4I1PA

Human malt1 (caspase-ig3) in complex with activity based-probe
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
379
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Activity-Based Probes for Detection of Active MALT1 Paracaspase in Immune Cells and Lymphomas.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 379
sequence length 379
chains with identical sequence C
ec nomenclature ec 3.4.22.-:
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4i1pA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i1pA01
1KMCA 2AR9A 1RWVA 4ZVQA 3GJSA 2CDRA 4AWBA 4N6NA 1K86A 3K7EA 4JJ8A 4QUJA 1PAUA 2J30A 4N5DA 4NOMA 3H1PA 4QTYA 4QUAA 2C2OA 1RHMA 3IBFA 4QU9A 4QUGA 4EHNA 1QTNA 3P45A 1RWXA 4N7MA 2H48A 3IBCA 4QUDA 5H0IA 3PCXA 3QNWA 1SHLA 3KJQA 5LUAA 3R6LA 4QTXA 3GJTA 3RJMA 4I1PA 3D6MA 1RHRA 1I4OA 3KJFA 4NBNA 4FDLA 4QU8A 3UO8B 2P2CA 4N6GA 4JR2A 2QL7A 3KJNA 2XYHA 4QU5A 1F9EA 4N7JA 2H4WA 2CJXA 4HQRA 5IABA 4JQYA 4PRYA 4HQ0A 2DKOA 3H11B 4PRZA 4QUHA 2CNOA 3DEIA 1GQFA 2FQQA 2H65A 3NKFA 4EHAA 1M72A 3S8EA 2XZDA 4FXOA 4EHFA 4JB8A 4LSZA 5IBPA 4QUEA 4ZVUA 4EJFA 3V6MA 1RE1A 3PD0A 5IAGA 4D3XA 1CVRA 2H5JA 1PYOA 4JR1A 4EHHA 3H0EA 3R6GA 1RWPA 3NR2A 3SIRA 4IYRA 2H51A 1SHJA 1RWKA 4PS1A 2H54A 3V4OA 5IANA 5I9BA 4EHKA 4IEFB 4NOKA 4ZVRA 5IAEA 2FUNB 2J31A 2H4YA 2QL9A 4DCPA 2C2KA 2C2ZA 1RHKA 4HVAA 3R5KA 4DCOA 4D3ZA 1RWWA 4NBLA 5IBCA 2J33A 5LU9A 1F1JA 1RHUA 2J32A 4NOLA 5IC4A 4FGUA 2XYPA 4QU0A 4ZVOA 2WDPA 3EDQA 1SC4A 1SC3A 4QUBA 3BIJA 2CJYA 4QULA 5I9TA 4QUIA 1RHQA 2H5IA 4AWAA 1RWOA 2HBYA 1IBCA 3V55A 2Y0BA 5IAJA 3ITNA 3GJQA 4JR0A 4AW9A 1CP3A 1I51A 1ICEA 2CNNA 5LU8A 4JQZA 3SIPA 1BMQA 1GFWA 1QDUA 3V4LA 1RWMA 2NN3C 3E4CA 2C1EA 3P4UA 3R5JA 5IAKA 1I3OA 3DEKA 2HBQA 2FP3A 3GJRA 2C2MA 2HBRA 1NMSA 3R7NA 4EHDA 3OD5A 1NMEA 2Y1LA 1NW9B 2XZTA 3UOAB 1SC1A 1JXQA 2HBZA 2XYGA 3D6FA 3H13A 5K20A 4FEAA 1I4EB 4ZVSA 4NBKA 3V3KA 3H11A 4EHLA 2CNKA 3NS7A 5IC6A 2CNLA 3DEHA 4ZVTA 2QLJA 2QLFA 4M9RA 4N6OA 5JFTA 3D6HA 1RHJA 1NMQA 1K88A 4PS0A 4DCJA 3R7SA 5IARA 4I1RA 4ZVPA 5LUBA 4JJEA 2QL5A 4D3YA 1RWNA 2K7ZA 5IASA 5IBRA 3R7BA 3S70A 4NOJA 3EDRA 2QLBA 3PD1A 3V6LA 4JJ7A 1QX3A 3DEJA
chains in the Genus database with same CATH superfamily
1YDFA 3OQ3B 5IT2L 2X8AA 1Z9PA 4QYWA 3ZWNA 4KFMA 3R19A 1W1WA 3MCAA 4OLUH 1RPUA 2FKAA 2NCEA 1BBDH 5GP1A 4H2CA 3MOSA 3OTOB 3QEQB 3W3AD 1J5CA 3QU7A 2WU0A 3UV7A 3NPAA 4TWJA 1GAEO 3SJVD 2JJSA 4YUAA 2VDQL 1Y1QA 5A2LH 3CBRA 2F9FA 5JT1A 1NIFA 2IL1A 1X8XA 2MKWA 4YV1A 2ZQYA 4GICA 3T7SA 3SGKC 1E2NA 4ZFOB 2G83A 5I47A 3A9WA 1PVVA 2BMKA 4NO3A 4F5DA 1J8HB 2NV6A 4PLPA 4XR9A 3EXHC 3KX2A 4TLKA 3H9ZA 2R0LH 4HK0A 3AB8A 3WMWA 3GLTA 3AYZB 1ZVHA 4IMKC 3F5WB 1ACMA 1AQYA 3WGOA 1M56B 3KS0H 4CAGA 3NTLA 1GJRA 4UU1A 2X0WA 2ETWA 1A3CA 3O3MB 4HU2A 2F5BL 3WSWA 1EUUA 3LH2L 3AR6A 1BZ7B 3RKDC 2AJZA 1P1HA 1X86B 1R3HA 3JTEA 4PGDB 1JB9A 2CZCA 1FVFA 4M8VA 3AILA 4NARA 1HJBC 2W8BB 3H9UA 4I77H 1GZQB 5D3ZA 1Q8MA 3WK9A 1L8LA 1OCCB 5BSFA 4WINA 4Y6QA 3OD5A 1I3KA 3GNQA 4OHYA 4M49A 3QPBA 1HDOA 2SKEA 4ELME 1PF3A 4Z9XA 1YH3A 5E4FA 3VPDA 1S1MA 1U99A 4L4SA 1JF5A 2AV6A 2GWHA 1QPKA 3HTLX 5D7JD 1FFXB 1ULZA 4WY7H 3X14A 1YBFA 3OAZH 4G2AA 4JS0A 1TTFA 1SC9A 3K35A 4MJIE 4XCYB 3I2JA 4LGRB 2NW2A 5CHNB 3PE6A 2ORBL 3W9DA 1J42A 2GSIB 2Q6LA 2OESA 3BP6A 3P45A 3MLPA 4JT2A 5SWZE 2W48A 2EYTB 3BRDA 3P0EA 2CE2X 3MA7A 1E4VA 4F33B 3Q0EA 4M61A 4TNVK 3SQBA 5K0ZA 5EIIA 4G86A 1KULA 4TF4A 1IY0A 4IMLB 5LP1A 3RDJA 5D4QA 1OHHA 3H0EA 4LXTA 1A1MA 3DX8B 4Y98A 1E5VA 2GZSA 2B99A 4XN7A 3OB0H 4O5OA 2PMWB 1OP3K 4JFQA 3PHCA 2UWEF 1TVBB 2IE8A 2X76A 3PWPD 3JSAA 3LIIA 1VJRA 4R01A 1E99A 4Y67A 2FG6C 3PGCA 1EXUA 4UUJB 1RHUA 4RHEA 1WW3A 5DRXA 4HF5H 4QUIA 3WLJA 3TZVC 1A04A 1KIRB 2BNRE 1GTNA 2DAPA 4XZ3A 3N0WA 4F5ZA 6PAZA 5ALCL 5E2WH 3PLAE 4OFYD 1VQ1A 3CJJA 3FCYA 4YXLL 3EJTA 3VH8B 4ATWA 2M2DA 1IGCL 5CSZB 2BSAA 3D8TA 4E22A 4KXCA 1MCKA 2F7PA 1YAZA 2XCMC 3D4IA 4BBJA 1W0WA 1J5OH 4Z7WA 1QP7A 1FSKC 4EG6A 2WU4A 5F9AC 2C88A 1JE6A 4QG7A 3V34A 3ENKA 4X45A 2FK8A 1VPWA 3EUUA 1ZOIA 1OE0A 1IY9A 2HPZA 3CLUC 1CS0A 5BW7C 3LHKA 3PQ6A 5CM8B 4AT1A 3I4CA 3IMBA 4F8NA 2QAGB 3CEMA 4H0HB 3GXBA 1E40A 2J9YB 3G7UA 4NYJR 3F12A 2SECE 3HVKA 3NZHL 4ZTPL 4MA3B 1MI5E 1SQ0A 5K3FB 4IBUA 4KP7A 3RZCD 1S9VB 4K23L 4P2AA 4M89A 4ZQEA 1AQDA 4EMBA 5JXIA 1DSYA 5I7SA 4REQB 1V2HE 3P2DA 1XU9A 1KEZA 3O3UN 4MH0R 4DWHA 4CM9D 3HZMB 4Z78A 2BZ1A 1JZTA 2V4MA 1HE4A 1DLFH 4G9FB 2HCBA 3OA2A 3V6OE 3AQIA 4X7TA 1HK6A 4LXHA 1NN1A 2B4AA 4L8VA 4HKZB 1XDZA 3G02A 2VB5A 3V1KA 1RM5A 2J71A 2FFAA 4PGMA 4YPGB 3TBFA 1IMOA 5KREA 1M6VB 3TRKA 2WYWA 4E5MA 3FU0A 4BNLA 1KPRB 2CYCA 5IFLA 4FX2A 3NIGF 3PGA1 2ORIA 3ECVA 1LS1A 5BUPA 3ZGVA 4QJBA 4TVPD 4WW2F 4URHA 1MPTA 1YQVH 3ZWMA 3TCKA 3VSEA 4XMUA 4QM7A 5GGSA 1DN0A 1FJGB 3I05A 3SOZA 1RYBA 1U3WA 3DROB 1NC4D 2VXBA 3WVNA 1YEKL 1U2RA 4NGHH 4ASUA 3MJ8B 1KFEB 2HU2A 3P9MB 4BN0A 1O97D 3QJVB 3U9UB 4B97A 4OQTL 4ZQTA 2BEUA 5K0CA 1YDPA 5EHNA 2X0EA 5C0DA 2FH5B 2P3QA 1ELOA 4B5KA 5AW8A 4DJMA 4FDLA 4CT4B 2E4TA 3DPBA 1T5IA 1XJCA 2RGWA 2GB4A 3X0DA 4ED9A 5DZAA 4TS3A 4DQVA 4P49A 1X7XB 3DARA 4JO1L 