4DLNA 3ULVH 3HBPA 5CAYB 1XBRA 4W1SA 1UL1X 2FQYA 5EU5A 3M7IA 2P9TA 4WV1A 1XAUA 2TAAA 3P73A 4WK2B 5TR9A 3L4YA 2JTYA 4P3PA 3TIDB 1XU7A 2FB9A 3VZBA 4NKDA 5HHNA 4HQ0A 2VR5A 4MRCA 5F3FA 5I2IA 2QRZA 1XPUA 2IDMA 2Q7AA 3RZCA 4E5PA 1A4RA 4NN6C 5HYJA 1JMKC 3Q0IA 4HUJA 4TMKA 4XVJH 1A8SA 3F7NA 2ZOTA 4BIKA 4QE3A 1MA0A 3MRFB 5CPFA 1KDRA 3E3MA 4LJSA 1NRXA 4OLZL 5IV2B 1MCQA 3FT3A 1YOBA 5DJ8A 4UQ2B 2L0DA 3MRBA 1HQRB 3HG5A 1UYWL 3GIZH 2GR9A 2C4XA 1Q0EA 4P2QD 4K23H 2R27A 2OMTB 2WNWA 3KB6A 3TLMA 2JKIS 3AUJB 3PJFA 2MOKA 2L19A 4ANXA 4F06A 3ZL2A 2VT7A 3V7MA 1IMJA 3FTSA 4DZBB 4KDWA 1LM8V 4X98B 4DF9A 4HH1A 3U7HB 2ECOA 1RRCA 1K7XB 4J91A 3VSQA 4BL5A 3ET5A 1PQ4A 3GEBA 3MRPA 4J3SA 3MLYH 1HDCA 3GEPA 5I82A 5CNHA 3ZDRA 3R3SA 4R0NA 2G70A 2D2EA 5KVDE 2QD4A 3NAZA 2CD0A 3EYFB 1U2YA 1KTVA 2A1WH 5T57A 3ZNQA 5A5GA 2H4JA 4MD0B 4P4KA 1TJHH 2D7CA 1ZXLA 1N6LA 4C56D 5AKTA 3H84A 4JO2H 3KV1A 4Q9BA 3KEQA 4RF2A 3TLRA 1YYCA 5HYQA 5AOAA 1YV9A 4N8EA 4ZJYA 2IPUK 1H8HD 3IT1A 1XVIA 4QASA 4G6KH 2LE0A 2ATPB 4JSTA 5I6KA 3ZL4L 2H2GA 1AG9A 4YGYA 1DB3A 2HVBA 4WVRA 3X11A 2J9XB 1QEXA 3MGBA 2B4AA 2OTUA 5LAXB 2GCOA 4N3GA 1MQSA 1W8IA 4MVXA 3AR2A 4PRLA 1XK6A 4JZKA 2XMPA 1GSKA 5DCYA 3ZYZA 3H9JA 4KX8A 3GIWA 1TF7A 3GBMH 2JQZA 1V3LA 4KFTA 2EP8A 3M6VA 1UBKS 4GW4A 2IYFA 5LYJF 4O58H 1M34E 3TB4A 4L3OA 1YGPA 3MCLH 5AWFC 3CXDL 4G41A 4EQ6B 1EDBA 3APNA 2CB0A 1CT9A 4NEHB 2P9BA 2LRHA 1TC1A 3L17A 4YRJA 1A7RH 4RFNC 3MPUA 4ATNA 4HOYA 4E1AA 1FFBA 4H40A 3IXQA 3GNSA 3WUWB 4UDXX 4EBQH 2HNBA 4UE3S 5JNLA 2E4VA 1AN0A 4DVRL 1UIRA 3QX3A 4L4YA 3O9WA 1A5BB 1HZLA 1JA0A 4PJ8D 1ZK4A 1Q9KB 1YQEA 2V7WA 3RYHB 3MOAL 3BGFB 4G01B 3LUBA 2Q28A 1NGZA 4QNMA 4DCVA 3BPOB 3C5XA 4ZAWA 2BP7B 5HBGA 1DBPA 2VJQA 3FPEA 3R7SA 2AQKA 5EPOA 1YR1A 4B5KA 5JPCA 5CGQB 3U3ZA 4A2MA 4RANA 3ZHTA 3FNFA 3P0RA 1R4XA 4YAQB 5GRVL 1XIWB 4C6HA 5DNDA 2VLJB 4BFVA 3U16A 3FCGA 4Q7EA 2H6PB 4U6QA 3IT3A 4UNNA 2FUG6 3BH7A 1RWNA 4IFBA 4X62B 3P0GB 4NZPA 4DO4A 1KBGL 2CLCX 2GCIA 2H9GB 3HNVH 3KLPX 1O0CA 4EL5A 1Y7LA 3O0RH 4N2LA 3DHWC 2E74C 3T5GA 5DJAB 3FSZA 1EX0A 4KXUA 3TEFA 2K8MA 3BVNA 4FOMA 1D2MA 4K28A 4NSKA 5EEGA 4LDAA 1QHHB 2PR4L 4BMCA 2E8ZA 3GQVA 4HGRA 4LESA 4ECNA 4HKBB 2PRIA 1ADYA 5CXXA 3ZD6A 3S36H 4NQCA 3CH5A 3ULSB 2C8VA 5E1AB 2FPRA 3WQBA 3AYXB 1MO2A 5C09A 2YSSA 1OLLA 1Z9MA 2PO6D 3GSOB 3G5LA 4DV6B 4K71B 1WBJB 4R3NA 4UV4L 4LP4A 1DT5A 2QAIA 1Z2EA 3BD5A 4XPAL 2QGFA 2HPHA 3L4JA 2BLFA 3EOAA 4CN4A 1IY0A 1YN7B 2F58L 3IDJB 4G9DA 3DFFA 2OR9H 1DLIA 3W1ZA 1ZISA 1E0OB 2YAOA 4ZMZA 5FC9A 3TPUB 4OHRA 3RPIA 3GHEH 4JHXA 1IKOP 3OTHA 3F6YA 1G7IB 3PWJB 3RGVC 3QUZA 4CTNA 1P1ZB 1TUPA 4E2OA 4XRGA 1TLKA 1F6BA 2YAEA 4MYRA 4P5TB 4Q19A 1EGJH 2Z2XA 3SODB 4DFIA 4UOZA 3OKLB 5C53B 2YD8A 2J9FB 3RCBA 4ZQEA 2K9UA 1MEJA 3FRIA 4RJIA 3WBJA 4FGLA 1ZD9A 1PIFA 1QCDA 4U1RA 1VIWA 3PY9A 5CK5A 3MFFB 1YBVA 1FVDA 1AE6H 4JPWH 3UT6A 1NVVR 1VCHA 2YOHA 4KODA 3F7YB 2R23B 2P8MA 3CFYA 1NXVA 3ZLBA 5SY9A 1OY3B 2KX7A 2MYTA 5CP8A 3EISA 1SN2A 4IRUB 3OOSA 1F4HA 3COPA 4PQEA 4K7PY 3BE1H 3BP6B 2VTFA 3BI9X 1T8YA 2NACA 3F7MA 2SHKA 1HL5A 1P4UA 4HVCA 4R8WH 2I85A 1RZKH 5C0CB 4B7XA 3R6WA 2PANA 3REFA 1RWVA 2BEUA 3ACDA 4TVUA 5I1DB 4IJUA 2VYRE 2OCBA 5IYZA 2P42B 4UUJA 4HH3C 1YHZA 4KMMA 3IT8D 4RD0A 3AMKA 2YC4C 2G3MA 4M1DH 1ENPA 4ZMXA 2F74A 3A25A 1T0UA 5SV2A 3U4EB 4D0SA 1OTUC 5CGTA 2VJPA 4PSRA 3GFSA 1MCWM 2LAGB 4CM9A 3D7MA 4AQ1C 4UM9A 3RX8A 2F59A 2OUKA 4YJ3B 2R56H 5DXWA 4PRDA 3UK1A 4YHNB 3WIVA 4IOIA 2D1QA 4ZT7A 2FQDA 2Q5JA 5KC8A 4L76A 3UICA 2FWAA 2QG4A 1MF7A 2XYGA 1RUPL 3B6KA 1XTQA 1ACXA 3GCWA 4EGCB 2VXVL 5CFPA 4XYGA 3LEXA 4BATA 3WIHL 1Z9OA 1XTSA 1RLIA 2BR5A 3VOBA 4R83A 2RGEA 3F7YA 2YK1L 4G23A 4Z4CA 1W1IA 2NWQA 5KVCA 1PEKE 1DPGA 3FTGA 2CJFA 4NX2A 3L16A 4E2YA 2Q5QA 1UMCB 5AKKA 4NI3A 2JSFA 3LIUA 2GPWA 3EUFA 4ER3A 4JYZA 5B58C 2EWMA 2YMMA 3IAHA 3L1OL 1XBDA 4F4UA 1Q72L 2OCCB 4YDLB 3Q41A 1VFBB 2IT1A 1WBYA 3GLIA 4B9ZA 4LZAA 3T99A 2BI8A 4XGQA 4HWOA 4KPUA 2YJTD 5FYJH 3M3DA 2VPQA 3B3JA 3PE3A 1SUFA 3UCRA 4OFYD 3STUA 1FZJB 2R8OA 1GZHB 1N0XH 2WTXA 5BXQC 1T0OA 3SJVA 4KXZI 5TEWA 5ENVA 1KEPA 4OLWH 5C2BL 1T1XB 1A5SB 4EA8A 4NOLA 3QNXA 3FSJX 3EFOB 1OP3K 3RVLA 3OIWA 2HPOA 3LS4H 2DLDA 2C4MA 1UXLA 5F9JB 2NAPA 2IK8A 5B12A 1KJZA 3ZDZB 2WU1A 1GNPA 1P7YA 2JDIA 3EJQA 5CCKL 3RKRA 1SQMA 2GPYA 5F3WB 5D1XE 2FSPA 4DCCA 3TR5A 1BRTA 1W5AA 5CR9A 1FMFA 2J87A 3GZNA 2NY4D 1VJSA 5BJTA 3JD1A 4NQXB 4X9XA 4YR7A 1UMCA 4Z3JA 1ESOA 5KX5F 1OAUL 4JDPA 1J8MF 3Q6GH 2ZS7A 5FHBL 1SIUA 3FC8A 1UFRA 4MMYA 5DJDB 2ZAMA 2X5OA 1NG1A 5DNAA 3O3BA 2GARA 4JPIA 4OFQA 1CT8B 3BN9D 