4I1PA

Human malt1 (caspase-ig3) in complex with activity based-probe
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
379
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Activity-Based Probes for Detection of Active MALT1 Paracaspase in Immune Cells and Lymphomas.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 110
structure length 379
sequence length 379
chains with identical sequence C
ec nomenclature ec 3.4.22.-:
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4i1pA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i1pA01
4DCPA 4AWBA 2XYPA 5IBCA 1RWKA 3H11B 2QLJA 4FDLA 5IAJA 4EHAA 3BIJA 3DEJA 2XYGA 4JJ7A 4QUIA 4DCJA 3V6LA 3UOAB 5LUAA 1RHMA 1IBCA 1SHJA 4HQRA 4ZVRA 1F1JA 1I51A 3PD1A 2H4YA 2QL7A 4D3ZA 4FEAA 2J30A 4QUBA 5IAGA 1RWNA 1CVRA 3V55A 3GJRA 2P2CA 1RHUA 1SHLA 3E4CA 4EHFA 4QTXA 3V4LA 2C2KA 5IARA 2K7ZA 4ZVQA 5I9BA 5IC4A 2DKOA 3NS7A 3R7SA 4ZVSA 4NBKA 1M72A 4ZVPA 4EHNA 2HBYA 3P4UA 4N7MA 4QUHA 5IAEA 3V4OA 2XZTA 4JJEA 1I3OA 3NKFA 4QULA 2FP3A 3R6GA 4ZVTA 2C1EA 4NOKA 5H0IA 1RHJA 3RJMA 3QNWA 2HBZA 4NOLA 2C2OA 1I4OA 1NMQA 3OD5A 4QUJA 1RWXA 2H48A 2H5JA 2WDPA 1RWWA 3GJSA 3H11A 3ITNA 4ZVUA 4JR1A 1QX3A 1PYOA 1SC3A 3KJNA 4JJ8A 1NW9B 5JFTA 2H65A 1JXQA 4NOMA 1GQFA 3GJTA 2HBQA 3H1PA 4NBNA 1ICEA 3D6MA 4NOJA 2AR9A 4AWAA 5IANA 4EHDA 1RHKA 4M9RA 4N7JA 1BMQA 2CJXA 4D3XA 2FUNB 2HBRA 4JQYA 4JR2A 5LU8A 4PS1A 3DEIA 2H54A 3D6FA 4QU5A 2CJYA 1K86A 4HQ0A 1QDUA 2NN3C 4QUEA 1CP3A 1RE1A 3R5KA 4QUGA 4QUDA 5IBPA 3KJQA 4JB8A 5K20A 3P45A 5IC6A 2XZDA 4PS0A 4FGUA 2FQQA 3NR2A 1PAUA 2CNOA 4QU9A 4DCOA 3PCXA 4QU0A 4ZVOA 2H51A 1SC4A 2QLFA 4AW9A 2CDRA 4EHKA 1NMSA 3SIRA 2Y1LA 2H4WA 2QL5A 3R7NA 4FXOA 4IYRA 2CNNA 2H5IA 3DEHA 4JQZA 4I1RA 1GFWA 1QTNA 4EHHA 4N6NA 1F9EA 4QU8A 1SC1A 2C2MA 4QTYA 4QUAA 4LSZA 2QLBA 1RWPA 1NMEA 5I9TA 3K7EA 3H13A 4N6OA 3IBFA 2CNLA 4IEFB 1RHRA 2C2ZA 2J31A 3V3KA 5IABA 3H0EA 3S70A 1RWOA 2J32A 3R7BA 4N5DA 1RHQA 3EDQA 3S8EA 2Y0BA 1RWMA 1RWVA 2CNKA 3D6HA 3KJFA 5LUBA 3V6MA 3R6LA 5IAKA 1KMCA 4PRZA 4I1PA 2J33A 4JR0A 4EHLA 5IASA 5LU9A 4N6GA 3EDRA 3PD0A 1K88A 3IBCA 3GJQA 1I4EB 4HVAA 3SIPA 4D3YA 2XYHA 5IBRA 4PRYA 3UO8B 4NBLA 2QL9A 3R5JA 4EJFA 3DEKA
chains in the Genus database with same CATH superfamily
1QU2A 5E51A 1NASA 1UFRA 1CE1L 3ZR6A 2V0GA 2R39A 3E9NA 3TEXA 35C8L 2BXZA 5K9OA 2ZAOA 2HUEA 2OL3L 3L41A 3WLBA 1E4XH 3VUEA 4ARSA 3L3GA 4Z4IA 2VXYA 3BVWA 3SVLA 3N43F 3E5NA 4JELA 4KRGA 5SZIA 1ULVA 3GA7A 4W9DC 3MWEA 3DE5X 2YMLA 1JIQA 4JG1L 4RY9A 2P8MA 3BP6B 5IOPA 4UV4L 5L51A 2CXNA 1JIUA 1LBHA 4DNXA 2GY5A 3SQWA 5HGBB 5KQGA 1I8KA 4FFWA 1FFOA 1N1EA 4QTUB 4XP6L 3P26A 3HO1A 2CIKB 1OIXA 2H7XA 1FAKT 2D7MA 4ND3A 3PREA 4JPIB 1XPRA 1NL3A 4P33A 2MYTA 4X7FC 5I0ZA 2JVJA 2YKLL 3GQBB 3HUTA 3KZKA 4DLPA 4C6TA 3C43A 5FADA 2IYSA 3C6SB 3GYGA 4FTVA 4QXUH 1T8RA 4MD0A 1ZHBB 4MB5A 1S7CA 3LY6A 3T1VA 4ACPA 3D9AH 3SDXB 4MVXA 4RACA 4WHYH 1NBYB 3PDIA 1P19A 3ZHYA 3QFDB 2I2AA 3EO0B 1K75A 1R6UA 1SU7A 1BOOA 1M8JA 2CFOA 2FATL 2JDID 3OR7A 