4O4JB 4X99B 3IS0X 4ZZIA 2NUTA 1ND0B 3G2MA 1YC5A 3F04A 3WGMA 3MXOA 2JKXA 4G7RB 1I8IA 2R3SA 3P3TA 5HD8D 3QHFL 2AXGB 1NCCL 5IDQA 3IA7A 3HAEA 3RY5A 5T3ZE 5K93A 5EHQA 5AKHA 5IJAA 1XVVA 3GJEB 4NCC2 4KKZA 4XXHA 3NA4A 5AVRA 4KR6A 3G82C 3SZRA 5B58C 2B8NA 2H4EA 4YSSA 5HHQA 2QLTA 3ASZA 4X7CC 4IBZA 4PJGA 5I7UA 2DHEA 3MRGB 1A97A 3CG4A 3A14A 2XQKA 2PRKA 3D2AA 4LCEA 3C43A 3C6SA 4I9GA 3OQHA 3O83A 2WD8A 2NYUA 2AI0L 4JFFD 2NPLX 4FOLA 721PA 2JASA 4I3HA 1J8KA 2PCXA 4V0OA 2D7QA 3KO8A 1R12A 2EW8A 2EE0A 3FQWA 3NHPA 1OB1A 3RHFA 3MXVL 5CSGA 2BFEB 4LHZA 1YEFL 2GHIA 3L18A 3GS4A 1GU0A 4GUOA 3EWSA 3I9NA 3F8SA 3WFEL 1QO3A 5EZOH 4QFCA 4QRRA 3GGOA 2PYEB 1OBHA 2A59A 3BFWA 2O0HA 3FUDA 1LCIA 2RH5A 4YAGA 1EXWA 3V4PA 3Q06A 4HTFB 4JNKA 1MCCA 1H85A 3G1WA 4KQFA 4MWZA 3VVVA 3DOJA 1PG7H 3B7UX 5KSWB 3EBOA 2BSBA 1JIQA 5DNDA 3S6JA 3GXUB 3E23A 1OL0A 4QBTA 4LL4A 2GXQA 2QLYA 1OWOA 3KQHA 4QHTA 4PZYA 5FL7A 3LRSB 3QEQA 1Y80A 3CRNA 1XZIA 4GBXC 2Y0CA 4DP5X 4QOSA 3WJAA 3ZD6A 3F1LA 3GRWL 2C3UA 1CGTA 4IS2A 3DJTA 4FZ8L 2BP5M 2FUTA 1ZLYA 4ZFOA 1TO5A 2FN4A 1AR1C 3D9AL 1J8HA 3NYQA 3CZLA 4JN6B 2M26A 1XEWX 2IZOA 3L5XH 1T1EA 1NSTA 3F5WA 3FHEA 4RISL 2P2SA 4FU0A 1L3IA 1HHJB 1BZ7A 2NYKA 3CSTA 3AY3A 4KGVA 3UYLA 2Q7XA 3TFQA 4PGDA 2Q8BH 4I5EA 2W8BA 1U95B 1GY8A 1GZQA 4MNQE 1COWD 2VF7A 1GN8A 3SE8L 4EN3D 1E1CB 1Q0ZA 4U1HB 4ZT5A 3ZW3A 1HTBA 5JISA 2ZG2A 1ZBDA 3AM3A 4FVTA 5D1QC 5AKYA 3IAUA 2X1OA 1L3NA 2RGNC 2HJHA 4XVJH 2VXYA 2RHJA 2G5BB 1FFXA 1QI4A 1PW3A 5H70A 1E7WA 3HKZA 3HUTA 2FWLB 4GAYB 1QFWL 3V8OA 1YCHA 3DV0B 2H29A 2OFXA 4XCYA 2X6TA 2J3EA 3K16A 5CHNA 4WZAE 4LDNA 3HVHA 1Z4LA 2GSIA 1BVOA 1RUPL 1KYZA 1KB3A 4GZLA 5H9VA 5KS2A 1OCEA 1URZA 2QVKA 4KKBD 2EYTA 5FOTA 1Y7PA 2ZR7A 3LVBA 1XO1A 1NCBL 1KNQA 2AJLI 4KQXA 4WKPA 4WNQA 4F33A 1BREA 1NW9B 1IARB 2ZRJA 5E6UB 4F9EA 2OMNA 3AG1B 1BVLB 5CA0F 3DGEC 2PD4A 4IMLA 5D2NB 3UTTB 4YV7A 4MKXA 5J9PB 3KLNA 2B2XH 4AC2A 1WSBA 3PQYD 3DX8A 5L7YA 5JZVA 4ZRDA 3DZHA 1S8NA 5BMOA 1XMVA 1TVBA 1JHMA 3TV3H 3T0ED 1G8SA 1SHZA 4U0RC 4NYIQ 2ICWB 5JG7A 4BBPA 4UUJA 1M73E 4KWCA 4OXNA 5BR8B 1MO2A 4N2EA 5JZ9A 3QNZB 2Z2IA 1KIRA 1AHWB 1YQEA 1G9XA 2DQZA 3BVVA 1KB5B 4XOCA 1NWPA 1FMJA 3F6EX 1JL8A 4J8RB 3RWHB 4N76A 3QUCA 2VLIA 5K6TA 1MCQA 3VH8A 2XZAL 3UAVA 4ZZ3A 1SN7A 4WN3A 3QQ3B 5CSZA 3MAGA 3OAUH 3D4GA 1GTFA 1COZA 3C3MA 5B6JA 3DJFA 4J94A 1DBJL 5TJHA 2F9LA 1W29A 2OFWA 4GKVA 4DZTA 5JARA 5JXWA 2P2GA 4R81A 3EF7A 2R7LA 5DJCB 4C4BA 1OPXA 4GZ5A 3PNYA 3BD9A 1E7YA 4JHUA 2QAGA 3HDHA 1D5BB 1U7UA 3TG2A 2ZPTX 4EI2A 2CR6A 4JPWH 1WY5A 4GNRA 4MA3A 5E5LA 3A9CA 5K3FA 1MIML 1MQKL 3BB1A 1T8SA 1S9VA 2IV8A 1E9EA 1YZYA 4CBZA 2Y1GA 4FM9A 4WCYH 4P48A 4REQA 4GKBA 5A02A 3W1EA 3DAFA 3F4BA 1N25A 4TLMB 3HZMA 3VI3E 5M7EA 3GEEA 4XCEB 4G9FA 1AKEA 5TQ0B 1IBKB 3GO1L 5DS8B 2PUQT 4W7IA 3H83A 2BNUB 2VYND 3GSUB 3SMQA 3HZRA 5IFHL 4HKZA 1SVMA 4YH1A 1BWQA 4YPGA 1S4QA 1M6VA 4L0CA 1NJ6A 4DB2A 2IYSA 3Q40A 4JGJA 1KPRA 1CDUA 4AQAB 4MX7B 3WLWC 3MLXL 2ATAA 4QUHA 2WTBA 2E87A 4KITB 4JH0A 3QXTA 3RY6A 4BVLA 1PE0A 1N2OA 1TQHA 4WE3A 5AYVA 2YH2A 4OZFH 1GJUA 4RTPA 4XVUA 4WLCA 4GBMA 3AF0A 3W5BA 3DROA 5HR5A 2INGX 3E9CA 3GGCA 3MJ8A 1DBAL 3CVIL 1ILWA 4TV8B 3P9MA 1B73A 3QU4A 3MJRA 1THAA 1LEIB 3B56A 4A16A 3U9UA 1ZVSB 1IXKA 2H5IA 3JQDA 2C9YA 3HC0B 3ZGXA 4P4KD 1X1BA 5EMYA 4EA6A 5CMAB 3FCGA 1N5LA 3DEKA 3SEAA 1NM4A 2W80C 2EJUA 2QFPA 3EASA 4N0UB 1X5HA 1GNRA 4AJ2A 3FU8A 3DJ9A 1RQ7A 1OT1A 2FAUA 4G5FA 4HK4A 2OCBA 2DERA 1X7XA 3O3AB 3S34L 1GVHA 4O4JA 5JDCA 1OI3A 5L9AA 2FE4A 4X99A 3L0CA 3DE5X 1ND0A 1UPTA 3EIQA 3FZNA 3QLJA 4N25A 4UTAH 4NZZA 2LQRA 4WFHE 3JQ6A 3F7RA 5I8WA 4KO5A 3QJSB 5KBNC 2NZ2A 3LOPA 5IZ4A 2AXGA 2WHPB 3OLZA 4RH1A 1JPJA 5E08L 1K6MA 5BRAA 3OLDA 2UZXB 3GJEA 5G2NA 3UPAA 5JDSB 1QDLB 1DQDH 3T3MB 1TVMA 1RYDA 5ED4A 4PFSA 3RAJL 3O2NA 2F54B 5TV2A 5I74B 1C7SA 3KB1A 1YUNA 1W5EA 2NO6A 4MV7A 3VSUA 3ZJTA 3MRGA 3KR9A 1VMKA 4Y2RA 2I33A 2W6CX 3LPGA 1AKJD 2CXQA 4B9JA 2AABL 4GQRA 3E5HA 3DX6B 3A4IA 1Q95A 3KD3A 1BYNA 1OC4A 2ODTX 1W4LA 2V5SA 3LX9A 1L4GA 2DQJL 1HYHA 5CZXC 3AQDA 25C8L 3O8XD 3EZ6A 1UADC 3I85A 1NW7A 1I3MA 3MS7A 4BRJA 4RZHA 1CP2A 3UMGA 5DT1L 5JANA 3H5LA 1Z17A 1JDSA 2BFEA 4P7KA 5DZVA 1EBFA 3MTRA 2ODPA 3IA2A 2COEA 3UK6A 2OPHA 5K1ZA 1SOWA 3ZY5A 4JI0B 1J70A 1QJCA 2FFRA 1QE5A 2PYEA 1VKXB 4IOKA 1TQCB 5IT0A 4KREA 3BM5A 2UXDB 5CN2A 2YN2A 4PJ9D 4R3NA 5DYOB 4DP9X 3NRCA 1P4BL 3U7WL 3BH4A 1DAPA 4NBZB 4K94H 3UPCA 5AI4A 2JK0A 4HTFA 2NY3D 2CL5A 2XB6A 1AK9A 1OXBB 4YS6A 2GUGA 4JLOA 2AQKA 4MDIA 1XCMA 1VKNA 3VR3A 3SO3C 4K8RC 3OFSA 2ZOUA 3LRSA 4NZFA 4XAKE 1EDQA 4RAVB 3RX8A 2XEXA 4YE4H 3E18A 3ZT5A 4C56D 5KAQG 5FEUA 3NBXX 4P05A 4XTRC 2BSRB 3PAVA 2UV8A 4Y9UA 2ZI4A 1B0RB 4D57A 4HLQB 4HMCA 2WA2A 3V6ZB 5TQ2H 4Y1TA 2FNWA 3E05A 5G53C 4QDXA 3SI7A 2QA5A 1CK4A 1GA1A 2YQBA 4ZAYA 2G5TA 1PYWB 4PJ5D 2R4QA 2ZUSA 4R0NA 1HHJA 1T1RA 3ABOB 4QLWA 3WFBH 3GBDA 2YOFA 2FSDA 3H56A 4PGEB 1U33A 1U95A 1PJTA 2Q4RA 3LKZA 4AKGA 4DEWA 3NCJL 3BQUD 3SHVA 4DG8A 1E1CA 5AW7B 4U1HA 3CQQA 1K8ZB 4XRRA 5J4LA 4Y88A 1MCWM 2IY9A 1U1GA 4WPGA 3ZBUA 1CZRA 3H3FA 2O2SA 2CGRL 1C16B 2G5BA 1DFXA 3OI7A 1GSKA 1Q1QA 1LLFA 4XIJA 4GAYA 