3QJXA 3UKDA 3QPQD 4WI4A 1UBUS 4IY1A 2Z31B 3U4GA 4XBEH 5IW1A 5BXFA 1WKVA 4Z7JA 4BAZA 2BSBA 1R9FA 3N70A 3VU9B 1CIPA 1K9VF 4RHUA 4M9CA 1T04B 2WMYA 1KYVA 1QHSA 3GGWB 2AJ3B 2WF6A 4P59L 1JJIA 1HSBB 3VFGL 4RA0C 4LF9B 3BPLC 1NW6A 4E08A 3KQMA 2C7OA 2H57A 4A66A 5F7KC 5I15H 4WI2A 4QHUB 3QFJD 3O03A 1E43A 4QRSA 3RZCB 2BDTA 2HLDD 1N32B 5DJ6B 3H54A 1Q0RA 5AM0A 2C5FA 1EG7A 1PS9A 2OEPA 1EXDA 4HH0A 3M7OA 2XKNB 2V1UA 1XH2A 3E2IA 1AQ8A 4WUUB 3WNIA 2C2XA 3RIAF 2APXA 3UMRA 1TKCA 3CZJA 2FDBP 2ZTHA 5FV2A 2NXWA 2VCEA 1UDXA 1E5XA 3KHOA 3NJVA 4IGBA 3FWHA 5JD5A 3COJA 5C9JA 5JVDF 5FWXB 2VJBA 2PUAA 1E1RA 2HDNB 3WD5L 1F1BA 2QTVA 1SXQA 2YHUA 3ESVF 1KPRB 1Z0NA 1QTNA 4H88H 4CN9A 2J6IA 2P30A 1PNOA 5EZYA 5AZUA 1KEGH 3WI9A 1D6MA 1G9EA 4OKVA 4ZFGH 2J0SA 3O84A 3OOYA 3BWAB 3EFFA 3D5TA 4R7ZA 4XPFL 8CGTA 1TTBA 2J3KA 2QM8A 2NU9A 4MV1A 2WD8A 2WNKA 1U3ZA 3TFQA 4BNYA 4DIKA 3BH4A 1NJ1A 3C8UA 4KXNA 3HKBB 5EO9B 4RKFA 3X1YA 2NOYA 4WTZA 1R6XA 1WZ1L 1NMCC 2WWKO 3U1QA 1DKRA 1F5WA 5FGCE 4MLPA 4TL8A 4MJIE 2K4AA 3FO2B 4C55A 3D4PA 2BOCB 3W05A 3ICEA 1WWCA 2WM0A 4JYBA 4BNDA 4C14A 3QNZB 4UXIA 5C6TL 3NKLA 3C6LA 3FOMB 5FLEX 3UZUA 4HBZA 1CLOL 7REQB 1TMKA 1OY1A 2DTEA 4DBVO 5EC8A 3PJNA 4FADA 2PYIA 4O0LA 3N2GA 3OQPA 4QDGA 2JJ1A 4R26L 1N5DA 4BHUI 5GXBB 1J2JA 3QG5A 5FPSA 2ZRLA 5TPWB 1GTRA 4DG8A 2VXSL 1E4VA 3WXWH 1X3DA 4G6AC 3PFBA 1PGNA 3D4IA 2IQ9H 1IOLA 2ZSEA 4PJ7A 4OGLA 5T3UA 1EFRD 1LSOA 1YRHA 1A3RL 1Y1LA 1JL3A 4CG3A 1RI1A 2QJRA 5DSTA 1KO7A 2ON6A 3A4EA 3DMYA 1D7OA 4MPRA 2JGDB 2VH2A 1MIML 2PKCA 1BA9A 1A3LH 5A6VA 1DKMA 1DN0B 2G7MC 1FNCA 5C9KA 4C06A 1V7PC 1HNZB 4B9CA 4DNPA 1XAGA 2DEUA 5DD6B 5JLZA 3TJRA 2Q27A 1QO0A 5C0RH 3MD9A 5KQSA 4BZ2L 4NV3A 3G7UA 4TTSA 4LLUA 1C5CL 4I88A 4G36A 4UMSA 3T65A 4AWAA 4NU6A 3FQ4A 1U8CA 3GBML 2DMKA 2HH0L 1QB8A 4YYEA 1DQNA 1QA9A 4XE0A 2F55A 3DQQA 1XCWA 3WYBA 5DVPA 1EP9A 4F04A 3CUEF 4Q7LA 2ZAIA 5BOSA 4LEEA 1DKOA 1QR4A 3SDAA 4PJCE 1IONA 5CR8A 1YEEH 4PI2A 1J00A 2A3NA 2QYOA 1WFOA 1EI9A 3QPQC 4OBWA 1S6YA 3CVVA 3BQUB 3S3JA 5KCMA 1FFXB 1H6BA 2F2TA 3BXHA 2WNHA 1X77A 2AV6A 1CQJA 1P6AB 4LOUC 3NKFA 6YASA 2QRVB 3UH8A 1RSFA 1ZC3A 5KSWB 4DWWA 3G9ZA 4EAAA 3RUEA 1WBBA 2DGDA 1SU4A 1P4AA 3UAGA 2X4NA 4AEFA 3LSOB 2CE7A 2HGSA 3ZNOA 1J0YA 3PL6C 1NJ8A 5F7NC 1TO6A 2Z5LA 2AR9A 1WWWX 1RI8A 3E7JA 1JXJA 2RHBA 2CYAA 1B43A 4L08A 4MD4A 2A9NH 5J4LA 5M3BA 1A9EB 3LB6D 4BFSA 2G60L 2P0EA 4C47A 2NU6A 2FXVA 3VKFA 4AL4A 2EYUA 2Q21A 2YXWA 3II6X 3ZHYA 1NIJA 4Q52A 4L8DA 4WDRA 2GJKA 3EXG2 2Y6TE 1HNNA 5EU3B 3HHPA 1H2WA 2W8BB 2GSWA 1QBLL 3U48A 1YJBA 4HDOB 3VB9A 1GVNB 2H9GA 5ICMA 1AKJD 4XC1H 5GGQH 1XLTA 4UDYX 2AE2A 4OJFL 2JLYA 3L1EA 2HJRA 3IQZA 5L4LA 2YAMA 1HOCB 3FT4B 2O61B 4OFKA 5SX5H 2BX5A 2WUVA 3LNFA 2OSYA 3R77A 1IL1B 1N5AB 2QKSA 4G59C 3C24A 1OVMA 1RZPA 1ULZA 3A24A 4NQCB 2H2WA 4ICIA 1FZTA 1KNQA 1HE4A 5LQMA 5ESAA 1XDDA 5DHSA 4DBLE 5MEOB 1PW3A 3H9CA 3KSDO 3CPJB 1Y8QA 4BKMA 4N2HA 3A05A 4QQFA 2YC2C 1OP4A 3UJ6A 1GL6A 3TM6A 4LEOA 1OAJA 4NYJQ 5E8DL 5JMOC 1ND5A 4CZ2A 3FTWA 3AT0A 4F2DA 4GYBA 1PX2A 5CP7A 3MI6A 3QHZH 1AV7A 1BE6A 5MGNA 4FYQA 4XAWH 3SMQA 1OP3H 1USZA 2XODA 1YD7A 1KTBA 4ICXA 2D3LA 4OHCA 1RIUH 3KUUA 3BEDA 1BSIA 3GRGA 4LL4A 3FPKA 2CDEA 5AW8A 3WIDA 3V7AE 2PZEA 1LF0A 3S29A 2AK1L 3JWOC 4PJEE 4XH2A 1XRSB 3DONA 2VC2H 2VRQA 1ZNXA 4AW4A 5KTEH 3NM4A 5BSFA 1G5IA 4B53A 2FR4B 1T7WA 4FNMA 1HDXA 2QTAA 1VFAB 3VDMA 4EOWL 2I07A 4HDNA 3TI7A 3KSBC 4LHUA 4H6PA 4NE2A 3D51A 4G84A 2C3VB 5IBPA 5C0AD 3D4ZA 3RHWF 1MSPA 3ZT6A 3LP8A 1MVNA 1NI5A 2HMUA 4RNRA 4IINA 4IMRA 3JZYA 1P74A 4JZJC 4MTLA 1JSLA 4PVLA 1JGVL 4AKTA 3WLRA 5M29A 1SHZA 3JQ7A 5A3RA 1CQYA 4H8UA 1FFSA 1QP8A 4WW0A 1IXKA 4F4FA 5K6AC 1JZGA 2CXRA 1IARB 4ATTA 3I28A 1J0EA 3BCRA 4NDNE 2X6AA 1U8NA 5E0FA 4GVLA 2FEEL 4IBUA 5H5JA 5E8NB 4WTQA 4DKJA 3O2WL 3UC2A 5AL0A 2QPUA 3AS0A 5KVDL 1HL7A 5IPFA 4GW5A 1E3DA 1XTBA 1AS0A 1VXRA 4Y2SA 3V4VH 3KB8A 3WYCA 5E4TA 1AKMA 1MAWA 3WNZA 4YRKA 1UGKA 2H92A 4HNVA 1V4BA 4FEAA 3EOAI 2VQ1B 2DQIL 2P5WE 4ENUA 2AV1A 4QBKA 4Q8BA 4LDRA 4QF1A 4E6EA 2C9OA 1KYOJ 4U6YB 1KBOA 1BLNB 2GKIA 2OMTA 2FD6L 1M8KA 2BOBB 1ZVSB 3GRVA 4RW0A 4ND7A 5TGDA 4ZPTB 4DK5A 1DJPA 1L0BA 4Q1VA 1AXRA 1QIFA 3ZK7A 1GRVA 2RE8A 2GD1O 2NTSP 2AVDA 3EGOA 4F3KA 5SWQB 1B14A 1W5BA 4GR9A 3OG4B 1SEPA 1A6WH 4L74A 4YSQA 3SIPA 5F1NA 1O6SA 4B6OA 1XIWA 4FT2A 1X5YA 5E9DE 1A14L 3KGUA 2YVAA 2FB4H 4EUFA 4F9TA 4G7YL 2YVLA 5DLML 1IC1A 1XMVA 2P3YA 1A2YA 5E70A 4NXMB 4ZOLB 2HPAA 5HSFA 4IGIA 4PJAF 1GHFL 1JJUA 1WVZA 2Q7OE 1CL7L 1KMIY 2ZCHL 2VWGA 4TLMB 4ZVSA 3PF2A 2DPXA 3T6ZA 5KTTA 1YJDH 3U25A 