3VXSE 4K7PY 3CDZA 2TYSB 3GPDG 1MJ7L 1CD8A 2GF0A 3UJJH 3BIKA 2VK8A 5DHVA 3RC1A 2DD8H 1D6VH 4HC1H 1QIMA 2IYWA 4RGMB 3TNNA 1H22A 4P2RE 1KTLA 4L0ZA 2EIHA 3NDJA 5DYOA 4F1ZA 2IJ0C 1Z4KA 5HOEA 3UA4A 4WNYA 1F56A 1C8PA 1X1SA 4R3SA 1ZHKB 3A3OA 4P3DB 4XE0A 2YJQA 2AABH 1JW9B 3UENA 3C87A 3HLAB 1OTXA 4UCXA 4BFLA 2JCSA 3OKCA 4YX2L 1DE0A 1ZVQA 4NPJA 5E03A 3BE1L 4NKMA 3G82C 1E4OA 3KO8A 1LEKB 1TJIL 5K39B 1ZHFA 3HL4A 4EENA 2NYAA 1LP9B 1B6DA 4FABH 1GKOA 4Q16A 5T3XH 2OEPA 2R2AA 1DDHA 3QEHB 4IO1A 2AQ1A 4LE1A 2Q50A 2WYTA 3RQIA 4K6MA 1R3IL 1N2BA 5IR1B 4K9NA 5HY9B 3TNDA 1U0OC 1PJ4A 2F1JA 4ETIA 5LQDA 1M6EX 1NR5A 5SYAA 4L6AA 5INCB 3FSGA 5GONA 3TT3L 1EMDA 3IBGA 2VJXA 2QKSA 3QCTH 3WGJA 5FI3A 2JHGA 3GRWA 4EKJA 4QPEA 2CDNA 1GZSA 1USGA 4ZW7A 4B76A 1L5HB 1C29B 3EPLA 3THWA 4EZMA 5SY9A 4QEDA 1KNOA 3IBOA 1FVCB 2LVBA 5E4IA 5JNYB 2EVFA 2LIPA 4LSUL 3OPQA 5F93C 4ZUTB 1C7QA 3TZVB 5EGNA 5KTYA 4GP7A 5GIRA 4I6GA 2XWJB 1GGVA 2VPYA 2GT9B 4OD3H 5KVFE 1JPNA 3V6LA 4PJBF 3UAYA 3EULA 3IMCA 4IJKA 4N7RA 3LQQA 4QBFA 1ZT1A 1EFXD 4ERSH 4BRJA 3X1NA 3BL8A 1Q0TA 1XC7A 4HHAB 4JUTA 1PYWB 3KAPA 4IDQA 3B3AA 1JG6A 4XZ4A 1TZIA 4KVAA 4AEEA 4JGJA 2IPUG 3V2UA 4QUJA 3FX2A 2BI7A 3MJHA 4H8WC 4E5YA 3GLDA 4PJ9C 2O0JA 4JE4B 4ZFOL 1HZLA 3G2HA 2WXPA 2OHFA 2J0VA 4O4HA 3PRZA 1UEYA 3P2KA 1NPNA 3B2MA 4ZMSA 4K9QA 1OF0A 3TBVA 2H1PL 1CSEE 2PANA 1X5JA 4XXDB 5JSZB 2YN5A 1AO7A 4R1QA 4BO1A 4Q3CA 2MH4A 5A40E 2YMQA 4DOHE 1Q91A 2QE7A 4FXKC 3QJFA 1PDOA 4L0YA 3RWOA 1A9RA 2G07A 5DM2A 1T20A 5ED0A 5C0BD 4X0KA 4AYFA 4FG4A 1OARL 2A8YA 3Q2CA 4L5FL 4PR5B 1PQZA 2DBRA 4MO9A 1X9QA 2RH4A 3ZQ4A 5J57B 1WD9A 1EQAA 2A5LA 3ZIMA 3QK0A 3AP2A 4BIKA 4LOLA 1AKYA 1D9ZA 1H5BA 3DJZA 5FJIA 1MG0A 3QVGA 1HS6A 1QH8A 5AL8A 1R9NA 4XCCH 3E82A 2DERA 1YOVA 2RCSL 1H3NA 4O2RA 3BUQA 4YQYA 1ZW6A 4NICA 5TJWK 2NTSP 1SUWA 4ABWA 1J9QA 4KQMA 1RQNA 2Y06L 2IGLA 4NO0D 2NZWA 1AGDA 4WSOA 5J6HA 3T2QA 3F01A 2H9GB 3BXOA 1RI8A 3WYDA 4F38A 2XY1A 3ENKA 3PV0A 4OKIA 1XR9A 3RWDB 3TN0D 1EDOA 1F4LA 3IQGX 3LECA 4P04A 5IQOA 2WM8A 4RLSA 1ZBQA 4U9HS 3BDAA 3KOOA 3EJQA 1JHVA 3ML8A 1GGCL 5DRXB 3VFTA 1BQSA 3DBRA 2CO3A 1DLHA 3P0GB 3ZWMA 1E3ZA 2W4IA 2UXGA 4LQCA 3EPRA 4P5RA 3WG9A 4KO6A 4GQAA 4UTAA 2I99A 1E3QA 2JVIA 2OX5B 4FYHA 5TE4L 4EI7A 3QHZL 3OE7A 1JKFA 1B26A 3EIOA 4G4JA 3CLWA 2FJFA 3G1TA 1HOCA 1E4EA 2FWAA 2EGGA 3JZ7A 1OH8A 2CGEA 2PT5A 1UKSA 3HI4A 3LY7A 1GIAA 4J1SA 4MJ2A 4NAQA 2J3IA 4EAQA 5DHVH 2G4LA 1G20B 3SDDC 5F1NA 3OX2A 2RK3A 4FZJA 4R1UA 1PQYA 4P4KC 4L4VD 2PTGA 3VI3E 4NECA 2XTJA 4WSKA 3VACA 1QSGA 2Z6AA 2WICA 2QHLA 2ZPTX 2UY6B 5DK0B 2FUQA 4P5TB 3BO8B 1Z75A 3C6YA 4YXLH 1ZLYA 1XMSA 4WZBA 1VIDA 4R8WH 2OMXA 4KPUA 4I4WB 1E6WA 1MF2L 4UU9A 4WNQA 4LNVA 4BQPA 3CSDA 4UXIA 2I55A 1PD1A 3L95B 3D8NA 4V2CB 1LP9F 4RJTA 1N3BA 2HVBA 1N1DA 3QE2A 4AZ8B 4FL4B 4N9OB 3NHSA 3TA3B 2H26A 4FW9A 1QWHA 5LAPA 4OBRA 4OGYH 1L7PA 3ZTTA 2EG5A 5DK2B 1W30A 1PZ2A 2HPZA 1PZFA 2C9DA 2EDBA 3PWPE 2OM5A 3TI9A 4PJCF 4P2AA 1A4IA 3LIIA 1BVNP 2W4QA 4LJRA 5DZLA 5HDOA 1SC4A 2CXHA 4P3PA 4KLNA 