4I1PA

Human malt1 (caspase-ig3) in complex with activity based-probe
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
379
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activity-Based Probes for Detection of Active MALT1 Paracaspase in Immune Cells and Lymphomas.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 110
structure length 379
sequence length 379
chains with identical sequence C
ec nomenclature ec 3.4.22.-:
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4i1pA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i1pA01
2H4YA 4I1RA 4EHLA 1SC1A 2J31A 4ZVUA 4QU0A 4EJFA 3P4UA 1SHLA 4QU5A 1RWOA 1RWVA 4QUIA 5I9TA 2Y0BA 4EHFA 1SC4A 4QUDA 2XZTA 3PD0A 4QUBA 1ICEA 1K86A 1I4EB 5IAKA 4JJEA 3EDRA 2HBZA 2HBYA 3PD1A 4NOLA 3BIJA 3D6FA 2P2CA 4I1PA 3D6MA 5IASA 5K20A 1CP3A 3NR2A 4DCOA 4QU8A 4LSZA 4NBLA 4NOKA 3H11A 3UOAB 1NMQA 1QTNA 1RE1A 3GJTA 2CNNA 4JR1A 3RJMA 4EHDA 1I51A 4NOMA 2XYPA 4PS0A 1RWWA 1F9EA 2C2KA 4NBKA 2CNKA 1JXQA 4EHAA 4FDLA 3GJQA 2H4WA 3V3KA 4DCPA 3KJFA 4PS1A 1RWNA 1PYOA 4NBNA 4HQRA 3NKFA 4HVAA 2QLJA 4EHNA 3S70A 3IBFA 2NN3C 2Y1LA 3NS7A 3K7EA 1BMQA 2WDPA 2QL7A 2QLBA 2XYHA 4JR0A 2H5IA 3EDQA 4JJ7A 4N6GA 3KJNA 4FXOA 3R7NA 3IBCA 3UO8B 1RHKA 4QUGA 4FEAA 5IAEA 2FQQA 3GJSA 2HBQA 2J32A 3SIRA 3V4OA 4D3YA 3P45A 4QTXA 1NMSA 4QUJA 5LUBA 4D3XA 1K88A 2XYGA 4JJ8A 4QUAA 3SIPA 4IYRA 3R5JA 5LUAA 3DEHA 5IBRA 1I3OA 3OD5A 1F1JA 4D3ZA 3V6MA 3DEJA 4QUEA 1I4OA 4EHHA 1RWMA 3S8EA 3H0EA 4N7JA 2CNOA 2CNLA 5JFTA 1RWPA 1NW9B 3GJRA 5I9BA 3R7BA 4JB8A 5H0IA 1KMCA 4QTYA 1RWKA 3D6HA 1NMEA 2AR9A 2QLFA 3DEIA 2H48A 4NOJA 3V4LA 2K7ZA 2QL9A 2J33A 5IC6A 2XZDA 3R6GA 4ZVRA 4M9RA 5IBPA 3ITNA 1RHMA 2DKOA 4N6OA 4QU9A 1M72A 2FP3A 1GFWA 4QULA 2CDRA 4PRYA 2H51A 4ZVSA 1SC3A 4QUHA 2FUNB 3H11B 5IC4A 3QNWA 4HQ0A 1RWXA 3V6LA 4JQYA 1QDUA 2CJXA 4EHKA 5LU9A 1RHJA 4ZVTA 1QX3A 1CVRA 4ZVQA 3DEKA 2J30A 5IAJA 5IAGA 3R7SA 2QL5A 3H1PA 1SHJA 3PCXA 4FGUA 1IBCA 4ZVPA 5IABA 4N5DA 1RHUA 4ZVOA 4AW9A 2C2OA 3H13A 5IBCA 2H54A 4AWBA 2C2ZA 5LU8A 5IANA 2C1EA 2HBRA 4PRZA 4N7MA 3E4CA 1RHQA 2H65A 3KJQA 4DCJA 4JQZA 1GQFA 3V55A 4IEFB 4JR2A 3R5KA 4N6NA 2CJYA 1PAUA 3R6LA 1RHRA 5IARA 4AWAA 2H5JA 2C2MA
chains in the Genus database with same CATH superfamily
4BK5A 2Q8AH 1M7UA 2AHRA 3HJCA 1QCZA 2R751 3DULA 5JAUA 4CL8A 1JBKA 1JA1A 2B2XA 1VJCA 3CRNA 4HRYA 3K5RA 2H1PH 3UHOA 1DX4A 2PMWB 1L7PA 4XMLH 4CUKA 2GAFA 3A4TA 3E4DA 1KZYA 3MLZL 4MAYC 5F73A 3MRDA 3RUGE 3U0VA 4D6XA 5HI4C 2C1OB 2CHNA 1G9SA 4BFSA 2VYFA 2IDUA 5C0IB 3P4LA 5KJRL 4MPDA 2ZBRA 1NQAO 4Q1FA 3M4JA 3RVTC 2VYCA 3AM5A 1YTUA 2FN9A 5IJVA 4CDMA 3UK1A 1V3MA 4LE1A 5DNEA 1CFTB 5CJOL 4NG4A 1IBRA 3VVMA 3QNXA 3QVWA 1W0WB 2CA4A 2MHCA 3W78A 1E7YA 3PXJA 1XGPA 2BGGA 3FO9B 1YUKB 2JLBA 1UXKA 4G4GA 2K1MA 3LBAA 4FTVB 5DMKA 1XCBA 1DBSA 1U02A 5INDA 2XT1B 5DV9A 3DNKA 2YN0A 1RAEA 3CSYA 4X4ZA 1V6CA 3R3UA 4HH3C 4E33A 1I8TA 3JTSA 2HPHA 3ZHOA 5HTKA 4IJ3B 5L0QB 3C8KB 3LH2L 4KFZC 1Y8RB 5BUGA 5BPHA 1HNNA 1QQDA 1KI1A 1P4BL 4Y30A 3GJ5A 5C5DA 3OA0A 1IC7H 3M8OL 1KMIY 2C2OA 3OBIA 4KXYA 4DANA 2I67A 4OV6F 4U33A 4DQOH 3OCVA 4KPHH 3MOGA 1DANT 4LLMB 4K71C 4RL4A 2J8UE 2JGLA 4R3WA 4GM4A 4MVJG 3I3OA 521PA 5EORH 3F6IA 1R37A 5C3UA 3D31A 2Q5BA 4M49A 5LGHH 5AKGA 1MEEA 5MERB 1PAZA 1BOGA 2QJDA 3B51X 1CEQA 1M42A 2CNNA 4AMGA 1YDMA 2NTFA 3DFIA 3QUZA 5DXJA 3KYCA 1SY6L 5EVCA 5M5BA 3U4QA 1OAXL 1ORWA 2QQLH 3F6SA 5EZYF 3MLZH 5ES4B 2OD7A 3MXOA 3QIWB 2ZRDA 4FIDA 2IH1A 5L2JB 5AVXA 3L5WA 1ZSYA 5IKCB 3WMGA 2OTUA 3OGOE 1ZRMA 3JVGA 3ARXA 2F7RA 2DBRA 5EPUA 4QGFA 1CK0H 4I3SL 3IP8A 3VZSA 4Y2DC 1T0OA 3FQ2A 5IBRA 3LRTA 3G9XA 4RHCA 5SZIA 4EA7A 2OL3B 4DA7A 4OJYA 2DQHL 5ESRA 1VZ3A 4Q00A 1R0WA 2VJMB 3IJ7A 5C0BA 2C3OA 3LNGA 2R1WB 4JFOA 2D3WA 3TWOA 5EJ2A 4V1CI 3CVHB 4IGIA 3OZAA 1IUZA 1X5JA 1KKLA 1GGBH 4AQ1C 3FPJA 3ZIYA 3FU5A 3MJGX 2CJXA 5HFNA 2GPNA 1Q9KA 2DF3A 4MKTA 2J7PA 3ZY7A 1FLNA 3COPA 4TKLA 5HD8D 4ZCSA 3UPRB 3O8QA 4C0SA 2YAPA 1TVKA 4UNUA 4U7FA 1IC5H 3X1JA 4TXJA 3AS2A 4A10A 3K6SA 1Z32X 3U3KA 3V4ZA 3AGWA 4C0KA 2K4MA 3BZ4B 1QPPA 4F56A 3BIKA 2WJIA 3KEQA 3OHXA 1RQXA 3VD4A 2B3DA 3I01A 4ZOLA 2YVAA 1SBHA 1NVXQ 5JQWA 2B1AH 4MGZR 4GQ9H 4H1TA 3MUUA 3SMVA 2FO4A 4YT4A 1MCLA 1XF5A 3UJNA 3OLIA 2AKYA 4M5ZH 3F2LA 3MLBA 3CZGA 3WZLA 1L6XA 4HWZB 4M5SA 3TCLA 4Z3TA 3JWGA 1X6NA 1TCCA 3EAGA 4PG8A 1IOZA 3GAAA 3OPVA 1QFYA 1UCFA 2Q0ZX 3PAZA 4WT7A 4MVJI 1JF6A 2H0EA 4MD0B 5SICE 4OZIF 2H9AA 5JSHA 3IP3A 4MEBA 3VXSD 1VXRA 4YONB 1HAWA 1A7OL 5DGCA 3UTTA 5GGSB 3NIDB 3MSPA 5J1AA 1I32A 4HWPA 4FHFA 1GLNA 3KLLA 3B7PA 3RNQB 4YT8A 4MNGE 3MJRA 2GUYA 1OZTG 2HFFB 4PNEA 1UJTA 1SCIA 3ZVKA 3FO0H 1HE5A 1RLBA 4IUYA 1F5WA 2F2HA 2QADC 4ZZ3A 4ODVH 2BSED 3DMFA 4FGMA 4G7VL 3NAAL 2Z09A 2WE8A 5HJ2A 5KX5A 4M43L 1NSTA 5AVVA 1OP9A 4IZIA 5TDOA 2D0IA 4KGVA 2B08A 6Q21A 5GP1A 5BOSB 4TN5A 4Q6YA 3QIWA 1KAHA 4N6NA 3C6LC 3SICE 3L3JA 1WLHA 4DZZA 3QS2A 1JPSH 1CK0L 4I3SH 1DHKA 4ZPTB 4BDSA 1G4UR 4TSFD 4AJNA 1E4VA 1BH6A 3IPFA 2GPBA 4S05A 4I1PA 5ICGA 5C31A 2WIIA 2OTWA 4DPRA 4D0SA 3AUXA 3CCCA 4YAOA 5CDFA 1W2HA 2FSEB 2R1WA 2CYAA 1KELL 3IDGB 2RIPA 2JI7A 4EL5A 4JROA 4OF0A 1WAAF 