4I1PA

Human malt1 (caspase-ig3) in complex with activity based-probe
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
379
Chain Sequence
b'MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Activity-Based Probes for Detection of Active MALT1 Paracaspase in Immune Cells and Lymphomas.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 110
structure length 379
sequence length 379
chains with identical sequence C
ec nomenclature ec 3.4.22.-:
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4i1pA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i1pA01
1I4EB 3R7NA 4I1PA 1SC3A 4QUJA 5IC6A 3EDQA 3E4CA 4N7MA 4DCPA 3UOAB 2AR9A 4ZVSA 3NS7A 1BMQA 4M9RA 3EDRA 4NBLA 4NBNA 2DKOA 5I9BA 2FUNB 2H5IA 3V4LA 1NMSA 3R5JA 4EHKA 1KMCA 1RE1A 2CJYA 2QLFA 1JXQA 4DCOA 4EHHA 5IAEA 1QDUA 1RWKA 1RWOA 3DEKA 1SC1A 2HBYA 1SHLA 2C2MA 2C2OA 3DEIA 4ZVUA 2H4YA 3GJQA 5IC4A 5IARA 2K7ZA 1QTNA 2HBQA 2J32A 4NOKA 4EHLA 4QUIA 5LUAA 1RHRA 3D6HA 4N6OA 4NBKA 3OD5A 4ZVOA 4QUAA 1RWNA 2CNLA 2XZDA 4DCJA 4JQYA 4EJFA 3D6MA 3GJSA 4QUHA 4NOMA 2QL5A 5IBPA 5IBCA 1CVRA 4QUDA 3ITNA 2H48A 3H13A 4JR2A 2J33A 4JR1A 5LU9A 3H11A 2CNOA 3R6GA 5IAJA 4FXOA 3V3KA 3H0EA 3RJMA 1RHJA 2HBRA 5H0IA 4D3XA 4IYRA 2XZTA 2FQQA 3H1PA 4QU8A 3IBCA 2J31A 2Y1LA 4NOJA 4EHAA 5LUBA 2H65A 4IEFB 4NOLA 4QU9A 1NW9B 2HBZA 3R6LA 3R5KA 4QTXA 3V6MA 3PCXA 1F1JA 4LSZA 3SIPA 3GJTA 4PRZA 2CNKA 3P45A 2CNNA 4PS1A 4N6NA 5IAKA 3R7SA 3NKFA 3PD0A 3GJRA 1F9EA 3R7BA 2C1EA 3DEHA 3IBFA 3QNWA 2CDRA 2CJXA 4QULA 3V55A 5JFTA 1RHUA 4HQ0A 1IBCA 2WDPA 4QUGA 5LU8A 5IANA 1RWPA 1SC4A 3KJNA 1RHMA 1QX3A 4HQRA 3S70A 2P2CA 4N5DA 4JB8A 4AW9A 4QTYA 4FDLA 3BIJA 5K20A 1RWMA 4QU0A 4FEAA 5IBRA 4HVAA 1PAUA 2J30A 1NMEA 5IABA 4AWBA 3KJFA 4EHNA 1I4OA 1I51A 5IAGA 2XYHA 1RHQA 1NMQA 3P4UA 4D3ZA 2H51A 2Y0BA 4JR0A 4I1RA 1K88A 2QL7A 4AWAA 4D3YA 4JQZA 4PS0A 3SIRA 1SHJA 3UO8B 3D6FA 3V6LA 1RWXA 2H54A 1RHKA 4N6GA 4JJ8A 1CP3A 4FGUA 2QL9A 2C2ZA 4EHFA 4JJEA 2QLBA 5I9TA 4EHDA 1RWWA 1RWVA 4ZVQA 2H4WA 2H5JA 1GFWA 2NN3C 3H11B 2XYPA 1M72A 1PYOA 4QUEA 1ICEA 3V4OA 3KJQA 2XYGA 1GQFA 2QLJA 3NR2A 5IASA 4JJ7A 3DEJA 4QUBA 4PRYA 4N7JA 3S8EA 4ZVPA 2C2KA 1K86A 1I3OA 4ZVTA 3K7EA 4QU5A 2FP3A 4ZVRA 3PD1A
chains in the Genus database with same CATH superfamily
1Y07A 4J27A 2WB1A 5JLAA 5F3DA 1MW3A 5DXJA 3SICE 1ECCA 1QV7A 4CR6A 2K5UA 3GSUA 4ER6A 1PCSA 1YVDA 4DCSA 4KLRA 4GPIB 1MY7A 2Y7NA 4V39A 2WTMA 3TR5A 4M8RA 4PH8A 5GRVL 2PX4A 1MW1A 4AMKL 4L74A 3FN0L 3B2DC 3RGWS 3CAFA 2H1SA 1YO4A 4NWIA 3U16A 4AKHA 3UKOA 3VDCA 1EK6A 3NJJA 1GC1L 2ATIA 4MXDA 4WCYH 2XWTB 4K7PY 5SV2A 4RD1A 3GI1A 4J12A 3FR7A 4KC3B 4NCIA 3ZHXA 1XC7A 5C0EB 1AKUA 3E3LA 2AZTA 3T0EC 4DLUA 4PIPA 1U3HB 1QP0A 2VH5H 3RWEB 3AVYA 3NCYS 1YJQA 4MA8H 2D2FA 4QULA 1K7XB 1QEWB 2ZZKA 4GP6A 3ZDZE 4D41A 3Q40A 1I1HA 1PAZA 4TQAA 4JI2B 4G83A 3NSJA 3MAWA 3OEHD 1JSYA 5DMYA 2MSEB 1XH3B 1CR4A 2NY4B 1J18A 2ZIXA 5BZZA 3S5UA 3CM0A 4E5VA 3T2NL 3S5LB 5C80A 4KO9A 3SZOA 3IRUA 4QY8A 1M7XA 2DKSA 1WK0A 4FG4A 4C7OB 3U4QA 2HFGH 2VCEA 4EI5D 4OM7A 1QR6A 2JPDA 3S8YA 2VLKD 4BSWA 1JR3E 3GMSA 3Q3HA 3IXTB 1UK8A 4DPMA 5GJWC 1N32B 2TS1A 4QU5A 4XNQA 1RJ9B 3L3IB 4D0BA 1FZKA 3V4ZA 5KWYC 3QXUA 1YEIH 2WWTA 3H16A 3I6BA 2QN7A 5FO0A 3RAJL 1DINA 4F9PC 3OQOA 1HF3A 1XJWA 1CF1A 3MJ7A 2WKLA 5EJIA 1XF2A 1RZJC 1RWNA 4R05A 3KOXA 1FNMA 4K9LA 4RHUA 4PBXA 1CTQA 2J9FA 1ZJWA 5FW7A 2OL3H 3UBMA 3G9QA 2NQDA 1JLLB 2P91A 3HP7A 3S88H 2H1XA 4XIIA 3IS1X 4OB5L 3N2JA 3U7YL 5CH3A 1EXUA 4MJ3A 2DI8A 2G9NA 1FDUA 3FDXA 1OVMA 1DUZB 2WJZB 5FR3A 1O7SA 4MJ5B 4OLWH 4WASA 4EJSB 3IFNL 4D9QD 3WIVA 1GP2A 3P5SA 4HPYL 1V45E 1NATA 4KGVA 3PWVB 1BHQ1 2EERA 3I30X 3ISTA 1CK4A 5FA3A 2ZVPX 4OZFA 3KWJA 1J5HA 6PFKA 3GXFA 3BD3A 3BHBA 1Q0UA 1Z6QA 5D4QA 5EIIA 3FPKA 2A6PA 4GUPB 2QAIA 4U00A 3A22A 2YFYA 3DB2A 3QE2A 2B0JA 4F33A 1ESDA 1U8IB 4EHBA 4O0MA 4OK5A 3OMXA 1M1XA 1Q0XH 3VR0A 1F14A 4J0EA 5K3EA 1Y5MA 3KPUA 3D50A 4PRBB 3MC1A 5C2JB 4KV7A 3QF7A 5ICFA 4U2ZA 5JPMB 2QV4A 3MCKB 3N2LA 1UXLA 1J5CA 1VE5A 4WGWB 1DLIA 2FFJA 2O3SA 5T64A 2GF9A 3OETA 1AXTL 5IXSA 2IXEA 4YCMA 1PX3A 1KSJA 4INAA 4X6EA 4J8RA 3QW9A 4NXSA 1MN4A 1IBGH 5EZPA 1FN4B 5GGUB 2C4UA 3B8YA 3C7DB 2C1OB 4K26A 4X4YA 2CF6A 1W87A 1SIWA 4P5RA 2D2EA 2Q1SA 3L4WA 3F71A 2W88A 4O2BB 4E0BA 1BWWA 3N42F 3FYDA 1X2BA 1FNLA 4NLAA 3BP6A 5DYNA 3U17A 2J20A 4KTTE 2BIMA 3F6LA 4PRDA 1X7YB 2EEZA 1O94D 1TM5E 1NTRA 5B58C 3EGXB 4ZOLF 5EMKA 3HRZB 3DVIA 4TMFA 3NIWA 3WV4A 1QE3A 5CJQH 4BCXA 1CD9B 4JCMA 2DQYA 4AJ0A 5ERWB 5JORA 2HF9A 1OGAA 5H02A 4PW0A 2ARJA 2XFXA 3ESCA 4BDSA 4OTXH 1TYRA 2DQGH 1LWRA 5CLLA 3R2JA 4ATWA 2VAAB 4AIIA 3LX6A 3V4PL 1HYHA 4LHUG 1PT7A 3CZFB 5ESAA 4H08A 3U13A 1MDAA 1OYWA 2FQXA 1NM9A 1NV8A 1JI1A 1F4YL 5E2VH 2I34A 3T3ME 2OC4A 1RP9A 1UEIA 3RJ9A 1PWEA 4G8CA 3DROA 3NATA 3D3KA 1DC8A 2V2XB 4HOYA 1ZVVA 4RPIA 2DTMH 2YMXL 1UADA 1QUNB 4DAGL 3LXUX 1QEXA 2VR4A 4L73A 2MPVA 3H8JA 3DTVB 4D9RE 3SZ3A 3OC5A 4PJ8B 1D4OA 4JKIA 3GIVB 1J6UA 3T7DA 4I85A 5HA5A 3MS7A 3MIIA 3ORFA 3UMBA 1I8IB 1GTL1 4PZ0A 5CFHA 1OW3B 5AW0A 3N07A 5IF3A 4F3NA 3JWHA 4EUFA 1QZNA 3ZVLA 2H26B 4L3EB 2JVIA 4WN3A 4MPTA 4FMKA 2QHRH 