3HN2A 5JUWA 1J0HA 2X9LA 5DRZB 1OEZW 4LRYA 3MNVB 1JDUA 1TJGH 1NATA 4NNYA 2B34A 1LDNA 4EUFA 1ADYA 4B17A 1IGFH 3GRWH 3BVPA 4C0WA 1XCPA 5MHTA 2VYVA 2ZTBA 4ADSG 1Y0BA 3H2KA 5FX2A 2XWPA 1NCBL 4YSAA 4O2BA 3WR5A 4HAUA 5AB2A 2G6TA 1UOVA 4HUTA 5B8CC 1EH5A 2ZFUA 3CFJB 3SJVD 1P8AA 4ZT1A 2FD6L 5E9DE 2D4FA 4WCVA 2OQIA 1NRWA 7MHTA 5SYMA 5JIKA 4G71B 2QZQA 1FXWF 5EINA 3ZDDA 3B1JA 3T9DA 5FOBB 1T4DA 1A4UA 3R5TA 4K3DH 5F98A 4ZD6A 4RDCA 3WLPA 5GGVL 4JG5A 5C8YB 4AMKH 1E0DA 4I6JA 5KYGA 3QDJD 4EUNA 2VP6A 2X4SA 1IRAY 1XP5A 1XZPA 3NCJL 4XXWA 4F7MB 5HFJA 2BNRE 4UWQB 5BRAA 1ODFA 3O2DL 5EIAA 2G4EA 4N9GA 3FT9A 4L4UA 4B3HA 2B6NA 4HUWB 4BS9A 3UAZA 3WKDA 4M9SA 1MN6A 4L6IA 2Z7WA 3WNPA 4Z3GA 1UXWA 2IBTA 2GCYA 4J0EA 1CDBA 4KJPC 1JUFA 4Y8DC 2P68A 2EZ8A 1GL4B 2GESA 2LLLA 3VG0L 3WGIA 4AC9A 1Q9WB 5DVNA 4IRJA 3BGMB 3ZD6A 1MJ8L 2YYSA 3VBCA 3ISYA 1XLVA 5B3JF 5CBEA 4HS3B 1G94A 1VBFA 2ZAMA 1G1YA 3F84A 2Z5GA 1JHQA 2X7HA 3OZRA 5I1IL 1PJBA 3TBTB 1R0XA 1R75A 1ZICA 3K0EA 2C3XA 4G3YL 4HH0A 1BHJA 1TC2A 1AHIA 4IAOA 5LD2B 3MRDB 3ZVNA 4Q9LA 5KDOA 2I24N 5DVMA 4Z3DA 3WMSA 3T2LA 3BKYH 2NU9A 2GI7A 2PS1A 2Q7OE 3CC5A 3HNVH 3VRLE 4QX6A 1GZ3A 2I8LA 3W04A 3NHUA 1S4QA 3CZ4A 1TIKA 1G6OA 4XVJL 1T6BY 3SEQA 1DJYA 3EUEA 4B2LA 3FPJA 1J7KA 5JJKA 3S4SB 3IIIA 4RKFA 1W4BA 4U4IA 4BV8A 4RNCA 2C3YA 1NUDA 4BVJA 2BFAA 4MV8A 4HZUA 3D3VA 4DPRA 5I1LB 1OBHA 7AT1A 3R5XA 1TZKA 4LFCB 4GO9A 4BX3A 3NHZA 4DQAA 3RPKA 1NDTA 3ZV5A 3MOAL 2WIJA 1OCZB 1RYBA 5I51A 5AK0A 5E2IA 3LKDA 4DLTA 1CY0A 3G08A 5B2EA 1R4XA 1KAHA 4WWKB 1Z6YA 3APFA 4GAAA 1TYRA 3KM0A 4NWTH 3BP4B 3AP3A 5JZBA 1S3RA 2VYQA 4HG4K 3TVMD 1YUHB 1RCYA 3CPUA 1X8LA 3UJIL 4DVBA 3EARA 1ONSA 4WKPA 5K3DA 1NT2A 1K6JA 4JEMA 1ZD2P 2DR3A 1F11B 1QSFE 1NICA 3AB7A 1IM8A 2Q3BA 2OKCA 4UTAH 1OGJA 2GNAA 3VX0A 2ZGVA 3ARPA 1TU2B 4RVOA 2WWOA 4QPJC 4KE9A 3L4TA 3SKVA 5F2KA 2BUCA 4P4GA 2PW1A 1MG5A 2OZKA 1KPRA 1F8UA 4NI5A 3FT4B 4L6CA 1SBSL 1JL8A 3O4OB 2F1AA 5L7XL 4Z8FL 2VUHB 2GAIA 4NU6A 1RIUH 5IVXB 1YQ9A 3E7DA 2YPLE 1R10A 4XHJC 4DPCX 3QPDA 1L5RA 1YPZE 2JS7A 1Z7EA 4Z4QA 4CV3A 1ENZA 2I2FA 2X6RA 1EJ2A 4X6FA 1MOZA 3C15C 2C1OB 2MQ3A 1GTG1 1CKEA 1MRSA 1YN7A 1U95A 4Q1AA 4EX7A 4BRVA 2AK2A 4DVGA 1I2BA 4IKPA 1HAWA 4M6OH 1YB5A 1JBJA 1V6AA 3ZDYF 3GJRA 4MINA 1Z8FA 3SPHA 2Z0BA 4J7AA 1M05A 2ZTSA 1RK1A 2EGUA 3ORHA 4LGVA 1JK8A 4ODXA 1KIAA 2A33A 4BFVA 4DP4X 4ISCA 2FYYB 4RAVA 2ZAGA 4V3BA 3S8WA 1PEZA 4EFLA 1B43A 4ZJZA 4UMEA 1TUIA 1G8JA 4JPWH 3WRYC 4W1PA 4CM1A 1MO2A 3S3TA 3DPIA 1E1NA 2Z95A 3DX8A 2OTWB 3OKKB 2I4MA 4PJDE 2PFSA 4KHXH 2O1XA 3N40P 1QGOA 5GPBA 4FKEA 2ATXA 1M57B 1R3LA 1E5YA 2XB4A 4OQQA 4FXGA 1NXQA 3BKMH 1Z28A 4D3FA 2YN3A 3D4CA 1P69B 3FSZA 2GO7A 3CNBA 1RLJA 3NWJA 3N2IA 3L84A 2JAUA 4JFDA 3AS1A 3GMPA 3WY2A 2PPVA 4JB2A 5ADPL 4X9XA 3CPLB 3RVLA 4EW1A 1THGA 5EU4B 2HJKA 1SHWA 1ZT4B 3FO2B 2NLJB 3DX1A 1A8JH 3TEMA 3HE7A 2CD9A 3TOVA 1JA0A 3KPRD 4ZPVA 2I4IA 3C85A 3FBTA 5FV7A 3U9PH 4UNUA 2MNWA 4GYBA 2VL5B 3OC6A 3NHAA 3O47A 4IP0A 1AYOA 5EZJA 2WLMA 4FHBD 4LRSB 5ANRB 1E3XA 