5DZSA 4RETA 5JSZB 2REXB 3LPGA 1HJCA 2QGZA 2XQYA 3MREA 4MUHA 2OFQA 1HU8A 1VZIA 1BU5A 2XWPA 3LSOA 1PLJA 2P43B 3VXRA 4PRDB 3CM0A 1QATA 4XXDB 3NALA 4HGYA 2EUZA 2ZCKH 3BZFB 5I0XA 1JAXA 2WHQA 3WTCA 4WN3A 3L2OB 2YD6A 1PO7A 3TUZC 4X6UA 4TN9A 1QP8A 4O5LH 3L0DA 4XPIB 4ZEWA 1H3WM 4R4NC 3GMRB 2O8DB 2VXUH 2Z1PA 2ZUBA 2CZNA 4DDKA 3IPXA 1QACA 4PLJC 4AGMA 5COAA 5I9IA 4DN3L 3OZBA 4TMZA 4XPAL 4M6NH 1TJ3A 1QVZA 3A25A 2WUCL 3PXXA 4QFMA 1RAAA 5MEOA 1J0KA 4RA3A 3BXOA 3ZDZF 3U83A 2QOEA 1DBML 3GWGA 2D7TH 4L1LA 3T77B 2HRGA 4YJZL 1Y48E 3QBDA 2AEPH 2GM9A 3AB0B 3U60B 2JLAA 4GEJA 2CN1A 5H37A 4LE2A 1QAMA 3I04A 1FUKA 2VO8A 4MKMA 2YWRA 2I60L 4OXXA 1AXEA 4C0BA 2I78A 1E4XI 1C7QA 4FYWA 1C9NA 2LLLA 4PPFA 4RY0A 4Q4HA 4AH2B 3AEQA 4F37F 2IYLD 1A9VA 3THMH 5FH9A 2QR0A 1T1SA 1X39A 5J8OA 4ZRNA 1GQSA 1NIPA 1T9BA 3DLHA 5GS0H 1MJJB 3TESA 2X0RA 2C59A 4NF2A 4BXOB 4DYDA 4PZDA 4Y1FA 2B1GA 1BQ4A 3WUWG 3K0CA 4HUUA 3RDJA 3FYUA 1G98A 1E2WA 2BP0A 3SZKC 2NU6B 1T36B 3UADA 3CHXA 2EBFX 4XJXA 2OBNA 3NIFB 5F6HI 2J9YB 5K4GA 1JR6A 5E6YA 2XTNA 4PJFE 4PB9H 4WV1C 4TM9A 3IP6A 4MAAA 3U4DA 2XKKA 1XQ9A 4PU0A 4F57L 2C82A 1ULSA 4NENA 1ZUNA 4CA4A 3QYCA 3DQZA 4NSKA 3RSSA 5CCEA 2WHRA 2H7YA 1JTFA 5IT2L 5CCDA 1A96A 4BGVA 1FCCA 1ZNQO 4OLBA 5CEZL 4LASH 4HSQA 1Q1BA 4HEPG 3CLRD 2V17L 2WINA 5JNYA 1JVKA 4ABTA 4R8MA 2YFOA 5FXMA 1R19A 1ETZA 2Z7WA 3TGPA 4QQFA 3DDFA 3NDBB 2WTEA 4C3VA 2BELA 2XKJE 3PPYA 2NY2D 1RZJC 2QQQA 2XN9D 4YDHB 3EJYC 5K93A 1UC4B 4L28A 4G8EA 1NFIB 1MFEL 4YRGA 2UUOA 4LOIA 4TLSA 3HBFA 1Z06A 4FLOA 1BLNA 1EDYA 1E3JA 4B4WA 1T3LA 3TIDA 1N8KA 4XB3A 2BOBA 4OZFA 2I7SA 3MJ7B 5MENA 3DB1A 4NNYA 1MLCA 3MRKB 2V9UA 3UK7A 3F7VA 3H5OA 4IQHA 4ZZ1A 3MA0A 1ZBQA 2HTKC 3SK0A 2YMOA 3BCDA 1QAWA 3EOAA 3ABRB 3QYPA 5HGJA 1P2SA 4J3WA 2FSVA 2G77B 2GRAA 5GGQH 2AEPL 3ESDA 3N85H 5IHUL 2QN7A 3D59A 3H2HA 2H3NB 5SY9A 1XPUA 2B34A 1OCWL 3ZK8A 5EYPA 4FEYA 1Q0XL 3VUFA 3WL8A 3L05A 4QOJA 1WEJH 2DFTA 3WFEL 2XNDD 1SXGA 1BEEA 4N6OA 3OHSX 3LVRE 1SOSA 4HNRA 1Z9SB 1D7FA 1B3RA 3PC6A 3C8UA 3PIIA 4XMWA 1NTOA 2F6AA 4JKWA 1Q8MA 3DIFA 4ZGWA 5JORA 4PRZA 3LN4A 3RS7A 1MAAA 2HK6A 4C21A 3KEDA 2MWCA 2VHJA 1RJLB 4ZCTA 2Y67A 2OCGA 1BD2E 1LD3A 3QIVA 3DM9B 5CB4A 5PGMA 3VDCA 2FRGP 3S99A 1A04A 3DPIA 1Z6ZA 2HHAA 4GSKA 4I77H 3GJXC 3IDMB 1Y98A 4W9ZA 1XNRB 1FP1D 3FOFC 1QI3A 4OPMA 1PNOA 4DEWA 1V96A 2B1RA 1LWHA 3R3YA 2CMGA 1TJGH 4NIMA 4PYOA 1UKQA 2X0NA 3QXXA 2BMEA 3SY0B 4X6EB 4MO9A 1L4MA 1G0XA 3NIFF 3FHLA 1FG2B 2ZOLB 4W9HC 2O3SA 2ACWA 3I5AA 4DSOA 2PR4H 1F3OA 3FYSA 4GSYA 4RVOA 3ZWDA 4F7PA 5E6IA 4LQLA 1W5BA 4B47A 1E2GA 4PC6A 5E5MB 1BWWA 5JAQA 4AM8A 2W00A 5ETUB 2OOSA 4XQ0A 2WJAA 1NR7A 4MAYB 3TJMA 3O9VA 4RKYA 1FVEB 4EY7A 1V45E 1EXGA 1NYRA 1SUWA 1MIMH 5DM4A 5FL3A 4DKEL 3NACH 2DMBA 4S0SD 3CLTC 1K6EA 2PPCA 4W9EC 3MQ4A 3PHIA 2APXA 2JHGA 3ARQA 3GMMA 1N5LA 4HLJA 3H97A 3U44A 3ELAT 1HNXB 3VI4F 4ZU3A 3AVTA 2BEKA 4UEKA 1DWPA 2CVHA 4LF4B 4NAMA 1JPEA 4B32A 3A5VA 5MEQB 1S7RB 4N2DA 1LK0A 4KI5E 4FLMA 3WLHA 1IQDA 4BKLA 2KKQA 4R2IA 1BWPA 1HYHA 3GELA 3QUCA 3MT0A 5IIEB 4HPWA 3LMJL 3D3QA 4HV8A 3LYUA 3QPVA 2LV8A 4XWGL 1R5OA 1B0GA 2HFFA 4FFYH 4JFZL 3MCZA 2PP8A 1CY8A 1E7VA 1KO7A 4CC4C 4LPXA 3UTTB 1UKAA 1UGKA 2YRBA 1W6RA 3FTPA 5EEVA 1NGWB 3RKDD 3DL0A 4PRHD 3QH4A 5DJ0A 3O2SB 3I73A 3CVBA 5KOMC 2LCQA 1ECBA 1VGKA 2G0TA 3UO8B 2JHFA 4TXNA 5A1AA 5AIAA 3LX4A 5IQ7H 1SG9A 4TPRL 3MROA 4YHML 5DLMH 4PSKA 3NZSA 1BJ1J 1DEKA 4HBCH 3GF8A 3N8DA 3D0KA 4NHEA 5G1OA 4OGFA 2QQLL 3GARA 4FR2A 2RJOA 1R16A 3FDWA 4PGDA 2XNAB 4CM8B 1EZZA 3CH6A 1GNLA 2I07B 5JNUA 1NLZA 2WKRA 1U92B 1L4EA 4Y88A 3MUFA 4INPA 4R6XA 2YPKA 1UCTA 3OPUA 1L7AA 2WFMA 5AQEA 1FLRH 3GG2A 4KI5D 1WA1X 2V7HB 1OXMA 1YNSA 2P2DA 1Q9LA 1GPWB 3H1FA 5CS7A 2IPOA 2JLPA 4NRZB 4KKPA 3FNGA 4GOXA 3BA6A 4MSUA 3W2GA 5C9ZA 5EIFA 121PA 4F15C 2R86A 1E9CA 2EDMA 4W7IA 3FMGL 3OZ7A 2QX6A 3UXFA 1FUYB 1X7ZB 3OZVA 3TBWB 5F1NB 3PXUA 1H2WA 1KR5A 2WWKO 2EJUA 2ONYA 3PC8A 3ANSA 4HADA 1RJYB 4AJ4A 2H4HA 1AKTA 4PRDA 1CZUA 5DP2A 3TW4A 2XUAA 5KCZA 4RMRA 4KRPD 3VRIA 1MHHB 1R4MB 4BZ1A 2CGYA 1J1UA 1N1MA 1P4SA 2ZBDA 3RAPR 3ZN6A 3QXJA 4TKUB 1U7ZA 4R7XA 4S2SB 1RZ8B 2KH2B 2R2EB 2CJFA 1NJ5A 3MGCA 1B0ZA 3N0VA 4KQ2A 1YZKA 1O94D 3NCJL 5ER9A 2QENA 2CXNA 4KLCA 2F43A 1CUDA 1XH3B 1YNKL 1B16A 3FYTA 2OV1A 2X1LA 3QLUC 3C8MA 2RC5A 4NSNA 3ORFA 2UX6A 5AB1A 3K0YA 2G5BB 1WDWB 4KXMA 4EPWA 3AJEA 5JPMC 2QL6A 1DMRA 5K05A 1RJFA 1SBCA 5H59A 3KSUA 4INOA 3G5AA 2BUAA 2XX3A 2BCKA 1JPSL 4HGMA 1P2VA 3L4SO 1D07A 1LY1A 3V9FA 4LCWB 3KE8A 3QLVC 2EIKB 3ALXA 2JJ2A 4FFWD 4FE3A 3DROB 1XIWB 4XB1A 5EJ4A 1UP7A 2I7XA 5FPYA 4B0MM 3MX0B 4NKQB 3MRFB 2BP0B 2ZIDA 2JA1A 1GUFA 4HDIA 4C2UA 4JJEA 4HC4A 4LJKA 2ANCA 1ZX1A 4I5BA 1MNAA 1RULL 4EUHA 1NUQA 1PKEA 2DG2A 4QGBA 1U0GA 1A7UA 1EAPA 4UTNA 3JWPA 3L49A 3LUFA 1XGQA 3KPPA 3PHGA 1DC5A 2OMZA 5LN8A 4IXNA 5C2UB 2NT4A 1GEGA 1Z8FA 3ID6C 1CZKA 4IG9A 4RGBA 3IEMA 4G72B 2VRAA 5E2TH 5AEAA 1OBOA 1HO3A 4AH2A 3TJZA 3G0CA 2AIRA 1FBNA 1H69A 4MWTA 3NAQA 3STBA 2J45A 3BAXA 3HB3D 4HDMB 1J33A 3HE7A 3WDJA 3II6X 2I80A 5J2UB 3U3XA 3GRZA 2BWDA 4XC1H 5DVZA 3SKOA 2P46B 1A9BA 5GS2D 4L3CA 3LY5A 1ET8A 4E42A 1KJNA 4PWHA 