3M9WA 1VENA 1IARB 3I9NA 5B12A 3D6TB 5CHEA 3IDNB 3NU1A 1VKHA 2EJWA 3TGWA 3MLYH 1CJMA 5HI5D 4PRNB 4CW1A 2Z2IA 1MNUL 3R5TA 4NM4H 1RR6A 5BV7A 3WRXC 5LKAA 3EQ7A 3KLQA 3O8XC 2PS1A 6REQB 3PHCA 3ICOA 3KR1A 5ANMA 4K7FB 2BY0A 3PGFH 3L02A 1C8BA 3R5XA 2XE4A 1AGCA 2DT5A 1E6MA 5A2GA 4YL9A 4FFBB 1OF1A 1NU8A 4R7XA 3GROA 1P31A 3A5VA 1Z2KA 2I6SA 3DFFA 2RHWA 3N7TA 5FULA 1G42A 1WWAX 3IPEA 2QPTA 3AC0A 3BH4A 2WSIA 1S9KC 3NHBA 1ZANL 5D9SA 3PQYE 3AACA 2EEPA 1SDDA 3S37X 5IOKA 1AXSB 1GGEA 4J16A 1E8WA 3VVMA 2OKMA 2FUKA 4XP5L 5ICYA 2XTJE 4JR9H 1MIOB 5LVEA 1COWD 2AN3A 4N7MA 3IQIX 3HU3A 4H17A 2P5TB 4BMNA 3WZMA 3JXEA 5DX0A 1OREA 3RV4A 1OTTC 4CF3A 1BMDA 1HZHH 1TMKA 3WAKA 5TQVA 4XMLH 1G6KA 1Q9LA 1KB5A 3HB5X 4D0DB 4FE4A 2QXYA 6NULA 4G63A 2AFVA 2OCDA 1SEBA 4PXSA 1ZM4A 4HH0A 4YRTA 5BV7H 4UM9B 1S7VA 5LJYH 3M6MD 3SGKA 3K09C 2OR7A 4PAMA 5C0FA 1SB8A 2ONYA 3NPZB 5DGXA 4KKLD 3GSVB 4K9MA 2IYPA 4PNPA 3VAEA 1A5FH 4N0PA 1S2NA 3SJCA 3L6BA 4JO1H 4Y0AA 4D56A 2A99A 1XZGA 2VXTH 2E74C 3EYOB 4GQPH 3GHYA 1WE5A 5CFAA 3GMTA 4TVOA 1MQ9A 4RZSA 4GL2A 4IICA 1L4EA 3MNWA 2G6BA 3QBDA 1YHZA 3IH5A 3M6AA 2ZYWX 4YX2L 4KPFC 1LBEA 3A67L 1U5BB 5H7XA 2QQ5A 1N7JA 1XLWA 2XBMA 3CRMA 1DSSG 2AV6A 4I6JA 3U4GA 3I3SR 1B8PA 3WX0A 2V3FA 3DVNA 4GKZB 1SKAA 4KP7A 4WBSA 1EGHA 3DLQR 1W16A 3DX9A 2PW2B 4ALAC 3TE7A 2QW8A 2NPFA 2FHFA 5HPMB 2GB2A 1KB5H 5IT2L 2HD4A 3PHIA 3IJHA 2A9PA 4NNYB 2NYZA 5EWIL 2WG1A 4NZZA 3T8VA 2R2HB 4NK4A 2EIKB 4YSUA 3FPJA 5FV2A 4WEBH 1HQDA 2BGUA 2O3TA 4HB4A 3PXGA 1UZ6F 2D2IA 2PNJA 3LNDA 2DPMA 2W70A 4HQKA 1I0LA 1FLAA 3SPXA 3PG2A 4REQB 4ZQEA 4JFRA 2PR4H 3WEXB 2E4ZA 1QWNA 4P6VF 2A2QT 2QRMA 1H3FA 4KXMA 3L3JB 4A0SA 4ONFL 3H1EA 4GGMX 2Q3BA 3K71A 3BKJH 1IZKA 3CU1A 1Q72L 4EOWH 1YC2A 4DUWA 2FSEB 5I1JH 1M7DA 3LEYL 4PHHA 3TL5A 4U7PB 4Q3BA 3ZQXA 1CMOA 2JGLA 4ER5A 1VYTA 3SZ6A 4LJ8A 3N6XA 4JUSA 3EYWA 2QEQA 3VM6A 2LDXA 3TYFB 5AVQA 4I2NA 3GLGA 4D43A 4A6XA 3ZWWA 3DWIA 4R3UC 2B3DA 2AJLI 3SKJH 1NPYA 4A9AA 1CR6A 4WU5A 3KS0J 3BZEA 2V6JA 2ICEA 2O30A 3QBJA 1RVDA 2F7PA 5DO2C 2LVCA 3QVGA 4I46A 1Y7TA 1Z5WA 1ZXLA 1AH2A 5B53A 2B16A 3D4GA 1INLA 4LSUL 3ZNNA 3D0VB 5KJ7E 1CZRA 3FFCD 5SWQA 1W72L 4MASA 2J4DA 1DANU 3CFCL 4WFED 4D9NA 5HF5A 5BV0A 1TL7C 2XZQH 1Z82A 3EG9B 2QZ4A 1EO7A 4Y4KC 3RVUD 5J11C 3NSDA 1TZ8A 1PYDA 4KGDA 2GCEA 3FCTB 1EVZA 1Y1SA 3OPMA 4TLUA 2XVYA 3Q8AA 2JI7A 5LNEA 2IANA 4HLZG 1RHUA 2J46A 4Y9SA 5B3KA 1NHWA 2C95A 1E2JA 2V8BA 1Q1JH 4BLRA 1OYOA 4QRTA 4ZFOA 3ABQB 4FMCB 2OKCA 2XTJC 3W2TA 4Q18A 5IM4A 3PAZA 3GTTA 3FTQA 2X5NA 4N8CL 3GCWA 3TZEA 3EJSA 5BNWA 3PQYB 2HRRA 3TO4A 1YCDA 2QT0A 4D4GA 4JO4L 1U0SY 1L5ZA 3MOBH 4B32A 3EH4B 3WNQA 1OTSC 3D4OA 4AT6B 5G4KA 2DQKA 3K9NA 1AY1H 1IY9A 2NY7H 2PCLA 3AM8C 4K28A 2ZT5A 2Y2UA 1QPXA 1ZIXA 1U2ZA 3KVNA 5HVHC 2W6JA 5F9WC 2NAFA 3TF5A 3K0AB 1RAGA 5IB1A 1LD9B 3TLMA 1IE5A 5MEOB 1KI6B 3PNWA 4UFPA 1JWAB 3JQAD 1FFPA 1ZV9A 1MY5A 3T7CA 5ALCH 3DFIA 4XHJC 4NP4H 3VUFA 4D1YA 3JWOL 2BP7A 3CBGA 2HA6A 4HKJB 3E8SA 1J70A 1YQXA 4NU5A 4P2RD 1PYGA 4ZJUA 3S36L 1S4MA 3L05A 4MRAA 3RADC 4X1IA 4XOBA 5IEHA 1G4AE 1SG6A 1PSWA 1JYSA 3PGA1 2Q8AL 1FHNA 5ALFA 2X0VA 5HGGS 4RMIA 3OR7A 4WUUB 2CNKA 2F8OA 1RJCA 4IRZL 1JPFA 3VNQA 1YVUA 1WSAA 5J6HA 1C3OA 1U36A 3SYRA 5IQLA 4LJ6A 3NDBB 4X99B 1O95D 3KUUA 2OD9A 5T1MB 1I4WA 1Z37A 1TYZA 3MJGX 3CH1B 5ADPH 1OBHA 4JB3A 1H4SA 4WHTA 1G9HA 1OWLA 3LUAA 3CBQA 1BXRA 3NQ41 1RZ3A 2P68A 5ICSA 5ALBL 3E8UL 1Z4JA 3VH4A 1DAPA 2YPVL 2D4DA 2I22A 4JY5L 4KMMA 2JXMA 4LK4A 5BS0E 5TPZD 3QYMA 3D59A 5B6JA 2YA1A 4FNRA 3HMXA 4HCGA 4QHYA 1ZM9A 1C41A 3CS3A 5I1HH 2H8PA 2DZDA 1X7ZA 2B2XA 1BG9A 2QVLA 3VXNA 1HM5A 3U62A 4RGNC 4I0PB 3V5DA 1W8EA 3WKAA 4PHCA 5F1NA 2HRCA 3MCYA 2XYCA 4I5GA 4PNZA 1NMBH 3QTLA 5EE5B 1KLGB 3VVBA 3WV5A 2NNRA 3VTFA 1YG9A 1EUQA 1M2WA 3ZBQA 3FQ2A 3I75B 4HZLA 2P1YA 5JAUA 1ANKA 1CF8H 5DD6B 2RAUA 4GOSA 1EFPA 5E9DA 3STLA 1PZFA 2VRCA 4OG2A 2YAQA 1LTHR 4NQCE 2QAGA 5BQFA 1R24A 3S8GB 4RETA 2X89D 3MV9B 2I69A 4LLQA 4ND6A 2Z58A 2XPZA 2NVOA 2ISCA 4ZIRB 1C3JA 4CM9A 3FYUA 1T2AA 3VW3H 1X92A 4O1MA 1KZHA 1X2EA 4JDPA 3D4YA 1UM4L 4MS8C 2BHZA 4HPOL 3Q10A 3W79A 4JB9H 2I3BA 2D06A 3DDGA 1GAFH 2VPXA 3HMXH 1AIFB 5HKAA 3IP6A 2GK7A 3IAS6 1V7MH 2EH7L 2B2XH 2C94A 1Q1BA 3LCMA 1K2DA 2XZPA 5CCKL 3DNFA 4Z0PA 3VFOA 1T22A 1E2IA 5G40A 4NWTH 3M4XA 1RRGA 1FIEA 4EXPX 5FI5A 4OD2B 4KHXL 1NSTA 3SIXA 5JS2A 4I4LA 4ASUD 3LT4A 4M7PA 3OECA 5DMJB 2JGFA 4UDTA 4PRIE 1J0KA 1AZTA 4YXHL 5DUBB 4Z7IA 4WUKH 5C0RL 1N6VA 5F7KC 4EYEA 1CY7A 3GGWA 4RDBA 5BZWB 3ETCA 4PP1C 4M1KA 4NO2A 1TSRA 3E0XA 3RASA 1HKFA 2ZIWB 4Y1TA 5LJIA 1NPJA 2QADB 1U99A 4A92A 4G8EB 4G8IB 1J1OL 3ETNA 3SM3A 1CUOA 2O5YL 5IMKB 3PNRB 3U31A 4XHQA 3ORJA 3P73A 1EEXB 7FABH 2ZUWA 4HQ6A 1NYLA 4KK9D 5I8EB 5I5JA 2VS1A 2EDKA 4AV5A 2EEAA 3TNMA 4ZEWA 2AK4A 2MNWA 4NEHB 1WISA 3CEHA 1LY1A 3NC1C 1KARA 4PJDE 5LZ4A 2ZIFA 5FBKA 4UHFA 2XUDA 1FP4B 1I1AC 5FQOA 2A5GA 3GJRA 3WFHA 5FF9A 3B6ZA 1BC5A 3QORC 4DWVA 1MDBA 1A9XA 4MAYB 2IYTA 3SC3A 4QLAA 4QNPE 1NLZA 2N1BA 3PABB 5IVZA 1VEPA 1J0CA 2DFKB 4HVAA 3T04D 4DGSA 4V3BA 3U1PA 5JMOC 2UZ1B 3SZKC 5T3UA 6FABH 1UAGA 1GPBA 1WSST 5SX4H 4EUPB 4Z7WA 1FVDB 1ZLUK 3HCAA 