4P5KB 1KPUA 5LAXA 3FPFA 3MMNA 1R8QA 5C8YF 3QUMB 4YAQA 2CFIA 4DA6A 4FI8A 2CDEB 2PYEA 3TGWA 4KKVA 2DWDB 3P1VA 2V0CA 4HYEA 2ZTUA 3QXJA 1OFGA 1WKVA 5T1LB 2FEEI 4FFOA 3HUJE 4LZPA 1YB2A 1HE8B 4M1GL 1WNTA 2C2OA 4A7QA 4I0KA 3JWNH 4QKQA 4ND5A 1MH5B 2W80C 3S35H 2EXSA 4ALMA 1RYDA 1UJ3C 2A35A 4FB5A 4FKZA 4CWAA 3I37X 4LXXA 5JCZA 3QUZA 3KYBA 3VH3A 2OXGA 1XRLA 1PAUA 1VMEA 4EMTA 3VGGA 3U6BA 1MCJA 3EWAA 4NCAA 4J3VA 4YCSA 2IEPA 3VRJA 1P74A 3PSAA 2G1AA 4UFPA 2Q7DA 4WW1A 1G6VK 5L8LB 2FE4A 5H4YA 3UMTA 3AR7A 4IEFB 4Z9AA 1DSWA 2O7RA 1M2JA 4XD2A 1IBLB 2HA7A 3V0FA 1T2FA 1CUSA 1IHUA 2QENA 1PHRA 3B5EA 2ZF9A 2XD4A 3KQUA 3VXMA 1ODTC 5E6UA 4PJAB 4NN5B 4TSCH 2P8PA 3T5WA 3H84A 5I73B 5FFNA 2PMBA 1VKZA 3ROLB 4MS3A 2VWGA 4HLNA 1W87A 2XZAH 1M8KA 1JTOA 4M02A 1UMDA 1NCNA 2VDPL 2BVUA 3UUWA 3W2DL 1ZOOA 4YGAB 5IROD 1IHYA 3I02B 1EFTA 5LMZA 3H53A 1H0SA 2VK1A 4ZI3A 3FW6A 3FQWB 3OKOA 3UBFA 4XO5A 3G68A 3U7GA 4G0UA 5EIFA 1WA2X 2HR1A 1ZM4A 2X8JA 1RIHH 5A2JH 4OOEA 4PRKA 4BNXA 2NYRA 2AJZA 5IYZB 1Q1PA 3MFQA 3PDCA 2F00A 2BP7B 1VLJA 2AFNA 4JKMA 5CO1A 5DURB 4OLYH 4FJ6A 2B8NA 2BEJA 4KE6A 1MZPA 5FBZA 3L43A 4E7OA 3CZNA 1U92A 4F5WA 1XUOA 5ICGA 1P9RA 3CRZA 3EDMA 4J4BA 3V34A 1XDTT 5GZOC 5C3TA 3CW2A 3SGDI 3MERA 4JSRA 1F2XK 2NUPA 3CG8A 3I9IA 3DDGA 2ZJYA 3FNRA 2Y1VA 2GG1A 4QT5B 2FDXA 2XOEA 5B1SA 2HRHA 3O82A 2BP8A 4N3AA 1JHXA 3L0CA 4G5FA 2NSHA 1MRNA 2D0GA 4KG7A 2JIPA 1AC5A 4BQCA 1HY3A 1M0WA 4R1MA 4ZT7A 3IMEA 4OD2B 1U8OB 1MLCA 1TUPA 2W42A 2J8ZA 1YY8B 1AG6A 1Q0HA 1R0ZA 2NV6A 4UMDA 3DCYA 4X4MA 1F14A 2WOYA 4PGMA 3ZKNC 3U9SA 5MERB 5TARA 1PGQA 4AL4A 1AURA 4YLYA 3RRZA 1B4LA 5FYJE 3GCGA 2AG8A 1A9EB 1ZRUA 2W8CA 2XU9A 4U2ZA 1IEAA 5EXEA 5AD0B 4P7FA 3NJ8A 2V55B 5C0EB 3L3JB 3U0PB 4NRDA 4OT1H 4JITA 3HE6D 4DQUA 4XNUH 2WBJA 2PLRA 1U2PA 5KC8A 4BASA 5AEAA 4Y1RB 1DPFA 2VZ3A 5CZKA 3B37A 1WBXA 3FUFA 2W95A 1A02N 1EP9A 4TLDA 1AHHA 5H82A 3VZRA 2JH2A 5IB2B 2R8BA 4V0QA 1MQAA 3FZGA 1VCMA 5IG2A 2Q6KA 3H9CA 1XCTB 2FVNA 2FQYA 4IBTA 4XCNB 1J9TA 5D96B 2V58A 3DJYA 1QANA 3DHYA 3SEZA 4C5BA 3CU5A 4PYKA 4KB5A 4HWEL 4CUCA 3BDBA 1NJ9B 3ZWKA 3GSQB 3EQ6A 3MFYA 1SELA 4JHBA 5KOIA 2F1HA 3U7FB 3MRKA 3E2MA 5C0RH 5EF3A 3I39X 1EVQA 4H6VA 3ARVA 1QW9A 1FV1A 3GKWL 1NCTA 2JLYA 4GZ5A 3EAFA 4L4ZA 3LVRE 4GM1A 4E9QA 1NKSA 1AKWA 2AQSA 1C5KA 2CW5A 4TLSA 1LJ8A 1YRLA 1XGZA 1TAGA 5T3XD 3RK0A 2AZXA 1IY0A 1QK4A 1T1XA 2DJ5A 2HCBA 1FH5L 3PJLA 2C9MA 1ADQL 2GXAA 1IWBB 4CYMA 1ONBA 3MLXH 1MCKA 4L76A 3PHHA 3MRTA 1MQ9A 5CVDA 2XEDA 3W8DA 4DT1B 1EZSA 4J3NA 3ZHDA 1QS0B 4FYRA 2HYIC 4EPXA 2JCCA 2FECI 4DEPB 3FH8A 4OZIB 4JFEA 1G6RA 4PS3A 2EDDA 2ECKA 1DDGA 4Z0HO 5IFJB 3GMQA 4GMKA 3L6FB 1DKQA 5ECWA 2FP4A 1DSSG 2F8LA 4G5AA 5BXFB 1I3NA 5GS1C 4CIXA 3RT9A 5L7YA 5K8JB 3CZLA 4EZKA 3NZUA 2H2IA 3IPLA 3ZJUA 3UT0A 4WHYG 1OCCB 3BSSA 1T0NA 4DCOA 1ZC3A 4YSTA 5HRAA 3TJPA 1S01A 4NQCE 5BQXA 5I8ZA 3AACA 3DB1A 3D4NA 1VP9A 5IEJA 2QU7A 1L4FA 3QORA 3VWJC 3DP7A 1Z9SB 2CFCA 2F58L 2JB6A 4AMBA 4NI3A 1VL5A 3AHHA 2WYIA 2A4ZA 3GB7B 1PZUB 3SYAA 4LPWA 1DWOA 4LJ4A 