2XWEA 2DWXA 3V4UH 2ZE8A 4OZIE 1XN1A 4P0TA 4OQ1A 3KD3A 3OGCB 1M72A 1UOKA 1U65A 1DANU 4NM4H 4U63A 3BLPX 1DQSA 3QEHB 3ULSA 3D9QX 1U0OC 2WLKA 3LEVL 2UXDB 4JYCA 2P8PA 4Q24A 2QF7A 2AX4A 1TFRA 2B14A 3V0GA 4O4JF 4V0SA 4PZEA 1K2DA 4AEIH 4QPDA 5SY4A 4O02A 1W1WA 1RLUA 4OZHA 4BJ5A 4TNVF 1ZIXA 4DNLA 4Y2YA 1IBBA 3F3HA 3O74A 3LKQA 1YB6A 3BN9C 4C2AA 4J6EA 1E27A 2MOKA 1Z7JA 1T5DX 4JITA 3UZVB 3U46B 2Q9CA 4QLOA 4UOEA 5GV8A 2FLRT 4N5HX 1MRCL 3V4VA 2VAJA 2TSYB 2FUQA 2O6LA 2YJLA 3RIFF 4HGOA 4KX5A 3BUTA 1YEJL 4R41A 4F1JA 3LIZA 2YNMD 2CPUA 3FZUC 4OVUA 4U7SA 1VCIA 4DVJA 1EXMA 2HBQA 5C5CA 1JMZA 4M46A 5IJAA 1WPGA 1MC8A 2PZEA 3ER8A 2GVYA 2Q46A 1N12A 1PG7H 1VHTA 1UT6A 3P4YA 4QO1B 3ZE2B 4IHJB 4G9EA 4BRJA 4X0KB 4QDZA 1WB5A 4EO4A 4JPIB 3NHWA 4PJAA 4JQSA 4X24A 2FEMA 5KYKA 1A3RL 3FMOB 2OV0A 2UDPA 5H8WA 2I66A 4JO3L 1RULH 2JQZA 4LF9B 2AL7A 3ZTYA 4W6WB 1LGYA 2IQ9H 3TOZA 1SU7A 1WD8A 1Z6TA 1LPOA 3ZNNA 4LL1A 4KTDH 3EC1A 4RKFA 4XCFH 1IULA 4BV2A 1YZTA 2QN6A 1CGTA 5LZ4A 1JT9A 3VX0A 1MR3F 1PZUB 5FNZA 1KGCD 3FQUA 1HK6A 1C3XA 1NFAA 2G6TA 1QONA 3JPYA 2CXKA 4AZTA 1TGVA 1DUIA 4HEMA 2COUA 4L0DA 1OIVA 4BNWA 4JFDD 3BW9B 1XNJA 4JLRB 2JJ1D 4PBTA 1S46A 2ZU6A 4ZK2A 3MYJB 5IB2A 2IANA 2RBEA 5BVPH 3UGQA 5IQLA 2I3ZA 1OLSB 4M8QA 3KCWA 4OLXL 5T1KD 1A2BA 2H8PB 4PJIE 4UV4L 4BU0A 2DQKA 4OQYA 3SFZA 5IBQA 2VT2A 4YXHH 4FOOA 2VP0A 4S2UA 1VJTA 5CGZA 2W48A 1IAOB 2V5UA 1GDHA 3RUDA 2GWRA 5T8KC 1YQTA 4E7OA 3LQFA 3AUFA 4LIQL 1X6LA 3RGVA 4HB3A 2NU9A 2C1OA 3NJHA 2C3WA 2I91A 1BFDA 3EUWA 1D9XA 4B33A 4WJKB 4MA0A 1NQBA 1VKJA 1AAJA 3QDAA 1P6UA 1X1TA 5L88L 3CSPA 1LP9F 3D52A 1CF9A 3QYJA 4Q47A 4JQVC 1K3FA 4ZMZA 1OF0A 5TE6L 1TT5A 5B37A 3WXWL 1LEKA 1FRZA 2FBJL 3OUTA 5GJWC 1OAKL 4Q3DA 2Q1TA 4R71A 3W5BA 5HHVL 5JRZA 3HPJA 3HHPA 2ZKIA 4DDTA 5C8ZA 3G0BA 3NHKA 3LPCA 1P53A 2BR5A 1G6VK 5IVNA 4B4VA 3VSQA 1Q9OB 2P0AA 4FNAA 1QIFA 2XA8L 2H65A 2J9ZB 3LVQE 3HRHA 2ICWB 3UH0A 5K01A 5EXSA 1NANI 3IVKB 3JASA 2CGRH 3D2UD 2DZDA 4G71B 5BV7L 2JE8A 1CI5A 1GYRA 1UVQA 4GOLD 4KSYA 2WTUA 1RL1A 4AT6B 1GGBL 4BMYA 4TV8A 2M6RA 5GS1A 4FYXA 2DQIL 1EZSA 4MVJP 2B5IC 3GR6A 2BUBA 5AT1A 3MLRL 2GNAA 4GX0A 1Y6GA 1AHKA 5F1IA 1CIPA 4OP3A 5L6YL 4TWBA 5C09A 4JLPA 3BREA 3D0VA 5D7KE 4R1LA 1LPNA 4AQYB 1QSFE 1SLWA 1YB5A 5FYLL 3NXKA 3B7RL 3TUIC 2JFCA 2DHDA 1CF1A 1SOAA 3OUZA 4FTWA 4A7VA 1UODA 4PONA 3OSZA 4OQ4A 4WOPA 1L7TH 2OMWB 4FILA 1DO0A 1SUSA 3VDNB 1AQJA 3UCQA 3IF1A 1L5ZA 4J4TA 3I9IA 4K4KA 3MYRA 3O8OB 1CYXA 3VX3A 5CNMA 2BPBA 4PHFA 3W3AA 2YQZA 2PO7A 2YZMA 5I4KA 3VXNB 5L8KB 2OHJA 3W2DL 1Z9OA 3PUIA 2CXXA 4LWPA 4Q1CA 1TM3E 3VD0A 4IHJA 5DRZA 3U1TA 2EFHB 4L9RA 5C1DA 3K80A 2QJTA 4AEIL 3ZIMA 3PQYA 2VSKB 4J2QA 4UU1A 1S96A 2UZ1B 4EG8A 2F9BT 2ZUQB 1T5OA 1S7XB 3A6LA 3CVWA 1WXHA 4EO9A 1RJGA 4JOBA 4GAGH 3D2LA 2M6LA 2VNCA 2EW1A 4QT5A 3TRFA 3NZ8B 3DWTA 1OWRM 2VAWA 3O0DA 1XMOB 3R7FA 1OTTD 3FOMB 1LK3L 1F7UA 3CX7A 1T0MA 4IP0A 1OCWH 3LL4A 2PGIA 2HIGA 1YNKH 1P8AA 3VFRA 4PG2C 1AKEA 2VMDA 1SOKA 3IRVA 1PL8A 1XTIA 4WW2A 4OUDB 4AYDC 2WNKA 3VYPA 3WHE1 5F23A 1KIUA 1NEZB 3E8UH 2DB8A 4NERA 3VFOA 1E1YA 3G8BA 1PD1A 5JQGA 3BSFA 3LZNA 3P2KA 5IFAL 4XMPH 3MRCA 4PYGA 5JA8B 1E61A 5IOPB 3LXAA 4PS3A 3MV7D 1DAFA 4FHEA 2CUMA 5AW3B 5GIRA 4I4TA 3WSWA 4GP5B 4G24A 1UVQB 3IS0X 1SD5A 2XEXA 3KG5A 1CYDA 2O93L 3CHSA 4PRBA 3IFNL 5CN1A 4LMPA 4HIXH 3BQMB 5A40E 2ZP0T 4QPEA 4TVKA 1A7QH 3OKLA 2CCVA 5IAAA 1JJAA 3MBEA 3PWTA 2AYYA 1GPOL 1Z4MA 1MB4A 3A4NA 1SY7A 2W95A 3QDMA 3NTRA 5F96L 3P9PA 2BZ7A 1J39A 1S2IA 3NWBA 3O8OA 2FWRA 1R33A 5B58T 3M3DA 5AVZA 3H9CA 2QUHA 2OXTA 2CFRA 1Z9PA 4KKAD 2R2AA 1AMUA 4WTZA 3FT9A 4FXKC 4QHLB 3KPOA 1IEXA 4KH2A 4JIGA 4E5YA 2LLGA 2HJWA 4LQDA 1TEFA 2X4TA 4JOCA 4U8HA 2I76A 1XF4A 3A3OA 2ZKWA 1ZGGA 1W93A 5SZJA 4JFFB 2CBTA 3A1FA 1YRLA 3LXMA 1NN0A 1RWQA 4EMUA 1A5SB 5C0GB 1NNEA 4BZ1H 1UOQA 1UXIA 2CM6A 3BGFC 3QHFL 4RM2A 3WGVB 4ZW7A 2IHUA 4JCOA 4P5MA 1FO0A 3Q40A 3C1OA 3T3PB 4EI5D 3PQ5A 2P5EA 1KCUL 3RVMA 5HRUA 5JIHA 3SODB 4HYYA 2J32A 5EQFA 4ZS7L 4D4JA 5HDBE 4C4KO 2ZYRA 1O9VA 3C16C 3HUUA 2H4XA 4JUIA 3FFCB 3O3OB 1TC1A 1T8WA 2APWA 1H66A 1D9KC 1WXFA 4FFZL 3FCUB 4ZAWA 2EG5A 2I5PO 2XZDA 4B80A 4QHMB 4WGVB 4GKAA 2RA1A 3SOTA 1E2DA 5LXGH 4V1CA 1URZA 1BXAA 3DD5A 1OB2A 3FT4B 5JQGB 3X2FA 5IF9A 4ZMLA 4DCQA 3QBEA 4CI0B 3LRKA 1LVEA 4D44A 4TYWA 1BX0A 2UYLB 3GBMH 3AF1A 2V5SA 2VPZA 5A1JA 4IEFB 5J59A 3GL9A 1Y4SA 1GAFL 3TFOA 1QKZH 3OJOA 4KKQA 4HUTA 1DCMA 2LV4A 1WSWA 3OPZH 2JFQA 4XO8A 2JPDA 2QELA 1IHYA 3HMQA 2XGSA 5D96B 1J9SA 1L5HA 4WUUA 1QYDA 3C3YA 5CXPA 1I1AC 3ARED 3WRYA 1QSZA 2A6IA 1YBMA 5A03A 3WJ1A 3KPQA 4G8DA 3NPAA 4GOSA 1U2PA 5IF3A 1WD9A 4C58B 2WJHA 2NTNA 4FI7A 5LZ9A 4AEEA 4M1TA 3SDDD 1HEIA 3B1ZA 4DEYA 1PD6A 3VYOA 5E8DH 2PXCA 1VKXB 1JGLL 3ZT7A 4PRAA 3QIUA 1JW9B 4F45A 2E7LA 3B89A 5DHEA 4JCCA 3AW9A 3C5ZA 2FZGA 2IYEA 4PB0L 2QQKL 5IW6B 3AADB 2X4RB 2V7QA 3ZK7A 3ZSSA 1DVSA 1UXLA 5AFSA 3E81A 4MVWA 3AOEC 1K8XB 5LUAA 3R7LA 2VWEE 2ET6A 2G5UA 3W56A 5AYTA 5F72S 1TJNA 4C7BA 4PRIE 3MJDA 3A6FA 5BORA 3CS3A 4FFLA 3LHPH 1M33A 5K3EA 2FV8A 2ZJ4A 4WO0A 3I9OA 3X43A 2NUTB 4MJIE 1QSEA 4BTVA 3WLBA 5MHTA 1RXIA 5HYSG 1AQMA 1RJZA 3C24A 2FUEA 