5EF0A 5JPMC 2YRPA 1XCQA 1OA0A 1Z12A 1M9NA 2I22A 5IG7B 1NBEA 2BDNL 4DA8A 4Y6QA 3ULVD 2C9XA 4XWKA 2ZKLA 3TQSA 3STWA 2PMFA 5A5EA 4K0RA 2H2PC 2ZYGA 2R2GA 3OJOA 1GAFH 4J1TC 3H19A 3V9EA 3RVDA 1O9WA 1Q1AA 5LWHA 5CT6A 2WJ4A 2CRIA 4MVJP 3MBKA 3B1JA 5B39G 4EQ6A 1H3PL 4X4YA 2BV3A 2V65A 3BIBX 2IYQA 1KDYA 4JMPA 4HGPA 1AHPA 3K4ZA 5EPMB 4Y2DB 2Q3EA 3JSAA 2FSEA 3PDIB 1J87A 1Q1JH 2BM1A 4NPJA 3LTEA 1IGJA 1PYWB 3OWRA 2EDOA 4RY9A 3HGMA 2QR5A 3O9WC 3DW3X 5L88L 1G64A 3AKZA 2ADJB 1YUNA 4TLBA 5J12B 4Z4HA 3SE9L 5FORA 4OL9A 3GFQA 3HC2A 5AOVA 1G5QA 4K9KA 3BCFA 5F23A 2ZOKA 2CNLA 3EZFA 2XWBB 3DE6X 4G9FE 1FA4A 3MOBL 1FYTE 3W2TA 1I8LC 3ABZA 3ZE6A 5EEYA 1YNTA 1PL3A 4LCWE 2JKRM 5ESVB 1CUUA 5JNVA 1LB1B 2ZWMA 5IZCC 3DC7A 4P2RB 2AFIE 1NQOA 3A4DA 3RBZA 2VKQA 3A9WA 3P9SA 3AG3B 5I66B 4X7BA 3SBOA 5DZAA 4ZP1A 3HQ4O 4PJ7F 1RAFA 4XR4A 2XN1A 4PC6A 4G6MH 5CD5D 4Y4HC 5JJLA 3QYJA 3E23A 4NYMR 1E28A 1PSKL 2TSAA 1QANA 4AL8L 4Q3OA 3C74A 4K8RH 1FFPB 4EDWL 1T0HB 4QUAA 5CIWA 1SKYB 4B3RB 1FVHA 2FJSA 2ZB2A 1KV7A 1C2YA 4I1UA 1U8IB 3TUZC 1BX2A 3CVCA 4PJFB 1ZSNA 1HZKA 5E8NA 4QHNA 4CCWA 4HK4A 1I1OA 2F1AA 3DRQB 4BK5A 3UZVB 4LGRB 1KGUA 4EI5B 1G5HA 1VI2A 1Y4ZA 1NVEA 2W65A 3AR5A 3GSVB 4UUBA 3IDUA 3BISA 3BJZA 1FOEB 1WDAA 1OHHD 3GT7A 4L8BA 1W0JA 5EU6D 3A2MA 4LXYA 1J5XA 1SU6A 2E6PA 2CF5A 1MAUA 4A92A 5AVYB 1N4XL 3BD8A 1QHXA 1ZJ4A 2YEZA 2R29L 3KKKA 4KQIA 2WLYA 1M05B 2PM8A 3KU4A 1OYYA 4BC1A 1S9XB 4E9SA 4D4GA 4S0TD 3P4OB 1DIRA 1SKBA 1D5MB 1PLCA 3TEJA 3T06B 3U44B 3S3DB 4QXUL 3W3AD 4NZJA 2FEAA 1N7ML 2GK7A 1CQXA 3DKKA 1GPYA 2VR6A 1PR9A 3OFNA 4H31A 3BX7C 2WTUA 4JROA 1UEMA 5L6YH 3VW3L 3T61A 4LXQA 3DV9A 5JTTA 3GO4A 2AEIT 1F8TH 2CLIB 3LZLA 1E9SA 4JQZA 1MQKL 3LDUA 1AOZA 5JS7A 2DQ6A 4XARA 4YEDA 3C60D 2JJSA 3K72A 4JX8A 3TCKA 1B73A 4Y2LA 1QEWB 1ZOLA 5EE3A 4AF7A 3ZIUA 3CRW1 3PC7A 1WM1A 4MLCA 1OI3A 3SS8A 1M71A 1PV1A 4K6KA 1ZA6A 4AYXA 5AW3B 4F3NA 1KYTA 4GD3Q 3CKLA 2H1VA 4RMVA 3DX9B 1N0LB 4OJMX 3DX7A 4ABVA 2Y06L 3G3EA 2YW2A 2AJUL 1XP5A 2YJ3A 4EELA 2A74B 3AR4A 3NCJH 2V4LA 2GT9A 4DEUA 5A2JH 2DQTH 1OTXA 2DX7A 4EP1A 2F9MA 4YEFA 3TVTA 2I6UA 3WL6A 1VGKA 3RS3A 2EGUA 1O9ZA 5DA4A 5LJIA 1K8YB 3DV0A 1Q77A 1TCRB 2YWEA 2X0VA 2I7CA 3LVBA 4TLDA 5DASA 4PG8A 5IT5A 4A7UA 2GI4A 3PV6B 2OX5A 4CRPA 4NBSA 5KVGH 4E9RA 2GOYA 1BMFD 1LEIB 1YXMA 3TH5A 5DLPA 2YAFA 3O2DA 2DBJA 1KERA 3FQRA 3ZWAA 4U7FA 4V1CA 5K8JB 1J12A 2NXEA 2A5FA 1JHTA 1FC2D 3JV4B 4LRNL 3BAKA 4IRSB 4YP7A 4JVSB 4YHNA 3BD7A 4M1QA 3JQFC 2J55A 1CJTC 5FUQA 1L7AA 3HXTA 2QEJA 3WMSA 1KVQA 4EUPG 1CURA 1DLFH 4U2GA 3JV6B 5IK2A 2QVCA 2UXFA 3KYJB 4UCXA 2IP4A 4XT1C 3ESBA 4NQRA 2RGDA 3L2NA 4XN8A 1U8OA 1J0JA 2VN8A 5FGSA 3EDQA 2VDMB 4C5CA 1QF7A 4DMLA 2HDHA 2ZWNA 2F19L 3WI7A 5BQXA 4PLPA 3TOVA 3KPRB 2WAQA 2CEKA 2W2TA 1BFUA 5B7NA 2XY4A 1UB5A 3HR5A 5HDBB 3VXME 1XGQB 1T3FB 2IIBA 1WP6A 3OP1A 1RL1A 3UROR 2D2XA 5JMPA 3BT2H 4D7PA 4RORA 1V96A 1WCIA 4ZMPA 1XZGA 2DETA 3ZE2B 4WIQA 4PJGF 4DL9A 1MC4A 5I0ZA 1ONOA 2EX4A 1VCIA 4Y4HD 3KXPA 4LZZA 2BDUA 4YIKA 1BKDR 5BN4A 2ERXA 2CO1A 3WYAA 5KMGB 2AI0H 4M0DA 4OGFA 5L2KE 4KUCF 2DZDA 3KYDB 2R6AA 5IREA 5KYYB 1AQUA 5MHSD 4V0RA 1TAUA 1B6GA 4Y2PA 1ZLWK 3KALA 5FFGA 4YWHA 5J1TB 3RNQA 4N2KA 1N1MA 4PFEA 4WT7A 3AEKA 4RZCA 1M7XA 3W39B 4FE7A 3IVMA 3AESA 1EBUA 5C18A 3KLLA 4QNPF 1YB7A 1EHKB 3CMMA 1NVUQ 5CA1B 3PT9A 3C6KA 2JGFA 3KR3L 4YMHA 1X7DA 1U8HA 3CT6A 1KMHB 3RF7A 3TNMB 1JZEA 3RX9A 1CLUA 3QS3A 4U1JB 1PJ3A 1MFBH 4IJ5A 4I0CC 2QA5A 2QDXA 1P1BA 2PD6A 3RUCA 4ON9A 4CM1A 4WHCA 1DUIA 1MOEA 2NU8A 3EDCA 2Y06H 3N8IA 2N4IA 4PS4L 4C4YA 3N7TA 5FX3A 3HR5B 1YB4A 2H2SC 4GM0A 1L7IH 1YMUA 4N0MA 4GRWF 1SXPA 4A73A 3K70C 1SZCA 1Y1TA 1KAOA 1TJMA 2C57A 5JSUA 5C08A 3RC1A 3O3AB 4EW2A 2BP8A 1QR2A 1O5PA 2VQ6A 4EKIA 2WBWB 1RKVA 1ZDMA 5LZ4A 3HPRA 2XTNA 3CX4A 4HL6A 1XYYA 4PNPA 5CG1A 4OHBA 1V41E 1Z7EA 3APCA 4NTZA 5DJCB 4YACA 3SJAA 4AJHA 1WD5A 1HOXA 1SZPA 4MPPA 1ZEMA 4PWEA 1CN4A 1SJXA 5TDPA 3VRJA 3AFLA 3QWBA 5JO0A 1DEEB 2RGGA 3K6SA 4KR2A 1N2CE 2H6OA 3PE4A 4ZGGA 3OPNA 1TQBB 2Z31A 4OK5A 4DEPC 5EUQB 4V24A 1KB5L 2EUXA 1QSFE 2UZ3A 4O02L 4X9IA 2C9BA 4TSAL 1SUCA 5M95B 2XUJA 3D18A 2ZP8A 2YD5A 4CN8A 1AZLA 3DMMD 1ZT7A 2OM2A 4OF8A 2P26A 3LPNA 2DKFA 2Z8YM 2NTEA 1VFBA 2AK4E 4PTTB 5D7EA 1KJ2H 1MN6A 3NCHA 1NMBL 4X5WA 3PJGA 4PG2A 2H1OA 5SWSE 2QKIB 2J85A 2HG0A 4BK8A 5BUCA 4O5OA 4EI2A 4L9WA 3G6JF 3ZBTA 2EEPA 3E03A 3BVUA 3AHIA 3X2SA 5FKJA 1B3BA 5ERGB 4QHLB 3I6ZA 1T1XA 3HYNA 1E69A 4C4KO 3D2UB 5I7HA 1I6MA 4AEEA 1QJ4A 1NDUA 2HCZX 1TZ2A 4OYRA 4MQ7B 2ICES 1DAFA 3R8BB 1DWUA 1XB2A 2LFGA 1YMMB 1NVGA 3CLSC 4BFZA 