1SYSA 5J8OA 3G7TA 3MNVB 2J1LA 4K5QA 1SKBA 1MCWM 1CBVL 2XKAA 5DYYA 5D1ZI 1ADJA 4Q15A 5DZAA 4H8QA 5LJLA 1LO2L 3V0WH 5TDPB 1WHTB 3MHZA 5CGYC 1T9BA 1ZEAH 2DB8A 5I75B 5FOBB 2W71A 3WJJC 5HHXH 3QJVB 3IRCA 4XC3L 4YE4H 1IVSA 1XTQA 2VHEA 4C6TB 2FDRA 4L4VD 3TT1L 3AQXA 3DBXB 5E1AA 4PQYA 1RL1A 2RKOA 4K6FA 2O2SA 1QKKA 4JLOA 4R0LC 1T3FA 3Q7QA 5JROA 2PP7A 2OZ4L 4K3UA 4MICA 1H5BC 4LJRA 3LKDA 4NI5A 3GZJA 2AIRA 2JB5H 1X1DA 3AHJA 3L4ZA 2G28A 2YD9A 5GRYA 2GX6A 5K9KA 3ILPB 1KK3A 4NKIH 2ZUTA 2F1BA 5DCYA 2GN8A 4ODTL 4HEA1 3TOSA 2G09A 1TTUA 2Y07L 2NY3D 5I5RA 4CIVA 1J11A 3OOSA 3DT8A 3HIZA 3VR3A 4EN3D 1LX6A 3EBHA 2ZBQA 4JVPA 3LO8A 4D8PB 3PT9A 5D8JL 1B74A 5HF6A 1FYFA 4RMRA 1LSUA 2ZOKB 3LPOA 1BGVA 2I6UA 3FZQA 1P7QA 1DG9A 3HEIB 4PC7A 1HWGB 2ZW9A 3EVBA 4G4GA 3QFTA 3KTOA 4PJXA 4KFMA 1ZN9A 5AW2B 4NE2A 5I9NA 4QRPB 3WG9A 4XI9A 1I4OA 4Z3HA 2QMQA 3M2PA 1Y7LA 5IQOA 3UTPE 5DLPA 3KBBA 1U2GC 1SBTA 4R1LA 2GXUA 4Q3CA 2ZCKL 3UZEC 2VK1A 1ZKDA 1MFPA 4WV1C 1AZSC 3RARA 3WMPA 1HH9A 1WX1A 1T5WA 4W9FC 3P4XA 1S78C 1U0EA 1BZYA 1PDKB 3RBVA 1KHHA 5K3AA 4J8QA 2R9VA 2D74A 1RKRA 4JZJB 1SZPA 4KDRA 1SOKA 5E2IA 4A4DA 2YQZA 1OZGA 4Y4FD 3QX7A 2DPYA 3JXAA 4LA4A 1G64A 2WYUA 1ZD3A 3X1YA 4F58H 2BHRA 5SY9A 1ZJ4A 2GBLC 5IOPB 1RQPA 2CNLA 2HT4C 3A1EA 3RC8A 2Y2YA 2Y36L 5ALTA 3BVWA 3E0GA 4LVOA 5DSZA 1CEXA 3R3HA 3VQ2C 4KI5F 5HY9A 1R9NA 3KEDA 2BYTA 4M60A 2W22A 5AI6A 4XJSA 1NF9A 3GOHA 2I78A 4ENVA 1G2OA 2OV4A 4ETWA 5KWJA 5CH8A 4U1SB 1KF0A 1L0PA 3CG8A 1U3FA 3BXNA 1A7QL 4S24A 4QARA 3DHJA 1B6RA 1T1WB 5GTDA 5AAMA 1AHMA 3DGGA 4EIBA 4Q9BA 1LQBC 1E1KA 3ODPA 3EC7A 3QQ3A 4LF3A 4P4TA 4IIBA 2PYEB 3EZYA 4LEXH 3DMGA 2FZLA 2VJXA 4ZNEA 4H5SB 1CRQA 2WKRA 3M6FA 4AT1A 4N6RB 4G41A 2XRAH 2FIRT 5C70A 2FR8C 4KOEC 1PKQB 3IAHA 5AK6A 3AK4A 3GEDA 4LDRA 5KQSA 2PDAA 4NU0A 1A3RH 2J3EA 1TZHB 1IN8A 1OTXA 3GPCA 4ZDHA 1CB4A 1AS7A 2R1WB 1T83A 3C75A 1BE1A 1G8AA 3KJHA 1DCEA 3VJRA 2B6NA 1DVFD 1DZ0A 2Y1VA 3GUYA 5C1DA 3T1FA 3WTBA 3AF1A 5J56B 1IXKA 2EXWC 4CDGC 3MTQA 2BFOA 3KPLB 1GOHA 4R5XA 3B5HA 2ZJOA 5ALQA 4YY3B 2H6EA 4UEJA 1ULTA 5A4KA 5CN3A 1G9NC 4HUQA 4JPIB 2ZVDA 3EUUA 5C0CA 4MR7B 2LRHA 4FSHA 1IPHA 2ZJYA 3EFDL 2IWRA 1H2HA 3R77A 3UGEA 2WB2A 4MQUA 4XIGS 4N2NA 4UTOA 1XTKA 1ATIA 4MKFA 1UT5A 2R7LA 4HIJA 1JEAA 2YEQA 3OQ3B 3PQDA 4Q9RH 4HJTA 5EO0A 3FRHA 1C3EA 1UBHS 2VH5L 4HH4A 5IBLC 2Q46A 4DC9A 2DX7A 5I8PA 4BMOB 4MA8L 1LBTA 4B82A 3GJTA 2P28B 3F7MA 1YU9A 1JBJA 2AQ1A 4PO8A 2GM3A 2VDQL 1SXPA 1KIRA 4JFFA 4O00A 4HDNA 2A74C 1M6WA 5AG8A 4J6RH 4BWUA 4KGLA 2EF0A 1NJ1A 3DOIA 1PAUA 2AEMA 3AIMA 4LL1A 2D3WA 3MMEA 4BQBA 3TA3D 3WNNA 1QRNA 3OEYA 4XW2A 2HFGL 4OBSA 1XNJA 4FCWA 2JRLA 3UMRA 4OQZA 1SNYA 4P9MH 1TC1A 5D2NB 5BWOA 1JKMA 4P08A 5C3UA 1PJZA 5BOVA 1AQLA 4DWOA 1TVHB 4YFLI 1KZYA 2X4OA 1YEIL 3C60B 1DELA 4YDVB 2DQDL 1U6KA 2X58A 2X8WA 1OT3A 3N0WA 3MRHB 2JCCB 1D2NA 5FBVB 4P38A 5FORA 3DECA 1TLFA 4DN6A 2EHJA 5KS9B 5C6TL 2M1KA 1NCTA 3GK8L 2ZWIA 3FSJX 1QLEH 3RT1A 4HUNB 2AK1H 4JFQA 4Q21A 4I77L 1T9GR 5IDXA 1RZIB 4YJZL 3OLCX 3CVCA 3NWOA 4M1QA 3J81A 2CSPA 3S88L 4UBOA 4ND3A 4RAUA 3PVZA 1HYGA 4G5QA 2EGHA 2OZLA 1WP6A 4FMCF 3QDGA 4BSVB 1XQWA 2VLJD 1XKLA 4GW5A 1P73A 4WCFA 1V7QA 1YBFA 1A9RA 1EWHA 2QL6A 3NAQA 5KBYA 5ENVA 4DJMA 1YY8A 3Q2LA 5A0FA 1ISMA 2NO5A 2Y5QA 3Q8KA 2ZB4A 4Q2ZA 2WWKT 1A5TA 2HRBA 4W5WA 2X0EA 2WIIA 1G8HA 3I72A 2JCBA 1WDAA 2PLFA 2G9UA 3OBBA 1U28A 2UWEA 1JHPA 5B38G 3OT4A 2W2OA 1WAAE 2VXOA 1Q0XL 4P23B 2OUIA 1FNEA 3FRPB 5KN5B 4LRTB 3UERA 1FZJA 4PJEB 3RY6C 2PZJA 4XB3A 3A9UA 1MC5A 1EAPA 4QXWA 5TQJA 3O9MA 5BQPA 4JVOA 2DR0A 3DO7A 1ISGA 4L07A 2ZRAA 3SNHA 2GDZA 3WKEA 3PL6D 5D7LB 3MGKA 4ZO7A 5J6GA 4IXDA 1IBGL 3QUTA 4MHHG 4ZT2A 5JAHA 1PZSA 2FOLA 1EEQA 4GSUA 1KMCA 3UJJH 1FL5A 3FOWA 4R2IA 2DQJL 1WAMA 5CVCA 4DESA 2QIOA 5HI3C 1UH5A 2QEJA 2FWLB 3KPJA 3BZFA 1B00A 1YNTF 2EP8A 3HG1A 2FPWA 1VSQA 4PV1C 3OZBA 3EF7A 1UZAA 4HG4K 5H2BB 4ZQKB 5IMMB 1KSGA 3FYSA 3VR2D 1FLRH 5CJQL 4I7ZC 1PGRB 1TM1E 1TKWB 3OXRA 2X5PA 4L5BA 3I2IA 5FR2A 1SKUA 1EFXB 3L8HA 1IAII 1DAKA 4PSDA 1XR8A 5LXGH 3KL0A 3IURA 1BYOA 1NDMB 2XJ4A 1ZH6A 4MNQA 1ZONA 4E30A 3FTGA 5C5DA 4P4KC 4N8UA 2GCIA 3WMQA 4IBTA 5E0KB 1CYXA 1NW4A 3HR7A 1DOZA 5A3JA 3T7JA 4XVTH 5LWHA 3L0OA 1NDHA 2C9QA 4P46A 4IOIB 3RS5A 3EZJB 2ATCA 4PYGA 2DTML 4GVXA 2OM6A 5AW7A 2E0PA 4PO9A 3OX4A 1QU3A 5BWLA 3BD5A 3SCMA 3SEAA 2H45A 4S1SL 3WL9B 3VXSE 5TNXA 3EQ8A 4WFIA 5CX4A 2AQSA 4L75A 4GXUN 2I80A 3FB8A 1EE1A 4XVOA 1RCFA 3FN0H 4LHUB 4U7JA 4Z7QB 1E1CB 1U0NA 3VUAA 2EKZA 1MEXL 4JI1B 4DSAA 3P3RA 1PW5A 2GFBB 5DHUA 3NK3A 3S5LG 2XIIA 4J75A 1GN8A 2IYSA 2HWKA 2GTIA 5AUOB 1JXAA 4ZZ0A 3Q06A 4BUGA 3MLYL 1JT2A 3D8MA 1K08A 3QUYA 2F9LA 5T8IA 4NM4L 4KUEA 4RVHA 4QOJA 3N86A 2J2ZA 5IVXB 1K8XB 1WBZA 4ENSA 2J7LA 4FXGB 3R7WA 2UUDH 2C3UA 1COBA 1C8LA 3PGFL 4NZTH 4AX8A 1SU4A 4OLFA 2VJDA 1A8JH 1YHNA 4U1MB 4IJ5A 3QG6A 3P9XA 2MKWA 3RDTA 4C0KA 3UVEA 4YJDA 1R64A 4IU3A 2WLLB 5AVTB 3L6FB 5BQXA 1Z7EA 1CLYH 4X7SL 3K92A 2HWZH 5J7CC 2I8LA 5IK3B 5EERA 5JBQA 1WRFA 1PR4A 4GNKA 1MCEA 4JR9L 4KFSA 5E5MA 4HK3N 3OLQA 1TM7E 5KNLA 2DWSA 2R9HD 5DJYB 1HZHL 4YHYC 3X1JA 5BRNA 1J1XL 3QZLA 4XMLL 2V5AA 2LKCA 1GS8A 3T1YB 