1FN4B 4NQSA 1M6EX 3GRFA 1RTTA 1ZIDA 4GG1A 3LUCA 4N8VA 2C9ZA 2BY1A 3JZAA 4FSXA 1SVMA 1GGTA 2HU2A 4NHCL 3BDBA 3RWMB 4TMTA 3LXCA 1RKRA 1Q14A 1BXUA 2GTHA 3JD2A 2DM3A 1RPQA 3F67A 2GARA 1U9YA 1D0VA 2VR7A 1XTZA 4DNFA 1MWAA 1UFVA 4I0PC 3BSYA 4MCZA 1L5VA 2IVZA 2UZIL 4NBUA 2GPZA 2D7TL 2R00A 3SZGA 1OALA 1YJDH 4V11A 1J5IA 4CQLB 4UBIA 2IAMA 2BW4A 1PSKH 4PJXA 1U2QA 2PZFA 4BKOA 5BZDA 1DJZA 4HQLA 4OJMX 2KI5A 3NVKI 2PG3A 4Q4AB 5L2KE 4Q4CA 3PQ7A 4MQ5A 2V2XB 5AKXA 1YEHH 5FIUA 4B48A 3U39A 3LP5A 3R5XA 4X98B 1IM9B 5FR1A 3IFOA 4TMKA 1R5IB 1P3DA 2C00A 4YDZA 4KWUA 3IBCA 3FLAA 2W7TA 2PXHA 1AB5A 1NKOA 3D4GA 2YQ2A 3VTKA 1E0KA 1EJBA 1Q9OA 5FYKD 1U6AL 4OT1L 1CY7A 3VPHA 1RYHA 2GBFA 3OM3B 4H7IA 4XPZA 3AR7A 3WDIA 2YGOA 4NI5A 5AUMA 1ZMOA 2HREA 4LDAA 4W82A 4U1GC 2EYUA 2Q8NA 2HMUA 6CGTA 1F4WL 2ORED 5EHNA 1I4WA 2X2FA 4P23D 4RWZA 5JYCA 4JHWL 3FKQA 3NJFA 4H3HB 3HJFA 4YJ3B 3DROA 4W5OA 2RGSA 2OGUA 4TTTS 1FZMB 2QT6A 3PJDA 1QAQA 4ZDIA 1UGNA 5EZ5A 3KM1A 4G5ZH 1JXAA 3GYBA 2WIJA 4IOLA 1AHWB 5KSBF 1J9QA 3G2OA 3IN0A 2V2TB 3HSKA 5BQ7A 4IGBC 2G9NA 3QUHA 4EFDA 1D9KB 3W5NA 1RPTA 2QN2A 1NIFA 4NRXA 1ND5A 5DBOA 2ED7A 4MWDA 1HG0A 4PYQA 4LYGA 4UCXA 2YXVA 1T2JA 2WJPA 5AOZA 1K3TA 3ZLVA 4BE9A 2NNAB 3CRQA 3VYUB 1HXMB 3EVGA 3PEVA 3D3VD 5T3ZD 2PGLA 4E7PA 1A1MB 4TMXA 3RY4A 1F4YL 1XWIA 3WKDA 3P3UA 3EHBD 1WXDA 1THZA 3UX9B 1U2GA 4J7XA 1EM8B 4O1MA 5FWNA 3DMNA 4MGEA 2ERYA 2MJWA 1HTYA 1OI2A 4G6KL 1YL5A 4AXWA 3AF6A 4HQQH 2OZPA 2J72A 1ZN9A 3UJJL 5FEMA 1YMVA 4DIUA 5SWQB 2F54D 3NSYA 3W7AA 2VDRH 3T0EA 4PSAA 1ZLSL 2BSSA 3MPCA 4OMFG 2D13A 1FLTX 1NUUA 2PO5A 4BX3A 3SZOA 1FS6A 5HDBB 2ZUDA 1IGYA 4ELMF 2D7PA 4DWWA 4L4VE 2RHDA 3L93A 2WB1A 2D2EA 3WK4A 2EC8A 2W5UA 4JFPA 1OT4A 2MNUA 3F7NA 4P4SA 4QXPA 4H0CA 4QIHA 5CFLA 4OI4A 1AS8A 3TKLA 4OR1A 3ETLA 1UK7A 5IVDA 3TTWA 3T38A 3QDJA 1BOYA 3EZGA 1EK5A 4WNQA 2XA1A 1QTQA 2IC2A 3HHSA 5C92A 4N6RB 1VFBB 5IC5A 3SIKA 4DCOA 1GGEA 4HT1L 4QOEA 3AL3A 1U8XX 1EXDA 4RVBA 3Q6GL 3ZTJH 2Y4OA 2FLWA 2CHWA 2UUDK 5EZOL 5KNBH 4W5WA 4GPD1 2B94A 3NV7A 4DJTA 3C7CB 2BDEA 1DRVA 3GJ8A 3WMEA 2HGSA 4WXPA 5CINL 4EJ1C 1N5YH 2ZAGA 1L9NA 3D3JA 1CFNA 5ALCH 3OG6B 3IOBA 4D8VA 1ACMA 2IF2A 5EXDA 2AH5A 1KCLA 4H25A 4O8ZA 2PUTA 4K81B 1JGTA 1FRGH 3S98A 2LD4A 1PYGA 2CLVA 3HC0A 1IBYA 3L6BA 3M70A 3T9CA 2E75C 5JJ5A 5EIHA 3K31A 3NJKA 4W70A 4NZ8A 1JE6A 4CVUA 1JIKA 3FF4A 1AHMA 4QJ4B 1WWBX 3CNOA 1A5ZA 1U2DA 3V1LA 2F2TA 3I4LA 1MJGA 3AXSA 2DSTA 2GAIA 1KARA 3G02A 2P9EA 4NBZB 5B58C 5A5FA 4NHOA 4ZFFA 1PMYA 3OTWA 4AN4A 2W92A 2AXHA 3RU8H 1LNQA 3KXLA 1SVUA 3KEMA 3H7AA 1TM2A 5FLUA 3PR2B 1SUIA 5ES3A 4HHAB 2Y7QA 3EH1A 3LRLA 5FRDA 2D2OA 3RFXA 4LVOC 3VFPB 5JPNB 5IH3A 1T5LA 4GUQA 2XXJA 1B90A 4OD0A 2UXCB 3HC4L 4NATA 1WA2X 4KGDA 1YJXA 2DWCA 1FJGB 1JPGA 1EE9A 4MOWA 3MZGB 2C7QA 2CHVA 1J87A 3U1VA 5JS7A 4X7SL 3FKUS 1QYCA 2BOVA 3DO7A 4JFOB 4M37A 3PWPD 1GP2A 1DJLA 2XSZD 3LUBA 3GRRA 3CVJA 2QJWA 4J91A 1IOVA 2WMOB 1DQML 3O03A 5EO1A 2Z9BA 1OSYA 4OZFH 4JO4H 1TFUA 5CINH 2HB0A 4B09A 2PU7A 3B1TA 2QADD 3G2QA 1N0UA 3CT4A 4X6FB 2WQAA 1I8KA 3I0ZA 1OLSA 4P5MB 4PHGA 2HXSA 4ORZC 2Q3DA 1TAHA 4NONA 3QE2A 3HJNA 4LTDA 4XCNA 1S02A 2IHBA 1CJMA 3V00A 3PC8C 1FZKA 1NVUQ 2YAFA 5JDSB 1V47A 1G7RA 2WBJB 4BFCA 1VFAB 5TE6H 3DZGA 5LA6A 4AYGA 2XUGA 4L5FL 1CEEA 1FDLH 4U8GA 1BVLA 1N6LA 4IWXA 1JRLA 1QU3A 3ISYA 1X1SA 1Z4KA 3QCUL 1D5IL 2XE8A 4JAMA 4CTJA 1KZ6A 3RAJA 5DN6D 3ELDA 1N7GA 4RISL 3E9UA 4V33A 3LRXA 4HFWB 3ECWA 1NE2A 1ZHLA 1NGXA 1TMQA 3RTLA 1OH7A 1WABA 3VO0A 2CD9A 4RMNA 5AM5A 4OZGB 3EASA 3MPUA 2HFGH 1XL4A 4MP3A 1SJHA 3KS0H 4X7SH 4R7GA 4FNQA 1E4EA 1WY5A 1I24A 3SKMA 3UC2A 4DRXB 1L1FA 1K2VN 2I87A 4CJXA 3IDNA 4XOCA 2XWCA 5DVOA 2PTHA 2RAPA 2EXXA 2Y23A 1FTWA 3BN3A 5DBHX 2EZ4A 4BFYA 4ZJPA 2X53A 4UVIA 4MQXC 3SO3B 1HDRA 3Q7SA 1XT6A 3SSNA 2ZIXA 1HORA 4E0BA 2HMVA 4WKPA 4NWTH 2Y7OA 3ZU4A 2CDCA 1EJ2A 3H1TA 1IEVA 4EI5A 4DXAA 1EJFA 2FKAA 3PLRA 1ZEAH 1IXKA 3VE0A 5DN9A 4QFBA 2EP8A 2WKGA 2AD1A 3GB9A 1ZK4A 3U62A 1OWMA 5B22A 4XX0B 2WZ6A 3BD5A 2FWBA 2B15A 4NQVB 3P3TA 3W6ZA 2J9RA 2YYAA 5BYBA 1I9IH 2WN2A 2I9LB 1WH0A 1YA5A 3NOXA 4HLCA 4JQXA 3IIJA 4H6XA 2WWNA 5EF2A 4FYQA 3MJCA 4NAJA 4M7ZC 1A4KA 2CO7B 3A6JA 1HHIA 4WEUD 4HWSA 1JPUA 5KW9L 3TO4D 1E79A 1F6BA 3H8VA 3FUXA 2QYSA 5JIDA 1JFLA 3BX7C 1UXWA 2CXOA 2IWGA 2A35A 3ZDCA 1N7JA 3D4NA 4UQOA 1JGLH 5FPIA 2Z8YA 3EXG1 3AF4A 3FB7A 4OQTH 4OO3A 1EKXA 5LJYH 5HG0A 4MA1B 2IPTL 2GZDA 4AL4A 3QIWC 4NNXA 1J8RA 5HHXH 3JTTA 421PA 2KZBA 3OZUA 3ECQA 3OKDB 4HMDA 1CRWG 1M7IA 1DEOA 2XQJA 5D1QE 4JN1L 4HJJH 4LIPD 4G82A 1HLFA 4Z76B 1F2XK 1OFUA 5MEQA 1DAOA 4M86A 3BERA 3QNZB 3OKEA 5AVSA 3U1QA 3B5HA 4EEXA 1YH3A 1CMOA 3HZHA 5SYNA 4ZNCD 1EGJL 3T3MF 2MINB 2ANBA 3SJAA 1X15A 4RAUB 4Q3EA 2KPOA 3ZDZB 2QM7A 5CIPA 4REQA 1O75A 1B0GB 4KNUA 1ZY2A 3MNVB 5E2BA 1SULA 2GHIA 4V0KA 4U39A 3TFKC 1M2VB 3JAKA 2VYNA 2PO6C 1LBTA 1SY6A 2D62A 2E55A 1V8ZA 1YOVB 5JYEA 4PJHA 5AVZB 2Y9MB 2ZEJA 1JVNA 1Y8QB 3BXZA 1JF5A 3V4UL 2ZBQA 5FEUA 4HUWB 2BJHA 3CT6A 3ISJA 3ELYA 1JFQH 2Y1KA 2AAAA 3OE7A 4UARA 3ODGA 5CX4A 2V9CA 1QQ6A 2E4XA 1H8NA 1A02N 1VFMA 3OY7A 4LJ4A 3DFFA 3F6EX 4H8WC 1DQMH 4E5XA 3EZLA 4U6XB 3IDSA 