4KI7A 3DV0A 4BQNA 2E47A 3WJ2A 2O1AA 1L5SA 3ORSA 2GK7A 4PY7B 3QNWA 3CF6R 3TCNA 4QDKA 5B4UA 4GEIA 4OF3A 2D3TA 5C08D 5KX5F 1W96A 4DSUA 1GYCA 3AJEA 1U0JA 4J6RH 1H2XA 1V7ML 1GRRA 3NZ8B 4KJZA 5EH1A 1FXSA 4AL4A 3KYKH 1U02A 3LQ2A 2GZ1A 1W15A 1P5FA 4R1QA 3B34A 3HVJA 5E6UA 2P4AB 5F7UA 1BVLA 2BFGA 3MRMB 4KV7A 5JOPD 4FYYA 4K3EH 1BYOA 3NR2A 3VISA 2HVJB 3M6FA 4AK2A 2MHAB 5D2NA 3UTTA 2QR5A 4NEHB 5J9PA 2I4OA 4NUMA 3RC7A 4MP6A 3DOCA 3QZWB 3ZWWA 5CFPA 2X6RA 4W93A 3KZMA 1CB4A 3IP1A 1GM5A 4OUOA 1NIEA 2AMUA 4IRJD 1PG7W 2ICWA 4GZMA 3R0VA 4HYQA 2NY2D 5K0FA 2GHQA 1KQOA 4Z7UB 4YUEL 2FE1A 3QNZA 1NZRA 5AICA 3V4LA 1U81A 3SM9A 1I36A 1AHWA 4LV6A 1RKRA 1KB5A 5FCUH 2CXHA 3ESMA 1Q0RA 5HI4C 5E1MA 5KQPA 4J8RA 3RWHA 3ARPA 4KFUA 3FKSD 4PJIE 2ZT5A 2NCMA 5ENWB 1CV2A 1QM5A 1RJYB 3IBYA 3QFCA 4JLAA 3QQ3A 1H3FA 3QNMA 1MHEB 3K6JA 4RGYA 4AZ3B 4FJ6A 1G9NC 1XMSA 3M6WA 1ONQB 1E5QA 5C0OE 4G11A 4KNSA 2FLMA 3A4DA 3OJDB 2A14A 4BO0A 2W9DH 4MP8A 2NX5E 3AY4A 1NXVA 3N1GC 5DJCA 3A24A 2XQYA 2QL7A 4JZKA 4U7WA 5L4SA 3L41A 1VMAA 12E8L 1D8TA 1D5BA 4JPKL 1DEEB 4OVUA 4U3SB 5D2LE 4ZOLF 5I1JH 2EJVA 4Y8VA 3BXNB 4F97A 4OVVA 5KYGA 3ZKWB 4Z0BH 3UG7A 4A10A 3S37H 4EZIA 1GA2A 1DUIA 3DECA 4IU3B 5FQNA 4BO7A 2GHZA 2FZ3B 2XWSA 3K0FB 1XLTA 4NIYE 5KTMA 2DKNA 4XCEA 2PS3A 4TL9A 5TQ0A 2Y06L 5DS8A 1U5BB 1M7UA 1DC6A 1TRKA 4ZAGA 1XELA 3EDQA 3KJEA 2F8TA 3QUKB 1O4WA 2BNUA 4M1CC 5IQ7L 4A1FA 3GSUA 3ET4A 2O3SA 4TT3D 1RJFA 1VE1A 3DTVD 1DPFA 4DCSA 4C57C 1OGJA 4EELA 1X7HA 4D9RE 3H6HA 1XG5A 4J43A 4AQOA 1DJQA 1ZIPA 2JCCB 5DVPA 2ZYWX 3NIBA 3LIZL 5E8DL 4G1CA 4AQAA 4N2GA 4XC1L 4MX7A 5CM9C 4A2GA 4IAOA 3TLMA 1A7AA 5D5ME 5H3CA 2L7JA 4XTCS 1E9VA 3BRCA 3OCVA 3DKHA 1CUCA 4WHCA 2QTAA 3UWPA 1L4IA 3P9KA 2QTBA 5D3MB 5HCIA 15C8H 2R11A 3AMVA 3SD5A 1QNLA 3G9AB 1L9TA 5IJKC 4RHTA 1KKLA 4TV8A 4QYSA 5DTJA 4ODHL 3AHCA 1MH5B 2JEOA 1LEIA 4J0IA 1ZVSA 1XYVA 3M1IA 4RNRB 1XGZA 2AMGA 3HC0A 1LDYA 3W5NA 4PH8A 1SU4A 4Q3EA 3Q6GL 3JTMA 1DVFC 1LWOA 3HSYA 4DUVA 2YPKB 5EJ5A 5CMAA 4HXAL 2KHZA 1N34B 2OILA 3RSHA 4N0UA 3C1OA 1KGCD 4U3JB 1W6RA 4YALA 5CH5A 4X54A 5DSZA 4DJJA 4PRHD 2KBFA 1QGDA 2R66A 4JCLA 3O3AA 3I6SA 1E2UA 1S78D 2EDQA 3RKPA 3FVVA 3LBHA 4S1SH 5D1XC 3MJ4A 4WUKH 3STTA 3U4HA 4AJJA 3M3HA 3CEJA 3OLEA 3R20A 2V96A 3PC8A 1E2GA 4DAGH 1C3JA 4NU0A 1MZZA 4QUBA 3FH5A 2WHPA 4UDNA 5TE4L 5IT5A 3WMPA 2OXFA 2UZXA 5E9DD 5JDSA 4QHYA 3COPA 2K2WA 1FTSA 1DSFH 1XGRB 4YEEA 5DM2A 4ONEA 4JBXA 1MRFH 2F54A 3LD8C 2HWXA 1H8SA 4P9MH 1DXQA 1JDZA 3SKJH 1JHKH 5TDNB 4RQAA 2H2PD 1QP1A 3PHHA 2C9RA 1DVRA 3ESAA 3LKDA 1CCZA 4WTZA 3TT1L 3A22A 1MVYA 3PUHA 1J0KA 3UJJL 3DX6A 4DVRH 3HA7A 2JHAA 4HC4A 3NAMA 1J90A 4PLYA 5JFGA 4JKYA 4JJ8A 2FEJA 4PJ8B 1Q38A 3G49A 1YI0A 4JUBA 3N8HA 3GPEA 1A6UH 4JFDE 4AYDC 3EWIA 1WLSA 1NGSA 5BPPA 4JUCA 1E4KC 3ZWDA 3QFDB 4N5HX 3QJFB 5EJMA 1CDIA 1S5IL 4XHJD 1EGHA 2DJIA 1XCXA 1VKXA 3TZQA 3C6MA 4BNFA 2ZAGA 4F1ZA 1CRLA 3PXJA 3LO8A 4ZAVA 5DYOA 1L5YA 5GS2D 4BV8A 1QZ3A 2H4YA 1L7IH 3FU9A 5LP6F 2EVFA 5JI3E 3F83A 3RNKB 3WN5B 5T8IA 1CXFA 1AZCA 5LBSL 3OLIA 4MYDA 4CIVA 4HIIB 1NDGB 1GGIH 4X0KB 1PSZA 1RWOA 3CJRA 5KMGB 2FZWA 4ZARA 5CT9A 3MT7A 3GLFE 1FX0B 4X24A 1CFVH 5AAWA 3ONFA 4ZQFA 3CZRA 3R5JA 1LO3L 1RZFH 2NY0D 3A6CL 1QLJA 4EAEA 3AXIA 2OCGA 2Y2WA 4UQIM 5AXAA 1Y6FA 3GZ4A 3I53A 4RAVA 1NN3A 2I3DA 1T5LA 1OP9A 4L78A 1ETJA 4J4TA 2FJPA 4ZYKB 4G2NA 2BSRA 4U02A 3UT5B 1S8FA 4NXSA 3BA6A 1B0RA 3HN7A 1WBZB 4ODWB 2P5YA 1WIOA 1SU7A 1OE1A 5TK2A 3H3PH 1B0IA 3V6ZA 4K3DH 1E4XI 1R0YA 1X1AA 4F4FA 4IOFC 1LEHA 4KC0A 1PYWA 1XDWA 2DMRA 2NZUG 3D5EA 3MUOA 4JHAL 5K8IA 5HHMB 1N0XH 2VDLL 5KTSA 3TM4A 4GUDA 4N2LA 1Z5HA 3WB2A 3U30C 4C1BA 4LOHA 4URXR 4PGEA 3F2LA 1CYDA 4EH1A 1OREA 4YUYA 3PX2A 4BMOB 4OA5A 3AOEA 5E0QA 5AW7A 3QHQA 1Z6JT 1Z9OA 5FCSH 1NFRA 4XOUA 4U2FA 4Q9HA 4PICA 4JP8A 4U8GA 3EMBA 1WZAA 4QFMA 5AB1A 3RTQC 5DYTA 4BFLA 1C16A 2X4OB 1ODTC 5FAKA 3F7VB 3VRHA 1K66A 4PY7A 3PYCA 1YMUA 4UEWA 4ZMZA 2IANB 1NGPL 1NATA 1URIA 4YNBA 1NLDL 2JARA 2FN9A 1G43A 1X13A 4QRDA 3NZ8A 4U3HA 1AHNA 3ODPA 3WTTA 3Q0HA 4IKIA 4C0LA 4X6CF 4GWLA 5LZ8A 3O6KH 1OAAA 3KAPA 4X6XA 2ZVPX 3MRMA 2PZGA 3A9RA 3CH8A 2HVJA 4N39A 2MHAA 1JZ8A 4HNRA 4F71A 1G20E 5JPNB 3LIPA 3B6EA 2CALA 4IIHA 2ZJSL 1NCAL 3QZWA 4E12A 3DHNA 5T1DL 4IKJA 3HXPA 1BZEA 2BPBA 3MVSA 4F45A 5CBKA 4YCMA 1ET8A 4K9EC 1SJVA 5HJGA 1KY6A 4YBLC 5ESXA 4S35A 1G60A 4I0PB 4Z7UA 2R5WA 2FYYB 3A6DA 1QRUA 5K3CA 4RFLA 2J6WA 2OZEA 2RJNA 1CXZA 4O5AA 2FK7A 1PR4A 5IQOA 5COQA 1A02N 5DD0H 5JCOA 2FEDD 1BS9A 5AZEH 2ZTSA 5ENWA 5IHHA 1RJYA 2CLOB 1FYTD 4IDOA 1ZN2A 2XY1A 1UKYA 1MHEA 4NONA 4AZ3A 1KEUA 1ONQA 4JPSA 1SFHA 2EE9A 2VR8A 3WWDA 2YMOA 3OJDA 4NQVB 3VFPB 3TS1A 4YSOA 3G9TA 4JQSA 1IHDA 4DP6X 4GSDL 1Y3HA 3PQFA 4XD2A 2B1IA 1BQLH 5L0QC 3ARFB 2H32B 4IJMA 2Q8QA 1DEEA 2X8JB 5CJBA 4U3SA 3LUKA 3GLGB 2HADA 3BXNA 3CX2A 4N0FB 1Q19A 3RK4A 5IBQA 3DEZA 3ZKWA 5AVXB 2EFCB 3FMGL 3FZUD 4IU3A 4OYYA 3W4JA 2LP4Y 2FZ3A 1FFBA 1HYBA 3QJRB 5SYNA 3CVYA 1AD9B 3K0FA 3UOGA 4DQOL 1QK3A 1U2GA 2J0QA 1DARA 4NPCA 2ZCJA 1DVUA 1H05A 3O3OB 5HHOD 1U5BA 2NQ3A 1TJ5A 5K6AA 1ECYA 3QUKA 2ZRMA 1GS6X 1EUDB 3E9NA 1QE3A 2F3RA 1WGOA 2HHCA 2YQZA 5DSCB 