4I5BA 2NYYD 1H85A 1V8PA 2XEXA 4ZU6X 3FWKA 2H4YA 4AULA 1LJ8A 5BV7L 3LW8A 1TQWA 4CC1A 1ZCFA 5H81A 4XLTA 3EH5B 3BCHA 5ALGA 7AT1A 3C3EA 3WWOA 3U7YH 4O4HA 2IVZA 1PL6A 2EICA 2DT8A 2QVMA 2WTPA 3FT2B 2JZNA 2XQVA 4B6SA 3MRJA 4DMKA 4LWQA 3DBLB 3EVTA 5BYAA 3A0OA 1OXBB 2EVWX 2LZ0A 4YX9A 1KYYA 4JDEA 1J5PA 1DDIA 1A5FL 2Y77A 3HHEA 2AJVH 1N6QH 1IN1A 4JO1L 5LOVA 4YAQB 5BR8B 5MEQB 1UZLA 2VXTL 1OAKA 4R2XA 1Y1UA 5ADVA 3VPDA 2XCIA 2V9UA 4ZAFA 2YRXA 3BDVA 3TVMA 4QTYA 2PN5A 1JFRA 3N28A 2JGNA 3GJFK 1WVGA 4W5TA 2GAJA 4HPJB 2V7GA 3EPHA 1RJ9A 1ZA1A 2X3UA 2J5WA 1D7DA 2ZXAA 5JHAA 3W9DA 4OI0A 1IMOA 4Q9KA 3ZZNA 3GZ4A 2AN9A 2WXQA 1K6JA 4LTMA 4PG6A 5AOJA 4I13B 1ORDA 4DPKA 3HJFA 2BWIA 4KQGA 4YSDA 2XYGA 1KB5L 1KBQA 4P7BA 1HG0A 1WWCA 5DV9A 2AA3A 1O9GA 4LRQA 3NUGA 3DXAA 2FO4A 3ASYA 3A4LA 1OIXA 1TUEA 4JI3B 4YEDA 1Z9PA 4WEBL 3ELWA 2B2NA 3SGJC 1AOZA 2DN7A 2GQHA 1RIIA 2DWPA 5DISB 3L0ZA 2CCLA 2RMKA 4NH4A 2HHAA 2ZYIA 1FYTB 4LBYA 1ET8A 5KOJB 1Y3FE 2NO6A 4U7TB 1D6NA 1K4CB 1DJZA 4MJ5A 4QFCA 5BW6B 4W63A 2HIAA 1H3WM 1T4BA 2VM3A 2PR4L 4NQEA 4IQ0A 3T0FA 2NQCA 3HB3D 1AKTA 4HT3B 4HUXB 5J1AB 3WL6A 1J9EA 2R8PA 2CKNA 1OAKH 2GY7B 1DQNA 1IOWA 4MS4A 3UMTA 4WWOA 4HNVA 3BKJL 1QFXA 5LXVA 2RIPA 1Z2NX 3LKSB 4EOWL 1XMIA 2HSDA 2PVPA 5FECB 5MN5A 4UQDA 5I1JL 1AGDA 1L7DA 2KQUA 1TVCA 4FMBB 1M6NA 1OGAD 3R6TA 4PRBA 5AAWA 4FEMA 2J21A 4G24A 1JZFA 3MCKA 2YC1B 3BVDB 1VL1A 2YR0A 1RYEA 3RIXA 3U6BA 4U6TA 5B3SB 3V8QA 3P7MA 1WFJA 2ZTLA 3OLWA 1NJ8A 4HOMA 1JSCA 1G87A 3IVMA 3WLNA 3DRQA 5D1HA 2WG0A 1XD9A 1ZDQA 1Y4AE 3PITA 3A3NA 3SKJL 2C1OA 4OAOA 1DU4A 1GRRA 1K8DB 5ISZE 2GNPA 2KQMA 2AVNA 4RHYA 2FWAA 2O9JA 5PCYA 2X87A 1FDIA 3LYUA 1EP2B 2P0EA 4X6UA 4YFDB 2WOJA 2PCXA 1P44A 2JB6B 1YAIA 1ID8A 1X7YA 1L1RA 4KROC 1XZJA 3VHLB 4ZBJA 4R3SB 1WB5A 1A7BA 5FAAA 3D33A 1DJLA 4OQXA 5DNWA 5BCAA 5KREA 1VI2A 2B34A 5EHQA 2A1IA 2AN4A 1GNQA 2EGUA 2E9WA 2XZQL 1FNBA 2PPLA 1ONPA 2RBKA 2F74A 3DD5A 2YA0A 3T65B 3V79C 1C16B 1XAGA 1XTTA 2PAAA 4CMIB 4A66A 1TQCC 4CEIB 4GSLA 3QQ4A 5JQ6H 1VHTA 1DEEB 1M83A 2IXTA 5HBBA 2R29L 3H6JA 3EY4A 2QDKA 2O3UA 5B1JA 2NNCA 1NUPA 3VM5A 5FWXB 3GLFE 5DJZA 4FFMA 1K8YB 4WLCA 2GN1A 3ESVF 1QQAA 2VN5A 1Z66A 3MOBL 3QA3E 1JPNA 2QL7A 2PZFA 1VPTA 3HFRA 4OVKA 1FFXB 3K1ZA 2H7XA 2JAWA 4CC4A 1AY1L 3QU7A 2ZOLA 1L8OA 3BM5A 2NY7L 3BD9A 4FGSA 1P0FA 3GEHA 4MULA 4IKPA 3DV0A 1SWVA 1N5RA 1E0DA 1F1BA 4BQSA 4U1NB 2VP2A 2Q3LA 5AI8A 5LN4A 4B17A 3P69A 3CE1A 5A3IC 3R7NA 3CDGA 4UQIM 4YVNA 2EV9A 2J45A 2A0LD 3MACH 1TUBB 4LPUA 4HUVB 2H2WA 4X20B 2APVA 1TCRA 1RQRA 5ALCL 1WF6A 4MX7A 2GTZB 3RX9A 1BFTA 3DP9A 3DX2A 2DMKA 1ESZA 3AERA 3LQAC 1HNGA 4BFFA 3ZNOA 5DU7A 5CIWA 1QGED 4Y1AB 4QPEA 4XPIA 4IINA 4JYCA 2I67A 2JQZA 4HKBA 2Y1CA 1ADGA 4J3WA 3WGVB 4N0RA 2PXHA 1FIGH 1KXJA 3TQQA 2YOFA 1VHPA 3BUYA 4MDJA 4ZFOL 3PCRB 1NG9A 1OIWA 3U30B 1JZ6A 3O75A 5BY2A 4RMVA 4JPVL 1QH9A 2CXTA 4H1UA 5ADPL 3LFHA 3AHGA 2MCAA 4FFPA 5C8ZA 4OGLA 1WPRA 5HJ7A 2CHGA 4AEHH 1KI1A 2VK4A 2B1GA 3GQBB 3CIQA 1IN7A 4KVCL 1F1DA 1KYDA 4IDDA 2J1WA 3R7RA 2ZBUA 5G3YA 2JCCF 1MIMH 4G3YL 2O8CB 3KU1A 1VTKA 4YDNA 1D9XA 4NARA 4L0DA 4F6RB 2P8SA 5KS9F 1V16B 4Q58C 1Q2UA 2GEFA 1F8TL 1UKYA 4QHNB 2Y05A 3AG6A 3JRXA 1FSFA 1RFLA 1DTSA 4O02B 2W6NA 2G9VA 3ETHA 3U83A 1OT1A 2FPOA 1NMBL 4IS6A 5EWIH 4QXGH 1UBUS 4X6XA 2ZJ6A 5AJHA 2FP3A 1TLTA 2YHGA 4U0QB 4MRSA 1AE1A 4HGRA 2PJUA 2XXAB 3MLTB 4N25A 5DCLA 5LYJA 1JWLA 3ZU5A 3VPXA 1RIUH 1CF8L 3NHZA 4J3SA 4D4HA 1K97A 3Q1SH 4KZDH 1RXVA 1P4LA 2W07B 2D31B 2Y23A 2ILVA 3FTZA 1KXVC 1WC7B 3B1ZA 1NFDE 2E4UA 3D39B 4C83A 2B1IA 4MHTA 5LIPA 3A6KA 3BGAA 1EXWA 4XNMB 3VW3L 4UV4H 2FZEA 1HHJA 3FQWB 5BZDB 1BJTA 5AKTA 2A6KA 2MCMA 1C5BH 1EWVA 2XAAA 3VKWA 5DVZA 4MCYB 5F9HA 4RJLA 4PJEF 3QJZA 1EZZA 3H8WA 3F73A 3RWDA 4G6FD 1GAFL 1CUUA 1FYHB 1FMLA 5IYZF 3HMXL 3DDNA 2QLMA 1VQ1A 2OSWA 4FA6A 3CZJA 4RMWA 5BRZE 2L0XA 2B2XL 3N43B 4B2YA 2OZPA 4XXCC 2F6AA 1KDRA 2CB9A 4U49A 3GBEA 4G1MB 3BH9B 3GB7B 3WUZA 5GSRB 2GKOA 2ICCA 4JI8B 3ACCA 4MJLA 1L5LA 5JYMA 4Y0VA 3EA4A 3FMPB 4X90A 2XV3A 1XLTA 2VJQA 4ZREA 4E2WA 1U8ZA 3PXXA 5KVGH 1T0NA 4Z4HA 1L8QA 3Q5YA 2VPTA 1RWVA 2DLNA 2Z1NA 1JAXA 2IIPA 2FMXA 3H55A 2PT6A 1CFNB 5DKFA 5KMGB 1PZMA 3QG5A 2GITB 2FWJA 3WP0A 3OB8A 4WUKL 4QIRA 4IEIA 3UGQA 1ORTA 3IETA 3QJSB 4HSCX 3WDMA 4GBXB 2B30A 2CY0A 1XAUA 4H77A 4R5VA 1AD9B 3QSYA 1DMSA 2K6YA 4FGMA 2L4OA 5FT9A 1S7WA 1A8SA 5AB9A 1FU7A 1OQAA 4MQEB 2ZJ5A 7FABL 1GKEA 5D7IA 4CSSA 1N2EA 4QUAA 4RUKA 1HETA 3CRVA 5DEZA 4LJ9A 5J4VA 2YWEA 1B0WA 1ADCA 1KF9B 3H2PA 4N9QA 3BFXA 4MGKR 5EJEA 5GGSA 3PIQB 2FYVA 3R19A 1N77A 2ZSFA 3ULVH 4HX2A 2P62A 3V5KA 3QXJA 4OQQA 4CETA 3KEGA 1HCZA 3BH6A 3Q8LA 3Q7RA 1T0UA 2J5LC 3P4OA 4RY0A 4IRZA 1NWHA 1U1GA 3O9ZA 1AU9A 1HKUA 5C0OE 1OH7A 1ZISA 4MI3A 4MW5A 5DHTA 4P3DA 4TVSa 4N8CH 3ZZQA 3SBOA 4IF6A 2PTTA 2IAND 4EMUA 4M9CA 5IT0A 4MQXC 4JO4H 3BRDA 5J4HA 5D3QA 3SWWA 2IZ0A 2N0MA 1NIAA 4MKGA 4NAUA 3G5AA 2CLRB 1WKBA 3CU7A 2XIBA 3REGA 1NI3A 3GMRB 4OZ4A 5GISH 5JCJA 3MRBA 2AFIB 3TO4D 4BB0A 1U6IA 3H2HA 3UXEA 3V0WL 3VD2A 1PG5A 2FO1A 3FN9A 1JKFA 3VQLA 1ZEAL 2IOFA 1XB8A 2Q27A 3QJHB 3QIWB 5EG5A 5HHXL 3H2YA 4IBZA 4LOJA 1OV4A 4YE4L 1VGEH 