1DKUA 1NCIA 5IASA 5GGSY 4C3UA 1A6ZA 1FFPB 2EF0A 3TNLA 3STXA 2EJ1A 4HNUA 5EUQB 1HZJA 1F90H 1AOXA 3V42A 4GLRH 2FPUA 2LNDA 5J12C 4UQ3A 3KKLA 5JPMB 1SR8A 3DGGB 2JGKA 3EBPA 1EQWA 4XX1G 3EYVA 1ZLDA 2JLUA 4M1QA 4FFWA 5KQPA 1FAIL 1S7TB 4LVEA 3TIGA 2ZZNA 5HA5A 5KJ7E 4OKIA 4DLKA 3P3YA 1MJUH 3F96A 1FP6A 2WA1A 3AI3A 4ZANA 2CNLA 3PDIA 1GHTA 5GONA 5SWSD 1FU7A 3L95A 5JZMA 3FU9A 4RNDB 3NIGF 1MNQA 3H8SA 2EIZB 4X9BA 3TQFA 2VSDA 2JKJA 4G7RB 25C8L 1AKWA 3BXEA 4IL5A 1TMGE 4TZ6A 1MPTA 3GJ4A 3LB6D 1ZVYA 2FUNB 4N49A 3HLKA 3MB5A 4A7GF 4Q66C 4Y4KB 2V3EA 1J2UA 3SPVA 4F92B 4AT6A 1K3UB 3HJUA 1EUUA 4RHTA 5I6LA 4OI8A 3R6DA 4Z0BL 1M9NA 2ODBA 4X84A 4QASA 1UJ4A 3WL4A 2VT7A 3I5XA 5IDQA 1ACYH 1A9QA 1EVKA 4XP5H 2VXTH 1ZUHA 4FBMA 5TQ0B 3U7QA 3H05A 1ESNA 1I4EB 4P93A 4R26L 4QREA 3GMQB 4CJ1A 5F21A 2WWTA 4RF2A 3TQRA 5DS8A 3O9MA 3WGZA 1XRLA 1FV1B 3QDGD 1M54A 1ACZA 5C08D 3IAAA 2Q1SA 4GXUM 1YZ3A 4LHUD 1G9NH 1KJWA 4MKHA 1UPTA 5GM1A 4Z3KA 4LFHG 4MJJA 1H9BA 4K94H 4IMJB 3MRIB 2ZRLA 3S35L 2Q0XA 2QRZA 1Z6GA 2PUWA 4HZLA 3KUXA 3B5IA 2EIHA 1ZT4B 1NXPA 1E59A 3VWKC 4PINA 4A8PA 3CRRA 3AKZA 3R09A 3FSOA 2C9DA 1UA6L 2H2FA 4L37A 3UV6A 5I6OA 1C7ZA 2EARA 2IH3A 1KKMA 3QMVA 2K7QA 4NQDA 3BMOA 2ENQA 3TT1H 5DT9A 5AXBA 5B5SA 2J3IA 3LKDA 1PV4A 4CW1A 1Z9NA 4M1EA 3I02A 4JI1B 3VMFA 2W9DH 3O8NA 5LCVH 2YL2A 3IJ5A 3ZG6A 3DTVB 5LQSA 3B2MA 1U3VA 5CP8A 1XZLA 3AL2A 1BPVA 5HPOA 4J5VA 4EECA 2PYEB 1Z6PA 5CIPB 1W0JA 1G2OA 1A76A 3W11D 3M07A 4ADGA 1VM6A 4AWXA 4CC1A 1MB9A 2G4VA 4M3JA 5JIMA 2DQJL 4G2TA 1DJXA 1Y1KE 4FQIH 2EW2A 4X66B 4V38A 5ALFA 4Y1SA 4DO4A 2KPNA 1OLLA 1LNUA 2VQEB 1XNHA 4HH1A 2ZYWX 1M8JA 4DY6A 1KK1A 2Y05A 1QOKA 5LYJF 1XJCA 4IF4A 3ZUCA 3KJFA 1S7UA 5HPYB 4FL4B 1IC0A 3RTQB 5SX5K 1N2IA 4M5YH 4NK4A 1QK5A 3WUWB 1IAKA 3QE4A 4RZUA 5LBUA 4Y1RB 2BBSA 4LCCB 4P6VF 1KEZA 3EMBA 1RI5A 2VH5R 1N9GA 4GC5A 3L1JA 4UM9D 3MCYA 3GUTA 4I3HA 4G59C 3CN0A 2FBOJ 1DAHA 1OJLA 1EBUA 3JV0A 4XQEA 3RFFA 4ZIRB 1T0BA 4XC3H 2G0KA 4Y7MA 5DBEX 3QAZB 4KI5F 2CMFA 3C2SA 1W4CA 3V4VL 4QIRA 1PI3A 4I13B 2Z98A 3DJYA 1IDOA 4I55A 4S1SL 2YA2A 3D3VB 4A2FA 3LOUA 3GC6A 4CEJA 5JW5B 3I9V1 1JHLL 2WUGA 1ATZA 2VNHA 4Q4HB 5I4CA 3PR1A 4MAFA 5DNUA 4NM4L 4Y16C 5DEOA 2KJQA 2G3ZA 4BRUA 5AZUA 3O8XC 1BDHA 1PCSA 2OC9A 4H59A 2ZAOA 2ORBL 1F2UB 3MOIA 4HLNA 1NR1A 2WT4A 3KCPA 4CLXA 3PT9A 4O1IA 4YH1A 2MSLA 2QDXA 3A9VA 1JWLA 1XP5A 4NUJA 2JIOA 2O1WA 5G4LA 3BP5B 4WCDA 4FVTA 4ZQBA 4JZOA 4OGQC 1UJMA 2W6ZA 2KBEA 5TDNA 1WY7A 2C5FA 4Z86A 2X2OA 2DQ6A 3Q2OA 1HVXA 2WXJA 5GONF 3GI9L 2FZWA 2APJA 1OB1A 1G42A 3FZYA 4YXHL 2AKRA 2AN5A 2AUNA 5BSTA 1RWNA 3SYCA 3WV4A 3KFVA 1R00A 1NGXB 3DFMA 1AGCA 3PP4H 5L2KB 3US9A 5IIEA 4OLUH 1WB9A 2ED8A 3HCWA 3ZV6A 4N9QA 1JAZA 5T3ZL 2C7GA 1TK2A 4MSWA 5EO0B 3NANA 4FR0A 5F7JA 2DIBA 3WY3A 2NZUG 1TCVA 5FTWA 3HOGA 3C12A 1J70A 2D5IA 4EN2A 1RWMA 1P19A 4FXLA 4Y9BA 4QGYA 4LOHA 5IVKA 3EISA 4GRLD 3VQ1C 3RL2A 2WDZA 3BD4A 2QXYA 4FMDB 2R2BA 4FNUA 2ID4A 2WLZA 3E9EA 3VBCA 4ENVA 4K0RA 5FR3A 5KAMA 1AQDB 3Q3GB 4AUJA 1NBEA 1X1DA 2ZKHH 4F57H 3VXUB 5F3RA 2ZBFA 5D72L 5KNDA 4UM5A 2GEUA 1FL6B 3F73A 4P23B 1SDAB 3BEVB 3DETC 3S7GA 3VFWB 5ANHA 2ZXAA 3RODA 4C7OA 4YSUA 4N3GA 3GH3A 5J89A 2C9MA 3J7AC 3HXOA 1AO7B 4EITA 1ZD3A 1KC5H 1U7PA 3VWKA 4LSSL 4IV5A 2GYSA 4R2GB 3SDBA 5TGBB 5B3KA 1SXSA 1QH1A 1D5MB 4AIEA 1XE3A 2NU9B 3H3PL 2OYLA 3NGBB 1G5QA 1YS6A 2BHNA 3CZ4A 5JOEA 4K05A 3OJ0A 3LC1O 2D4AA 3ZHBA 2Q0QA 1UACL 1TUGA 1OOEA 1JQEA 1SUEA 3O6KH 1I82A 4ZOBA 1MFAH 3SE9L 1QOPB 2CXGA 3EGVA 2NY6D 2NT3A 1CUHA 3QEBZ 3X1WA 3H5WA 4J2OA 2CEKA 2HVBA 2A6JB 2K70A 3I6BA 5DHRA 3QITA 4C4SA 3X11B 2Q7XA 4G8IA 5KBMA 2FWMX 2PKEA 1E2KA 4ZO6A 4JNXA 1PR6A 4B9CA 1A27A 1HXYB 4KSCA 2PT6A 1YEDB 1KOLA 1PSKL 2O2ZA 3ANTA 4TULL 1E1KA 4PEVA 3EIQA 2GZSA 4YUXA 5IREA 2NY1D 2N59A 4KH9A 2VSNA 4M48H 2Z0BA 3JQRA 3FB6B 4UB0L 4EUNA 2PYDA 3JVEA 3HJHA 2Y7QB 3OE5A 1NOIA 1T6XA 3E9RA 2NAPA 4EUPB 4UCFA 1J5OH 4FEEA 1U9IA 2HLFD 3MRBB 2ZZUT 2VFAA 5LXGL 1J8KA 4L5FE 3LEVH 4P4RA 3WXWH 1T9AA 2E4ZA 3WGKA 3CZFB 4ZUVB 1ZGLP 3KB2A 3KM0A 3DO4A 4M4SA 3Q8KA 1EK3A 1WE2A 4TQHA 1S1CA 4YV2A 2CL5A 3L4WA 3Q8CA 2VXBA 2W0MA 4EZBA 4ZVPA 3H19A 4NWTL 3PQYD 2VZUA 4OLWH 3WMQA 3JQBA 4GS5A 2GVNA 3ETHA 4UT6L 2PPEA 1NYTA 3OAYH 3ZYZA 4CMGA 3ARGB 3OTOB 1D1QA 1SZJG 2XMZA 5E4JA 2RHOA 2DV6A 1GWNA 1SVIA 5TPWH 1QCCA 3T5AA 1MQKH 1B6GA 2II6A 4EQZA 1AI1L 4FN5A 3E22A 3GD5A 1BMDA 1I1RA 1AK2A 2PMBA 2VDJA 2I1VB 3WQHA 1RVDA 5HCUA 1HM5A 1BIHA 2A67A 4WHTB 4CCSA 4GXTA 4XYGA 3UJTL 2AJVL 5L8LB 5SZKB 4HKXB 5HXMA 1W5EA 3I6KB 3LRSA 5JEEA 5IBUB 4CIXA 1P84K 1U5BA 1M76A 4N39A 3IPBA 1Z0ZA 4OQTA 5CA1F 4RVUA 4FG6C 4XP1L 4A2WA 5AOAA 3N58A 2C7RA 4C76A 4UHKA 4QRRB 3KR3L 3EJCA 3CX5K 1U94A 3F8UB 4DIXA 3FTNA 4WZAA 4BA0A 2Q6OA 4G80A 3HFRA 3TV3L 4PLTA 3V7UA 5DKFA 2DM7A 3UZQA 2XVGA 1ZXLA 1SC9A 5DUPH 2X70B 1ZOPA 2WYIA 1OSZA 3P4MB 4CUCA 2XQKA 3BP6B 1QWOA 3FO9A 1MG5A 4ONHA 5HVHB 1U3HC 4ZX4A 1EMDA 3RU2A 3H75A 4RBPK 1KEUA 5ITZA 5AW8B 3OT1B 3FJTA 3K3PA 1DEAA 1L5FA 4P99A 3OJVC 3IEKA 4QI3A 3I6GB 5JCJA 1KBPA 1N2HA 3MZ0A 2BI4A 4KP7A 1QMGA 3W39B 3ONEA 4JCMA 1XCMA 4IFIA 2ESVA 4WUKL 3L9YA 2FFQA 4KPUA 2ACEA 4PQEA 3B1UA 