4YPVA 5JIQA 3BFXA 5FWRA 1IMHC 1LA2A 2P5UA 3KZXA 5JZOA 4TYNA 1BFDA 3RYIA 2QDXA 3FT3A 3BT7A 3R9WA 4RMHA 4A67A 4DP5X 4D9LL 2L0DA 5KTTA 4DLYA 3QVVA 2VDKH 2WNIA 3L5KA 1XR8B 3TM5A 3C6LC 5EEUA 3L13A 3VXOA 3T5CA 1RLBA 3JT2A 5TF1H 2IUSA 1RU9L 2Y36L 5G1OA 3DQPA 3PFWO 4E5XB 3A6JA 3LP8A 3WA6A 4CCSA 1OVGA 1MFPA 3EGCA 4N22A 3CF4G 3ELUA 4JW3A 1U4NA 4M0UA 4TL4A 1K0UA 3ER8A 1I7RA 3FQUA 1HURA 1ZUD1 3DKPA 2I7OA 3IE0A 3MOGA 2GBVA 1KTRL 2DBZA 4U2YA 4ENTA 4BWUA 4ZZFA 4FSXA 4NQEA 4KKCC 1E8ZA 1SDAB 1SMAA 3QAQA 3PJNA 1G21E 2ZCKL 4YASA 4C0BA 1EAQA 2Q6LA 3UC2A 2WJAA 5C0CE 4RKWA 3BKWA 4J8QA 4LV5B 4C4OA 3M2TA 1UPUA 2XTZA 1JAZA 3NAQA 5HXMA 4FZVA 5MP6H 5DJCB 1KZ7B 5IHZB 2XRAL 1MFCH 2FHSA 2H1WA 1UXMA 4HD8A 3U9UA 1KIFA 3QUXC 1UJCA 3JQBA 4DAGL 3DGCR 2WU4A 1RJYB 1T5KA 2C78A 2PRYA 3TRDA 1VTKA 1B3JA 2YJGA 4Q19A 3R5SA 1AGRA 3LZRA 1L5MA 3HJ0A 3K0WA 3RWFB 4YRFA 2TAAA 4YR7A 2J1ZA 4FFWD 1W96A 2QBWA 1KDYA 4Q4EA 5DO8A 2B94A 3AR6A 2HHLA 5FL7D 1BD2E 1PAMA 5IW1B 2RA1A 3LHPL 1A7UA 5EXXA 2OO5A 4KAAA 1NRXA 1ACLA 1BFKA 3KR9A 3I4FA 3FAXA 1EHLL 1VGEL 3CT4A 3BH6A 2XMBA 1XIWB 2FW8A 1SRQA 4FTVD 5BRNA 4AL8H 3AFNA 3IGUA 5FPYA 1NBCA 3X1GA 3O3CA 1KOGA 3DM9B 5F3BB 4MQXD 1D6MA 2OXCA 1PS9A 2DF3A 4MVYA 3EVNA 5IK3B 4LYEA 3MRFA 4I5FA 1GYPA 2EDKA 2JLZA 2JAHA 3HCVB 2WKRA 3SR3A 4KVNH 5E99H 4XKJA 4PNPA 1E65A 3NQKA 4F2PA 1FNMA 4KGDA 2KKQA 1SCBA 1QA9B 2AANA 1U8ZA 4N5UA 4ZP1A 4HDSA 5EUOF 2LTAA 4YWGH 3U2IA 2YEVB 3ZKMD 4JVPA 1J8YF 3A1DA 3D3KA 4PZEA 5FK9B 3KK0A 1Z2KA 3R8FA 2O48X 2E6UX 3ZLJA 4B5EA 1R19A 5KEIA 3GEGA 1E2NA 3GC3A 4X50A 4JFFA 4YPGB 1CB7A 5FUZL 2J73A 5IHLB 2QRZA 4CUZA 4L2LA 1BM7A 4R9SA 3AWDA 4W6WB 3CCHB 3IDAA 3JWEA 3IAUA 3LKOA 3THXA 4L72A 3V4VL 1BKYA 3MRPA 1O5OA 3ZU8A 3T5DA 1SDYA 3IAAA 1P3DA 1E28B 3B8SA 2WO4A 4GMDA 2ODAA 4FQHB 1KR2A 4MVJP 4E15A 5TT1A 2V6GA 1CUUA 3T04D 2O54A 1ZD3A 2K3TA 3FMIA 4X9FA 4QG3A 4OQZA 3EW7A 1DXQA 4FYMA 3DMFA 4D3ZA 1FY2A 3DZHA 1I5EA 4X9YA 2C00A 4OZIF 4YK4B 2EFYA 1B00A 4JVWA 3RVUD 3FSGD 2QVLA 1FYTB 3TIEB 1KEWA 2XJ4A 1FIEA 2CNBA 3SSMA 2PTUA 1L4NA 3IL2A 5J12B 2RKBA 5KYUA 3WYGA 3EXFA 4H7FA 3LCJA 5LGHL 1PKQA 2FW0A 2MMXA 4NUGH 1WTGT 1OWWA 4KXZI 4B9JA 2JTDA 3ODGA 4G6JH 2CF6A 1K8YB 5H2BB 3ZNPA 1DEEB 4MS8C 2IG2H 3A6CH 4LIPD 5FNVA 3UTSE 4E1VA 1XZIA 3TVTA 1YK1A 4TYYA 3VHRA 3WV4A 4WY7L 4JAMB 4FI3C 4R7DA 1I1YA 1PWEA 1XVSA 4OAOA 3KKNA 3TTXA 2H8KA 4WEMB 3PTAA 5AVVB 3O45B 4EY8A 3BM5A 5AVJA 4CDHA 3CH8A 4JKLA 2JSFA 5JIPA 2J71A 1N2OA 4W5JA 1OJ7A 3PICA 1EXGA 1ORHA 3WLAA 3NFNB 3OX4A 4WCFC 1NEZG 1EXNA 2EJCA 1GTMA 1AZNA 1Q50A 4QVGA 4Z3KA 4MXVF 2PQ0A 1N92A 4G81A 1M7DB 1XD1A 1IEXA 2AOTA 1B2YA 2E7HA 5CXQA 2D3LA 2FJPA 4MNQB 2VZEA 5G0UA 3TA4D 5IEBA 3I2FA 2WVVB 1ULUA 2X42A 2F7RA 1IL1A 2EIZA 5IMBA 1TSRA 5REQB 3LNTA 1AO7D 3LQZB 1F06A 1YB7A 2WF8A 4BBZA 2QE7D 4E5SA 3AOEA 4LYJA 3D6TB 1N0HA 3CUKA 5JQWA 4D26A 1EDHA 3WY9A 4HSEA 4KNUA 1HOTA 3SXPA 3JD1A 4CL2A 4LQ1A 3LQAL 4HNUA 1CP2A 1B0RA 3PC7A 4EL5A 4JP1A 2G4CA 4ZVKA 3L82B 1N2XA 3QKRB 3TQHA 2X38A 2QMKA 3QLVC 2P9QA 4Q9HA 