4U6VH 4GQQA 1SEQH 5DD1H 2GSGA 3WUWA 3KYNA 1ES9A 2W6JD 4EA6A 1UXSB 1VG0B 3AZPA 1T5DX 2IF0A 3EG9A 1KAOA 3PWLB 5AI4A 4M93C 4FB5A 2JB5L 1GZSA 3OX8B 3EXEA 4XOAA 1VZ3A 5CBEB 4DZBB 1RQLA 4MYSA 5I6DA 3AAZA 4NKIL 5IN5A 4ZVOA 3K5RA 4NQDB 5EP1A 2NZXA 1NCHA 3LVFO 4JGNA 2GHRA 4ITRC 4IRZH 4PG9B 3Q7TA 1ITZA 1PGPA 1JIUA 3E05A 3BYTA 1MFUA 4ZSOE 3FU6A 1JPJA 3ASWA 2B92A 1WSBA 1HZZA 2YWYA 2HBZA 4BNMA 4OCRH 3QEBZ 5IKOA 1KMMA 1UEYA 3PD0A 3HS0B 4V38A 3T4YB 4INJA 3PQ8A 1C30A 3NJIA 4JY5H 4E4TA 3PQ3A 2Y6SC 3D48R 4B9GA 1N5MA 2GJ6A 1I31A 4HIIB 3E35A 2D9QB 5H9WA 3PP3K 3HKBA 3W6PA 4G84A 5AJVB 1NTOA 5T3ZE 1F0YA 2OO5A 3PHOB 5L0QB 4LVNB 3CFKB 3D8HA 4TXMA 3UO8B 3MN1A 1EFVB 1RK1B 2RJOA 1ZUNA 4EHFA 1PQZA 1DUYA 3UT6A 4L4TA 5EJ9A 4IGFA 2GTWB 3BGWA 4TNGA 3A9WA 4PY2A 4L3WA 3GNQA 3P9SA 3ANYB 2M6SA 1HFJA 4TNEA 5DM0A 1LXMA 1N6LA 4DHWA 1KEPA 3FQUB 4HMOA 4F58L 2X0JA 1BBJA 4Z3GA 2R2EB 3HVNA 3BJRA 3BT0A 4W8OA 3QH3B 4JRWA 3RUAA 4ATTA 2RBEA 3IJYA 2OTUB 4NDMB 4PJ9B 3FO2A 2D2VA 3BX1A 4OM0H 1AQ8A 2VRCD 3N8GA 2WQUA 3WL5A 4BKTC 3K0FA 4S1TA 3APNA 5D5ME 2VJMA 1UM4H 4L8WB 5LIRA 2MINA 4NJOA 5C09B 2ZICA 3JVFC 4JRXD 2DLDA 4Q3AA 2YQ5A 3ZJAA 4II3A 3C41J 4YRDA 3HYTA 3M1CA 4G1EB 1NXXA 2X13A 1A2YB 3RUGE 4KQMA 3U9LA 5EGNA 2HP4A 1QHOA 4CM9D 1YS4A 1U7PA 5KVDH 1SOVA 2P6OA 5E6IC 1IBKB 1F45A 1M9WA 4LEXL 3Q5EA 4NHUB 3AEUB 1RWPA 2GIXA 4HB0A 4PC1A 3TR6A 2XRAL 2V2TA 2MMCA 4RTNA 4D9LL 3V7UA 2WPGA 1BU8A 2FWUA 3MV8E 3LOWA 3LS2A 5BQ5A 2ZB7A 4QYIB 1E9OB 5DHSA 1A3RL 5DULA 4ZMNA 3URKA 2CCJA 4WZ9A 5BOZG 3DKKA 2IVFA 2COKA 1GDHA 4AY3A 3APCA 3DTUB 3U6XA 1YQQA 4R2KA 1ZRHA 1SHSA 5AW4B 2X5JO 4N82A 4AJ4A 3QFJE 1LQUA 2W9DL 3OKNB 2OGZA 5IROC 2GXQA 4RSHA 3O2WL 1TTRA 3PR3A 4FFWA 5JYEA 1TQ2A 3SEFA 2XZLA 2C83A 2Z8WC 5AVXA 4C76A 1AH1A 2DL2A 4DE5A 1KFCB 1N8SA 1U8PB 3RIFK 4MB2A 3QEQE 4HCRA 1YB7A 3LD8C 4EUPG 1M8PA 2AOWA 4LOLA 3N41B 3PWNA 1LCIA 1SQFA 1R0BA 5EE9A 3TIEA 2ED9A 4DB4A 1T43A 1EUCB 1V5IA 4PM1A 2E1PA 2G3XA 4A7TA 1NP6A 4Q9RL 1CWUA 1H5QA 4MMYB 2WVUA 2G75B 4NQVA 4QT5B 1G5QA 4RU1A 3D85A 5DVLA 1Z56C 2FQQA 1CQJA 2AK4D 1NUFA 2MR5A 3MOQA 3HVUA 4RAVB 4ER7A 4DOHB 1ZMXA 5HDBE 3B2MA 3T0EE 5CAEB 1OLXB 1QOKA 4J6RL 2HFFB 4MCMA 1HHGA 3S97C 4IIXA 3OTWA 2WUFA 4LI0A 3M33A 4EY3A 2LV8A 2YVKA 2YZ8A 5DJ6B 1IQDB 4APXB 1CFQA 4JFXB 4QJ4B 4YAIA 1CBVH 2J3KA 4OCMC 4KQJA 4A16A 3G5VA 1GR1A 4P9ML 3KQMA 2G08A 1E27B 3V6LA 4WI4A 1Q0QA 2G5BB 1GSIA 4ONEA 3VGEA 2Z7UA 5BQ3A 4C04A 4JREB 4ELKA 2OS7A 2GBVA 2XF8A 3S1SA 4XC3H 2LUOA 3P4NB 4K6GA 4PC2A 3ZXUB 2FGKA 4G8IA 4ADSG 2ORYA 1CY1A 5IMKA 3U3XA 2ITCA 3RB8A 4HCRH 2PMWB 1KJMA 3L4XA 3HBNA 4O4IB 4ZMRA 2Z7WA 4KX5A 2IBSA 1O96B 2L17A 1QLEL 1E2FA 4AY5A 1DQMH 2AK1L 4FYXA 4Y2NA 4BAGA 1DX9A 2K7QA 4YDIL 5F7DA 1X42A 3NDJA 3HG5A 3IB4A 4UF7C 1FP4A 5LN1A 1ZOSA 4B6ZA 4WY7H 2ZIGA 3UTQB 1A1OA 5IJDC 2BZ0A 3VJKA 3CNHA 1ZLXA 1FZOB 1QXSA 3ETBF 3CPUA 1VDZA 5HBGA 3PABA 5HJ5A 3Q9QA 1MGOA 1KXHA 3NHWA 3WV0A 2OWEA 5DVOA 2Q21A 3IAPA 3RH0A 1ZGAA 4PY7A 3B8SA 3KVVA 3OU6A 2NW2B 3VR3D 2G4GA 4MYHA 3HSYA 3FZEA 1MJ8H 2VTFA 1WYJA 1IXSB 1P7QD 3SDDA 4D97A 3ARVA 4C4OA 2ZCKH 2HSGA 3GZKA 3D4NA 4KUGA 4MS3B 4DLXA 1ZNQO 3F8SA 1FLNA 3Q01A 1ZG3A 5IT5A 1U0GA 1WXDA 1GXEA 4ZUTB 1XWFA 2OM2A 4HDMA 4I1OA 1S9YA 4X6CE 4OCNC 4ZVPA 3ZWCA 4ZYLA 4G5FA 4JQZA 2PUFA 5LSAA 3UJJL 4XXWC 3JQ7A 1SXJB 2BAGA 4HZAA 1QW8A 5B38B 3JYNA 1DYZA 1EIZA 3KQVA 3M1AA 3AVPA 2GPAA 5GS0H 3NTLA 3USES 3NGBB 2Y36H 1V96A 2P6RA 3ZDAA 4Z7NB 3TLGA 3PNQA 2QAJA 3O0DA 3FO9B 4YFVA 3VWJA 1UQUA 3FT3B 3HN5A 1AANA 3M1YA 2W38A 2ZOKA 1FLRL 2W43A 1A7QH 5GGVY 2HB6A 4UCXA 2GI4A 5CFOA 5AI5A 3T54A 1DVQA 2FJGA 1A4RA 3N5CA 2I2XB 1MAMH 4KI1A 4RJTA 4F20A 4IMKC 4OXXA 3ISYA 5LXGL 2ZKMX 2WAOA 3AUJB 1WZKA 3WGZA 4KR9A 4M8QA 4CEJA 4HGWB 3C85A 2HJGA 3JYHA 4XN2A 4I5FA 1QHGA 4JWKA 3VPAA 4XVTL 1EEYA 5KBDA 2OMYA 1DQSA 2WVGA 3KJNA 4N5DA 4GI3A 3REVA 5GZNA 2H85A 4DNOA 4XP6H 3KDMB 5EU7C 3PC6A 2GBTA 4E41B 5CT5A 3LQZB 4JZJA 1SEVA 2B25A 4EG5A 3LXRA 1WSDA 2WQXA 4ZRGA 1R5OA 2VRAA 2IXBA 1RM3A 3FUUA 1QZZA 4JI4B 4RC9A 3N8IA 1HA3A 5AYUH 4B43A 5DRYA 1DO8A 2Q2NA 3A3YB 3U0TB 5IOPA 5H4YA 1KJ2B 5JCOC 1BVYF 3EFDH 4OEHA 4JUBA 2ZQYA 3DE6X 4JFEA 1AUPA 2V9TA 3DO3A 4LCWB 5I4IA 4GMKA 5C0CD 2APFA 4BATA 2CUHA 4XXHA 5DGQA 3DPDA 4QDUA 1X7TA 1KL7A 1NDQA 4V0QA 1QSEE 3HE3A 4Q3OA 4GUCA 3N43F 4B84A 1L4KA 3U7QB 4EDHA 4Q1AA 2VDQH 4NMMA 4UU7A 1XTMA 5ABPA 3KPOB 5CT9A 4NZTL 4H5SA 4IQGA 4N6RA 3U1BA 1F4WH 4EPYA 5IMOB 2XB4A 2X15A 3ZZTA 1BQ4A 5JO5A 1MG0A 1PNCA 2ZWAA 1PKQA 3PWJB 4YDMA 2YN2A 4MVBD 1KCBA 1GTMA 4DGYH 5EG6C 4BX0A 4IQHA 5F9OH 4XD7A 1TZHA 1UKEA 4CODB 3M7OA 1CLYL 2AW3A 1VEMA 4JFFD 2XIQA 1UOLA 2HWZL 3MOIA 1UQSB 4BHTA 4LE2A 3Q6MA 1JMYA 2QI9F 5FNVF 1VDGA 1JG3A 1NT4A 2BXYA 4XWYA 3MJTA 1ZD8A 3EUDA 1QRND 2JFNA 2ABWA 4JPIA 2DQDH 4CJ1A 2CXRA 2HPVA 2A8YA 3TIDB 3KXIA 5J3HC 3QYCA 4AQ8A 3VO2A 4ZMZA 5C6TH 2IDFA 3GK8H 5BN1A 3HZYB 3LEXA 1KXQE 4I77H 3CSYB 4PYRA 5BNZA 2H32A 1AB6A 4KRYA 2CFCA 3W7BA 3OCCA 4J0KA 4X84A 1XSIA 2OCBA 4YHZH 2XAUA 3JQ8A 3WAJA 1W4LA 4WXHA 3LPGA 3LPCA 4H7IA 1OTHA 2JI2A 4TWJA 1UT9A 3FM9A 3FRPG 4IKOA 5FXMA 4CTMA 1OPOA 3A3OA 3GMLA 1P1RA 3SPHA 4RABA 2EEXA 6PCYA 