4LC0A 4KPEC 1Z6YA 4NTZA 5A0VA 1SUJA 1I1OA 2VXYA 4R01A 4PZLA 4BNTA 4F1KA 2JGNA 4IBTA 4LKXB 4QT4A 1FNSH 2YD3A 3SDDB 4K7PL 2UZIR 4HB0A 2JJUA 2Q3ZA 1PE0A 3CO0S 1ID8A 1CC1S 4C56D 2O2DA 2AP2A 3FKSA 5A43C 2AF3C 3CFJB 4LSPH 4DS3A 1AP2B 3UBGA 1IM3B 1KN2H 5WRFA 3DXAD 2IDFA 4OFVA 2B77A 2RB8A 1JDNA 1KAGA 3SE4C 3KSMA 3KQSA 4FX2A 4TYPA 4QEDA 5EJ7A 1EG2A 2Q4TA 2WVUA 2AJXL 3LGSA 3B2QA 1GKEA 3EUFA 4JDTL 3DX3A 1DV1A 4NJMA 1RYNA 3PGXA 1PP4A 1N6UA 4BRVA 3VFSA 3VXUE 1PG2A 4EKGA 5K3FB 1PWYE 4XRRA 5DMYA 2FRVA 2XNKA 4IHOA 5DHSA 1KB5B 3FUCA 5M95B 4MQ7B 2WB2A 1Z5HA 4OBXA 4YPGB 2R7LA 5AD1A 3EYOA 3VR4H 2H2AA 4A6PA 3UL4A 1PJWA 2O5EA 4HC1H 2IH3B 3DVGB 4KVCL 1JIXA 1DN2A 2Z6QA 3FTGA 4MH0R 3SJUA 1TCUA 2ST1A 4UVDA 2HOQA 2Y0EA 2X12A 3F6CA 2GCYB 3J07A 4FUTA 1OAZL 2C9XA 4HFUH 2JEZA 4M1YA 3J81A 4Q1AA 1WS7A 2NTEA 2IHJA 1M0WA 1NLBL 3WN5C 2CDAA 3BZDA 4NJ9L 4D8OA 4WW0A 3KDSE 4DESA 2O0JA 4AY0A 1TM1E 2IKQA 1RE1A 2YA1A 5BMVF 4Z18A 3JALB 1RXUA 2X9VA 4KLZA 3ENKA 1B0PA 2HTLC 5EOQH 2RFXA 2HT1A 3QVGA 4KPFC 1R5WB 1Y42X 5JHHB 2FPPA 4LYDA 1NAKH 2FWUA 2FW9A 1AIZA 5CXSA 1E9SA 2ZWZA 1TTUA 4FN4A 4TTAA 5EI5A 3H42H 2OHXA 5KYNA 4JKOA 2VLJE 3KWLA 5KBDA 2VDWB 2HCTA 4UVGA 3LZRA 3A0RB 4TQGA 1ZTMA 1O95D 3QWIA 5FBHA 2QYHA 4YVNA 4IVNA 3G2IA 4UCWA 3VR2D 1BM3L 4B74A 2CHFA 4QM7A 3ZGOA 4PJDB 2DH6A 2QGCA 2F8LA 4LOAA 4C83B 5TE4H 3HG4A 3L54A 1Y9ZA 3FTWA 2NP7A 4BZ2H 4E08A 4XPGL 5TH2A 5DJZB 2UZIH 5CB4B 3IJSA 5LGJB 4ND3A 2LTQC 1Q15A 4FMCF 3GIDA 2JAHA 1GU0A 4RMBA 5FW8A 2IDTA 3MNVA 1EESA 5K8CA 1HILA 1SVCP 2Z4RA 3HB7A 3WX0A 4KAXA 2ZOLA 4EYKA 2CKMA 4D0CA 1FSSA 1SBZA 1FFXB 1KMQA 1JPST 4ND7A 3WXVH 1RFDH 2OGTA 4G7YH 4YBHA 1T4CA 2PYIA 1JB1A 4ZQKB 1NF9A 1WF3A 3LWZA 3CCHA 3S2SA 4HDNB 4AC4A 3RFZB 3QE9Y 3C3BA 4KXCA 4C43A 4Y2XA 4XBEH 4GMSH 3NWEA 1UKYA 1DG1G 3C2QA 4PR5A 3QUXD 1QF7A 1QYRA 5AR1A 3GIZH 3OWEA 1L3NA 4ODSH 3O8BA 4QHPA 2QVCA 1F4XL 2EINB 2VP6A 5DD5H 1ZN2A 3MLPA 2HVJA 1Z5GA 4RD6A 4WNYA 4B3MB 5DC9B 1DBAH 2YHGA 1J8SA 3RVDA 4IBUA 5D1QD 3RAJL 4I5DA 4UIKH 2IIPA 1W47A 5IZCC 1ZDMA 1G20E 4EN3D 2O3JA 3FRPA 2AABH 4IKJA 4X9FA 1FZMA 3F8TA 4X1OA 3L1FA 4BVFA 3W7VA 4JBXA 3M1LA 1ZQ9A 1PJ8A 3IU3A 1TLMA 4AMBA 1Z2EA 1M6HA 2QUJA 4UBDD 3TZKA 2AMGA 3AQDA 5LXTA 3MJ9L 4ZVMA 3R6TA 1M8PA 4ZEOA 5T6BA 1ZGZA 3JQ8B 2Z8SA 3MTEA 3HZYB 1O7VA 2WG0A 4D42A 4AW9A 1XTTA 3IX7A 4EI7A 3KCQA 2CIIA 1NOAA 3NCJH 4RFOH 2OXFA 5GVRA 3MV9A 1D2EA 3HN7A 1O9ZA 3HBJA 1N32B 4JCLA 1FX1A 1U8IA 1S9XA 1ZGLB 2Z31A 4CF4A 3PQCA 1Z88A 2QTHA 1KG0B 5E2WH 4YJFB 4BQPA 5EUKB 3R8QA 1FNLA 4AKHA 4YH6A 5EXXA 1V27A 4HPJB 1WBZB 5DTQA 3CQ9A 4RVCA 5TK2A 5BYJA 3HO6A 4DRXA 3GJTA 3IJ8A 3L5WB 4DG9A 2I6GA 3FUNA 4FGWA 1UT8A 2CBPA 2N3ZA 3Q6FB 4UNTA 3PCYA 1C0PA 4UFOA 3W81A 3NJ4A 4XPHH 4E0RA 3NS7A 4C3OB 5EIEA 5JNVA 1BXZA 3RSGA 1D2NA 1U7TA 3WELA 2VC2B 2QT0A 4OAWB 3MRXA 4DA9A 4G8JA 1UZNA 1F97A 2PQ0A 2AQRA 3VXQB 4DNQA 3QEGL 4G0MA 5E6SB 4M9PA 2C5DC 4E70A 3A24A 1Z45A 1UBRS 1MELA 5HIMA 1W6LA 2X5JO 4MYDA 2AT1A 1INQB 4J0QA 4ZYLA 1MF7A 3FSGA 3B3GA 1NCDL 3LHIA 4ZX3A 2QFRA 1UZ6E 5EMKA 3BVNB 4EB3A 4EFLA 3V6LA 5DUML 1GPNA 4BDVA 2EIXA 1PVHA 5CWSA 3W3ZB 4R9NA 4ZTPH 3QRBA 2WXMA 4FCTA 4H7EA 3QCUH 4TZTA 5CB0A 1PIGA 1R8SA 2NR6C 4GP4B 5HMMA 4CM4A 4NV1A 1NDQA 1QQBA 3MV7B 4HAGA 2WU0A 3DHWC 4WU7A 2A5LA 3F83A 2YBGA 3DAFA 4Q7KA 1YMQA 3E8MA 4EIWA 4L9AA 3HDJA 1HC7A 3C3XA 2PK3A 5CX1B 4JHWH 5EJ9A 5T5QA 5AKSA 1FNGA 5HE9A 1ARZA 3RYIA 5I6KA 1ZCFA 3VH1A 1CDDA 4UAVA 4MRRA 3APNA 2PCFB 3CX5J 3EDQA 4KXWA 5JDCC 4PR5B 2LGJA 5EN4A 3ZCUA 4N87A 3LCYA 4LOUD 4C4XA 5A16B 3ADKA 3NTUA 4OKVB 4PSRA 3TBYB 4H7DA 4QEKA 3WS6C 4OHZA 3MNZA 1SVLA 2PNDA 5KSBB 3QPUA 3AT9A 1O77A 2PKYX 2FVNA 2VDOL 1GZ5A 1GZPA 3PC3A 1L7QA 4HCFA 4DO5A 3OE1A 4ZT1A 4JBHA 1GPDG 5JJIA 1U0SY 3DTYA 1XSJA 5CVDA 1DC8A 4N5NA 3PDGA 4LLYA 4HGWA 1U41A 1E3XA 5H4ZA 1S9YA 1W30A 8LDHA 5EMNA 5J6GB 4Z4EA 5DYNA 4AYEC 4L2IA 4RO0A 4PCSA 1F42A 3Q6MA 1FW6A 2WUBL 2OCBA 3ZE8A 3VG9C 1P0QA 3JVFC 4OX9B 5I66B 4ACTA 1KFCB 4L4VD 2CFCA 1QG6A 4LXTA 5JO0A 2DLTA 1RPZA 3PIRA 2DFKB 1TECE 4OGAC 3SC4A 4P48A 3QFHA 4PVNA 3GFOA 5A5EA 1JHYA 3DCYA 4OIBA 1Y6NR 2IUYA 2EEZA 4PCUA 3T09A 3U6XS 5ICCA 2HFTA 2OMZB 4G81A 1TQDA 5EZYB 1OL0A 5D7LE 5IB3A 5CNIA 1T2AA 3ZVRA 4KY1L 1R8XA 1TIUA 2A6PA 4BFLA 3A36A 1SJXA 2PXYC 5GMOA 3MLUL 2ZUEA 2IQIA 3TT3L 2ID7A 5ALIA 3TSOA 3D2TA 4IX9A 1RIUL 2HJLA 3DAOA 1LO4L 2ODIA 2FEWB 2ENYA 5IUCA 5J6HB 1BBJA 5GS0D 1KVQA 2CKBA 3VOBA 2FI1A 2WYUA 1UC9A 5BXFB 2QL7A 1QRNE 3UDWA 1KH1A 3T4PA 5E0QA 3UT0A 3UB4A 1FB5A 1WXGA 4UZGA 2RJMA 3RI5F 3E2IA 3S36X 1XAIA 2AJZB 4MW5A 3OPMA 1UMCB 1YZLA 2X6MA 2HEIA 5IMKB 2C9QA 1GRCA 1P80A 3L7KA 2WBJA 3BFQG 2OW6A 4JY7A 5CX1A 2JB6B 4GSXA 1ZMRA 4W7SA 3HC7A 4QRSB 3ZD7A 4QJIA 35C8L 1PQZB 1JHQA 4R0MA 2VRCD 2MSPA 4MQFB 1KDVA 1OF2B 4W6YB 5KS9E 1MDTA 3K81A 1XWFA 2ZE5A 1O6CA 1AGPA 1YAIA 3SHSA 3ABLB 3VR3D 1A3LH 3VUEA 3D64A 3B8SA 3IQZA 1UAAA 2A38A 3WICA 3UZVA 4H4DA 3N85L 5IHUH 2DPLA 1CE6A 4EABA 3AAZB 2XNDA 3GO1L 1HOCB 3TEZA 3GT4A 2VABB 3HC3H 1V6SA 2MU1A 5C1IA 4RWYL 4ALAL 2WKPA 2WY2D 1A1SA 4JFRA 1O89A 3DKRA 1NEUA 4PTUB 1PLKA 4B4UA 3VRJA 4I89A 1SM4A 3CR3C 4RFSB 4QXTB 3ML8A 4EHAA 