3EZXA 2QVMA 2GX6A 5DVLA 3BG5A 4YMPA 1NSNL 4FLSA 1F8YA 1U3FA 1QA9B 1PWEA 5AEAA 4I87A 5JPNA 3UHOA 3ZL4H 4LXFA 3EYOA 5SYNA 5E00A 3H8JA 3CDGB 4JBIA 5BNXD 2GG1A 5AESA 1AS7A 4JN2A 4YDIH 1M8FA 4CKYA 4N12A 5CXPA 2Q86B 4D9MA 1NATA 2OXRA 3EGEA 2WYZA 3A6CH 1LRJA 1Y3FE 4BKLB 2BPOA 3I1YA 1CZKA 4ZHQB 3WFZA 4MS3B 1QPXA 2WUFA 3GVPA 2BVUA 3DOIA 1UBOS 2B2XH 2PO6B 1KVUA 4A5SA 4CEJB 3T1OA 3S8FB 4MYTA 2E1RA 3H3BC 5FO8B 3KTAA 3QWNA 3UNXA 3IOMA 3A67H 2EFCB 4NP4L 2GDZA 4NMXB 4XQ0A 3KYBA 1JMXA 2QADB 2ZSKA 4RIRA 1PLKA 1E6LA 2WLTA 1SKYE 1IGCL 3QTTA 2VDRB 3V8NA 3QIUC 1VFNA 4HUXA 5I5GA 3K0HA 1BMGA 3ZE2E 5JY6A 3K80A 4GKLA 1Z25A 3RI5K 5DTJA 3VVMA 4ZYKA 4H3VA 2B8TA 1II0A 3P9PA 2Z5FA 4UQ3B 3ZGXA 2BMKB 4PYNA 4KXAA 3CLFL 3HCBA 3ZHUA 1RC1A 3I3DA 4GGOA 3HC3H 1JI3A 4ZT6A 2DM2A 4BRWA 1AO7D 2FX9L 4APQD 2NY5H 3F04A 2N1BA 2P8PB 2PPEA 1XGTA 4Z9FA 1Z16A 5T1MA 2FWNA 1SXJD 4HUWB 4PJBF 2HAEA 3QW9A 2D7PA 1QIGA 4B8YA 3TRIA 5I66A 1RYBA 1W34A 3ENZA 4JANB 5FYLL 1BJTA 4QHYA 4OQDA 4KRYA 1A7KA 2B4KA 5ALOA 3H9ZA 1V7NL 3FU9A 1TFHA 3R0VA 3D4YA 1XRPA 4OQPA 3BIJA 4M6OL 3F9RA 1T5DX 4NO0D 1R5VB 1YZKA 4RESB 4RGNC 1SJ9A 3VU2A 2XF2A 4YWGL 5TQ2A 5FPIA 1ECCA 1NMQA 3G6AB 4EKYA 2BJML 3DK2A 3AFGA 2B9BA 1BHGA 5JPMB 4E88A 4EN3C 1S7SA 1DBJH 3MGTB 1IJKA 5IJDC 2DMRA 5AUQA 2VSXA 2KQNA 4I1OA 5JOPD 1JPUA 3RV4A 4MAUL 1ASOA 5D5MA 3JBG7 3KJNA 4K46A 3EBOA 3QBEA 5EFZA 2WP3O 3AZPA 2DPMA 2Q7DA 2FPIA 4OA5A 1PR3A 4W5TA 2XV6B 1KDZA 3K96A 5EC1A 3DVAB 3CZNA 2FX8H 1X5KA 1QLWA 1ZHFA 1UM4H 3DFMA 1GXSA 3QLUA 3KPSB 4PJCB 2Y27A 1KB3A 3UQYS 5KVMC 1MLBA 3C16C 3WL4A 4FTDA 5D1NA 3R7DA 5JHMA 1AI1L 1E2PA 1R9JA 1N0XL 1T7XA 1DBRA 1ADQL 2VAAB 3WL5A 3DVGB 3IHLA 5DFTA 3H42H 1M66A 4P4RA 3FLBA 4KDTA 4Z7WE 2YRWA 2B1JA 1PVVA 3HUEA 5BSKA 4RCYA 4EG0A 3KBEA 1V7MH 5C09D 3FWYA 4L95C 3WL7A 3CGGA 2X4OA 4S1VA 3QLUC 3T0FA 3D7PA 3WA6A 3IUBA 4CMBA 2N47A 2ZWPA 1A9EA 4YOKA 1ZGAA 1JN0A 2J7PA 5F7LB 3EASA 3MBWA 1XP8A 4OLVH 1T5BA 5KQGA 4HAYA 3R0NA 1VFOA 4IX9A 4J75A 1XQWA 3ZDDA 1KHTA 2XN9B 3MCUA 3MGOA 4N1AA 3HXQA 5LJLA 5B7FA 3H7LA 4CMMA 4HHGA 5F6HI 1J8HD 1DZ0A 2VMDA 3QXCA 1PR4A 1TCAA 3OEYA 4JKLA 1U8AA 4M87A 1Y98A 3FIUA 4DLKA 4DLWA 3H2IA 2X5KO 3PAUA 4JFYA 1I4OA 1L7QA 4TSFA 3NHFA 1T1ZB 1SVSA 3D0OA 1K5NB 2P5SA 3F58L 3ATFA 4Z7UA 3QUAA 5KYUA 4YHZL 1JKJA 2WEKA 4CLDA 5CYGA 3ZHRA 5GJSL 3L1HA 4EPSA 4TPRH 4C0SA 1ZTXL 4RH3A 3FYUB 2BF7A 4QDKA 3EGXB 1XDSA 4NI6A 2CV1A 1ULSA 3BHBB 1BAPA 1O6BA 3EYSH 4BV1A 5EJ9A 1GT91 5I6XB 5K93A 3M4JA 3EN0A 3LKZA 5K9JH 3IPCA 2ZIEA 2ZJ5A 1R5NA 2BIIA 5I30H 5EEZA 1B0GA 4B85A 4PRIE 1YY8A 1T6ZA 3ARYA 2WG1A 2GNOA 3SG0A 4YBZA 5JHDE 4ONFH 4D8YA 1X15A 4LOFA 4OZHA 2DRUA 4BE5A 1JHRA 1BEEA 3T7KA 2WXPA 4QPNA 1ZHBB 1YSCA 2BCJQ 2ZREA 4PGDB 1ZAGA 4TNFA 4OQNA 4UCWA 4QUEA 4HHAB 2FR4A 1Q1QA 5FKPB 5FYDA 1CS6A 3HUTA 4X7PA 3IMBA 2J1XA 3EJCA 1MTZA 4ZCIA 1CXKA 2VDOB 4BQEA 3B2UD 4M7PA 3LNDA 3ROPA 2E86A 5GZOD 2DLEA 3RC3A 1MA3A 2ZUTA 3ZBQA 1GYUA 2VL5B 2PCXA 4HALA 3ZE0B 3ZU6A 1FDIA 3JATA 3MJ8A 5FD8A 2VZSA 3DC0A 3T5TA 4I0PA 1N6RA 3LKQB 1ZK5A 4YT4A 1UOPA 2FEXA 4I9FA 4F7PB 4JFQA 1ODSA 4MUJA 1WQVT 2ENYA 2A38A 3QJYA 1CDHA 1V3VA 4LCIH 4AK2A 2VW7A 1GUZA 2W6PA 2ZW9A 4R1UA 1V25A 4YDKL 5CBPA 1EAJA 1JNLL 4NIYE 4JUFA 4RD1A 2P6UA 3OE7D 3P4XA 2F5BL 4KUGA 1YDGA 5CH5A 1V3TA 2VEDA 4JKNA 4KNYA 2ZVQX 4DLBA 3KIPA 1NQVA 2YASA 1M34A 1NIBA 5L3SA 3WHKA 4IUBS 4ZGBA 1MB4A 1BWQA 1PS3A 3WL9B 4RS3A 5DS8B 4MQMA 4NYIQ 3VFVA 3QORD 5D2NB 3GNML 4ODUB 2CKNA 4OZGB 1VERA 5I0XA 3P2JA 1IBDA 3A11A 4MRPA 1VP9A 1WJGA 4WV3A 2R25B 3T6WA 2PJUA 4PWKA 3X2QB 3VNSA 3AL0C 4Y9UA 5EWMA 3FDWA 2O8BB 2RR3A 3ZJVA 5I1GL 1U99A 5T5QA 2ZOSA 1T4MA 4DP8X 3SJVD 3RIGA 2X0JA 4GG6F 4GUPA 4NATA 3AR3A 3MV01 1UJCA 5EUOF 3KPNA 3U3KA 1IUZA 4HI0E 4Y5XC 4ALAC 1NGPH 2NUPA 3TFKD 4CL8A 1YZUA 5IQNA 5DK0A 4AYFA 1G6OA 3SSAA 4P5TA 1FNHA 4JO1L 5CFZA 5JVDB 3H5OA 5DE3A 4PEEA 3RPEA 4R1QA 1BFSA 3X17A 5K1ZA 2X40A 3MRJA 2FCBA 3PSHA 4U2DA 5FJJA 5IWLA 3OPUA 1N2XA 2BL4A 2IUEA 5IHZB 2DLFH 1B4LA 4HIJB 2JI8A 4TQEL 3W06A 3B3IB 3QPKA 1LV7A 2EQAA 4KKXB 1R0KA 4J6EA 1JYFA 3ZNPA 4M4RB 2OHFA 1D2PA 3HFML 2HFKA 4RHFA 5J43A 1AGNA 4Y4KA 5ALEA 4L9AA 1W0KD 1OBVA 2AE1A 5D1XA 2I2XB 4P5EA 2ZBVA 4XEUA 4KROB 1KZ6A 4ZCMA 3WFCL 2J88H 4MV8A 4F9FA 3MRCA 1L3BA 3GSNH 2APFA 2Z92B 1JVNA 4PB0L 4N7JA 1NAHA 3O8OB 1KY3A 3V1UA 5EBMB 2E6UX 2ZBUA 4Y2GA 2E18A 4BFEA 1F6LL 3K6IA 5DNUA 4DB4A 4G7YH 3GB7B 5CN1A 2OPHA 3IWUA 2UX6A 3FYCA 1JT9A 5JSHA 3MMEB 1T66D 3ZC3A 1FORL 5DHQA 4KGLA 3DDFA 2C4WA 2ZYWX 4O3MA 3WIFA 3LQ1A 4BBJA 4OZIE 3EEIA 4DSOA 2ZCLL 3KR1A 1T1WA 1NNI1 