1NFFA 2HRBA 2O8BA 3PCXA 3F85A 3OHPA 4IGFA 5DJ0B 5FEMA 2MIZA 1AJEA 2GW5A 3L9YA 5A1AA 4GSLA 2GD1O 1HSOA 1GQSA 1ORQB 1UC6A 3B3JA 9LDTA 3RRNA 1KQOA 1CLVA 1WA1X 3SWWA 2W9LA 5E70A 4NQSA 2H7WA 1FORH 1XL4A 3PEFA 2VDLH 3EYSL 1GN9A 3CUPA 3D18A 4GECA 3S2ZA 1IC7L 4PJXF 3HY3A 1SD1A 2CMRH 1KI6A 4C6SA 4B7CA 3RD5A 3HU1A 3IBCA 1FDLH 3N59A 4OY3A 5A4JA 3BHBB 1ZN2A 4XSGA 2GAAA 3EFOA 5CBAB 1YEJL 4IS6B 4CLDA 5IAJA 4PSUA 4GG6F 4AITA 5IB5B 2OJEA 2H2GA 3WV0A 2VXCA 2ZU0C 3SB3A 3WCYA 2NNCA 4G5SA 2XDYA 3STWA 2DKNA 2APFA 4PBVC 1VCAA 5J1TC 1F6BA 2HB6A 3S37X 4P31A 4Y9DA 1O54A 3N3AC 1QTSA 2LR4A 1U9YA 3O6KL 3OE7D 2ZLBA 1KY2A 1OGTB 3WS7A 5LCVL 4HK0B 3OESA 4J2QA 4ZMNA 2BF4A 4D43A 1A5FH 3BKCL 4PCSA 3WL4A 5J4MA 1EZLA 1D5MB 4XNMB 2GY7B 3PQ4A 3KSAC 3ICCA 1EB9A 3MIZA 3CH5A 5JDJA 3KSMA 5CJ8A 5LVAA 2CBMA 1P5UB 3ARYA 4ZW3A 2A83B 2XTJD 4MI9A 3TYFB 1SB8A 3K74B 4U3SA 5D1QC 3ESDA 1ENOA 4HJJH 1JWMA 4ZZKA 2IEAA 2Q20A 2Y1DA 2C0QA 5J4YA 2XVBA 1J0XO 4KY1H 1ZKDA 3NUZA 3V5KA 2AUMA 2Y07H 5EU3B 4KDCA 1NPTO 1RUML 2MWMA 5AMXA 4JR0A 5C0BA 2QWXA 4MGZR 1YR7A 3SKJH 1GQRA 4R98A 5M2QA 4PRYA 3BZWA 4EF6A 1MENA 1ECPA 3Q1SL 4G8EB 3ARDB 5ICYB 1D5ZA 1FNCA 2DPMA 1QDEA 1WZAA 1RRFA 5TFSL 1KFKB 3ULUF 3HKCA 3WEOA 3A10A 5HI3D 4ZSOA 1L4IA 3EEOA 4ODVH 3SJAA 2Y24A 5AVQB 2ZE0A 1UFKA 3GRGA 4M6AA 1LHZA 2AEQH 2HLAB 3UMNA 2ISDA 5FTMA 5D7LB 2AXEA 4ZXBA 4HIJB 2Y1KA 2C1EA 4K8RL 4PN6A 4JLDA 5LC1A 4NO0A 5JARA 2VJBA 2FMXA 4LOJA 4WI6A 3A6BL 4NQVA 4ZGBA 2VF8A 4KQ3H 1XTSA 4CQJA 1N2RB 5AVWB 4HAZA 4RX4D 3C6EA 5FOXA 4N3NA 1O9WA 3MLWH 1E5BA 1JNHA 4C0HA 5A9TA 4KHPB 3TN0A 1KI7A 1SCJA 3M6FA 1FO0B 1BXRA 4QDTA 2OAEA 3IODA 3GSRA 4XPGH 1KQ3A 2HFKA 2JEYA 4FFYH 3OZBA 1DSFL 4G67A 3LMJL 2BMFA 4XVHA 5L45A 1X39A 2O05A 4PJ7A 3CSBA 5DX1A 4JFXA 4N0CC 2AAVA 4LOUD 4QNMA 1XRJA 3IOCA 4UOW0 3POCA 1BZ8A 3LSOA 1U1CA 1FU7A 4H7VA 4KRFA 1H8OA 4TWIA 4ZOEA 1RZUA 1R4NA 1MJHA 2Y6SD 2OG1A 2P69A 2C7OA 3I76A 2ICWJ 1RLIA 2GJ6E 3RFZB 1KXQA 2IU0A 3V7AE 3F65A 2LFEA 3N2EA 5EUCA 1CDOA 5B1DA 1KJQA 3ETDA 3L9WA 1LDPH 3T65A 1X5ZA 3ARBB 1EA5A 1MX9A 5IT4A 2J21A 4IRJD 3MRNA 2GWHA 3KUKA 5ICXB 3MJTA 2Y5QA 2AEFA 3I0NA 4O1HA 2C29D 2K2WA 1JNLH 4IRMA 4TX1A 1HT0A 4GP8B 5E23A 1QHHB 3EHBD 3CEHA 4JRXE 1WK0A 4JDZA 5HHQA 1J5OH 1JQ5A 2O23A 4LXTA 4TMKA 1JEYB 3PU7A 1Y6NR 3W7VA 3VTAA 3T5PA 2IOFA 5FTNA 3EQ7A 3FTCA 4ZVLA 4MD4A 3CV3A 1OAZH 3WKBA 3O74A 3DNPA 4RD3A 2XTAA 3JWHA 1KJNA 3KSRA 1UZ6E 3H3KA 4I0CC 3V1NA 3GR6A 1M7UA 4GX0A 4GM0A 1NCIA 4J75A 3DQZA 1CEYA 3FF8A 3F00A 3TGPA 2OMUA 4PAMA 2HFJA 3ROOB 3U4GA 2B8JA 3TBSB 4N6OA 3IVGA 4BQQA 2O9JA 3L7OA 3PQYE 3IFNL 4DK5A 4P2RD 1BVRA 1R3HA 1S8NA 1OFVA 4PP2A 1D5WA 2G7ZA 2JKLA 4E3ZA 4TYUA 3W6PA 4DCMA 4P07A 4R4FH 3QI2A 4O1MA 3SGKC 5T8KA 3P9IA 5BN3A 2OCAA 2ED7A 2JRLA 1JNJA 3N0PB 8MHTA 4MZRA 1PX4A 3SJVA 3QVWA 5BQFA 1CYEA 3WLKX 3BUBA 4I08A 2WTRA 2HA0A 3TJEL 2WXFA 4O2FB 1CEXA 2VTEA 2EADA 3BK1A 1T8UA 5I5EA 3Q3EA 1T4WA 3JWNG 4Z0PA 1Q0XL 4JJEA 4XAKD 1ETUA 4D4HA 3PXHA 2J5WA 3NIDE 3KX2A 2HKHL 3PYCA 3BMWA 5IHUL 5AOMA 