2BM3A 2JFOA 1G8KA 1OP5H 4FA7B 4UAHA 5AG9A 3VNZA 4GIPD 2EARA 2YJNA 2CLDX 3M1BB 1G8GA 3JWGA 2GKIA 1JPUA 1YB4A 2AJVL 1N6QL 3QDGD 4G7QB 2ATAA 4PRKA 4GINA 1O89A 3DBHA 2Z4QA 4DJDC 3L08A 3ESZA 5F0MB 2GPBA 2FN9A 4LV6A 1SULA 3GYRA 1N0IA 3C1UA 1EK3A 4UDUA 2WU3A 3TQHA 2WLZA 4S1DC 4JUTA 2ZFUA 3IKMB 7MHTA 3AEQA 4YRQA 1SR8A 5INTA 5ED4A 3E1F1 1WIPA 4JI0B 4C6SA 1S6NA 1TVHA 1X7SA 1O3YA 2H1CA 5MGNA 4I81A 3C60A 2FHCA 1UH3A 4PQRA 4JI6B 3REWB 4ZCPA 1AUOA 3RL1A 4QXPA 3H6GA 2YD8A 5KOIA 3O3EB 3WXMA 3OM9A 3WP1B 3UZQB 4RJ2A 2H32H 2PGNA 3S8EA 2DQJH 4WNAA 3IE4A 1KPUA 1ZHKA 4XP1H 4WKXA 2I8AA 5EF2A 2XV6B 2XTNA 4HNAB 5FPHA 3VXOA 1TDJA 4YBQD 4KYUA 5DVPA 1V4BA 4GSKA 3ZIDA 5M29A 4D4KA 4QRUB 1F8YA 4BSVA 4JBWA 4JHWL 4JANB 1U0LA 4QGFA 2JWYA 1E3MA 1H3VA 2D3TA 5DTQA 4YYZA 1EQWA 4NSKB 5FR1A 1QK3A 4O4LB 5HX7A 5DYWA 4OZFH 3UYOD 1HT6A 3RLIA 4KLAA 3HG1D 3MBWA 2CVQA 5B1DA 1RPTA 2E85A 3DC7A 4OJFL 5BSEA 4BX8A 1OAKL 3EOYG 3LKVA 1Z6YA 4HJIA 1PMYA 1NY6A 2V7BA 3Q7SA 2CBOA 4JCWA 4MCAA 4X8MA 3D25B 2XNSA 1SIUA 3K05A 2PM8A 3R0MA 5HPYB 4DVBB 4IEFB 3WS3B 3L8DA 3TWCH 1RI8A 1ZZEA 4P23A 5FX2A 1CX9B 5KN5A 3G08B 3EDOA 5SWZA 4MGYR 2E5LB 2XPGB 2ZXQA 3IL2A 4EENA 1SKMA 3AHDA 4MNQD 3A1SA 3W4IA 5CLIA 1UXOA 5EKSA 1KTRL 4BB9A 3IVKB 1W19A 3GLZA 2P5EA 3KPWA 3V46A 1W8IA 2CEAA 1ENOA 1RYYA 4S1SH 1WG3A 4DLBA 4ADGA 1UOOA 3UWPA 2NYRA 5F4ZA 1ACXA 4P46D 1NFDF 3H9HB 1O0VA 3SO3C 5C9ZA 1ZPUA 4P9HC 1P4AA 4LEIA 1MFEH 5BV8A 3SHQA 3PVSA 4XNAA 4XVRA 4LRSB 3SCMD 1MEXH 4LRIA 2JELL 3L0DA 2OZKA 3TOXA 3B70A 4XMWA 5MN6A 2J8HA 1NDUA 2W94A 3T3DA 3WIDA 3BIKB 3G0CA 4B96A 1CXIA 4G0YA 5H2BA 1AV7A 4N2FA 5EF1A 3UJCA 3C6QA 1A6TA 1TJXA 3U9PL 5DGTA 3LPFA 1BP3B 2DWTA 4K9EH 3KCNA 1V3UA 1N9PA 4EHLA 5EJGA 4DQ0A 3VSDA 3FUWA 3ZDZB 3A1WA 4BNZA 1XQ4A 2HCBA 3SHFA 4HTAA 1LSOA 1NVWQ 1E42A 4X7EC 1XF9A 2F64A 4AZ8B 2ZXCA 2VTDA 1XCXA 2NXZD 3CKKA 3NKLA 3QUYD 1ZIDA 5JQ6L 3O8XB 3ALXA 3V8RA 1P60A 2WKQA 4HK3J 5FKAB 1Z15A 3B2UC 4XODA 4UT7H 4WBNB 1B15A 1OWOA 3CFIC 4FL4C 4X7SH 1SJEB 3KSMA 5E1IA 1HU8A 6YASA 5EZOH 4KN9S 3WWEA 4R96B 1CUHA 2VDMB 2FT8A 4OAPA 3DSNB 4HUTA 3H5RA 1BX0A 2PZLA 1GCAA 1BREA 3RDTD 1AKWA 2HK9A 4WW0A 2O8FB 5IFLA 3B6SA 1OLUA 2R48A 1CIPA 1NFIA 1HDMB 3BMNA 4F1ZA 4LHUA 4Z3IA 3HZZA 1KDYA 5EOCL 4MNHA 2L0DA 1I8LA 4JM2A 4Q7QA 3N41F 2WO2B 5IW1A 2CLCX 1J1XH 2A1UA 1NLUA 1ZGZA 1ZUD1 3KE9A 1EXNA 5CGQB 5FLVA 5AJUA 2K3HA 3MACL 1OZAA 3J2PA 3OPNA 4M7LT 1EFRD 5DF1A 1Y3AA 4FXKC 4URUR 4UUMA 5CBKA 3JQ9C 1AVTA 3ZKSD 2O1EA 4C2BA 1S3KH 5REQB 4QRIA 2VXQA 3FDJA 2COQA 5EXPA 1GSMA 2WHEA 3IKJA 2D7QA 3S5JA 4RKQA 1NBVH 5D96B 3BULA 2H2GA 3MRFB 4EGAA 1I3UA 2F1KA 3QUMB 3D7SA 4DP6X 4FW9A 4Y7CA 1KYOJ 1ZK3A 3SDSA 2FLMA 1LFAA 3UBXB 4U1MA 4MUFA 3LZOA 1JILA 1FIGL 4HWGA 1KMIY 3O41B 1ZAKA 4CILA 2FYYB 3A4MA 3C87A 2BHSA 4JFAA 5CFNA 2XN9A 1MXHA 4HXEB 5AVTA 2P8LA 4U1HB 3L6FA 5KVAA 5K05A 4N3BA 4XAQA 1XPOA 5DS8B 4EF4A 2ASVA 4BSJA 1DC3A 4AEHL 5DJAA 4EG1A 2JVJA 1KDTA 2MSWA 4Y5XA 3CC5B 4F7MB 5ULLA 5CINH 1HJBC 1H6EA 2BY1A 1O1YA 2BD0A 3GF8A 1MIML 5JZSA 3TVMD 2ZS9A 4O4IF 4V1CA 1MHPA 3FTSA 5H94B 3V42A 4A6DA 1TO1E 4HQLA 3VWKD 4WF7A 2FDBP 5IXJA 1B8NA 2VZUA 1Q14A 1R8SA 3UAYA 5IR1B 2E4AA 3D3JA 2ESRA 4QXGL 5AR1A 4F97A 4L9RA 4P05A 2VXQH 2CFTA 4KNSA 4N20A 3EJYC 4OOFA 4RKEA 1RQ5A 4UQLA 4RGNE 2BSBA 1RIUL 3JTBA 1OPGH 4BO3A 1ABFA 3OBAA 3Q1SL 4DREA 5GHWH 4KZDL 2ATPB 2E56A 3DXAD 1R37A 1H8EA 3DX7A 3N1UA 4FOOA 4XQGA 3NH7L 3ORRA 5DOVA 4J1NA 2JLQA 1EM8B 1Y6KR 2FLBT 1D2AA 2BUBA 4UV4L 4Q3NA 1H66A 1ZOXA 2Y69B 1RCUA 5AKEA 2B4CC 1C5BL 2HYIC 4Z6AT 4AYGA 3MRMB 3BGMA 3QZWG 4NQED 3T3MB 3FYHA 5BOSB 2BF4A 3THYA 5D1QA 1IG3A 3TQRA 5AVWB 2ZQZA 3OKYA 2V7UA 3B6MA 5ER6A 1ZGGA 3SE3C 2R29A 2YIHA 1AJEA 1V47A 1VIVA 5HCNA 4GOMD 1MHPH 2DUNA 2GC7C 3P0JA 2P40A 4MAMA 3D1VA 4PRHE 5H9VA 3RFFA 2NSQA 2RAPA 1KY6A 5DQDH 4EYGA 5LQBH 2IPMA 1EM6A 3KXFA 4RGQA 1M66A 5KVGL 3HZMA 5BRPA 2OCJA 1VSTA 3I05A 4OY9A 2AABL 3LH2L 4Z7NF 3NJVA 5AM3A 1RSFA 4D8VA 1AHNA 3MV7E 4WXEA 1TYBE 1M1UA 1NAMA 4NI3A 1Y6ZA 1HHIB 1HL3A 3JWNH 4GVLA 4BOYA 5FK9B 4AZ3A 4WTZG 4U9UA 3L84A 4J3JA 3SDBA 1XV5A 1K4CA 4N7BA 5EXXA 1MCJA 4EYSA 2VDPB 4BNTA 4CMKA 4KH1A 4X5PA 1E5XA 3WJ1A 2HFKA 5L6LB 1UOVA 2P7IA 4U9IS 2YN0A 2YC2C 1AHHA 1PS0A 4X7TB 4TUJB 3H0TA 1H2RS 4G42A 3ARGB 3NP3A 2VZTA 2O2IA 2JF0A 2GFIA 4GT1A 3J7AC 5G5DA 5FECA 2B7BA 5I6LA 1SVCP 5J11B 3ULVL 3HDHA 4JXXA 3TEZA 2V96A 4G6ZA 3K1KC 4NZDA 4M4RB 2HQ1A 4IIGA 3N58A 3A6ZA 2R29H 2F54E 4H40A 1HOEA 3O3AA 2CHVA 3MYJA 2P3OA 2Z6UA 3WGHA 5AOAA 1VCMA 4EEEA 2O6DA 4LZZA 1J4AA 2ZCHH 4ZYVA 1A7PH 3FJYA 3WYNA 3V9AA 2EDHA 3I01M 2VK2A 4ARAA 4AYBA 1OD9A 2P5PA 2XTJB 1QK4A 5CDUA 3MUJA 2FKNA 1Z35A 5I1LA 3AR9A 3LYRA 4YR6B 4Q9QL 1BMZA 4Z18A 4AJYV 1FGVH 5GISL 2F7RA 3UYPA 4F7CA 4AYWA 2VN4A 5AKGA 1H4QA 5CJPA 4WZ6A 1NAMH 2BKEA 3RVVC 2Z56A 2IXQB 1ORQB 1UJ5A 2IF2A 5KSVB 1CI5A 2ZJZA 2FN8A 1SXZA 2CLZA 4NN5C 1RLWA 5HVHB 1VGEL 3G5XB 4U6VL 2I54A 2J0UA 3DVAA 3GEIA 4L08A 1SEQL 3QWOB 5DD1L 4AZSA 3LAWA 2F8LA 4BNDA 5F9WB 4JHAH 3BWXA 3THOA 1VKXB 3DIDA 1U30A 1XGTB 3PGCB 4LXTA 4GPEA 3T65A 2Y4NA 4XARA 2WNHA 1BCRB 1A1VA 5AW9A 4HXFB 2CEKA 1ZMOA 1DSYA 2XX1A 1GGHA 2J43A 