3FCYA 3KW7A 4TV8B 5HX7A 1RC8A 1IQUA 4V2IA 1TJYA 2WPDA 1ZCBA 4O00A 1WOYA 3LPCA 3AIIA 1NGQH 3U0BA 2QVGA 4K86A 4MGXA 4WY7H 1KA9H 3K4DA 3MX0A 5TK2A 3VRLF 1IAIM 2DEYX 2A4ZA 1QW8A 2Y1WA 5GONA 1BA2A 3WNCA 4MS1A 2OV4A 2W42A 4OGWA 1HJCA 3GAMA 2IHJA 5INDA 3PWUA 3PV6A 3SO5A 2ROYA 1Y18B 4FBLA 4P4KD 4QTHA 5ICEA 4BKLA 3RVQA 4M9XA 2EATA 5J4YA 3UHPA 3BQUA 5J11B 3W8NA 5GGUA 2FO1A 3PABA 3TNJA 3DDHA 1ECLA 4XXWA 2AQ1A 4O2BB 2BY2A 1IC5L 4NBWA 3O8OA 1CXEA 2GVDC 4KNVA 2OCIA 3MV8A 4WE3A 1KRWA 4G5HA 1R0ZA 5H4GA 5HHMD 2IEYA 3NQKA 1RXIA 1ESZA 3FHLA 4W99A 5AT1A 4XZ4A 1XXHA 5B4MD 1D6JA 2XD4A 1RJEA 3L8FA 2VXUH 2Y1ZA 1Z5PA 2ZSFA 1X5MA 1NOLA 1QDLB 1J8YF 3PICA 4JLNA 4KK8D 5CCEA 1QFZA 5GRVK 1CZOA 3DCYA 4ETIA 1HFUA 4GI7A 2GY5A 3DDGA 4PHTA 2C3VA 3AF6A 4MCZA 2VNHA 3TX4A 5JIHA 3RX7A 5F1SA 4C30A 2YS4A 4H0LC 1LGVA 4HKJB 3UMFA 1NT2A 4ZVRA 2WXHA 3D25A 1F58L 3KQVA 5HTSA 3K6FA 1F4XL 1DADA 2WU3A 3GZNB 4DIBA 4MUIA 1MX3A 2AK1H 4OFVA 4BRJA 5JO5A 2ZP9A 1OT4A 3UBHA 5K0SA 1XSKA 5ADPL 5T6BA 1WEKA 1KGSA 2EDXA 2XVKA 3HPJB 4KE9A 4FXGC 4E12A 1RXCA 3BXOA 3L04A 3LB6C 3TLGA 2E9IA 4DIUA 1G43A 2VWHA 2V8MA 5C34B 4CM5A 3KQQA 2JLWA 5KOJA 3V7AG 4XZUA 3THXA 5TY0A 1HHIB 1UJNA 5H70A 4O2EB 3RSHA 3SX0A 3W1WA 3LN4A 2JGKA 4JJ7A 2D5BA 2P6OA 2OK8A 5JDJA 4MBRA 2EIBA 3TBYB 5LBVA 2QQGA 2C7VA 2EVWX 5HXAA 4F5ZA 1IFHL 4ADIA 1HH6B 5A1AA 1EVJA 4UTVA 1RWPA 2Z92A 4ZRGA 4HGWB 2O14A 3ZKSD 4L8WB 3RSQA 3HUJE 2EIJB 4DP2X 1ZCZA 4ZUSB 1OM3H 3KSZO 4ZNCD 1J2EA 2DH3A 4ISVA 4G0QA 3AFNA 3BD6A 4Q15A 4D8TA 2OCPA 5HRAA 2XN9E 4WCFC 4QRRE 3K6JA 2SECE 4LPWA 2R8EA 3VYWA 5J47A 1LO0H 1R4ZA 4U33A 3ABMB 4BFIA 1OE2A 3T12A 4NAQA 4JDVB 4GRMB 3VOSA 2Q1YA 4BFTA 2GEJA 4JO3L 2VLKB 5B6JA 1M10A 4BLVA 4XDZA 3ZXSA 1QI5A 4JXXA 5IVNA 5JYEA 2G04A 1K6QH 4CIBA 4H8WL 4P2OA 5C0EA 4BO9A 3DO8A 3S36L 12E8L 5B57C 2QTVB 3O4LA 1XTJA 2WWXA 5FTLA 2NY1B 4DGVH 4AY6A 4U6HB 4TXLA 4KK5C 4OCYH 2ZUBA 4KV5F 2LP4Y 4TVOA 2FCRA 3DEKA 1JGUL 3ASWA 3OM1A 1ZIPA 4PLWA 2A78A 1E0DA 5JFGA 1F14A 5CJXC 1JEDA 2OLEA 2VP3A 2H3NB 3IJSA 2DJSA 4O4IA 4ZYZA 3U2SB 3K0CA 5EVCA 5HJ2A 2GMWA 4HXFB 4JR0A 1UZ6E 3WMRA 4WADA 3M5PA 4E9LA 2C4FT 1GSOA 1R17A 4H3KB 5DEFB 1CEEA 4IVRA 1MFAH 4KXLA 1JU3A 2PFGA 3MNWB 1VPVA 3O9ZA 2NQDA 4HDQB 3WFJA 3HN3A 2XH8A 4IDAA 2R2HA 1G20B 4ANFA 2OVFA 4YI5A 1HZJA 3MLUL 1RUAL 3HJHA 5JOEA 3LV8A 2MYPA 3GCGA 3ZQXA 2R2EA 2OMVB 4Z7VF 4IBYA 5HS6A 2COEA 1DKNA 2E4XA 3TWCH 1YB2A 2ATXA 1EDEA 3DECA 1R9MA 4BC0A 3Q7EA 5JW5B 3QCUL 4ZG1A 5DRXA 1SXIA 3TBCA 4OGAD 4K9DA 4YFDB 5FHRA 4CWAA 2ZRMA 3FQRB 3F65A 3DLCA 2RHDA 4ADGA 5BNFA 1XLUA 4OMDA 1EDHA 1J06A 4Q93A 2IFFL 1QRRA 3PKIA 4W1QA 3A4NA 5FO9B 1QM5A 1CEQA 1AMNA 4GS7B 4G0ZA 5G0VA 4PAZA 2WBKA 1O0VA 3NYQA 4AYSA 1E3JA 3R3UA 4XX0A 5GINE 4S2SB 2AC4A 1T21B 3W9SA 4DSTA 1G9NH 4W68A 3FF4A 3FYDA 2A6KB 3RA7H 2G9VA 4UU9B 3NBXX 5C1DA 5AXCA 1KNXA 2KLBA 4URTB 4TTVA 4PW4A 4C4OA 4TTQA 4Q4IA 1OF2B 4RV4A 4HCJA 3NWPA 3W2HA 2AQHA 1P75A 3DMGA 4FX2A 5CBAA 1GRCA 3JWNE 3B85A 4PG2C 4MK4A 5CLTA 4TKUB 3ZWYA 3OXSB 3W7AA 2JJTC 1WEHA 3C3MA 4D4LA 2ZULA 3MMNA 4L0CA 5L4NA 3I5AA 4ZKDA 5E2TH 1WDKA 3P4OA 4WI9A 5L7YA 1KBVA 3NU1A 4E9WA 4YR6A 3PHCA 2KJQA 5DBEX 4LLWB 3HFMH 3LRMA 3LA6A 4PCAA 2YUZA 3VWJD 2AXJA 3RLFA 3WMXA 2IXTA 5F7HA 5DT1L 2CJUL 5LOVA 1G18A 3DWIA 3EC2A 3Q9QA 4XC3L 1UD5A 1PT9A 4GEJA 1UB6B 3WNKA 4LJ4A 2IS4A 4BFBD 2ISSD 1S89A 1UDAA 2WJ7A 4IR7A 4OM8A 1VSBA 4ERSH 3GXOA 3I6LD 3NHWA 3KUKA 2CNWD 3FVWA 3LEXB 3IDYB 1YTUA 1GCIA 3CNQS 3HB4X 5IWAB 2LZ0A 3LQYA 2DJIA 3R41A 4I2NA 5AOMA 4M5YL 2WWYA 5C0FA 2HX9A 2DQMA 3NORA 3I4FA 2WZPA 3QBTB 2QN6A 5INTA 2CLRB 3B34A 3F62A 4PHHA 4BQIA 4LSSH 2JGMA 4CW7A 4Q1CA 5FUVA 1MOQA 1SEBA 2DQJL 4RLQA 4OXQA 5I1EL 3PUWA 4P9NA 4HUQA 4UBOA 5C08B 3VZRA 3BJRA 3P4MB 2MRYA 3V80A 2DWPA 4MINA 3FNBA 4WESB 3NOVA 1PTJA 1CF9A 1KYOK 1I7LA 2G9RA 5CFRA 3T1FB 3IDXL 1I85C 3DKIA 1QRKA 3E80A 3H6JA 3W5MA 1ITZA 2VAXA 4L0DA 2HSJA 4YCAA 1JHOA 4RIIA 1DE4B 3DDNA 3D0LB 3VH8G 3BUTA 3F5FA 4M49A 3I5MA 4HIJA 3A47A 4AQYB 3I5UA 4YXFA 4LXGA 4R26H 3CC5A 1TCBA 2O1XA 2W48A 4UPDA 2O3UA 1JF1B 5CCDA 5G5DB 1LJLA 4XTRA 2C7FA 2FY8A 5JS6A 3BWYA 2X4RA 2DWEB 4CM4B 4HFMA 4C43A 4LBWA 4ZMSA 2V7UA 4JW3A 4LRTB 5IJWA 5DOZA 2LDXA 2K70A 3DTUB 1FTYA 4DIEA 3FRUB 4YR9A 3O8XB 1NUNB 1KH1A 3KAQA 3CC1A 4CL2A 1QTSA 4KE7A 4BE4A 2X1WL 4LV8B 1MXGA 1WEJL 4NZ8A 3OQ3B 4GMDA 4UMGA 1TR7A 4F1JA 1J9CT 4FYVA 3QXWA 5GMOA 3NJGA 1IZ0A 1LS1A 4MHHI 2FOLA 2W2NA 4XXDA 5CILL 4ZMAT 3U7FB 5DDIP 4AMXA 3M9XA 3CVHA 4RFNB 1YQ2A 3LOQA 4LCYA 3CX2A 2I6QA 3NTXA 4LVOB 1PSKH 2Y6VA 3GIDA 2PLTA 3F8SA 3INUH 1JK9B 2R6R1 