5BCAA 3LPPA 1FNNA 1R88A 2JCCA 4L1BA 4MNGB 2G09A 1LSUA 4IRSD 3LDAA 1EDDA 1QDEA 4EQ3A 1KOAA 3OMNB 1GGBL 4WBNB 4JI8B 5ICGA 4PU0A 1Z4JA 1IHPA 1LBEA 3EUAA 3TSZA 4O4HB 4EEEA 3L4BC 2EICA 5T5FH 1RPAA 4G6ML 2WT8A 5D3MA 3DYMA 5D8JH 3PPYA 3HA5A 4MMXB 5EEUA 3G6WA 1JK8B 4ZI2A 1Z4KA 2BZSA 2NSYA 1ECGA 4P5DA 1NA8A 3ZD8A 1MH5A 1MEOA 1OEZW 4ODIA 3FCCA 3FVWA 1WEKA 5J13C 2A86A 2ZATA 4YRIA 2P9YA 4RNRA 2R60A 4YCAA 5L6MB 4R5HA 5GIPE 1U1EA 2DQDL 3A6BH 4LV5B 2I3BA 2E9IA 1B1CA 2YPKA 3TZBA 2GM4A 4ENEC 2RIPA 3QIVA 4X60A 1ZS9A 3GLQA 3I4FA 4U3JA 5FWQA 1GGVA 3GHEH 1RCUA 1P45A 3NDYE 2NY5H 2XRAL 5F33A 3KPRB 3ZDQA 5C32A 2IIVA 1RMFH 4CW1B 4PGCB 3HYTA 1WCBB 3NCBB 1LLDA 4EW6A 2OYLA 2JDID 2WOOA 3BZDA 2WIKA 1Z2PX 3RVQA 4EOWL 2Z8VC 1B00A 4E9TA 4FD0A 4BZ2A 3ZTEA 4PHFA 2NY6B 2R0ZH 1N9KA 4MZ3A 2D1SA 4AYTA 1RI1A 4E31A 1XGRA 2VZSA 4BAGA 3Q9QA 4FE4A 5FOQA 3P2KA 3O94A 4A55A 4FC6A 4N0EA 1KSHA 4DV7B 3N1FC 5TDNA 1JA0A 1G94A 1FHNA 1O6FA 3HWSA 4OGKA 5JFOA 3LOUA 3UYPB 3X2QB 3SDXF 1P9MC 4G0PA 1CDBA 1ECJA 3HM9A 1Q1NA 3B7WA 4FYVA 4GKJB 2Q21A 2A38A 4YI3A 1U7WA 3BLPX 3GNML 3RUPA 2ZYIA 4GAGL 1OBVA 1C3VA 4JG1H 2ZUQB 5LMZA 2CVZA 2K8QA 1AZUA 4PJ8A 1HDIA 4UANA 3VPBA 4O29A 1FYFA 4QTFA 4LZNA 3MCKB 2QG4A 2HMYB 1OVMA 4CI0B 2YHAA 1T2UA 7MHTA 2JCSA 1RQRA 2PCLA 1LWHA 2PN1A 2QPSA 3QFDA 4FP8H 3QJFA 1GPKA 4KYIB 3DAYA 4BDSA 2HT3C 1B93A 3O84A 5IKCB 4I5GA 4O4YL 2FRDA 1Y6JA 3I09A 1FLRL 4LCVA 4BS9A 3NXKA 4A6EA 3SYAA 4EE2A 2P9ZA 1QF9A 3OEHD 1KYWA 1H1LB 3RNKA 3CIAA 5TMBA 3VB9A 3ZV5A 3WN5A 2ACKA 3NOOA 1W9HA 2X53A 2EZ0D 3QVAA 3RP1A 1VG0B 4HIIA 1QNFA 1NDGA 4X0KA 5CGYD 5KMGA 4ZMWA 2PTTB 4E9XA 3UO8B 4PG7A 1SXJC 3QUXD 5AOLA 1FX0A 1I3UA 1D7OA 3OMZA 1G9NH 2D59A 4B80A 1TE2A 4NI3A 2V7EA 4B40A 4FA6A 3QX7A 1XA4A 5BZZA 4IH1A 4UMEA 4ZCRA 4W9HC 4U6SA 2VDOB 3OETA 4ZYKA 3FHOA 2ESVD 4OD3L 3UT5A 4BQBA 4NZJA 2QR0B 3W7BA 4ODWA 4PVDA 1VCIA 1RUAH 1W2KT 4GSRA 1DQJB 4Z7VB 5JW3L 4G71B 3CH7A 3LZCA 4UT6A 2Q8NA 2DRIA 2RH4A 3OAZK 3ZGHA 3VFSB 1KRXA 4OGXL 5DMYA 3D3KA 1RMYA 1SKYB 1DJSA 4MVJF 1SXNA 4OHPA 1EE2A 5ILOA 1XKXA 5G41A 3VM7A 4Z0PA 2W11A 2ADIB 4Y0NA 1J12A 1AHHA 3KBHE 2OT3B 3QLVC 2FTKE 4HYEA 4I55B 2BI7A 2UUAB 3E8UL 1RBZA 1UXOA 2JLRA 3ZHDA 3WUWG 5I23A 5ADOL 1ILUA 1KMIY 2QTVB 2BGLA 3DXAD 3H3BC 3JS5A 4TQ8A 4KX3A 3B9PA 4RD2A 2FWAA 2BM3A 3BDBA 4OZGF 1KTBA 4POZC 4W9IC 4LRTB 2ZX8A 3DSFH 4K1XA 5D6CB 2QRQA 4DBZA 3OB0K 2R4SH 3MRDB 5DQDL 2BKAA 4B53A 5HGBB 1S9WB 5FYJL 1YHYA 4NMMA 3FI9A 3T38A 2X4OA 2VSFA 2OHOA 3F7VA 1IBGH 4LOUC 2BFDB 4BV2A 1U3GA 4Y1AE 5ERWB 2FWPA 2B8OT 2IANA 2K4MA 3HEBA 3QPQD 2VQFB 4PRNB 3MCLL 2F7SA 1DFBL 3CPJB 3ZZTA 3ELYA 3JZDA 3OIFA 3UCFA 2ILVA 3ROMA 3HB9A 1UMBB 5C8VA 3BUPA 5I8OL 1KDYA 5J89A 3UKOA 7AT1A 1K4CB 5L51A 2PTVA 1IHYA 2O6LA 1TK9A 1BA2A 5I7FA 4BFJA 4QOHA 3DRQB 4AKQA 2BDNL 5JPNA 4Y5VB 4YX2L 4MCMA 3EARA 1JXDA 4EFNA 2VPQA 3QDJB 4MLSA 1KXJA 1UP6A 1RFLA 2PT6A 1CG6A 1ZC4A 3ORJA 4BV9A 1ES0B 2E2WA 3BGFC 1JV2B 3ARGB 1R0AH 2OC4A 2IDQA 1WJ3A 1KYOK 3GLAA 2AUTA 4I0PA 2FYYA 2XIBA 3V7NA 1XDTT 5AEAA 3AZPA 3LHPH 2OGTA 4GG8B 4M22A 3VZDA 2CNLA 3Q2NA 2QT1A 1P7QB 3OC8A 2COKA 2O6PA 5HUQA 2HIMA 2KPWA 1W44A 2ZCHH 3EOBI 2X0VA 4J0QA 4MB3A 1RP7A 4DPKA 3OR7B 1YDWA 2M6LA 1BU5A 1ORQB 4AX4A 5JXED 4JGBA 3L6EA 2EP5A 4MV3A 1TT6A 3BEVB 3QT2A 4RAOA 1NEZB 2YBEA 4K2UH 1QOPB 4HFJA 5F3HB 4TXJA 1JGLH 2X2JA 1UB6B 3RBGA 4ZS7H 4G23A 3RKUA 3H2YA 2WWKT 4NQVA 3VFPA 1QR1B 4LYFA 3EVZA 1KPUB 2FJHB 3CAFA 3QIWD 2TS1A 1ZIOA 1NMZA 5KU7A 1IKNA 2NR6D 1L4KA 5E38A 3ARFA 2H32A 4KQIA 2OFFA 2X8JA 2CHWA 3GLGA 4KZDH 2BW4A 1RAFA 4N0FA 2OHGA 2PX4A 1NUQA 4UT7H 2PYDA 3X2EA 1MPAL 4PBRA 5AVXA 4Q4CA 4DLBA 2JLZA 5KUMA 4ZZKA 3D8NA 2GN4A 1VIMA 3RVMA 3T7TA 1AD9A 3IUQA 2DTDA 2EVHA 4P5TD 2YMXL 2MR5A 3ENVA 1U8LB 4B8ZA 4GT1A 3OU7A 3ZIUA 1YRWA 1CUHA 4XCCL 4ALAH 4H44C 3RX9A 1EUDA 1P29A 1TC1A 2YGPA 5DSCA 3DNPA 1F3DJ 3GJRA 1FYEA 2V7TA 1RS0A 4AIEA 1XB2A 3O7MA 4PW3A 1S3SA 1TSRA 1F0PA 3RT9A 3GLUA 1P7HL 4YAEA 4N8DA 1SVSA 4KQ3H 2NNXA 1E7VA 2Y1DA 4MNGA 3EYSH 3RANA 2B94A 1RU9L 2O05A 1WIWA 3AB3A 1S6YA 1SOQA 2VH5H 5IHUH 2HSJA 4WBNA 1SKMA 5C97A 2Y0DA 4Z7AA 1BVKB 2XPYA 4DEXA 4O4HA 3KLDA 3MBWB 3BWUC 4BV3A 2CM6A 4JDTH 5DLEA 4MMXA 1JK8A 4PSDA 4A7SA 5BS0E 4Z9KB 4D81A 4UAJA 4DGVL 3LUCA 4KXQA 2OP1A 1LM8V 4M48L 1AG6A 1X7QB 2OM6A 4C4TA 2H4WA 3NSYA 3IQFA 1YQDA 4N90D 2ZUWA 3N2NA 1AO7B 4AJLA 3O2JA 1JFQL 1DB3A 4I4TF 1ZU4A 4MA8L 3DCIA 2D6FA 3WLBB 4LSSL 5IUCA 4O2EB 2G82A 2BWJA 1NU8A 1R7RA 4I9WD 4POYA 3KPRA 4NHUB 2CBGA 1NNSA 2KUTA 4F3FB 2OQRA 3S40A 3QQDB 4CW1A 4PGCA 3CCHB 1WCBA 5A6LA 3F7TA 4OLVH 2PL1A 2A9QA 2IYFA 3KQSA 4PANA 3C6QA 1MREL 3F62A 2ZICA 2FPWA 3L95B 4I1VA 4BU0A 2CRMA 3GSWB 3WDKA 5B2FA 4X85A 4Y6SA 4CN9A 4J0FA 4PS8A 2EH7H 4U7DA 3MYRA 2IXQB 1WZIA 4MUGA 4PAOA 1YV9A 3GXMA 1SO8A 1HEUA 3GZQA 4MUJA 4XNQB 3CZPA 4PJBF 2J3MA 3KALA 3FBGA 3O4IA 1X5AA 1L6PA 3UUWA 1UM5L 2G3MA 2IUEA 1JEOA 2ZJ0A 2ATEA 5E9QA 2BIIA 3UYPA 2OMZB 2ZCKH 2PHZA 1QYXA 4L29B 3LDUA 3SC2B 1SHUX 3N41B 4BZQA 4ZXBB 4JZJC 3QZLA 2ZPUA 4ER7A 3F3MA 1L5LA 5AOMA 3ZQJA 5L7XH 4U2ZA 1NBEA 1N2HA 3EZ2A 3LLMA 3T0WA 2VZ3A 1SHLA 4FINA 1S5PA 1XZCA 3E1GA 2IUYA 3FQYA 