1L9XA 4RD6A 4WNJA 4Q7EA 2VA8A 2K9FB 3UPRB 3AKDA 2D3VA 1YNTB 3DOHA 4JKMA 3VCLA 1I4FA 2AJXL 3JWDC 5JNYB 5FOXA 3TN7A 1W4RA 3TEJA 3GIDA 2X10A 4OCRL 4I99A 5FH9A 2DWDB 4JPVH 3FYCA 5FWXA 4BQEA 2FTAA 4KR0A 2WFAA 3RGVA 3CX7A 2EQDA 4A7SA 2WZ6A 1G4RA 1YR2A 4F37K 3IMKA 3WSVA 4KVCH 5C81A 3NKFA 5FUBA 2N1KA 3V8BA 4AE0A 5F6IB 3I02A 4G3YH 4HQRA 1TU4A 5HGAA 4HPXB 1BXGB 5IEKB 4U1NA 2XMGA 1JHQA 2REQA 1G8SA 1OV6A 1AGBA 5JDSA 1F8TH 2ATKB 4BINA 2QZZA 5FYLH 2JK0A 4XR4A 3ARBA 3LMJL 1U4SA 4CSZA 1NWPA 2YY7A 4G23A 1NCIA 4WWKA 2KQNA 1CQKA 4E07A 2WFLA 4DR1B 3V3TA 5A7BA 2GTZA 1XFAA 4YPJA 1XZMA 1QOQB 2JIDA 3OJWA 2ID5A 1WO2A 4JQXA 3WB2A 3VA6A 5KDLA 3MA9H 3TJPA 4OF5A 4TQPA 5DHMC 4N90E 4R2WA 1YNKL 1UEMA 5F1OB 3N3BC 3IMVA 3DX3A 4JLWA 4JOQA 4IF4A 4PJ5E 3GPIA 1NM5A 4UIMA 1JECA 4PZLA 5JAIA 1DBSA 3FC8A 1KBGL 1V27A 2OP1A 4OM0L 4TZTA 3GMPA 1O57A 5EU6A 4EY8A 4B79A 2VDRB 1HQRA 4HKXA 1NQ5A 1IC4L 1IJKA 1Z36A 2VUSA 4CC0A 2LPMA 3QELA 1R16A 6TAAA 1WXWA 4R4BA 2F4NA 3P02A 5CDFE 5LQAA 4NZOA 1UIRA 4K71C 5CBAA 1F42A 5KSUB 5KVDL 3HNOA 4GYBA 5HCUA 1GPWB 1LKZA 1KI9A 4X6CF 3FTXA 4UHCA 2V33A 2O8CA 1BQRA 1U2CA 4HL6A 3RU3A 2EDBA 2QDVA 2WW8A 3ULVD 2F9BT 4ZYTA 2RMNA 4R2GD 3CUPA 1IAKA 3TL2A 3VX3A 3BOVA 3OQIB 3PDWA 1TMOA 5J12C 2E8YA 5I1DA 4EK9A 1XGPB 1MVNA 3GRKA 4H16A 3EJPA 3UICA 1HL4A 1DDGA 3QISA 2EDDA 4OQ1A 3NIDE 2PLTA 3ET5A 2YOAA 1CWVA 1HHHB 3H1BA 4YT5A 3RVWC 1DLJA 3N5KA 5SYNA 1MCHA 4M9ZA 4L18A 4M6AA 4O4LF 3WDLA 3EOAI 1PLCA 4YCSA 1SWWA 1WC7A 3PF8A 5DK2B 5FGBC 4AJEA 2LABA 4LDOB 3D39A 3AYZB 3IUMA 2QT6A 2BCKB 3JY6A 1Z5OA 1N0XL 3BIAX 3FQWA 5JG7A 5JZOA 5KVVA 1V37A 4IZ6A 4TVPH 3WKQA 4XN4A 3TPUA 4QFBA 3IR5A 3O8RA 1UBKS 3ZU4A 2LLLA 2NYKA 1DKLA 2R8OA 4F56A 1YCSA 5D1ZC 3VNBA 2XC8A 5EHXA 1U92B 1XHHA 1AK2A 4HK0B 1I1AB 3DT6A 2FX9H 5AVOA 4F7PB 2PO6C 4K86A 3OG9A 3MHPA 3QORB 2GHTA 3CTPA 4HHAA 2I7TA 4ABTA 1JR6A 3D4PA 3DLAA 1NKSA 2IF7A 2A33A 3WIEA 3I50H 4QXVA 4RGOH 1T03H 1FL6B 4J0CA 4LKRA 1UXGA 4LGCA 5ILQA 1G7CA 2BM9A 4EQ3A 5KEZA 1ID2A 2PVCA 1CBJA 1U6AH 4QXOA 4UBIA 4AL4A 5DEFA 4K9NA 1TIBA 1TF5A 5ESQB 3G3EA 3MBKA 2H0RA 3PXEA 1ND0B 4BGEA 2WO4A 2QUBA 1FL3A 1VAHA 1EAQA 2EYSA 3COWA 3FTYA 1R3KA 2JJSA 5JCJD 4CU8A 25C8H 4HCRL 3H5LA 3M45A 1YDGA 3ZDZF 4BNGA 4YHOH 2DWQA 4MQEA 3O2DA 2X4UB 1V1JA 4Q6WA 4QMEA 4CQJA 1HEHC 4HIQA 1DQML 5LZ9A 4R0LB 4Z51A 2D2OA 1ZLWH 5CSZB 4OYLA 2V4UA 1H5BB 3FNIA 3FUCA 2JK1A 1BFDA 4WBNF 3GTVA 1PR5A 4WY7L 3O4VA 1EX6A 2DC1A 5JHHB 3JTEA 2XT0A 1BZDA 3ZW3A 1P0PA 3D51A 4MPDA 4GP4B 2GK4A 4ESHA 2WJVA 2PWFA 2CCGA 1W581 2QZSA 1S3IA 1A7NL 1KGYE 1ZT7B 2PYFB 5BS0B 3IEMA 4PY8J 1THCA 3S35H 4O08A 1N8ZB 5KBNC 1G7IA 5EFZA 3CJQA 1B9KA 5JVDF 2F7SA 4B3MB 4EP1A 2QQNH 4OW6A 4TPRL 1MJ8L 3CA8A 3MRPB 3WFBH 1I7RA 3RTQD 1G7RA 3NALA 2APXA 1C7IA 1ZI6A 1G4UR 1XV8A 1E2ZA 4GPBA 1HS6A 1DX4A 1FVEA 1DCTA 4O2AA 2GJ6D 3GGOA 3G49A 3QIWA 4L7VA 5T3YA 2NUPA 3S34H 1E5AA 1OAYL 4GUDA 4HFMA 2IEBA 3LUJA 1BWMA 3O2DH 4YS4A 4WV1B 2X4LA 3TCKA 1ONOA 3PFQA 1UXSA 1ZTMA 1WS7A 2DERA 4EHDA 4NQCB 2ZCZA 3OX8A 2V7EA 3HMQA 1WB6A 4L4TD 1BAGA 4DZBA 1M2VA 5D7HA 1LLCA 3BVPA 4CLDA 4PREA 5AM2A 3V4RA 3P3SA 5GS0L 1KEUA 3PV7A 4DW8A 1DGQA 4G8FA 5DHFA 1E90A 2BEUB 3A4NA 4N0MA 4JE4B 2O8BB 2GPWA 2ZM6B 1BVOA 3GNMH 4R54A 5IHWA 4YHKH 2EL7A 1ATZA 1I2MA 1XF5A 4QRSB 1W75A 3QY9A 5C97A 1C1YA 4EJ6A 5JXWA 5LWYH 3GAMA 4ZOLA 2DR2A 3JARB 1FYWA 2OK8A 2YUWA 4XGRA 5BV1A 3HS0A 1FFAA 4A1RA 1MAML 4X0NA 3DPUA 3L79A 5FWYA 4G11A 4KMTL 1OU0A 5B3NA 3BWSA 2A9CA 3O4LE 2GD1O 3QBVA 4PWJA 1JN6A 2ZRHA 3STXA 4MMXA 4LVNA 3CFKA 1GZ7A 4D9LH 5DD5H 3WDIA 3OJLA 2WBLC 2A9RA 4NFSA 2MTPA 1EFVA 1RK1A 2X7XA 1I2CA 1NEUA 5L8KB 2O4EA 4OYRA 2NTJA 4X8HA 5ICUA 4PRIB 2I33A 4PGCA 3DRTB 1YA8A 1ZHNB 3PX3A 1KI7A 2GTWA 4XP6L 1FJ1B 1F4LA 3O8OA 1FC1A 4DRYA 1XH1A 3HYNA 3WLKX 5ILTH 1ZPDA 2ZP8A 1NAIA 4DV6B 4M9XA 1WU8A 4GE3A 5H4GA 1M6UA 1HYBA 3VSAA 4MZXA 2W9DH 1KTBA 1G8YA 3R7LA 1JJUA 1NCWH 3O2WH 4UNSA 3MCG1 3C5EA 2C3VB 4B81A 3K32A 1IGYA 4FFVC 5AB1A 1EB9A 3E7DA 5AYUL 4XAKD 1R34A 1EG2A 3SE4A 1HLPA 3KPPB 2J71A 2OTUA 4DUZB 1U5AA 2X2JA 4QFDA 2G2RB 1E9SA 2BSSB 3F6BX 5L51A 1FW8A 4OM8A 3UGJA 3LYLA 2QKIA 4OCLC 3BMXA 4FFWD 4PJDB 4KXUA 1SHTX 1A4IA 1JG9A 1I32A 4IV8A 2E55A 3T3MF 3R6DA 5C09A 4GXTA 1VACB 3F7VA 1MU0A 3H75A 1FNNA 1A2YA 3NBQA 1VFAB 2EO1A 2R4SL 1K5NA 2YS6A 1XELA 4ZHQF 1CVRA 1GVIA 5T3XE 5A7GA 3AEUA 3T4UA 1F4WL 1ONBA 3CVHB 3D85D 1E8ZA 4DGYL 3L0IB 1E9OA 2A74B 5F9OL 4EGCB 1OEZW 3LKPA 2VWGA 5EMJA 1R00A 1QR2A 4TRJA 3LKZA 5EULV 1UB5A 1NJSA 3DCIA 5C3IA 1P7BA 1K66A 2QRVB 2EJTA 2WRZA 3BIJA 3OKNA 1ZNXA 5J1TC 4C0SA 3KEQA 1SA0B 3EDEA 2WIFA 4FP9A 1RZGA 5ITZB 2BERA 1JLKA 5TF1H 3VDAA 3UPUA 4Q47A 4NXMB 1SU7A 5HJGA 1EERB 1GL9B 1G4HA 3LBAA 4OB6A 2H8GA 5ELMA 4PTTB 4LKCB 2OMNA 4PGZA 1PX2A 4MDIA 3FKSA 2HG5A 4IKNA 4K94C 3HA0A 1JBQA 2Q7OE 2RB4A 2PZMA 4TTAA 4K73A 4O2FA 1WABA 4YDIH 2ESVE 1BG1A 3R06A 1BJ1H 5HGDA 3E5HA 4BFTA 3U60B 2ZRQA 1JLSA 2MQCA 4ED9A 4WO4D 4YHZL 2V0NA 2G75A 1F18A 3NORA 4Z5RA 1N6RA 4W5HA 3QRLA 4N8VA 1CNMA 2I4OA 1OW0A 2FRDC 4WQOA 2VZ9A 3CXDH 3NA9L 4BO8A 4BXVA 3AKYA 3F4LA 3UB3A 5AVYA 2WUBH 1QQTA 5GS0D 4PYHA 3SCZA 3NCHA 4YRIA 4NV0A 1CSEE 