3WGHA 3INUL 1JEEA 4JS0A 1R2QA 4HVAA 2TMGA 5DURB 1XMWA 4U02A 4ISCA 2H6EA 4JRYA 4P2QA 1AB6A 3TH2T 3ISRA 3TAUA 4JSRA 1VPOL 1N6IA 5FK9A 1BWMA 3C3KA 3IO3A 5LUMA 2WD7B 2G28A 4JL2A 1UDAA 4Q7EA 1PR5A 3WHXB 4P9ML 2JDID 3PGVA 4OGAD 1IBGL 4TSCL 4L4XA 1UJNA 4XFJA 4Y2TA 1B00A 1PQYA 3VW3L 5T67A 3ZXSA 1NVVQ 3K8YA 2GUGA 5CJ2A 2AJ8A 4HYTA 3UJ6A 5BMFL 3FVTA 1MRDL 3E35A 2L2QA 1G63A 5IB4B 1D6VL 2CR0A 2IXQB 3WKCA 4QBHA 4IUBS 2XHZA 4H8VA 7AT1A 5JDCA 1FYVA 2E6JA 1NP6A 1KSFX 2EKZA 2HW8A 3RPIA 3FOBA 2VMFA 3MNWB 4BO6A 4J1UA 1OU4A 3QUML 1EAMA 1L5RA 3O4OB 1JNNL 5LN4A 1T5TA 1JG3A 2ZX9A 4ZVLA 1BX2A 3MACH 3PDHA 8ATCA 1ICTA 1NMCC 5B39A 3UK2A 3G8CA 3CIAA 1IXZA 3IJRA 3B85A 4MDFA 4ACBA 2PPAA 4Q9CA 1JAHA 2EWVA 1QX1A 5DYIA 2QDWA 3D09A 4H8PA 3U4EB 3S5JA 4PJBB 1MCBA 5D71L 2F18A 3HABA 4MAUL 2BF7A 3AETB 2FECI 4RZCB 1JF1B 2Y36H 1OW3B 3HO1A 3ADBA 4GOND 4EDXA 4GKSA 1V39A 2OQVA 1IBDA 4BV8A 1RJ9A 4L76A 4MVCA 3RDTB 1UWCA 3TVMA 4LLUB 4K55A 4MFHA 1YLBB 3A4IA 3COJA 4KPHL 3VXSA 4FR5A 3M1AA 3D2AA 5CSZB 4R5TA 3SKJL 1AF4A 3HBAA 1K4DA 1UXSB 4RFOL 3TNNB 1FFSA 4Y2LA 1HQDA 5MN6A 4LSQH 5KVEE 2ZJ2A 4NFSA 3LN5A 5F8RC 2DQUL 3OPYI 4MVJF 4BLRA 3SKUD 1P7KA 4RFSA 1LLAA 4L4YA 2HX7A 1Y6MR 1JGDA 2XSKA 1O54A 1MCDA 2NVUA 5FCUL 4JT8A 4CLRA 1JEAA 4O4YL 1PEDA 2A74A 3V6ZB 2QTTA 4B5LA 2P9QA 2QLLA 1VLQA 1YQGA 1BCRA 1M0TA 3H9SD 1R1CA 5JHDD 1SOUA 2AGJH 4N03A 3SBOA 1I8UA 3GHEL 1LDBA 3WQQA 3ZOKA 3WDMA 4E2FA 1EHLH 4DJAA 3L0PA 5JPMA 1L7MA 2Z04A 4MUKA 8FABA 3BPNB 5EQJB 2CLVB 2VDPB 4YWJA 3IQHX 4I18C 3IE9A 2WRZA 5BO1L 2VHZA 4KMTL 3VXMA 3Q3CA 5D7LB 1RUAL 2QQFA 1SB8A 3SYRA 1SLVA 1K08A 5EDXA 5DMJB 4HQ6A 4CIBA 2HLAB 5CN3A 4KQ1A 3DYIA 1DAPA 5FHAL 3QX3A 3RWJA 1B2YA 1OAJA 2FB4H 3OC0A 2MIIA 1Y81A 1VBMA 3JWNC 3QJTB 4CN6A 4JI7B 4K86A 3KGUA 2YBRA 4JVMA 5IYZF 3PUCA 1NFDB 3W05A 1FL9A 4WUUE 1E96A 1TO1E 1J1OH 4W5JA 4GF5A 2A88A 4HJUA 3FBGA 2HKFL 2VE6A 5AD0A 1R75A 3ARGC 4QNNA 1J7VR 4WASA 5C0JB 1TNMA 1N77A 4HF5H 1UZAA 3OQ3B 3ULVL 5EFIA 3O45A 4YXWA 1A6ZB 1FFPA 4PYRA 4Q58C 1RZKH 1G66A 4PIVA 4UVHA 3KGTA 1DPGA 3N6RA 3NTCL 3HKDA 1KDRA 3MCLH 3E5HA 3COWA 3VYVA 3N6VA 4FJZA 3JCZA 3DRQB 4AO8A 3PUYA 4FP8L 3EDCA 3IERA 3K8KA 4YTEA 1JWMA 2AEJA 1GH7A 4BO1A 3T5BA 2R1VA 3UGTA 1JXJA 3OB0H 1DXYA 2FBJH 5EKSA 2GMWA 5G0UA 1RI2A 3KB1A 1NFFA 4G42A 4QM6A 1JDAA 2UZXB 4GBXB 5CDGA 3F6YA 1GGYA 1SU8A 4TRPH 4O4IB 4M6NL 4ACAA 2WZDA 5BSHA 5T1LB 1TW3A 5HZGA 2FVYA 3GPBA 1I36A 4JZJA 4TUYF 3WMXA 2XVBA 5D7JB 4LA4A 3P1VA 5ESQA 2PMCA 4XYBA 1V1JA 4BH8B 3UG4A 4G5HA 5JDIC 1KF0A 3AOGA 3X2SA 4ABWA 2HSGA 5JECA 4LXXA 4OA8A 4MRVA 1LQ2A 2WF6A 4WCYL 3WS3B 4A0RA 2LUOA 3D3EA 5DE3A 4IRJC 2IH8A 3PRJA 2H7XA 4UT9A 5JAHA 1S9HA 3QJHA 2B2XL 2YQ4A 5DUBB 2H92A 1V54B 5DS8B 4KQ9A 5KSAA 2PCFA 4NC2B 2H9GA 3V0HA 3JD0A 1XEWX 1T4CB 4XIJA 1JGUL 3U7QB 2XTJB 1RRVA 2JELL 5ANMB 3PFGA 4QU9A 1L0YA 5D72H 2R6GA 2R56H 3P20A 4H3KB 4YRZA 3ZMNA 4Q74A 4KJQC 3B1VA 4DDVA 3U30C 5CM9C 2H1PL 2CDNA 4F7TB 1HWYA 4HJXA 4PYJA 4F8QA 4MNTA 2GQ0A 3V2IA 5A5VA 5DOZA 5FDWB 3VDAA 4I1UA 1C5BH 4EA9A 1JGEA 2EW8A 1I01A 1FXWA 2UZAA 4NOKA 3WNNA 4LW8A 2CU9A 3D4BA 2GFIA 2FT7A 2YRFA 3RX5A 2WCPA 5DIFA 4DSTA 3MILA 3NUQA 5DF1A 1KXTB 5AZEH 2I7OA 4FNRA 2WUVA 3TPUB 1A71A 1DU4A 2EHJA 3EQ7A 4G36A 4MZIA 2QVGA 2NO7A 5I1EL 3HU1A 1FHGA 1JXQA 1A21A 1PX3A 2Q2WA 3R2JA 4JUDX 3AFGA 4WLFA 4ZPJA 5LIPA 1CTOA 4Q9RH 4P57B 1XTKA 5CMAB 3CF0A 4HDAA 1L4LA 2ECFA 4UTCA 3D6UA 3X44A 1XMJA 2XZQH 1BPLB 1CDHA 3G1TA 3MVSA 3D25A 2IDCA 3QG7L 1UWXH 4EW3A 1E1LA 5EINA 1HFJA 4HK0A 4LZOA 2FUKA 5DJAA 1N8ZA 2HEGA 4I4IA 32C2B 1IN6A 3ORJA 3ZJUA 3T3ME 3M4YA 5BVGB 1QMPA 1UOEA 3C14C 2WW8A 5DDHB 4X1KB 3E18A 3U7WH 3C45A 2WVTA 5CZVH 3PQYE 5D2CA 1GY1A 1ZGLM 4DMRA 3FPXA 5AVYB 3T41A 4C07A 4XVUD 1IYZA 2DLIA 4GP6A 4OMCA 3WS7A 1C1EH 2NUAB 3EGDB 4A8TA 3GRUA 4WTWA 5DZAA 4H1VA 5KVVA 3A2MA 1KPRA 3NSJA 2C8LA 1Z3RA 2IXTA 1UZ6F 3GNML 2VUUA 3SDAA 5CLQA 2A6KA 3A6CH 4GXVH 1Y4ZA 3FPCA 3I9GL 2IGFH 4F5CE 4Z54A 3UA3A 3GLIE 2CNWD 5EZJB 1IC6A 3EDMA 4ZFNA 3EDRA 1AUQA 3Q11A 1SBYA 3CONA 4N0EA 1AK9A 3QDME 4F58L 1EFQA 3UJHA 4Q21A 2AW3A 4UXJA 2ZRCA 1YO4A 1A9YA 1JIQA 4NRDA 3OZ9H 2X4RA 4QRPE 1I2MA 3HI6A 2GI7A 5CGMA 2HKFH 4ZQEA 3IVXA 3SR4A 1KDZA 2QAGB 1GZQA 3NCHA 5A3IC 2DMCA 4H77A 4BE4A 5G2NA 3U7IA 3HFMH 2JK0A 3QLTA 4ZNEE 5JHDB 4L74A 3FO2A 3WYRA 5B1CA 1RY7B 3KL3A 1INEL 4Y9FA 4HKBB 4JO5A 2ADMA 3S5LA 1M56B 5D7IF 4GPIB 4EN3B 1Z5ZA 1AO7D 5CLHA 1NKGA 4XN9A 1BQ3A 1BD3A 1XP8A 3M1IA 4LK4A 3PL6A 3P0RA 3AHEA 3ASWA 3ZU8A 5DSXA 4FGKA 3E1SA 1NZDA 2EH8H 3GZOA 1A4CA 2PR9A 2VDNH 3BK7A 2WQWA 3HWX1 5E8RA 1W96A 2JI3A 3IIMA 1LK7A 1PLCA 2DYPA 4KZKA 4BVLA 4KROC 3MLSL 2XFGB 4DLLA 1J8FA 4IIVA 4I9XA 4MA8H 3IMWA 2FHSA 2OYRA 3IH5A 5I28A 3VR3A 5IAKA 4F80A 5C97A 3EMDA 5C0AE 2E21A 4WVRA 2XYCA 3A6GA 1QJ4A 3BOSA 5LB2A 1MQ8B 4F58H 1RRFA 2FJUA 4Q03A 5B1YA 1NGYA 2ZSVA 4OLFA 3D8RA 3AHIA 4WKGA 4K7PH 3I62A 2X6QA 4IU2A 4UEJA 3DL7A 4WZZA 2GTWB 4EGJA 3NJRA 1USVA 4YHYB 4HCRA 4K3DH 5E4EB 2W80C 5D1ZA 1J1IA 1H22A 4KRNA 3O4LD 1OCOB 4FOPA 4JC0A 1SF3A 4YYEA 4R2JA 3W1VA 1X1CA 5K8VA 2H4FA 4A9AA 1WZ1H 1Y4AE 5A4JA 3V5NA 3BDAA 5KKCA 4GAJH 4WW2C 4BFIA 5KQMA 5IN5A 4X94A 