2BRRL 2I2FA 3P20A 5G3ZA 1QKKA 3MCKA 3I39X 2P26A 1E2EA 3GJZA 3C2AL 5GZOA 2VMJA 3MLZH 3B6MA 2X10A 4U7TB 2OTCA 2Z34A 1T26A 4Q74A 5I0DA 1H19A 1NONA 4JM0A 3WJJC 2PX5A 5IKCA 5BURA 1CT9A 4HGNA 2BHRA 3QPXH 4WI3A 1ZSHA 3F85A 4L8LA 5KVGH 4N87A 2DYPD 4QD3A 4N8VG 1H1LA 4CR6A 4N54A 1MSPA 4X6FB 3CRRA 3FR7A 1PF7E 2ZRDA 4F86A 5D1QE 4LSGA 3NQKA 4JGNA 3PABB 5JNVA 1ZIBA 2PTTA 1K27A 4D4KA 1D0SA 1R16A 3KR2A 3E03A 3RVVC 1FHGA 1V39A 1TLFA 2WD9A 2WI8A 2IU0A 1UPFA 5LMNB 4RTMA 2MOGA 3TH4T 1IOWA 1S01A 4RY8A 4K8RL 1UOLA 4R4BB 3DUHA 1SOVA 3KJHA 4C7XA 5KNBA 4TZTA 3LYHA 1J7JA 3VDBA 2QR0A 2R00A 1HBJA 2GKSA 1W9MA 1R9FA 1DQJA 1Z5LB 4YO0B 5DK3A 4Z7VA 4RADA 2XYCA 1ETA1 3URMA 2E9JA 1AXRA 3VFSA 4V0ME 1LWNA 4FFVD 3HS0B 4LNHA 3K0WA 1VIWA 3E15A 4LGVA 3ZKQD 2ADIA 3CU7A 3BAFA 2DMKA 2GZHA 2BERA 4I55A 5KYYB 4QJ3B 5DFAA 3MLVL 1VPVA 1FMFA 3CN4A 2X9XA 1U8ZA 4IUDS 1NVAA 3GRCA 5IQNA 4IM8A 5EKTA 2N1TE 4D3CL 2QTVA 2PMCA 3NVMB 1K9VF 3H7AA 4R2MA 5J5EA 4RCYA 1Z5OA 2PXHA 2Z93B 1DJZA 3IMGA 2H4XA 3RVTC 5C0CB 4WLUA 2ZRQA 5T4FA 1DV2A 3O31A 1EZ1A 2EAEA 2ADMA 3K1YA 2QD2A 5D6CA 1PX0A 2CSUA 1DBVO 4E70A 3OQ6A 1PNVA 3MRDA 5C0EB 4YCLA 2IBMA 5HGBA 3A1DA 1S9WA 1K4YA 2ZNXA 1OTSC 1TJHL 5ALRA 4B6GA 1PTZA 1XSOA 2BFDA 3RTBA 1KN4H 3ICEA 4W1PA 2VLJD 5ERWA 5FR1A 4QNPF 2K7QA 1BVZA 2OMBA 4PRNA 3ESYA 4KN5A 2NAPA 4DA4A 3ZS8A 3WZMA 3A4VA 1E8ZA 3W04A 4G1MB 5I9NA 3AIOA 3UAJC 1UMBA 3MGOB 3N0AA 3L3DB 1K4CA 3GRZA 1Y0LB 1P44A 4TKUB 3CQFA 3FH0A 4JLBA 5AHWA 3EOYG 1M2EA 1YMMB 3PLNA 3SE6A 3TLRA 5CF3A 1D6VH 3DRQA 2V9CA 1XEWY 2OAAA 4Y5VA 1MCSA 2LDBA 3QDJA 1XIVA 4D5EA 1ECZA 1X70A 1ES0A 5IB5B 1XTQA 1JV2A 1ZCBA 3ARGA 4PW9A 5JWRA 2H5LA 4P46B 5KSBE 3W4IA 5JLZB 4GP7A 1KCRL 4Z8YA 4GG8A 4LLYB 1P7QA 2ST1A 3IN2A 1U90A 4AI7A 2QUKA 2WSLA 2JZNA 2NZJA 3KBOA 2DU8A 4KZCA 5A71A 1A5ZA 2WIBA 4TRNA 4K9MA 2PRZA 3RS9A 3OR7A 2C26A 2MMCA 2PQ2A 1X5MA 1ORQA 2QV2A 1KK3A 4ZYTA 4S05A 1ML3A 3L4JA 4FJ0A 3BEVA 4PLKD 3UZVB 1NEZA 2H5EA 1F2QA 1Z2KA 1F8UA 2FMHA 2OV6A 3MS2A 5F3HA 3VR6H 1KXZA 1FNSH 1UB6A 1DDOA 4RRPG 3F6PA 4CC0A 2CKBH 1C0PA 3HGTA 1QR1A 1L5QA 4DCUA 4QDZA 1KPUA 2FJHA 3QQXA 3BHBA 5KUTA 4JO2L 3CXDL 2H1PL 2WZAA 2GPSA 1GFIA 2MCFA 4ND1A 1Q0HA 5KVDL 3GUHA 4K4KA 1SZPA 1O8CA 2I26N 3KV1A 5GIRB 3HG1D 1EVJA 1UWGL 2ZONA 4YBQC 5HDWA 5T3XE 4OF8A 1RLOA 5M95B 1JDAA 3V4RA 2ZTBA 4QBKA 4H18A 4H0GA 1J5PA 3TWYA 5BV7H 1U8LA 2BUBA 4CV2A 3SDAB 2OUKA 2PUWA 3IT1A 3HZHA 4WKGA 1XXDC 3MTGA 5L95A 5JQIB 4HLZH 1UZGA 1PJ3A 1PD6A 3BAYA 5AK5A 3JZYA 3N2KB 3BRWA 1P4AA 2ZOWA 4QAQA 1H3XA 3GLZA 3RU8H 2AXNA 5HM6A 3S7GA 2H45A 3EGEA 3H1TA 4TMPA 1YNLL 1PJCA 4KOCA 1BVKA 1A7OH 1CJKC 3EZXA 2Y9MB 3B9BA 2XGGA 3RVXD 1TCMA 1CW2B 3MBWA 1SKAA 1WGVA 3OMWA 3OKFA 3WYEA 3R5FA 4X5QA 3EC1A 1UASA 4G8GE 5EV7A 5AJHA 1XTZA 2LLGA 1X7QA 5C0BE 3RVWC 3HOGA 2GM5A 3TG8A 4XWOC 2ENPA 1AO7A 3UJ8A 2G4GA 4FR0A 2PL5A 4ODUB 1J4AA 1IE4A 3W9EB 2N46A 2PS1A 3WLBA 1JQKA 1UKEA 4K5PA 3UUGA 2PUFA 3ZVKA 2DPYA 4TYWA 1BN7A 2WT4A 2G5PA 4O2EA 3MJDA 1BFVH 5JPIA 3ON5A 1LPMA 3DD5A 1OKKA 2M98A 2AEMA 4NPJA 4NHUA 1TZ2A 4XB1A 2DBJA 4F3FA 1T2EA 5DX8A 2G77B 3SMVA 3QQDA 4MEAA 3CCHA 2XWJI 1BECA 4WXHA 2ASEA 3N5CA 3PAUA 3KPJA 4O51B 3VWKD 3PHAA 1W75A 3L95A 3BERA 4EAQA 3SBOA 4ZU1X 1RZQA 4QPJC 3GSWA 2ZJ8A 2FWOB 3SEFA 3H6GA 4M56A 4LK4A 4XQCA 1L2TA 2IXQA 2PX2A 2IYXA 1G66A 1QBLH 5JAHA 1MJ5A 2VH2A 1I3GL 1X7DA 5CVDA 4XNQA 4DQAA 2AOTB 3UPDA 3KXFD 2OMZA 2XA2A 3F49S 4L29A 2R2EB 4N20A 4KZEL 1XPJA 2WDPA 2OR3A 4PHZA 4MZ2A 3H9BA 4MJ5B 5SZHB 1FRGL 3EQ2A 2YJ3A 4MLPA 2OVFA 1CUOA 4PHXA 3S3CB 4WQOA 2QTCA 1WE2A 3QR1A 5C07E 1B2WH 1GL6A 1LTKA 1IBFA 4AUUA 2QUHA 4R2WA 4AJWA 3KNBB 4CWAA 4HXBH 5EOQL 2FMTA 1BQEA 4PJDF 2J5BA 3F6YA 3RTAA 4XH2B 3MN1A 5E99L 1KY2A 2FR8C 4BQCA 3L8MA 3KPVA 1TTBA 4A63A 4DIDA 4LRIC 1H69A 1CBJA 1NIDA 1AQHA 1G5GA 2DV6A 3O8LA 2IXGA 1T1SA 3F73A 2ZWYA 2ZRFA 4JY7A 1JTFA 5K3AA 2JIZD 1PLGH 4NRYB 2N42A 3NWJA 1TZGH 3VE0B 2QU8A 5TVKA 3W38A 4X6FA 1E77A 2GZDA 4G0NA 3MSPA 4RHFA 3PABA 4X7SL 1TZHB 3FETA 1IZ0A 2GEQA 3D7NA 1P6UA 1FF9A 1EBUA 1YSCA 2BGTA 1TD9A 1YNSA 4TWRA 2NQ2C 3CLSC 1FFWA 3C6LC 1S8OA 3VDXA 1QTIA 4FMFA 1WXFA 1TU2B 3SZKC 5I1EL 4R4BA 2YOAA 3WTBA 1E18A 3R1GH 1N4DA 4EPVA 4UU7A 2A9RA 1OOWA 4ECAA 1UDXA 5E3HA 4E88A 1USGA 3TIIA 4EPYA 3B1YA 2ZQZA 3QWHA 3P02A 1W9XA 3M46A 1E92A 2WWTA 1Z5LA 4YO0A 4ICXA 5DS1A 4YC7A 2I5PO 3NANA 5B3JF 1TZKA 1CLCA 4V0QA 3H84A 5IP5A 2ZIUB 4Q37A 4DWVA 3HS0A 4C7BA 4Q3DA 1TIUA 4RX4A 2RGBA 4R83A 1E3IA 4NUGL 4C3ZA 1FU4A 5LN1A 1Z0ZA 5A1AA 2P27A 4C06A 4GX2A 3BPOB 5KYYA 1CDZA 1U0FA 1IFGA 1S7TB 3PDDA 2MYNA 4LHEA 4QJ3A 3D4NA 1ZPUA 2XFGB 4WNQB 2PUEA 3TOVA 1ZXKA 2WZ5A 3IP6A 2MNUA 1BAFL 4LSPH 2XWJA 2BZGA 1EERB 2BBTA 5IUSA 1U0SY 3II2A 1RVV1 1Q1ZA 2Z93A 2B3RA 5C0CA 2VC2L 3GLHB 4IOMA 4TRPH 2VWEE 5DMIL 4V0RA 1A6VL 4YYEA 5FPKA 2IGTA 2PUGA 4Y8AA 4W4OA 4BWGA 5C0EA 4Y2DB 4F7WA 2ZT9C 3SPCA 4CLHA 2AUNA 1PU0A 5CD5D 4KAQL 1CC1S 3S8YA 2NY4C 5DDIP 5B6IA 1F4HA 2ZROA 3M1BB 4K94C 4CUJA 2VITB 2VJDA 3B89A 4G1MA 3MGOA 1IZZA 2EX1A 4L08A 3L3DA 5JRJA 4HUQB 1Y0LA 1NZDA 1CL7H 4TKUA 4U0KA 2O3UA 2JKVA 1FU8A 4I2XE 4WFGE 1YMMA 4G6AD 5EO0B 5AFSA 3V4VL 3WKML 2Z5LA 5AXCA 