3H7LA 5K09A 1VMKA 3IJ7A 5JALA 4ZARA 5KTYA 4QJ4A 1G6OA 1E63A 2MU1A 3VVCA 3EEYA 1IGJA 3EJQA 5IVOA 2C31A 2WSKA 1MG3C 1VB9A 3W5JA 2GEVA 3ULSB 4FR0A 3AUXA 2W8BA 3GBDA 3L46A 4RA9A 5HZGA 1PZCA 4Y67A 4KK8C 2YRLA 3TO2A 1AO3A 3MINA 5IYZB 2C9MA 3WTYA 2NXYD 1JQKA 4JLVA 3SDDD 1RXWA 5HHQB 2WKWA 1SVLA 5F88B 1XDZA 3EDDA 3MN8A 1SELA 5ILOA 2Q3JA 1WAEA 3E9RA 2DBQA 2II6A 3P2EA 3DO4A 4RIRB 1K5PA 4BNHA 4KTEH 1ZBDA 4XUCA 3D07A 2VQ1B 4MUHA 5DO8A 4XP1L 3HY3A 3QBTB 4S2SB 2PCJA 1NX9A 4HNUA 4R26L 2RI0A 4FOLA 2HMAA 2YAPA 2X0UA 4F8TA 4ZAZA 4QUIA 1ZC4A 5FOQA 5F9DC 2YCLA 3RWHA 3MELA 4XJXA 3VAYA 2H5IA 4JW3A 4PYOA 4LQLA 1OVGA 3ETEA 2ONJA 5K3OA 3ZDXE 2BO0A 2FLVA 2NP6A 4U3JA 4E0RB 4ZX4A 3QEMA 3CKMA 1OH5A 3TFKD 4FX5A 5GGRB 4MLCA 3N91A 4HT1H 3IPAA 3VWJD 4CGUB 1BXKA 4OBRA 1JS1X 3K20A 1ETA1 2FNBA 3DMFA 3KDPB 3CF0A 4JGGA 5EZ6B 3COPA 3BKYL 3LRGA 3TWCL 2YYZA 3STTA 5C0IB 3LV8A 3BE4A 1CTNA 3SN6A 3TASA 4P4KB 3KVRA 2XPCA 5LMUB 4DR2B 1CFZA 3FPHA 2WWWA 1NLDH 2H7CA 1P84J 3C8UA 4KB5A 1BFUA 5CEZL 1FTGA 2ZXBA 3KZVA 4HU2A 1YC7A 1E2MA 1BAWA 1XMJA 2WCSA 3ACDA 1RMYA 1CZNA 1MLDA 5FKPA 5E4TA 5LQNA 5DIZA 2RH4A 5GZND 3TVYA 1VPWA 4OU3A 1O4WA 4IDOA 2GA8A 3AX6A 1SXJA 4K9OA 1MFEL 3THXB 5HFNA 2G0LA 2AC0A 4E5KA 1WULS 4FEYA 3V1LA 3RBGA 1UWFA 4R5HA 2Z3VA 4HGMA 2ATEA 1T80A 4PY8I 5JIHA 3VZBA 3FT3A 3EZ9A 1ODJA 1M74A 2WLKA 4UHHA 2YHIB 1N6PA 4K9EL 4JELA 6ABPA 2BP5M 3BF8A 3VG0H 3IAFA 3VBEA 4NBNA 1WA5A 2BZCA 3N5AA 1U9IA 5FA8A 4OV5A 3NCTA 7ADHA 3HLAB 4BNLA 2P80A 1J87A 4I50B 4JG5A 5E8DH 2RHGB 4JFED 5E4OA 3WTTA 4PPFA 2B99A 3UTSA 4F4DA 2IX3A 1PKOA 4EARA 1SF5A 3EYVB 4ISVA 4IDHA 4WWID 1T1XB 3UHAA 4DV5B 1LK7A 1EUZA 2Y1OA 4UT7L 1SVOA 1K3ZA 4L78A 1QFWM 3NRQA 3SODB 4KXBA 4FNMA 1XTZA 3RZWA 3RWJB 3ZBTA 2BLFA 1QRSA 2Y92A 3VSVA 3M7FB 1VGKA 1LK3H 1BH2A 1RBQA 3T5GA 3QVVA 4X7CC 1SIOA 5EZOL 2HX1A 3J07A 3LQZA 2AV7B 3T3IA 4EUNA 2AMUA 4P57B 1K75A 1JV5B 5K3SA 2RHMA 3NYIA 4K03A 4XD7D 1UWCA 4DN3L 1B9ZA 5ES4B 2QZQA 4BZ2A 1RZRA 4IP0A 1GKLA 4IYKA 4ZVLA 3A6BH 4XPAL 4FC3E 3BZUA 3C2QA 5FO1A 2XWTA 2NU9B 1P9MC 4UZGA 3BFQG 4L4SA 3HVRA 5F33A 2H2AA 4P4SB 3DOSB 1DZBA 2YJTD 3GUUA 4ESEA 1BA2A 3TD9A 4TNFA 4E4YA 3L9EA 2CMGA 3MSPA 3VXRE 1YMME 2P3LA 5C0EA 4F5EA 3ICVA 4YHYB 3SK0A 2XNCA 1S3KL 1T34A 5K7SA 1U3HA 1X3DA 4I4NA 3RWEA 4POUB 4AXWB 1NBVL 3D5EA 3GPLA 1OFGA 4X7DC 4YHLH 4GFTB 1JTEA 2B5VA 1QEWA 3W8NA 1EAJA 2H07A 2RHDA 5ENWB 2ORED 3PE4A 3KPOA 1U8YA 1UURA 5DLYA 1PDWA 1T15A 3FBGA 1I3VA 3CIAA 1XH3A 1B4RA 2V7PA 5CB4B 4HDAA 3PWJA 3S5LA 2I7SA 4KK6C 4EJFA 3QFDB 3ZDYE 4PIRF 3HC4H 5FM4A 2ZX6A 3WBKA 4C7OA 3OO0A 1EHYA 4TKVB 1QVRA 1KJZA 5E51A 2XWDA 1O6SB 5ALPA 1CLOH 3LZQA 5DNDA 3OIGA 3IXTA 3IU4H 1YUKB 2ZBFA 1NR1A 2ZWPA 3L3IA 3RDJA 1JIBA 1QC5B 1WFMA 1TYEB 1N5LA 5CINL 4H1WA 3STWA 1Z4KA 5JRDS 1MV5A 1A9OA 2C1EA 1RD6A 2EUVA 3I53A 2IGLA 3OLDA 5BRJA 3S28A 4HLQB 2ZSAA 3C3AA 3OWEA 3AGVA 1PK7A 4PGBB 2XV0A 1L5MA 4N68A 1O54A 1AZVA 1Z2DA 4IO0A 3GGSA 4UXIA 2VC2B 2JFPA 4DYHA 4BBWA 3ET4A 2Q8PA 2G5CA 3C60D 4ZZFA 3BFVA 1GNTA 2VXQL 1LDMA 2G5GX 1JLLA 3MS4A 3L8QA 2PIDA 1DL7H 1T3HA 2DDQH 3A26A 3SP1A 1QCZA 2EKQA 1OPGL 5GHWL 3FUKA 2WJ3A 4JHWH 1DUZA 2UVDA 4EJSA 2H3NB 3GFUA 1G21E 2KZBA 5LKRA 2Z1MA 1BWSA 4U2BA 1TLLA 3PWVA 3MODH 4OJFH 1R3UA 3ARRA 3DXFA 3EOBI 4NHCH 2WLJA 4FUQA 4GMDA 4LHSA 3N2YA 2BNUB 1ZDSA 3M6UA 4GUPA 2X76A 4ZW8A 2IYEA 4JVWA 1U8IA 4LL4A 1VFPA 1QYDA 4AJLA 3RKSA 3ABKB 4DT2A 2PX0A 3C5ZC 1DVXA 4Z77B 2DQTL 1BVUA 2HRQA 1AM4D 5JPMA 2WQZA 1YGYA 5TSDA 4K15A 1KH1A 1JZJA 1MHPL 2CCKA 1PZGA 3U3OA 3D4ZA 1L7VC 2WXNA 4AUYA 3VXSB 3REWA 3ATBA 1LTXA 2C5AA 5HS4A 5DQDL 4ZT5A 5SWZD 5LQBL 1EAYA 5IN4A 1XRLA 1G1MA 3W9BA 1FN4A 3QVOA 5GGUA 2VT7A 4HEMA 5IFAL 2SICE 1NLBH 2WJAA 3OE4A 3QZWB 4CLXA 5FAXA 4QHKJ 4O2BA 2P5ED 4ROSA 3WFIA 5TVKA 3KBFA 3B51X 3NT4A 1H0KA 1H8NA 2JELH 2JFQA 2VJYA 2RKWA 1OFHA 3HJRA 5JO9A 2QNIA 1T1RA 1SK8A 4EPSA 4J4HA 4CWAA 5A6MA 1U0OC 2D1YA 5CB8A 3FUXA 1ZA2A 4FKEA 1WA0X 3EGXA 2WM2A 3HRZA 4AKOA 3WBJA 4F5CE 1DFHA 3P26A 3R9IA 2FPLA 1BF8A 4LOKA 1MW2A 1IEXA 3U9PH 2JHAA 3AUAA 3ROQA 3GRCA 4M3KB 4YMGA 2VKTA 2DKFA 3M6XA 3B1FA 5ERWA 4KROB 3WNKA 5MDHA 1L9KA 1EQUA 1P2CB 1DAOA 3D25A 1U5CA 4IIZA 4RD3A 1T3GA 5IJKC 2VAAA 5DYIA 2EX4A 3TVDA 3N0TA 4DVBA 1QGZA 3OFJA 3WS3A 3CZFA 4L1HA 1TW3A 1SNRA 3VISA 4NBKA 2ZE7A 1TQCB 1M2EA 3QXHA 2DTSA 1O5DT 3NIDF 3AR8A 4KTDH 2WN2A 2V2XA 1AR1D 3ELAT 3ASNB 2ZCHL 1QUNA 1A7PL 4YAKA 1DJOA 3TTWA 1UJBA 3SS8A 3DTVA 1P9WA 2NZJA 4XQ9A 4LF9B 4PJ8A 2I7OA 3GIVA 2CWDA 1YZZA 2BVYA 1E64A 3NGLA 4JBIA 1BZOA 2QTNA 5FHRA 4MKXA 1NRJB 4YI5A 1I8IA 1CF4A 2JKIS 1FGVL 1D6JA 3G0HA 3WGKA 4N47A 1QV9A 3T77B 1NAML 4JHLA 5EOCH 3UBXG 1FVHA 3B9PA 4NBSA 4WA7A 2ICWB 1OB1B 4PJDF 5AXDA 2H26A 4L3EA 1IH8A 2YKKA 3P4UA 4OQFA 1NANH 1K6MA 1KO8A 621PA 3TAHA 3G7NA 3G5WA 5A02A 4P4UA 4LHUD 3IDNA 3MMSA 1BA3A 1XWIA 4C57C 4M22A 4JHAL 4PRNA 3AEYA 4XPHL 4QDGA 1ZGLB 4JM2D 4QNPF 5C32A 4H8VA 4EL0A 3G8DA 1HURA 1LVEA 6REQA 1EX9A 1CUEA 1JNYA 3CFJB 4NAVA 3O8NA 2DEUA 4F2PA 4K7FA 2QUIA 4R8SA 5HRAA 4IJWA 2O8EB 3TNNB 4ZYKB 1P1JA 4FFRA 4KRGA 5C08E 3O6MH 4BA0A 1NR5A 4FLRA 3C98A 1KCKA 5FKAA 1UBRS 4DQKA 4FFBA 4D5GA 1WB4A 1