1OGIA 4F24A 1EGQA 1F8FA 1HE2A 3FN4A 4F58H 4EO9A 4KI5C 1QDEA 3LWZA 4BWYA 3ZGIA 2ICWJ 4OJKA 2CUIA 1H8EA 1DVRA 5LZ8A 4HRXA 4MD5B 3FFCE 1L1EA 2OBBA 1ESNA 5FYQA 4Y1RB 2O7SA 1KOAA 3LT1A 2QGBA 4JI8B 4FQCH 2RAPA 3NZHH 1M2OB 3ROLA 2EICA 1BVNP 5IJVA 3A3KA 4EZIA 4U2EA 2PS0A 4HBQA 4I13B 5BWCA 2Y9RT 3S68A 3UIZA 1GZPB 2R11A 4EGQA 4XPIB 3CM0A 4AP6A 5IUSA 3G6AA 1WY5A 5JSZB 2D31B 4EG7A 4ZPJA 3UH0A 1BCSB 2AERT 3FGOA 3NV7A 2UWEA 4GLOA 2JLPA 5CLFA 4P4SA 2O5ZL 4BRUA 1NIAA 2EJBA 4H17A 2YBGA 4FK8A 2VGLM 3KGTA 2I3GA 5IVXE 5LB2A 4F5WA 5AQEA 1LFAA 2B1AH 3NSDA 1FTQA 3WC4A 4C01A 3G6DL 4N5IX 4F4HA 1ZW1A 3WDMA 4UUMA 1J8QA 1N68A 3EWSA 1MDAA 5AOKA 4E6PA 4Z7VE 1WWKA 3GMMB 3OMWA 3M6XA 2DBVO 4WSJA 4ZPTA 3H4TA 1U0JA 1ZXXA 2P9QA 3ZKMD 4H15A 1VLJA 4E94A 1OVZA 3QJHB 4R7XA 3IEPA 3F7TA 1R0LA 2EKLA 3CNOA 2JZCA 1A9BA 4PPGA 4NCKA 4KKNA 2X2HA 1TTQB 2J7KA 1CE6A 3B9AA 1OB1B 1KTIA 3L1UA 5BY2A 4XMXA 4AZVA 1Q1JL 3OLIA 1O8CA 4HXYA 5IAJA 3OGCA 1H5BC 5FUZL 3UQZA 4X80L 2QUBA 1I2ZA 2XG4A 1U9JA 1G2PA 1QO0D 4XMLH 1IIIA 3JWOH 4O33A 4WESA 1P7WA 4BU0A 1MHCB 3M6IA 5A7GA 1M5RA 2UZ1B 5B53A 5D96C 3AJ7A 1Z6JT 4G83A 4P05A 2QE7A 2UVPA 4JPSA 4CFZA 3DD5A 3KXDA 2CMDA 1P53A 3A70A 4CIYA 2QBWA 3EJZD 3CFJA 3OPZL 2ZU6A 2BEVA 1SDDA 1VCOA 4YYZA 1YE3A 5I0VA 5MEPA 3TINA 4JVPA 4LHSA 3B6IA 3S9DB 1LQUA 3FB4A 4Z7WA 2LPMA 1GPMA 5EGSA 4JL6A 5I9IA 5IB5A 4CCYB 5ANMA 4PYGA 1KPGA 1BZ9B 1NEZA 1YULA 3KQTA 4DN3H 2PCJA 5AVSB 1TQHA 3PHHA 5TE6H 2ZXUA 4ZI3A 4Y0GA 1VHPA 2ZB8A 3NLLA 1WXWA 1RJDA 3HCEA 3QOYA 3EOZA 4XIFA 2ZB3A 2CDFA 2BFCB 3WGHA 4P86A 3I0NA 1COBA 1CGXA 1I1YB 4F12A 3PBKA 4ETWA 1SD5A 3PC8A 4NKQB 4N2FA 4LSUH 3NFSL 4XNQB 2M6RA 3EYVB 3KCPB 3ZZ1A 3KS0J 4YC2B 4MO2A 4GIPD 1WFIA 1MFPA 4J3OG 3GFOA 1SKAA 4K9SA 1P9LA 2J57A 2HK8A 4BVBA 1Q7CA 3RAPR 1K5DA 1YG9A 4N0QA 4LDQA 2YPVA 1BDMA 1T26A 3DOEA 3GVIA 4ASUD 1NWHA 4NFBA 5GIRB 3WQHA 1V8HA 2ZRNA 3CFEA 3MUFA 3I3BA 4EUPA 4TM9A 4FFVC 3A9TA 4N5EC 3W3ZB 4OLXH 4PG6A 4JDZA 3L7YA 2BISA 2AZTA 4C2UA 4LRYA 4K9EH 3FUEA 4J3OH 5BQDA 4PQRA 5TDPB 3FQNB 3MRIB 2PYED 1RK0B 3REVA 3VPCA 4LXXA 1QKIA 5IBLD 2WUDA 3GLIB 2XIJA 3QDME 5FWYB 3OESA 4P4KC 3N75A 5LO7A 3VFOA 3D31A 2WWNA 4RK6A 4RZUA 3RURA 1FRQA 5B38G 4JBHA 2O0HA 5JXHA 1U8IA 3B5EA 3KYCB 1OARH 3SDDD 3VVVA 5IMKB 2QM0A 2XGMA 3TBYA 4BSJA 4QXGL 2AJ8A 3U9PH 2AKYA 1ZTXH 4BWUA 4HJIA 2OBNA 1X1BA 1BYIA 3IUNA 3I0ZA 5J12C 1ABEA 3TGLA 2OKCA 4LQCA 4BA8A 3GXBA 1NYRA 4V0MA 3PU6A 5D70H 3DE7X 5ADOL 2ATKB 4KZDL 5GZNC 4HNGA 5K59E 3GDOA 4G11A 4M7OA 4AMWA 2BM9A 3WWOA 3KM0A 3LAWA 4FDUA 1ID1A 4PZPA 5A9SB 3CFBA 1Y3DE 5KJ1A 1MHTA 1OWMA 3X1KA 1OCEA 4P38A 1IE4A 1D2EA 1NQ5A 4Q4EA 2VBGA 4GUQA 5CEFA 3L6FA 1MKFA 3VWJC 1S2LA 3P77B 3G6KA 3V2UA 1WTCA 2E7CA 4HUUA 3R0QA 4AKQA 3SE4A 1I1AD 1YFLA 2HV9A 3W8DA 2C4FU 5BR4A 5HYJE 1DN2A 1MV8A 1DJLA 2JA2A 1MREL 4QAJA 1RPZA 2VLJA 3LLMA 4HQRA 1F11A 4L22A 1U7OA 1U0LA 1EQ2A 4GYKA 2HT3D 1PZXA 2IDQA 5KAQG 5EWMB 3ILDA 2J9GA 3P2OA 4CU5A 4XVSL 4JM2F 4L4UA 4DDHA 1FO0L 4AL8C 4ZFZB 1R50A 4LYYA 2CR6A 3Q5OA 4I1IA 4ELDA 3SE4C 3QNWA 5AVXA 3FTXA 3PIQB 3SYAA 3TQCA 1SCBA 4AEIH 1WOMA 5FFFA 2ZKMX 5B3JE 3B3IA 3X1BA 3CPEA 3IVAA 1H5QA 4LQ4A 3JWNH 3LBYA 4W5JA 2RK3A 2YHIA 3TRDA 5JXIA 4HQLA 4K3DH 2WAXA 4FFLA 2YZGA 3AGWA 3MPOA 3RJZA 3QXHA 5BS0E 5KSAA 5ED0A 3RY5A 1U92A 2V4UA 4AZ3A 2GBGA 3FU3A 5D1ZB 1SVNA 3DVQX 1MO5A 2AXQA 1IAVA 5AJYA 3H13A 4YHIA 4O2FA 4EA7A 1N4AA 1NW5A 3QCTH 3O75A 3H04A 1NL3A 2A0LC 3LX4A 4O4HB 4RFLA 1I4FA 3SY6A 3VGEA 1WCWA 5KINB 4UIMA 4OBRA 1HYHA 3QHTC 4KN5A 3T3EA 4KKBC 1JZ7A 3L4UA 3AC0A 4A2PA 4GRLA 2G5CA 3AB0B 3SDCD 5CWSB 1I7SB 3L0OA 3AW5A 4PYJA 2QHRH 1KYDA 2DJ4A 3P30H 5D4IA 1V8DA 4DH2A 5BUPA 1H3GA 1WW2A 1CUCA 2CUZA 5T3ZD 2NNAB 3LQRA 4I18A 2O06A 2GXAA 1B6SA 2I2BA 5EU6B 4EY3A 4DG5A 5T1MB 3QU2A 4TLKA 4AQ1A 2KHAA 3QUXA 3TD9A 4KKRA 4NNOA 3CLRC 3NBKA 3SKVA 2H1HA 1BVZA 2Y36L 3NK3A 4FDWA 1NCWH 4JREC 2I3AA 3SKOA 3U4MA 3GRPA 3U6RA 4D92A 4JFFD 2I2WA 3UOAB 1TEVA 2QW8A 1AGCA 4AGQA 4HJGB 4A2GA 1ZUIA 1QZZA 1M83A 5JECA 3HZYB 4L18A 1QQAA 1FEZA 5ENZA 1ISFA 4NHCL 1PPIA 4TMFA 1XD0A 2MTBA 4DUGA 1A5ZA 3THYB 4MSUA 1YJDC 5YASA 1GY2A 1MFDL 2R0WL 2VDLB 3IFNL 1GWNA 5E6IA 3U7YL 4M1YA 4CKZA 1NY5A 2G0NA 3VQLA 4HXAL 4NFDA 1U3HA 3EGWA 1EO7A 4HNQA 2ZSAA 2X9GA 2CXGA 2Q8BL 3T77B 4CC4A 1ZIXA 3R3VA 4MTCA 2J4FA 4ICWA 1A3QA 1BG6A 2YMXH 4Z0XA 2PLNA 1Z9SB 3OM8A 4DP7X 1FP2A 5TE9A 2FRDA 4JZNA 3UC9A 4L5FH 3P2MA 2XWBA 1XXHB 3N9IA 2O8FB 2NT1A 3IXAA 3HVKA 3KXLA 1NKGA 1N59B 2VQUA 1NH6A 4FNOA 1WT5C 3P9MB 5BSHA 4I2XA 5I23A 3GCDA 5E9DB 2YWHA 3G49A 4IGBB 3G6JB 4E0RB 5HEKA 3FF8A 