2WP3T 1J0ZA 5A3ID 2VLKE 2NY0B 3KQMA 1YQXA 1K9TA 3B37A 5IR1B 3FJYA 1RK7A 3AFMA 3N7UA 4MYTA 3TEFA 5IJ9A 3F47A 3N9GH 4DCCA 1ZR4A 3DHMA 4AROA 4IJWA 2FPRA 5I7UA 2X1QA 5E9WA 2NO6A 4MHOA 3SCMC 3UTSA 1I1AD 3AREC 2X5NA 2V7PA 5ALVA 4B96A 3NMUF 4O4JA 2ZOWA 3VAZA 3SYKA 1XF2B 5A9SA 2OAAA 4KITB 4IS6A 1ZSDA 1CZOA 4FG4A 4OCWL 4TNWF 4JLOA 3L2NA 3GVHA 5D7LA 1H05A 4HYEA 3E80A 4UQPA 1VE1A 3ZDQA 2QTCA 3D5EA 2WXNA 5BN3A 1C3VA 4BXOA 3K71B 2XOKA 1S7WB 3T4AB 1CQIA 4YRNA 4PJ9C 4YHNA 3V6OE 4MUNA 4YSPA 2SODB 3UJTH 1DZIA 2AKAB 1P2TA 2G71A 3ZSTA 1OZUA 5I66A 3CF2A 3O9WC 4Q6WA 3VYNA 1FFOA 3ZE2E 2FGJA 4E2YA 4ZAZA 3U1SH 4LLMA 3B2PA 1VFPA 2FPXA 4CCYA 4LSMA 3UGJA 5A2BA 4C59B 4BE7B 2XU9A 2ZRJA 4BKSC 1JK9B 1KFAH 2AXWA 5E8EB 3Q87B 3PUWA 2BRQA 1PDWA 3CVHA 1OAOC 2QQ5A 1T1JA 3MDJA 5D1XA 1ECGA 3H2SA 3TLMA 4D3ZA 1USUA 3PPVA 2XGGA 4IV0A 4MIEA 4U0KA 5CFOA 5BSEA 2SECE 4EBFA 4MCNA 4JFAA 4XPGH 1AQNA 3UMFA 3WDHA 4D6PA 3AYZB 1UP4A 2QEQA 4XJSA 2OFFA 2C34A 2SBTA 4G43A 4NBVA 2BFEB 1K5HA 1C7EA 2UVEA 4YPJA 2QN8A 4KYTA 2IH1B 1P9LA 4Y6PA 3SSOA 6YASA 1QC5A 2IYSA 3CNBA 3BVUA 2QUBA 1COBA 3OQHA 4LXFA 3H13A 5LLIC 5HIIA 4U05A 1MO6A 3G6KA 3BRFA 3IUBA 2WLLA 3VPGA 4D79A 4W9MC 2ICEB 3WUWA 4B7XA 4GAFB 5FPTA 4MA3B 1ASOA 2GF0A 1JIBA 1MAWA 2KERA 2E7CA 3DW3X 2QD5A 4FQLL 4PC1A 4XPFH 1U80A 3IOYA 3IU4L 4ZW8A 3K4ZA 2X8WA 2YAQA 4MWEA 3LZFL 4FHJA 3O2NA 1B8PA 2O07A 3A4MA 1KB3A 4ZI2A 4U2FA 2H9GB 3Q0IA 5D1ZI 3Q5EA 4MW9A 4UT9L 5DZPA 1HL4A 4HV4A 4X4KA 1QEWB 2AK1L 1XMEB 1MJ8H 4WCFA 1J0AA 1II8A 1FS5A 5IZCA 2JLWA 2X3UA 3B6MA 4YUWA 5JPDA 3ZQXA 4NKIL 1Q1GA 1M6OA 4BFEA 4X8OA 2C99A 5TDPA 4ZAKB 3UJIL 2L69A 2O7NA 4MYRA 1NULA 3FNQA 3S6CA 2P47B 3ISTA 3E3MA 3GNLA 4LDZA 2OZLA 1FNBA 1WYJA 3IC5A 2MHAA 3QQ4B 4QTYA 5D2NC 4WFGE 4U1IB 2VDOB 3FQYA 2O8CB 1QA9A 4LXGA 4QECA 2QVFB 3F5WB 5HYJA 1EAJA 2J0SA 1W36C 5EMLA 4HC1L 4H7VA 1QKKA 1VKZA 4QVKA 1TVHB 2GRJA 2BS71 3LD9A 1X42A 4DYHA 3KSAC 1QR4A 2P5WE 2EJVA 2OXRA 1HHGB 5LFAA 4PV9A 3WGTA 1P5UA 2QPDB 4ZFOB 3U4BL 1EXHA 3Q7EA 1RUQL 2YZ8A 5IROD 1Z8HA 3SC6A 2F19L 5FO9A 2X4UA 5KWIA 4PP1C 3DLPX 1W91A 3QEQD 3W4KA 3F7TA 4BNJA 1EK0A 3QSKB 3QISA 3CPEA 2EHDA 3N2JA 3RS8A 1SY6H 3K0HA 1Z2CA 4FS3A 5FFGA 5KSPA 2QRHA 3V4RA 3HADA 3H1GA 4C2BA 4YHMH 3EDOA 3VPDA 5C6PB 2GUOA 3IQIX 1LP9B 5D5MA 1VPWA 2EEPA 3C6MA 1D9KD 1EEQA 1ST3A 3JS5A 4EZIA 4JV5B 3RUCA 1PKQA 1FFTB 4MJ6A 4U6NA 4P81A 2ESRA 4L3AA 3BWMA 1C2TA 3T77A 4HSGA 4KZPA 4PJIF 4YDKL 3UJ8A 3ZE1E 2XY2A 2V4UA 5U1PA 3CF6R 3FT3A 2KBFA 1FDSA 1QLEL 3D9AH 1A4RA 1SXNA 4CU7A 4L3EE 2GEDA 4N90D 1FDLL 1B0RB 5C7IO 1IFGA 1XZNA 4MZDA 4NHUA 3K2QA 5DJ6B 3VXSB 3I4FA 3KJXA 1HOTA 2RHGB 2AERT 3GS4A 4WXMA 3W5MA 4UQEA 3HS8A 2XBMA 3SOBH 4JENA 1KGYE 4Q9KA 1E28A 3BQNB 3TXAA 4OY9A 3CV3A 3JVUA 4U49A 2FG5A 2AC4A 3A6OA 3QY0A 3UPTA 1J0HA 2FW6A 2Z4TA 4GQQA 1D5XB 4QHNA 4KQEA 1T26A 3N42B 4ADIA 1Q0ZA 4J27A 3UAAA 3BT0A 5KTEH 1FZOB 1YN7B 4GRWE 3VSUA 2J6CA 2FX7H 4M38A 2I34A 2YHIA 2XE7A 4FLFA 1BMFD 2YOGA 2M2DA 1WOMA 2G3XA 2G2RB 1G6RH 2BI8A 5JDSA 3K4HA 3RTQC 1DN0A 2XYVA 1GKUB 3APDA 2WXPA 3QOWA 5CAEB 4KKLC 4WWKA 1WDTA 2IU6A 4LDEB 3LX8A 3G3LA 4M7WA 5EZJA 5L3QB 4C89A 3NBNA 3HXLA 4Z7IA 5EEYA 3SWWA 4R6WA 1W36D 2WPDA 4M4RA 2ZJ8A 5ICMA 3RAJH 1O6ZA 5TMDA 3CMGA 2IS1A 3D3NA 1P5VB 1RHKA 2GY7B 4QHKJ 2CVFA 2DQZA 1VKHA 3V52L 2JFXA 3MRPA 3JYHA 1H2AS 1M2EA 1ESCA 2DOKA 1U8ZA 3T4UA 4CM7A 1X8JA 2ZUYA 2UWEA 2PWFA 3K3QA 2WOOA 2ATPB 1AIFA 5I16B 1EDBA 2E4VA 1G9MH 3MC0A 5C0GA 1GGKA 1QZZA 1E3LA 3CFEB 1E2UA 1N59A 1GHFL 3M6DA 2R6FA 4P53A 4LOFA 3ZDEA 1GUZA 4YMSA 2Q86A 1A1NA 3DUUA 3RIGA 1IEBB 5ECYA 1SHJA 2XXAB 4JM4L 1JPFB 3GO1H 1KTRL 1IY8A 3Q8FA 1JKIA 1IZ9A 4MCIA 3FN3A 3ARFC 5FFLA 3ZQUA 3HMWH 3QEQB 4ZX5A 1P5FA 4ALJA 3ESBA 4G1CA 4NKDA 1SDDB 3I58A 3VE0B 1PFQA 2WLMA 2XB2A 2REQB 4J8RB 5F6IC 1LI4A 3FU7B 4A68A 2HFEA 4H17A 4E46A 1S3RA 1BM3H 4JE0A 2UVQA 2K0RA 1FE8A 4ND4A 1ONNA 1B4JL 1RIVH 2EZUA 4DE5A 3WNPA 4KXBA 3CH4B 1NYQA 3H5LA 4E4TA 2H41A 4JRXD 3HU5A 5B1JC 3QUXC 2I1WA 1TDQA 5JLJA 3S2AA 4WDIA 1HETA 2PBZA 3FM9A 1MCKA 3PGCB 1OOAA 3BFWA 1U1EA 5CBEA 4XP5L 3HG1D 3COOA 1N2JA 3IVRA 4UHBA 2VSMB 4QGSA 1LP9A 2XV2A 2C0CA 1RC8A 2ZSBA 1K06A 2Y6VA 2R1YB 2Q28A 1QXSA 3W3AD 3IYLW 3QORA 1G3IA 3B3IB 5CMLA 2FSPA 4QYXA 5AYVA 4AQEA 1ASPA 1MCPL 1E5DA 4E9XA 1Y9AA 4MV9A 3CCBA 3RQ3A 2NVWA 3GN1A 3HZVA 2JGDB 1YS4A 3K35A 4QQKA 1POXA 1ZLYA 1BVKB 1JWBB 4RE5A 1KJMB 1J0IA 4QRRE 1Z0KA 3AWDA 1ZWKA 5TGTA 5AOVA 1MNUL 3QEUA 3LC7O 1GGIH 2CD0A 3ZHNA 4AIOA 4UE3S 2QTGA 1VE7A 4OTZA 2PDAA 3DVLA 4L95C 4RGNE 3WJLC 1YRAA 5A9SB 4NKOA 3SZLA 3I6IA 5I1GL 1GSOA 4FHGA 1LLCA 3O6LL 4H4CA 4O63O 3T9BA 1INDH 2W0LA 2R9HD 4WY7H 4GMKA 3NPSC 5JXIA 1JXOA 2QX9A 4DWHA 5AJHA 1T1XA 4IRJA 3TA4D 4KO2S 1KBOA 5EIBC 2FSEA 2PGOA 2HJKB 3VKUA 5C0RL 1ZM4A 4PAOA 1YG9A 2WLLB 2DD8L 3UPDA 3KZ8A 4ZRMA 4M02A 3HNTH 3VMNA 1MOPA 3GNTA 5FGRA 5FBWB 3QEQA 3H2BA 3JY6A 3L7AA 1UBHS 4KR0A 1MJGM 2ATEA 2CK3A 1TB4A 1TYCA 2OMYB 1FV1A 3QWHA 3DSNA 2Q1EA 3ARYA 4NC9A 5INTA 3DV9A 1KFEB 4Y2QA 1F2TB 4F27A 1RC1A 4PS7A 3IP7A 3AUVA 5FM5M 2P4AB 2PAFA 3LDGA 5K99A 2K5UA 3B9EA 2J8UB 5I1KL 1KY3A 2W94A 3L3DB 3L7FA 1GXSB 2WUCH 3IB4A 4OI2A