2Q1TA 4OA5A 4FOLA 4UQOA 3G9TA 3E9CA 4NBNA 3QS2A 4XVQA 2O30A 2ZI9A 3GHPA 4N47A 5GTDA 4I8IA 2FETA 3KYJB 4C21A 2HU5A 2JNZA 3KDSE 1OGAE 2Z8YA 5BVJA 1J1OH 3EVEA 2GCNA 4QPZA 3SHVA 5DC2A 1JZ2A 3FQ4A 4IDEA 3T8YA 4AN1A 1CE6A 5DGCA 1G7CA 1TLKA 5I1DB 2EYQA 2CLEB 3G8AA 1UMBA 4Q01A 3RPIA 1E6KA 3KEFA 2NR6A 4IDOA 3U44A 4BNMA 1ZVSA 2ZRAA 3VPBA 1JQLB 2VC2H 1R5BA 5D1XE 2YHSA 2NTEA 2Q7AA 1XCMA 3WIIL 3IFPA 5DBEX 1H1LA 4TTVA 3SJZA 2XVMA 5BO0D 3SKXA 4CM7A 1JB9A 1Z22A 3KQLA 1EO5A 3VD5A 2GXUA 4CPDA 1ZV2A 4JN2B 1MFBH 5IMMA 1ZH4A 3V0IA 1KLGB 3K0SA 2HNKA 1E9FA 3AJ7A 2OCBA 4NYLA 2QVKA 3KU4A 1IL0A 1R16A 1OANA 4YEFA 4DPBX 3N05A 4ZDIA 5DJXB 4Z7WB 5LQJA 2WD8A 4TTAA 4HCRA 3ARGB 5IT0A 2YUVA 1YHZA 2Z8ZA 3ARFB 2JBAA 4JFDD 5FBQB 4K8RC 4YAWA 1XZ8A 3OB0H 4N12A 4TRPL 3HYSA 3SYCA 1GGYA 4JREB 2B9EA 1HILA 2ZUFA 4JVMA 1KRWA 1R24A 3IDMB 2OYKA 3N0TA 3HE7D 4Y67A 4M5YL 1AFVL 4K9EL 1JDCA 5CTJA 4HKBB 3TVMA 3ZSTA 3H2HA 3VAZA 3HC3L 5EFIB 3LXAA 5FPQA 2EW1A 4OB6A 4KWUA 4P5PA 5SWZA 3V1YA 5FL3A 4ZRDA 3AB0B 2EFGA 2AFHA 3IDIB 4DFIA 1JFVA 1V16B 4RZ2A 3CFKA 3Q05A 5D93C 2DJMA 3HCBA 2ALWA 5CWSB 3JALA 2PYED 4ZS6D 3TYGH 4TRMA 3RJ5A 1HHKA 5K3SA 4RMVA 1T9HA 5C1DA 1HTYA 2V6IA 1N67A 4A7UA 2WQZA 5I76A 2PRZA 1H0DA 2FJUA 5LG1A 3OPYA 3DHNA 1XIVA 1XF5B 1F4WL 3SDBA 2APSA 3IDXH 3TBKA 4ER5A 1VJDA 2IP2A 2RHEA 3KLNA 1FXUA 3W82A 4EK9A 2MCMA 4DLKA 2OMBA 1JILA 2DJSA 3HS0C 1IN5A 2V8LA 3MCTA 4PBSA 2ICAA 3LQFA 1M1YA 1D4FA 2GYVA 1NDQA 5EPOA 4MDHA 1L1QA 4ZRNA 2DYPB 3CB4A 3PEEA 3P4XA 4MNHA 3QU7A 1Z83A 4E7PA 4F5CE 1OIWA 2HCTA 2PU7A 1I6KA 5IOKA 4NYMR 1UH2A 3VDRA 1E92A 3GJTA 4UXHA 2VXOA 3Q2KA 4Q6IA 3PRHA 4TOIA 3M6XA 1OKKD 4L8BB 4PWFA 4FGLA 4S1QL 4LHZA 3ABMB 1RT9A 4TUJB 3F7YA 4ZTOL 2A6JB 2NOYA 4FBLA 4IJ5A 3C6ZA 4MJ3A 2XX1A 4F7PB 2R4SL 5I1GH 2EDWA 5EJ9A 1A1SA 3IS1X 1LV8A 4CCYB 3B6SB 4B3CA 3D9QX 4FHFA 4CG0A 3DS8A 4JVNA 2N56A 3EFFB 4TMZA 1TCRA 4QSHA 3CHYA 1ACXA 3QIUB 4WKXA 2VNIA 4JLUA 2J3LA 5EERA 5F64A 5DMKB 3VGAB 1VCHA 4NK4A 2IWKA 2Q07A 1G6HA 1VENA 4ZCLA 4K6FA 1F9AA 2ZCVA 3BPOB 2ZOTA 5JJIA 1E2IA 4PV9B 3TONA 3K2IA 3QJHB 4BJLA 2FWNA 1RD4A 1Z47A 3AXLB 1TJPB 3K09C 4HYTB 4C22A 4A2LA 4EABA 1OBOA 2BC4B 3N53A 3MJ7B 3DGGB 2GSWA 3NA9H 1KYFA 1NGQH 5BSEA 4W5WA 2IV2X 4QGBA 3BAWA 3EZXA 3LZQA 2I1QA 1LPBB 5CXUA 1PZEA 1BOGA 2Q1YA 1SRDA 1CC1S 3C3KA 4HIHB 4XVSL 1CLOH 5HF8A 4Q1VA 5I8CB 3PWLB 4P7KA 3STZB 3IT3A 3NEOA 3GUCA 1H5UA 5C52B 1RZJH 1J9CT 3OZTA 4OQPA 4YY3B 3WG7B 3L1HA 1PU0A 4DSNA 2P9EA 4JBNA 1Z7JA 1FP5A 3GEDA 3QH4A 3OZUA 3VXUB 5K6RA 2IH1A 4EEKA 4XXCC 3NZ8B 2VJMB 2HNBA 1M6UA 4A2EA 4FE9A 1CGUA 4QJ4B 2I26N 5I1JH 2X4IA 5I1EH 3V1TC 2NXZD 2NY6C 3B2VH 2CD0A 4IYRA 3STUA 1DIOB 3TL6A 3O9WC 2OORC 3QQ3A 4K1XA 3TS1A 3OHMB 4KVZA 3T3OA 1NMAH 4WXRA 1IZJA 3TZLA 3R3YA 2AEPL 1YH3A 2QD5A 1K3FA 2XLCA 2X4UA 3GZNB 1C7FA 1E6JH 2XIIA 2AI0H 1LVUA 4J1UA 2WBJD 1BQ3A 2GAFA 2UXDB 1RPKA 1RK7A 4B6JA 5HVFB 2WUEA 2ITCA 3E3MA 4G89A 5GJTL 4UB0L 4BQFA 1XVTA 1G7PB 5J6GB 3Q7EA 4RKEA 1W85A 2BNRD 1A9XA 1UM8A 1RP8A 3I1YA 1CY8A 1YCFA 4OVKA 