3C5WP 4P2OB 5DEOA 2X4TB 2A1TR 3EYQD 2FFHA 3NP3A 2O2SA 3S5LG 3VI4A 5LUMA 3JQEA 4PCTA 4HK3J 2J41A 4FYMA 4ZAKA 1WAMA 2ZTSA 1P7QB 2GETA 4RK5A 3Q01A 5J4VA 3NHAA 1EFXD 3E15A 2XYCA 3KQPA 2YRXA 4PZDA 4ZFZA 1Q9LB 4ZU3A 1VSCA 1HAWA 3QEMA 2G08A 4CODB 2JKYA 2ONJA 4AJ9A 2FF5A 3DVLA 4UQCA 1RZFL 1IVYA 4M98A 4UXHA 3UZVA 4JOSA 2PW2A 5JOFA 4XCFL 3D6JA 4GZ5A 3ZXAC 1MNAA 4LSVL 3TLGB 4E5XA 3OT5A 1Z26A 2XZQH 4XN9A 1UEIA 2PHZA 5T67A 3B2VL 4MEAA 2PRJA 3NJIA 4I9XA 1D9ZA 4TF4A 2HJHA 3W5CA 2IQ9L 1WRBA 3TH2T 5L4MA 2CC2A 3K6SB 4ODXA 3K53A 3LDAA 1QP0A 5LAPA 4K73A 2IXFA 2CK3A 1LWHA 1OWRM 4DESA 5GGRA 5EIAA 3W79A 2WP3T 5JHLL 1TF5A 4NRXA 1T0NA 5BS0A 2J46A 3D5EA 2CA4A 2YQGA 4NCXA 4KOEC 4FFTA 4KMRA 4LHXA 4HNHA 3C8DA 3TLZA 2W38A 5TTRA 3H1EA 4KHTH 3PPIA 4BNMA 3S4SB 4G43B 4RWHA 2LNDA 5HP4A 2ZB4A 3D3KA 2XTJA 1ZVKA 3ARGA 2DZEA 5IGXH 1QGED 3DHYA 1KOGA 4OLWL 2LGNA 4NOJA 1ORDA 1KCSH 1ZAKA 5IDXA 1CGYA 3R40A 4DRXB 1XB3A 2AEMA 1FE8L 3LKOB 3BB1A 4B73A 3DUSB 2DPHA 4YVNA 4DPCX 3LQAL 4ARSA 3SE3A 4KI0A 2DFNA 4XTRD 5BV1A 2QVIA 3THWB 5LR6A 1YZLA 3RJTA 1U31A 4ISBA 3FPFA 1CE1L 3ZVKA 5H9WA 4M43H 1UBJS 3MRJB 4KWUA 1DJXA 4NC9A 3OSVA 1P72A 1F8GA 3KBOA 4XE5B 4B17A 4CN1A 1U8CB 2FTAA 5L7TA 3UG6A 2YDYA 2G0AA 2WVJA 1LDMA 2FAXA 5EN4A 4A8HA 4QPEA 2QLMA 5JRJA 1LEGB 5L2JA 1R27A 1JQDA 4QAMB 5EN3A 4GU5A 4LZWA 5JNSA 4EQ2A 3PQDA 1NUGA 5EU6E 5DVZA 5JCOA 4B50A 3VPHA 1X80A 1FJGB 3IVGA 5EJGA 4YO0B 1EZUA 3MWDB 5IBRA 4TUJB 2CQVA 4N0FB 3VCLB 4XQGA 3VKWA 4OLYH 1I8MB 3CZGA 4OH7A 5BZXA 3QZNA 5LOVB 4FRWA 1ZMXA 4E41E 3QVKA 4Y1EA 3UK2A 3A4VA 3ZE9A 4UFNA 1Z6XA 3HVJA 1X6NA 1KFAL 4NHCH 4FTWA 5JTWA 1YASA 1YKGA 3RJQB 2DTSA 3H8SA 5JADA 2WKWA 1JHVA 2MTPA 1XZLA 2O3JA 4FQ2H 5LDDC 3MUGB 2ZR7A 5E9DD 1YCDA 4C7OB 3FWZA 1SXNA 1UXOA 3PR2B 1YU9A 4AYDC 3VWJA 1LY1A 4YCDA 5HYJD 1Y7HA 4ZJ9A 1XUOA 4XIIA 4CFSA 1DE0A 2CPUA 4Q66C 1ZESA 4GX1A 5IABA 2FUQA 4MQ6A 1MRFL 3AU9A 1KSFX 3AY4A 1K86A 4QYTA 3LMKA 1A4XA 3D0RA 1N67A 4WZ6A 2MINA 4OX9Y 2C61A 4Z0BL 1TQ2A 1ICEA 1CXLA 1P0MA 5EO9A 2CL0X 3AONB 2HWZH 5I18L 2VXQA 1BAFL 1RSZA 5B1SA 2W6IA 1UAAA 3JQ8B 4DEWA 3HAEH 2FX8L 2HDOA 5KNDA 2AWOA 2X13A 1N2EA 4IDBA 1Z82A 1ULAA 1NLZA 3FFCD 1RAAA 1IIRA 3MACH 4R3SB 3CRRA 5HHOE 1NCUA 5FOBA 5CEYA 4GRWB 1DP0A 1KTKE 3KS9A 3M17A 3EBAA 3I50H 1XFDA 4FD0A 2CLHB 3MLRL 4PD4K 1GYAA 1TCRA 4PGMA 1QUNB 1RZIB 3AP1A 1NW8A 5C07E 5J63A 4AIIA 2E75C 2C5BA 1IZ9A 5TF1H 5DVNA 2HD4A 3QXVA 2FLBT 2J3SA 4OATA 1BZ7A 5JPMA 4PJBE 2CJ3A 1TCVA 2PTHA 1ZJAA 2MEJB 4NN5B 1A82A 3SKUD 2E76C 3C2SA 2WTNA 2BGJA 4CMHB 3KJGA 5HVNA 1R5OA 3LPGA 3IDJA 3NH7L 4G9DB 4TLSA 2WXFA 1P45A 3BYZA 5JNRA 2KERA 3C5SA 1TUBA 3TOZA 3SJZA 4M6WA 3ZT5A 2ZIWB 4C07A 3JARB 3SHWA 1XR9B 2YXDA 1G20A 2Q5IA 2WXJA 1BVUA 3HZHA 3GRCA 1FRNA 1NU6A 2NN3C 2XDWA 3QZUA 4J07A 3BEOA 2JH9A 1IAOB 1I9GA 5JA8B 4RAOA 1PHRA 4XUGB 1IC7L 3VD9A 1Y89A 4QAWA 2GKGA 4EN3D 4BMYA 3IKJA 4F6RB 4L5JA 2V5YA 3N0PB 4I4TB 5FWXA 2DERA 1PL8A 3F9CA 2C7GA 2PYDA 4Q6WA 4HWEH 1MEOA 3QJOA 1YBHA 1GNRA 1EDZA 4A55A 3EOTL 1PKQB 2B3DA 4HPJB 4DR4B 3R0XA 1RPQA 1HETA 1CNMA 2XZZA 4HGOA 5T1KA 2WHYA 1HXHA 1V05A 3S8GB 1RUML 2VAMA 1N25A 1U3UA 4P58A 4OQXA 1X80B 3ZI0A 4DXAA 1DE4A 3BVNB 1I3RA 2Q3CA 5BO0D 4Q3LA 3QUGA 2K6YA 4IV8A 1DRVA 3BGMB 5B21A 4Z7QB 5SWZB 5C7XH 4KYVA 4IIGA 1T4KA 5MHTA 5IMSA 4G7VL 3RVWD 1Q57A 4JLVA 3FUDA 3HU3A 1L6ZA 2APBA 2X3YA 1N2SA 2QX6A 4UAJA 3MJCA 4TNWF 2E56A 2OD9A 4J9UE 2I1QA 2NT0A 4YHOH 5HGAA 4PPFA 4EH1A 5H35B 4H1HA 2Y5QA 3VFPA 1XTUA 2J20A 1XRRA 4IRJC 4F46A 3QEQB 1U8HB 4PNZA 2WLJA 2FUNB 1NCBL 1TVHB 4LX0A 6ADHA 4HWGA 4B5LA 1P6XA 3CE9A 4UJ5A 4R4BA 4MVYA 10MHA 1EEQA 2G6TA 1B16A 1U8QA 3JAWA 4Z3HA 1EESA 4U9IS 4PY7B 2C1PA 3UT5A 4PJHB 4D7BA 5CGYC 3DT9A 4AC4A 1PUXA 1AV6A 4FI8A 4B6EA 1UKEA 4LCCC 3OWXA 5EUMA 2Z2KA 4LC0A 1ZVQA 3NRCA 1U6AH 5LQBL 4NZMA 1R3HB 1Z3RA 3RK4A 5C81A 1MCKA 4M8KA 4DOMA 5GS1B 4ND3A 4HPXB 2WB1A 4EHDA 4KLNA 1SK9A 3TNLA 3OBAA 4XVJL 1CDBA 1CY0A 2IZ1A 5IJAA 5D6OA 5JR3A 3CVHH 2V96A 4QGBA 6LDHA 4Y7OC 5IVDA 1HXKA 3BGMA 3QSGA 3Q6FB 3M17B 2DR0A 5L4JA 5IJKA 3FMGA 4GBMA 5ICXA 2I66A 1TT5B 1ZHKA 3V0JA 5KU7A 4WCFA 1XZJA 3MQFA 5INCB 1DC4A 4QQKA 3T9EA 2E1PA 3MO1B 1A0QL 3QP3A 5DI3A 5K45A 4UM8B 1L5LA 4X4YB 4S1PA 2ZBQA 2JFBA 1Q84A 2GQHA 5LQNA 1C0LA 2WXRA 2XVLA 1G9ML 1UJ3B 3TFOA 3PL6D 2GCNA 4GKSB 3RVVC 3FD8A 3WR5A 4FEEA 4N68A 1YQQA 4C83A 1KBWA 1QHPA 3JZAA 4DMKA 1UPAA 2VSMB 3ILHA 5JIIA 3EXG1 3WVNA 4UT7L 4ZQKB 4JY6B 3ER8A 3T2NL 4HIPA 3O3CA 1P2VA 3GY0A 5BQFA 4LF3B 3OKAA 2UWEB 3RRYA 4NAVA 3DPIA 5ERYA 4I66A 1RZ3A 5IUJC 1N3IA 1HEYA 4ZZKA 4AZSA 2PBRA 