1A65A 3ZQ9A 2QW1A 2QROA 3GXOA 3RJDA 1NHGA 1NVBA 1C5DB 1DN2A 1O7DE 3VXSD 1HFKA 2FP3A 4RANA 3TV8A 5IB5A 2FX9H 2JCGA 1JLKA 1T2XA 2A9CA 3GCGA 4P46A 4QRQB 3QZBA 5JLZA 3MOIA 2QKIC 4K9EL 2HTFA 4UBOA 5FB8B 3E61A 4DLSA 2AITA 4RKWA 4M7JL 3WNIA 4LLYA 3VPHA 1FBIL 3NBQA 5FPSA 2CGEA 3LN4B 1XNJA 2WKLA 4N47A 4YJFB 1OPRA 5T41A 2WCSA 4Z7WF 2O4CA 2WM8A 3N2YA 4EDFA 3REVB 4QUJA 3PIDA 3UZVA 1AXSB 2AS5M 3ARTA 4D0RA 1W7AA 5JNUA 2DEUA 1NCDH 1ZS8B 3SFVA 2ROQA 4JR2A 2YSTA 1E1RD 4PJFE 2P2YA 1Q72H 3DHJA 2G9VA 3EIOA 3PI7A 4KWEA 4OFVA 3KPSB 5HG0A 3FS9A 1SKUA 5JCZA 3FJTA 1B14A 1KJVB 3X3GL 1N92A 5M5BA 2NXYC 4FTVB 1GUYA 5BRQA 5JAIA 4EHHA 1IBHA 1VE6A 3L16A 5DRZB 1A76A 4II7A 4A2QA 2BZCA 1RZ7H 3S27A 1CQYA 1ZANH 1VL2A 2RKOA 2IFTA 5GIRA 5FBQB 4KROB 2JLLA 2IIJA 3BIJA 1A69A 4KE9A 3TSOA 3BWAB 1RVFH 5K5YA 5BPFA 1PD0A 3EW9A 4JMPA 4KRFA 4ZTBA 3SDAA 4ALLA 1SHSA 3X12B 5D1XE 3U62A 2PO6B 1RCYA 3PD7A 3CLEH 3NN8B 4MQXC 2D3LA 5DD5L 3N2KA 4OI9A 1WZEA 2XIIA 3SGEI 1ZRUA 3BAXA 3LECA 3EFFB 4FYJA 2B0SH 3DW3X 2V5AA 1GR0A 4WO4B 1QAMA 2OK0H 2W6OA 3VD4A 3CNEA 1SD1A 1PL8A 4R69A 3QELA 1EHNA 1I3LA 4FI8A 5IJCC 2X5XA 1QWUA 2WG1A 3LVEA 3HBPA 4E5UA 2PNFA 2BSDA 1JAEA 1CB7A 4AMWA 3IKLA 3CEHA 3F97A 4BLOA 2BOLA 3QIBC 1DIRA 1IOVA 2PXYC 1TVKB 4PUBL 5EJIA 5E8EB 2FQGA 4M1KA 3ZDZF 4KQEA 2J1ZA 1Y7LA 4MYRA 3A4MA 1XR3A 2XUJA 1ZH4A 3UPRB 4AU1A 2YWJA 3UK0A 3V5NA 4NQCE 4NSKB 3ABLB 4ODUA 5C7YA 1ZEAH 3EF3A 3W9EA 3SYMA 1C8QA 3CBGA 1WBXB 1BCSB 4AZTA 3PWTA 5IY5B 3TD9A 4ENTA 4ETWA 1KEML 5LXGL 1KQGA 1XU7A 4EYEA 3TPZA 4HADA 3KXIA 3OQPA 3VC2A 2ZQKA 3NUQA 1KN2H 1IPFA 3MJTA 3V2IA 3SR0A 3UUEA 4O51A 3FGOA 3J07A 3SNKA 4MB6A 1E6MA 1CLYL 4RF5A 4ZICA 3OJEA 2Y36L 3O6FD 1T10A 2WR8A 1ADQH 1I7LA 4PJGF 3VMFA 2FWOA 1RSYA 5GRZA 1N2CE 1C30B 1YT5A 2EZTA 1P2UA 2X9GA 4DERA 3A3NA 3BH7A 3U0PB 4U49A 2AEFA 4B84A 4ER0A 3VR4D 2AOTA 1CLZL 4LC0A 3TXAA 4AQ7A 2R2BB 3BWYA 2XUDA 2WQVA 1GU7A 1NL3A 2JE8A 2EVGA 2R2EA 2BZ7A 2WEKA 4LJ5A 1C7TA 4MJ5A 1MT0A 4OM1L 3DPDA 3S8WA 1NBVH 5ENVA 2PRYA 5SY9A 4Z49A 2PR9A 2YZ2A 2OO3A 4B7AA 3BAIA 4MDIB 4DW2L 4AXXA 4NRXB 3GCXA 5C1MB 1EKXA 2GSGB 3KNBA 3I6IA 1P1JA 4DADA 1NMAH 4J7XA 1TYDE 4XH2A 3WEAA 1TMGE 4N0CD 2PUCA 3CUEF 3KZVA 2CUIA 2KE5A 1YAHA 2HTEA 5LR6A 2YAPA 3JVEA 3HKEB 2HJLB 3UO1H 1AGFB 4JVSB 3U3OA 4O0MA 4X63A 3GMSA 1HG1A 2BO0A 4U4AA 4NRYA 4F9LA 2X88A 1PSDA 3H2HA 2P3OA 3VE0A 4IJKA 1QHSA 4OQLA 3IXAB 4PSCA 4AITA 3DULA 5GVRA 3LY6A 2VYVA 1WPRA 3MCUA 5GTDA 3AGWA 3OP1A 1CF1A 3G5YB 1TZHA 1PS8A 1FORL 3NCFB 4JFUA 5LSAA 2QLFA 4IQ0A 2X05A 3BVDB 3O1IC 5BT8A 2XBDA 2OOSA 4HK3J 2HNKA 2ZWOA 2PX3A 3OJOA 1TU2A 3GDHA 4OZFG 4OMUA 4UI2A 4LOVA 3KHUA 4EENA 2DLTA 3IVAA 3KSRA 3L05A 1ZVJA 4YIQB 1CDYA 2J3DA 4JFED 1UENA 1MJFA 3L1OL 4IOSA 4Z23A 1Q3KA 3A4LA 4JY6B 1MC1A 4UCXA 3IQXA 4W6YB 4YV2A 2VK2A 1NOKA 3HE7B 2H2GA 4MKRA 5EF2A 1VYHA 4LTDA 3DGDA 1NT4A 2FZVA 3ETEA 1XAJA 1RWQA 1AXGA 3KEHA 3D5OF 1HKHA 4P4SB 1IX2A 1I7RB 4NU5A 2GVDC 3F5QA 3NM5A 4F1KA 1XBTA 1GC1H 1S7TA 1TO4A 1BD3A 3MPCA 4M0UA 4YSQA 3FJOA 2DM4A 3BE8A 4GQBA 3OG4B 1QLWA 1VL8A 3HBZA 2ZREA 4YHMH 1M2OB 3GLHA 1T03H 1XD0A 4GPBA 3ZWOA 2FBRA 1RU3A 2QTHA 2YEZB 1PS0A 4NICA 5BR4A 1A6ZB 1KZ4A 3SLRA 3C41J 5CNHA 4KXYA 4WWOA 5JW4Q 3PUWA 2I66A 4Y2DA 3K2IA 5FNVB 1CK0L 3LXRA 2XUZA 2HWZH 4X6DB 5T8KA 1EMTL 4EIWA 4RK4A 1B7GO 4GZ3A 3ESQA 1IEBB 2VDRH 4DMRA 3T0DA 2J09A 1PR3A 3AEXA 3I6QA 3BSGA 2HLPA 3M1BA 2VITA 2TRYA 1FNDA 4P4NA 2YC2C 2ZTHA 3PJNA 3BKML 5GJCA 4Y4KB 1BQ3A 4ESKA 4HUQA 4KLZA 4B4UA 2VXQA 2DPMA 1ORDA 1X3DA 1LDMA 4FXKC 3ZDXE 4J4PA 2A74C 3NTCH 4AO6A 1KB9J 2KT6A 2FUG6 5EO0A 1SY6L 3KT6A 1WXEA 1T66C 3WRVA 2Q50A 1ZDSA 4QX6A 1ZMRA 4N7JA 2A1WH 3MWLA 4KMMA 1C5DA 1G7LB 4JN2B 5KJCA 3OU2A 2V5VA 1FZQA 2VPWA 2PLTA 4OLUL 3GDWA 3JYHA 1XQ6A 5ECYA 3NKFA 1JWMB 1MG2C 1O54A 1BBDL 1J0IA 1YK1A 3BPNC 3IAS6 4JP1A 2H1HA 2Z56A 3UH0A 3UY4A 3TT3H 4YJDA 4QRQA 3MT8A 4IFBA 4CLEA 4Q0MA 3I64A 5BW5A 3GOQA 3QYFA 2I9TB 4HAUA 2OYPA 2Y1ZA 3NJXA 5FB8A 3D0QA 3KWMA 1YOVB 4ND8B 3G3EA 4BJLA 5HVHB 3MTIA 1AUPA 3PVSA 3K2QA 5JEDA 3LN4A 3QS3A 1AZWA 4LEBA 4YJFA 3DYPA 2ONJA 3REVA 2PU5A 2ONZA 5I6NA 4O8ZA 2R0LL 3QS2A 3R7FA 4IBOA 5ICSA 1WFJA 3CH6A 1AXSA 4TNGA 3EEIA 1YACA 1G6RH 2R6CA 1ZS8A 4LJ8A 1W34A 3RIGA 3I9OA 4ECEA 2XVKA 2BHTA 1W8IA 4CV0A 1DJNA 3KPSA 2OORC 4Z86A 2VHYA 2BM1A 2FFBA 1KJVA 4KQWA 4MARA 4FTVA 3QARA 3AP2A 2YZ1A 4I77L 4B4DA 4P0QB 4L3EB 1V9CA 1AJ7H 2O1SA 5DRZA 3PD1A 3G5XB 1V35A 5IHWA 4LDZA 4X3CA 5IHPA 4M5TA 1CGSH 3PFCA 2JKZA 4GPZA 2X6QA 3Q5YA 8CGTA 4F2WA 2GZ3A 3OTWA 2HTKC 2SNIE 1YIDA 5FYLD 3MKGA 2PH5A 1DQQB 4Z9BA 5E1BA 1H0DB 3BWAA 4WY7L 3DD1A 4PCUA 1WOMA 2E21A 4WERA 1SQSA 3VCLB 4LMQI 2DJSA 4DNOA 3X12A 1C1XB 3QZOA 3CE9A 5DT2A 2PO6A 2X38A 3NN8A 3E38A 2VN6A 4AMVA 3GXDA 1YJ5A 3BFXA 4AVIA 3CN0A 2B08A 2H54A 4B44A 3EFFA 4JX8A 1AY1H 3AG2B 2NNCA 4YRFA 3GBVA 4WO4A 5AWNH 3TYGH 3PXAA 2I22A 4YDIH 3RIFF 2QZZA 2GIYA 1FJ1B 1TJGH 1HORA 4OH1A 1UJ3C 4X0NA 3O2QB 1BXKA 1MCDA 5JW4N 1G42A 4JX9A 3BC9A 4J3OH 4MXVF 1TVKA 1W1UA 2NMVA 2VXVH 1H5UA 1H6AA 5E8EA 3CEPB 4R1UA 2GNOA 5DWQA 2AN4A 3V3KA 2QGNA 1YVPA 2QADC 4H1LH 4HF5L 1JVNA 4NABA 1I8AA 1U0TA 1Q0EA 4LVOC 3ULAB 