4G9FA 2O5XL 5HVHC 1S78C 1KEUA 1JH8A 4M0KA 2ZT9C 1M7UA 4FAAB 1P29A 5I6DA 5DVMA 2TMDA 5F3HA 3QMPA 4JI3B 1X38A 1K4CB 1I94B 1N2BA 5IVXB 3W0WD 5TF1L 1GPAA 3MV8D 2GFIA 2UVFA 3UWDA 1HL8A 4XO8A 5J23A 5K8TA 1L5RA 3S5YA 3MRXA 2PN5A 5L3QB 4DMGA 2QZZA 4NDMB 5K1JA 3ZKMC 3PQ7A 2JGJA 3ZQ9A 4HN2A 1OP5K 3OG9A 2DL2A 1U9ZA 3I2YX 1P5HA 2CWRA 4AITA 5LXGH 2GT1A 3KPNB 3IB6A 2O0MA 3E9QA 5JZMA 2GAIA 3O1JC 4MVCA 4LQDA 3BGWA 1AXTL 5C08E 3O47A 5AVQA 4WFGE 9CGTA 2W6CX 5I1KL 2AN3A 1VF5C 4ACPA 3M6MD 4DVRH 4MCHA 1EVLA 3MNWA 1BDYA 3VH2A 4MYCA 1SDAB 1QFWM 2GI0A 4KGXA 4E14A 3PXUA 2EFEB 4OZFH 4CJ1A 3IXTB 3MNZA 1COWD 1X7GA 3ZYCA 2EIEA 4OXXA 2PMZA 5L8KB 5CP7B 4LE2A 4Z54A 4CTMA 1MNQA 1B2YA 3AFMA 3VTFA 4XGKA 2HLFD 1BDHA 5CUSH 2PGIA 1TVHA 3U4AA 3HR4A 3DARA 1UA7A 3CWQA 1Q1GA 4LGCA 4W9DC 4UBIA 2AQSA 3ETCA 5KYTA 1GOGA 4B6QA 3OAAD 2WFAA 1NANI 2PP7A 3V8PA 4OKIA 2BWJA 4JO5A 1N8ZB 2X77A 3L8GA 4PAWA 2X5JO 4IXWA 1NN0A 1Y9EA 1HXMB 5G1PA 3HHSB 2HQRA 4WNJA 2QAJA 2BJMH 3BFJA 3CFIC 1NQBA 1ZGZA 3ZI7A 4BK4A 2RH8A 4O08A 2DIAA 2XXFA 3RVSA 1OX4A 2ZI4A 3BMCA 3ZWCA 5DM60 1XIWC 2YOCA 1VPEA 3C3BA 5LQUA 2PPVA 2YXFA 3S8EA 3NEEA 1BN7A 3JWEA 5A3ID 3KJXA 3WIFB 1I2MA 4FQ1H 5F77A 1E6WA 2A73A 1XGRA 3CKYA 2JB5H 2R1WA 2V2TB 3KXKA 3UW3A 3DTVB 2IUUA 5I7UA 2HLAA 1NYTA 4PJGA 4MRAA 2BR3A 3TRFA 3ZL1A 1JEQB 4BO3A 1JNJA 4N3UA 4X7CC 4BEVA 5FLXA 1S3KL 2PS9A 4KUZL 4LZLA 5EEVA 2TSBA 2X4RB 1VEMA 4V0OA 3UJPA 4HAUA 3VFOB 5LZ9A 4FE3A 4PGBA 3U0PB 2KHZA 4N5MA 4HT3B 3VXTA 2V8OA 3UANA 4R71A 1KO8A 1QIEA 1QG6A 3L40A 3AG1B 1DCEA 2XVMA 2J25A 1RJFA 1RZGB 3WKPA 4K2AA 1Y6JA 1GZQA 4Y6RA 1Z3IX 1I3GH 4TZTA 1UM6H 4TSBL 5CSGA 3KPUA 1YC5A 4AO7A 5DBFA 5BPFA 4JG5A 4J76A 2BKXA 3WY2A 1TG8A 2WVHA 1NM5C 2UXTA 2YGOA 5AVTB 1B6RA 4P2QB 3HA3A 4MDIB 1Q44A 5D4JA 4UTBH 3O4GA 1RAEA 1C8QA 4E41A 1A2YB 3ENVA 1C5DA 2GHRA 2B34A 3P02A 1VLXA 4WY5A 4NH4A 3E6HA 3FTQA 3P30L 4IYKA 5BUQA 3Q6GL 1TMGE 1UBLS 3MRMA 5DD6A 4YC2C 3GU3A 4WZBA 1AQJA 2OV8A 4Q4HB 1DO2A 4OI2A 4PU0A 4F2EA 4IOJA 1C1HA 4U6XA 4TTIA 4J0CA 3NRJA 2J5XA 4GP7A 1UWVA 3ZDZF 3ZKWB 3GRYA 1TZKA 3OBIA 1JZTA 1X5XA 1WY7A 3DOFA 1PX0A 2IYAA 2Z9CA 1SBYA 4BX0A 4MULA 1WK0A 5AVUB 4J28A 2EWVA 1T1SA 1EZZA 1XSEA 3QIWA 1XTLA 3AXSA 1CRLA 4OJTA 5DS2A 1JFSA 4NPAA 2Q0XA 1JWMA 3QKRA 2O2IA 4P4SB 3GJSA 1MCHA 1TEYA 2IPXA 4HFJA 3VJ6B 3SDCA 4H0NA 3FQ2A 2DFVA 3DXXA 2G1KA 5KOJB 5P8WA 2D6FA 2WUCH 3OLDA 5BSVA 5EJ4A 2G07A 3DE3X 1IGYA 3LY9A 4JXJA 3DPUA 3OKPA 2DWDB 3QF7A 4ENPA 2NQ3A 2YD0A 3JZIA 2PRZA 2D9CA 3U0VA 1T83A 5CLIA 2J4DA 4Q39A 3FBWA 4Q47A 5JHGB 4J2OA 4C4PA 4ZEWA 4O9HH 4RZ3A 5F78A 1T0PB 4KREA 5ALCH 2C4UA 2EDCA 3MUOA 3QMVA 4CTJA 4JODA 2Z93A 1J18A 3P0VH 4CMGA 3NBAA 5DHRA 5FTNA 1AHKA 1KEGL 1KJNA 2R97A 3O6VA 3SQMA 2IS6A 4NJEA 2ZCHH 3N41F 4BNHA 3GK8H 4D82A 1CY6A 3ECUA 5FYKH 2AKRA 3WLWC 3FOWA 4MA4A 1ZCFA 4M3JA 3PCRB 4N8CH 4Q0XH 2D62A 3UBXB 1E3IA 2B6HA 3VX3A 1C7TA 4QO1A 1N0LA 2NXZD 4N5NA 4UDTB 1XPJA 4PR5B 2OE2A 4MKZA 1SC3A 4GPAA 2VYND 1GTZA 2J6EH 1U0GA 1UWXH 4Y6GB 1YFZA 5DJYA 1U1CA 1HY3A 3UWKA 1UH4A 2AXGB 1EAOA 4FFMA 4CLOB 4IRZH 2ZWYA 3PXHA 2FPXA 2XCQA 4KO5A 3T15A 4WNAA 5AR1A 2M6SA 3AI7A 1SCDA 3RKUA 3H83A 5EP4A 4PJGE 1XAKA 1FDLH 2MSKA 5GS1C 3CG8A 1ARZA 4ANKA 2YTZA 2D0GA 2X7HA 5I7SA 2FGWL 2BGNA 1JDSA 2AVNA 4KUEA 3E2HB 2KLRA 3RC2A 5D2NA 2FP4B 1IN8A 5AVYA 1KLFB 1IN4A 3TTWA 1C7RA 2DEWX 3KUDA 4N6QA 3VOAA 3ROEA 1HNGA 3LRSA 4ZUVA 4OQYA 1FGVH 2D7MA 5A7FA 4YVUA 2OM5A 4LE1A 1J07A 4TL6A 5CLYA 2OP4H 1BA3A 4D0GA 2H17A 3O8NA 3HYTA 3UTTB 2YN3A 1WLYA 1PNQA 4X8HA 1VSUA 2VSFA 5ICZA 4WUVA 4IFEA 4ZVPA 4EKNB 2YVUA 1KI1A 3ARZA 3ZD8A 1Q74A 3JD2A 1KJWA 2V0GA 3R4DA 5D55A 3EYOB 3S3CB 2VHUA 3JTTA 3GLHB 1T2VA 5J3HD 2P6RA 1OXSC 3AEXA 5ICSA 1KY5A 3DMRA 1JNYA 4MCJA 4A0RA 4M99A 4NKOA 3RYMA 4ZW5A 3PD1A 3NX4A 5JI2E 3QI9B 4OFXA 5JOFB 1VG1A 4BAUA 3A58B 1FSKB 3MCG1 3QEAZ 2OS7A 1EZVX 5ID1B 1WO8A 4KO1S 5KQPA 4RCVA 5JATA 3FI9A 4TVPD 3GX1A 4TLAA 1AD0B 4OMCA 4Y16C 1ICTA 1VPWA 4M1SA 2NY0C 5JUEL 4BQSA 3QXAA 4NUJB 4EEKA 2H06A 4QWWA 3G2QA 4NYMQ 2NZWA 2DIBA 4PJIA 1MJ8L 4IKKA 5AVJA 3TS1A 3FPSA 5DWUL 2OKGA 4DMUB 2MR6A 2ALAA 2ZCLH 5KTPA 3MTGA 3MTAA 5FGBA 1Q22A 4FC7A 3O0DA 3BK1A 3GZJA 2Y7QA 5I1EH 3PNMA 2IV3A 4EZLA 4HCGA 2BW4A 3NIDB 4HTAA 1SQ5A 2HLNA 2H32B 3KPLB 5IDYA 3E5RA 1RKRA 1YDEA 5KDOA 4E2FA 1GDTA 2EDAA 4PRPD 2UYOA 2JKSA 3CDFA 5JOPE 2ZJ2A 4CF4A 1Y0LB 2HU7A 5JO9A 1HHJA 4PCSA 5AIBA 3KR3H 1T1IA 1FFOA 1NLYA 3CCHA 1R5WA 1UP4A 2IZZA 1X87A 2QRJA 2GEBA 1EP2B 3DTDA 5H37G 4FCWA 3AKDA 3Q8BA 5MI0B 4Z5XA 1QPGA 1K4CA 1X5HA 1E96A 1X0XA 4MQEB 1XEAA 1HYBA 3MX0B 1PIWA