5ESAB 2DUUA 2OWDA 2C92A 3UPRA 3GMTA 2C3YA 2NO7A 5E2WL 1XJ5A 4Q3OA 3C60C 4NSKA 4G1VA 3QC5X 3UTCA 4HQKA 3WLPA 1WBXA 1KOGA 4O4JF 5CMLA 1KV7A 1T2JA 5C4GB 1C4XA 1BCSA 3GMNB 1K1EA 3E2HC 4HBGA 2SEBB 3FTEA 2K5UA 2Y99A 4X65B 2BGIA 2BHYA 4IW3B 1J5OL 1VGKB 4FHCA 4TMZA 3FB7B 1N1EA 3D34A 2WO3B 2YY6A 5A2KH 4NQQA 4Q3AA 4NNYB 3RU3A 1VCOA 2QP9X 2DLHA 4RKYA 3RDTD 1G9SA 3DOUA 3LRXA 3RWOA 3RYCB 2Z91B 4OCSH 1C30A 3TA3C 4UAOC 3U0PA 5INTA 1QSFE 1RHKA 1QBKC 3BAEH 5EJAA 4PO3X 1HE3A 1FRQA 3JWNH 2CKMA 2EIBA 2R2BA 1U2DC 4KMOA 1D6EB 3LEYH 3TIXB 1VG9B 5F7KC 1HMPA 1PEZA 5JC8A 4YHZH 4RMWA 1DLFL 2Z4SA 5C4MA 3QZNA 1I9CA 3ZDAA 1KSGA 3T6VA 5BRZE 3GVPA 1NPTO 3OFND 5KS9E 1VSQA 2VAJA 4DFHA 3JX9A 5JZOA 1OPOA 2N9UA 1SXAA 1PKQB 1NX9A 2PMZA 4MNTA 4NRXA 2VWHA 3NAGA 2GSGA 1T1JA 4OOEA 1XWIA 4MQTB 1AACA 2G6TA 3FNGA 5F7WC 3KLBA 2DL2A 1BU8A 3KPLB 1YQVL 1OQOA 1K6QH 1E6WA 2DM7A 1I6MA 3OQ1A 2HLDD 3HKEA 2HJLA 4FFYH 3ZN6A 2XMBA 1AGFA 4NGHL 4PC1A 5FKPB 3PC4A 2P9CA 1LFDB 3FUTA 4KTDH 3SHQA 2W9XA 3SYQA 1OFGA 2O8NA 4GLOA 1Q1PA 2KPNA 2GC4C 3IXAA 4PNZA 5ER9A 2VUYA 1I5OA 3U9LA 4UOW1 5ALLA 4RM2A 3ISJA 5DYNA 3G5YA 1BQKA 3WKNA 2BVPB 3VSTA 4GUAA 3I72A 1T7ZA 5FBHA 4ZG1A 5KJ4A 4ZVRA 2NY5C 3C4QA 4P2YA 2NXEA 1TFUA 1Y5LA 2BVEA 3TC9A 4MIOA 4ZT6A 2IEIA 1ARZA 1RI2A 4NKQB 2PUDA 4BP8A 3SE4C 4WI7A 4YIQA 3BE1H 4G8BA 4O2CB 3WEBA 1SF3A 4JJGA 4U1JB 2MJLA 3CMGA 4LLQB 2O48X 2IV3A 4JY6A 3FQTB 2R6JA 4JFHE 1SUPA 4JDPA 3W1WA 3HE7A 3I75B 5B7FA 4K3JH 3OGOE 4BXVA 4PVMA 3T94A 1K3ZA 5B4MD 1JXQA 2C82A 3H1AA 5KPJA 1PJBA 4UJ5A 2OXGB 5I1KH 1ZM2A 4E0BA 1JZ2A 5ITFB 1E0SA 4P4SA 4HJRA 5TXGA 1I7RA 2OL3H 2WUEA 1E8YA 4WXPA 2FH6A 2JIXB 4BKRA 2LCFA 4FQCH 1YS2X 3SKVA 2J5LB 3ULUH 1FMTA 1YJBA 4CQLB 4GO6B 4ARZB 3PHQB 2A7QA 3RFUA 1M2OA 3PQ4A 4JPIB 4WCFC 3KU4A 2YEZA 3V0WH 1A6ZA 3N2IA 2ZJZA 3KVOA 1Q7CA 4DQLA 4OB7A 1R0SA 3S2GA 1U6IA 2JH2A 3Q7JA 3QVKA 1IGIH 4RY9A 1JIBA 5FNVA 4EO4A 2YVLA 4D4MA 4X6DA 1DBRA 3QMVA 4D9FA 3IMEA 4L8DB 1IM3B 4WFED 1VKZA 4E9YA 2IAMD 4HQ6A 3SK0A 1IEBA 1F20A 4FKZA 5EZOL 1G63A 2CD0A 2FNAA 4HUWB 4PJ7B 1SPXA 5DX0A 3C09B 5JMOA 4NBLA 1KVTA 4K15A 5DE3A 4Y4KA 1XI2A 4V0KA 2I9KA 1SAYA 1AD0B 5JW5B 2E4AA 2IW3A 3NALA 1VXOA 5T5NF 1PG7L 1OV4A 4WWKC 2D7JA 4KX8A 1MFDH 3T2OA 2XNJA 4GOSA 3VVMA 3TCXB 5LKAA 3T9AA 5CP7B 2IMNA 2TMKA 1XQVA 3GEDA 1G7LA 1S9YB 4JN2A 2GJ8A 1TM4E 2YXFA 2QPLA 5H81A 2WTOA 3LYRA 1JWMA 4IBYA 4Y5YB 4JROA 3F65A 5HJEA 1EIBA 2I9TA 1JPNA 2WQ8A 1VJ1A 4FOMA 4ZNCD 2ADGB 1MLCB 2FXVA 3HR6A 1G7CA 5D4IA 1YOVA 4ND8A 4PZLA 3VQMA 2EZ9A 4HYYA 4DXDA 4KMLB 1JWUB 2JRCA 1QOZA 4GAAA 2XXBA 4W8GA 1VRVA 1FN4B 1X7ZB 1O95D 4AZ8B 3D12B 3IEMA 4GYWA 4C22A 4R2JA 3GVHA 1MN6A 5EUMA 3L5XL 4O00A 4HEPG 3NORA 3L79A 1JFTA 1OB2A 4ZJYA 5TDPB 1BSVA 3Q5DA 4U2DA 1E32A 1MFEH 4LSZA 3ZZSA 4P82A 2WVVB 1RQNA 4HG2A 3HNTH 3LRHA 1RIHH 4UTRA 3T0VA 2Q8BL 3I2CH 3PK0A 1JCKA 4L3EA 2Y5QA 5B1JC 4Z7OE 3G5XA 3ABIA 2WIIB 1O2DA 5BVGB 3GJFH 2NNWB 1YE8A 2OSWA 4YDHB 5FYKD 2BMEA 4XVJL 1DQQA 2QSJA 1JN0A 1H0DA 4ZAWA 3S0JA 5DPMA 2Q3BA 4E46A 3VCLA 2FVNA 4HC1A 1G18A 1SD2A 4OCWH 4QHMB 2VKQA 1C1XA 4KQ6A 3ILVA 3L5OA 3PNSA 3C6BA 2WPDA 4XN5A 4IBTA 3EHBB 1HN1A 3A9UA 3NEPX 3ZJAA 4F92B 1FNFA 2IS6A 4UATA 2XWCA 4XMKH 4IDPA 2FHBA 3R4DA 2V9QA 5SX4H 2CDCA 4PWZA 3M3DA 2Z35B 1FJ1A 4RULA 2B2XL 1DLIA 4TV8F 3LFUA 2HX1A 4HZUB 4MQMA 4AICA 5CDYA 2F7QA 3FTQA 4POOA 4MQEB 4JEHA 5HI3D 3TV3L 2ZXUA 4FIDA 3TUJC 2HCJB 2W0MA 3KQYA 2A3TA 4TRMA 1VFAB 3ATAA 2J0VA 2HJSA 4LKCB 2AQSA 3OT4A 2AV1B 5ESAA 2XN1A 1T2DA 4MV6A 2A4EA 5CCKH 4RNDB 2BHZA 1JLSA 3VU8A 3QDGD 1PJWA 1WB4A 4B83A 1DJPA 5GVSA 5I73C 3BL5A 2EKPA 3GMNA 5DXWA 3OAUL 3DL2A 2SEBA 3JTTB 4W6WB 1CU1A 3O0DA 3OJ2C 1VGKA 4UCFA 2JCXA 3FB7A 1S9HA 2V5YA 2WFLB 4HKTA 4YQYA 1XD9A 2FEOA 5D00A 3FSWA 2Y9RT 5DLDA 5EUBA 2Y7MA 1T8RA 2Y68A 1T3SA 2FSSA 1SHTX 4NNYA 4BVEA 3IMWA 3P9RA 1XZAA 1TZBA 2PGXA 4F3RA 3QXUA 3RYCA 1GP2A 1MF2H 2Z91A 1IFHH 4JPWL 4IJ3B 1P5VB 1KFGA 3CINA 1CFBA 4MRNA 3ZUGA 4WCYL 4MVJD 2HU8A 4ER5A 2OUIA 3EEBA 1D6EA 5HDOA 1KJ2B 1TTUA 1U1FA 2QI9C 4PPFA 1SOXA 4ALAC 3ZI0A 4ZAFA 4CMMB 2Z6QA 4M7KH 2AMYA 3RYTC 3ZTCC 2C2WA 1P9WA 1T7WA 2IVFC 1MX1A 1DO5A 1MAHA 2MWCA 4KYTA 5GONB 1VBFA 4HUJA 4GP6A 1JP5A 1TXGA 5DFVC 4YH6A 1PKQA 3KYMB 2YAMA 2JWYA 1KGWA 4LHUG 5D1ZC 4AY2A 2CLSA 1XL6A 4H08A 1PGOA 2FPLA 3FSZA 2O3TA 2OQ2A 4MRSA 3PWVB 5J0BA 4QZVA 4DNFA 1Q21A 5GISH 1F90H 1R4XA 4N5MA 2XJ4A 3ZXIA 4D97A 1I2AA 5I1GH 3KPLA 2FDCA 3NQ41 3RS5A 3VVLA 1WC7B 1ENZA 2E4ZA 5IN4A 4NQDB 1P84K 3ZBPA 3W2FA 1GAXA 5FKPA 3MA0A 4JS7A 4S1DC 3MRLB 1ZXXA 3W82A 2WBLC 1MHPA 3CVXA 1N2GA 3QDME 1OZ0A 1OASA 4Z7NF 1DIGA 4AS1A 2MTAA 4U4BA 2NOAA 2R25B 2MSPA 2GY5A 2BELA 2N0SA 1F06A 4OB8A 3VWJD 2E75C 4Q56A 1CULC 2BVPA 4LF8B 3GWGA 2HLAB 3SE3A 4H0CA 1EX0A 4GC5A 3GEGA 4KVGA 1Z5ZA 1OALA 1P91A 2Q62A 2PT9A 4H26B 4JRXB 2QM7A 4PWFA 2C8VA 5CK4A 2GY7B 3TN7A 2QZ9A 4JO8A 3S4SG 1P81A 3HBLA 4M0MA 4O2CA 1XEDA 5DO2D 4U1JA 1CHDA 1K8RA 2K4AA 1DTSA 4QRPD 3QI7A 4UTAL 4LLQA 5F76A 1E50A 3VFMB 4PAWA 5DS2A 3FQTA 1SMDA 3K09A 1K4MA 3I75A 3P4NB 2P3SA 1MMFB 2JHPA 2H7VA 5EORH 1VSTA 2P5EB 3DZGA 4QC2A 2OXGA 5LGJB 1UPXA 4MQSB 4GUCA 4M1DH 1DQDL 2PXXA 5ITFA 1Z08A 1ZLEA 1IC5H 4BE5A 4MB5A 2BZ0A 4CETA 1M1ZA 1CLEA 2EF1A 2JIXA 5FGCB 1R3DA 2CF5A 1PG0A 3GXPA 5HJ2A 1LGVA 4YSCA 4FNQA 3KJGA 1SPBS 3K1KC 1I4TD 4YRCA 2OKMA 3QFHA 4EK9A 4CQLA 2REQB 2C9DA 3OE4A 4ARZA 3PHQA 4HWNA 2QX4A 3H8NA 3ZDBA 3QI9C 2X4NB 4JPIA 4MGHA 4JWTA 3D1MC 5AI9A 4NN5B 5A3IC 4HOYA 1FF5A 1NVVQ 3NRFA 2VEOA 5TT1A 3IIMA 3M4NA 4WDQA 5F3FA 5F5NA 1SEBB 4KU4A 2WXGA 2RCSH 4PJHE 5HBBA 2G5GX 3H2KA 4U7JA 4ZOEA 3EGXB 4L8DA 1IM3A 4H13C 4AC9A 3RVSA 1EUTA 3B1WA 3GCZA 1V8ZA 1U92B 1Y6MR 2FOIA 4KAXA 4HUWA 4PJ7A 4F5CA 1ZMYA 4ZHQB 4MPJA 3D6TB 5IVIA 1SN2A 4M8RA 4QUAA 2R5NA 5J59A 1FC0A 4K94L 1AD0A 3IN0A 5JW5A 1KARA 1SWVA 4RLHA 1B4TA 2DAVA 3FT9A 3RYIB 3WDMA 2MCPH 1QVVA 2D62A 1BVNT 5KCMA 4KRGA 3TCXA 5CP7A 5ANRB 3Q15C 3DLAA 4RGMB 2VPTA 1XLVA 4Z7UF 4GC9A 1S9YA 2IQ9H 4LK2A 3LCYA 4M5SA 4Y5YA 3Q48A 3VAZA 2O6FA 3B7RL 4F21A 4RZXA 2BGGA 4WLFA 3GMDA 3K1TA 3GEFA 3D6VA 2ADGA 1MLCA 4S04A 5C7OO 1E5ZA 4YE4L 1UWEH 1SZNA 4ZVOA 3AB0C 1M2KA 4OKVB 3EVCA 2DN7A 1JWUA 2PCYA 4MXQC 1FN4A 1X7ZA 4AZ8A 1J49A 5DNCA 4CG3A 1A4JB 5L40A 5TQ2L 5JNWA 3TIVA 5JD3A 2Y3IA 5GZ3A 4ANUA 4LDEB 1Q7BA 1WWCA 2FX8H 2JKIS 3A26A 5ALTA 5TDPA 3JWOC 1AQ8A 2XZPA 1Z88A 3MF4A 1K3FA 4GSKA 3EMDA 3NV7A 5KVEH 3VB8A 5A2BA 2JD1A 2C3GA 2IHYA 4OLYH 1NQ5A 1JFLA 5CGTA 2WVVA 4F04A 3WFBL 1ZSNA 4MS1B 4X6YA 3UG5A 3WIIH 3UENA 1GARA 1GA4A 4U5QA 4WEMB 3D8HA 4N41A 4HIPA 1ODCA 2GQHA 3CN3A 1ZK1A 3DGFC 1X87A 2WIIA 3K71B 5BVGA 5EUOE 2PEYA 3UYRH 2GUWA 4RTLA 5FWYB 5JU6A 4CZ2A 1MQ8B 1UFVA 2VUIB 1FX1A 1P7VA 3K0CC 1U6JA 2GBGA 3JD4A 5HRUA 2Z3FA 4AYBA 3DHMA 3BB4A 1IN6A 4QHMA 3ASUA 4FS0A 5HPMB 3WBKA 4UEJA 2VT7A 3CRQA 4G72B 3W5VA 3BUIA 4J6RL 2GEFA 5IAEA 4OD1H 1VL0A 3UYKA 3KYKL 2G71A 2ZB3A 1J5IA 4D9JA 3S1AB 1POWA 3EQ6A 4Q7KA 5LDGA 5AYUH 3ZTJG 4B7LA 5IVKA 4JBGA 4K3EL 4LYEA 4AYWA 4P2OB 2GXAA 1KOFA 2Z35A 1BHGA 2VAXA 3AUSA 5J3HC 4FAAB 4U00A 4PG2C 3FTCA 4HZUA 1XMWA 2ZSIA 4BO8A 5C5CA 3P54A 4J8PA 4MQEA 1WBDA 3IDAA 1X1RA 4FEAA 4HSEA 3CKMA 4QXVA 1DEDA 13PKA 3IGUA 4FBGA 1VFAA 3RIXA 3G0HA 1YAJA 1PR1A 3HLAB 4ENVA 3I6LD 3ZNNA 4LKCA 2X7LB 3QWQB 2G7MC 1GGNA 3EOBB 2AV1A 3BGIA 1BS2A 4HFRA 1YKFA 3KYIB 4YP9A 3NCWA 4BJHB 2EBUA 2COQA 3WFDH 5FCUL 1ZNZA 1KBGH 4C6TB 5CTAA 3RC2A 5LXTB 3MRXA 3HFMH 1JWAB 3CONA 4YDLC 2IBSA 5FT9A 3W8NA 3D52A 3WSQH 1XRQA 2HRRA 4BNKA 4YGXB 2QUZA 3JTTA 3HLYA 2WLIB 4OMCA 5CYGA 2C00A 4WASA 2WFLA 1HDZA 2H57A 4NJAH 2W9DL 5H3HA 3IHWA 1YGYA 4F37F 2Z65C 3R09A 3EGOA 5ILGA 1REIA 3SPXA 5GMOA 4E41D 2HO5A 1QPZA 3STXA 1L9SA 4FG6D 4FBLA 3FNBA 4CC1A 5I1JL 3LVTA 1HFEL 4RHUA 4D0DB 1P5VA 3K8LA 4IQFA 4CNBA 2KQNA 5FGBC 4Z0BL 3NBZC 3GAZA 2JI2A 2NU9B 3S37L 4CM4B 5AP9A 4W9ZA 1KIPB 2DT5A 4H0FA 3ARBC 5BV7C 1CP3A 2F1KA 4UAGA 4K5QA 1KJ2A 3K6RA 4P84A 5AWFC 3DJYA 3HRZB 4CMMA 2BEJA 4ZZ0A 4OVKA 2QRMA 2ADFA 3OZDA 4TTIA 1ZR4A 1I8UA 1N6VA 1TFHA 1J1XH 3AP3A 5GONA 3ARSA 3LBYA 1NU6A 4IICA 1OFTA 4R2HA 1BD2B 4IIZA 3KYMA 4OGAD 1QYGH 3W77A 2B5IB 3ZHQA 1O7SA 3HCDA 1G98A 3KCPB 1RH8A 3PWVA 1RIIA 3P1JA 2CA3A 3X3FH 5I9IA 1YE3A 1AD2A 2RKBA 1KTRL 5ALIA 4MTLA 2DLFH 1Q0LA 4M0KA 1WC7A 1OW3B 1P4JA 2QV0A 3GC6A 4NQDA 3R5SA 1ZGLB 3QVTA 4RDQF 3EJWA 15C8L 5HF5A 3EH4B 4YHOH 3NVQA 5E2AA 1QV9A 4FQ7A 1IY8A 3PCYA 2FWIA 4NC0B 2FG5A 2C9OA 5E8NB 4U3CA 1OF1A 3MRLA 4GQPH 1GQFA 1W6WA 5IK3B 1M66A 4YP0A 4GMTH 2H1CA 1T6YA 2ZI9A 1BG1A 1BG9A 2BY2A 2W6JD 5JNRA 4MYWB 4X2UA 4XZUB 3RB5A 3ZG6A 3ZXYA 3G5UA 4O4IB 2AQRA 2NZ9C 3A6EA 2V7QD 4OY9A 2WQSA 4Y0AA 4DO5A 5BXQC 1O9VA 5D71H 5JSUA 4RQQB 2HLAA 1IJEA 1RLWA 3GWZA 2RSLA 3D4ZA 1Z13A 2XQBH 2Q0QA 1Z7JA 2WGNB 4CM6A 4H26A 4BX3A 4JRXA 5B3NA 4KWTA 4A8JB 2L17A 3DDCA 1GL7A 1RLJA 4IO0A 4BFZA 2AN1A 4U33A 3JWHA 4PLWA 4S1SL 4D80A 4WUKL 4KBPA 3CUPB 3VFMA 2XV0A 4U1KB 4I7EA 1H6UA 4TUOB 4DAGL 3P4NA 1XP8A 2P5EA 1MW1A 4AW7A 1WIUA 4MCNA 5LGJA 4XJSA 2REBA 2QN9A 4EXKA 3ZDRA 2YD5A 4FWIB 3PXCX 1DSFL 1NJ5A 3UHOA 1D07A 2V6MA 2DECA 3CNQS 1WZMA 1M6NA 1MRFL 4P9ML 4KQJA 4I66A 3WD5H 3SKJL 1JHKL 3A3KA 3KPMB 1CQIB 1N5JA 2XRMA 3HBJA 3IQGX 5DQJB 5KDLA 4NHCH 1GYUA 3PGFH 3GRGA 2REQA 5L53A 3TECE 2LAGB 5F1PA 4AN1A 2FZCA 2X4NA 1ZVQA 1CI3M 4DVRL 4CFSA 2PX8A 2ZJ1A 3AWEA 2R1WB 3VX1A 3EE6A 1X9LA 3GH1A 3TO4B 3UJAA 3OEWA 4AIZB 2P78A 1P2CB 3PNKA 2P46B 2OMXB 2VRKA 1SEBA 1SCDA 5ADPH 1NY5A 4W70A 1AUXA 1A6UL 4M7ZC 3UDWC 1NFIB 3EGXA 1LPPA 2W98A 1NR7A 2QTWB 3O4OC 2BVQB 3OE5A 1U92A 3RI5K 1A6WH 4OTXH 4FKHA 4BUQA 4KOAA 3G2NA 2R0QC 4ZHQA 1ZXLA 4G5QA 4PV8B 3VR5A 3VBEA 5FA6A 1U04A 2HA4A 4R9NA 4YWHA 3PSHA 4DWJA 1TX4B 3PHIA 2POQX 3QVWA 1L7IL 4DVJA 1E3ZA 4UUNA 5LAPA 1A2BA 4K05A 3H9SD 4IP0A 4Q1CA 3RYIA 4EWLA 3Q6IA 3FRJA 3UAZA 3TQRA 2PGAA 4Q05A 3LXUX 5IFJB 1GGIL 2D3JA 2JAWA 5I6XB 1FS5A 3C6KA 1UWFA 1ISFA 2D03H 3CWQA 1CFVL 3I73A 3SDYH 1BRMA 2K7ZA 1OMOA 1RZFL 3OLGA 2FSFA 1GCGA 4P2QD 3UAAA 3BHBB 2C4HA 4ZCTA 2VJOA 1HE8B 2PMFA 1M5UA 2XCIA 4TOYH 2VXCA 3PWNB 1JRHI 2WXFA 1KENH 3R0QA 3QTLA 3LC2O 2E8ZA 5IUJC 4OKVA 2JFHA 1PK8A 4LWOA 4MTCA 4ZYLA 1MFBH 1CXIA 3SG0A 2V3CC 5KWYC 1S96A 3H3PL 4H7HA 4XX1A 4K3DL 1A4JA 5KOHB 1ZJ4A 2Q6IA 4GI5A 8LDHA 4TPKA 5KB3A 3AX6A 5IREA 4BVHA 4ZMAT 2GKGA 3SYLA 3OM9A 1N0XL 2FUG1 2QDWA 3CN1A