3CVHB 4HCRH 2FZCA 4KR2A 2PD6A 5CLXA 4C4SA 3BDYL 4I3RH 4XPTL 2FO4B 1ISJA 1ZTXE 1WB5A 1UP7A 1S2NA 4X7BA 4XQGA 1NC2B 4TT3A 3UO1H 1U94A 1FCJA 4AJOA 2AJCA 4FDTA 3KGUA 1KETA 5IESL 1ZTMA 1OK0A 1SUCA 3FIJA 3LY5A 2J4WH 4OLWL 1N5OX 2V45A 4WOJA 5GM1A 3KL2A 5I0DA 1QBBA 4LJYA 4KFZC 2UKDA 1IC5L 5ANMB 2O50A 4K9EC 3P1JA 3RVVD 3UYKA 3A3YB 5IF9A 5IF0B 1E2QA 3SEAA 3NDZE 5DC0A 3K16A 4HWBA 2QMEA 4RZXA 1RUKH 2X15A 1Y8QA 2WUBL 2X7LA 1T3TA 3OWRA 2FGJA 2W70A 4BRWA 3ZV6A 4KGVA 1DZ0A 1KBVA 4K5LA 1JXMA 4GOSA 1NBEA 3KSDO 4DTGL 3TR0A 2BBSA 4JFED 2X4QB 2Z93B 3NKLA 3MLZH 2WSLA 3GMRA 4LZLA 4DUGA 1GNSA 4WV1B 3B3IA 4PBDA 3TC9A 4BZ2L 2CVOA 4RANA 4Y1GA 3JWOH 2C3UA 3K35A 2NVUB 3UK1A 1R46A 1LI4A 4MQTB 3BP5A 1E4HA 3CPEA 4I1VA 1FFXB 3OG4B 3ZKXB 3EY9A 1N6RA 1O6FA 3NEJA 1F58L 5IH3A 7GPBA 4KLCA 4I3FA 1CUYA 5J0BA 4XRGA 4QOKE 4BNUA 2GEQA 3N85L 3BMCB 1GIGH 4CJXA 4N2LA 2CNDA 1JZ8A 4P48A 3DHVA 2ZBUA 4PLJD 3UZVA 3QORD 1NC4A 3IJEA 3OSZA 3P9ZA 4LDNA 1CU4H 2LCQA 1KE2A 2O2DA 4WZAE 5IT5A 3T34A 2FPIB 3CINA 3ATBA 5D2LF 3QKSA 1GL6A 5BR4A 3D59A 4BFXA 3BMOB 5KSWB 5M34A 5DNEA 1RC8A 2LGNA 1I3RA 2DTML 5DTQA 1ZLEA 2HCJB 1A6ZA 1NC1A 2VP3A 4LPXA 4QO8A 5HSGA 4K6GA 5BV8A 2Y7NA 4LDCA 4EJSA 3CFIC 1JF8A 2JJMA 1BWRA 3JQPA 4H0NA 2YXNA 3CTMA 1FSFA 3DO6A 1Z08A 4LLYA 4AQAB 2CLZA 3VJMA 4AJIA 3DX0A 4LYYA 2R29L 4ZD3L 5I7FA 1HHIA 2H2DA 3T9EA 3W11C 3IDGA 4GAYB 1Z9NA 2J7PA 1KYVA 1FS5A 2E6KA 5LDHA 1Q57A 4TQIA 3PWJA 1R5WB 2RHJA 2BP0B 2XZQL 3PUXA 5KSBA 1U4EA 3I72A 5E8OB 2Z4SA 1YYLH 1V4VA 5AW1A 3D6GA 1R4MA 1NI5A 3CF4A 1JN0A 3EBIA 5E6RB 4YDVA 2VE6A 4ONGL 4FTWA 1VLQA 3LXMA 5J4HA 4HQLA 3FWZA 3DMRA 5FUQA 2GTIA 2W9DL 2F43B 2I69A 4MRCA 2JKRM 3OCYA 4PW4A 2C9XA 3RS9A 2EFEB 3W05A 1PVOA 1VI5A 1R00A 2BJHA 3WB9A 2ZI3A 1JU3A 5DCUA 3F73A 4LHUB 5DQJB 1X19A 2YOAA 4I50F 2OCGA 3TQRA 4MAAA 3QEQB 4Z0BL 3D2BA 3OZIA 4Z1MA 1GMEA 4PD4K 3GLHB 3D6MA 2BISA 4CW1B 4HZLA 4PAWA 5LA6A 3CZQA 1VG9B 1HKLH 3SSAA 3BHMA 1IE5A 3P8ZA 5DSCB 1H6UA 3UTZB 2XGJA 4WO4C 1V9CA 3WLNA 1BQUA 1YMMA 4NV3A 4G70B 1G16A 3EO1A 1CCZA 2ZUQB 2JGEA 5HKBA 1P4BL 1EFPA 4LCWB 1SC1A 5HRUA 3EGXB 1BFOA 4NCDA 2DF8A 4XWWA 1KZ6A 3PWSA 2GEFA 3JQ7A 3SDAA 3FUKA 4M5SA 3OJOA 5HYSG 3RUEA 3QQDB 3U82B 4PLVA 4XX0B 4BB9A 2O5ZH 3MLRH 3RT7A 3ZDXF 3WKCA 4PANA 1LDMA 3FETA 4RJJA 1ZAGA 2N0SA 3S7GA 3L7NA 2DYSB 3RA7H 3PX7A 3GS7A 2HSZA 2LVCA 5KOHB 3L77A 3HR7A 3OKLA 4H8WL 1IUOA 4JUCA 4ODBD 4YCDA 3QDGA 1D7DA 3IEAA 4X6EB 3VFGH 3JTBA 1GV0A 2G9ZA 1MG3C 1W29A 1TF5A 1WTAA 3APMA 1XCGB 3R7SA 1F4YH 3NX4A 1L0PA 4JFFD 2DQHH 4JUDX 2I32A 5AW2B 4GR4A 2H48A 1QO9A 1T5IA 1IUPA 1FYDA 2RC5A 1NEUA 2B36A 4NOJA 5KHAA 1Y9ZA 2QKYA 2O5VA 4P7BA 3N1FC 2JLRA 3V9CA 4PO8A 2C7UB 1I85A 5JNUA 4ZYVA 1EAPA 1OE3A 4Z4HA 2PJDA 1F6LL 2O5RA 2O0MA 4YGYA 4YQFA 4DA4A 2WLKA 3DLCA 3HJAA 4HIEA 2XG4A 1T1ZB 1T3HA 3HUFA 1JMKC 3F58L 4LC9A 2AKAB 1EI9A 4QHNA 1S8DA 4ZHQA 1AXRA 1Z6PA 1GGNA 4KYVA 4NGHH 2J31A 4JC8A 1UA6H 4KROB 2X05A 4RFOH 1LO3L 3BJIC 3EXHC 2I62A 3I1IA 4D8XA 2IHKA 1HCYA 1GZPA 3KHKA 1J1IA 2VS1A 3X3FH 4OQ1A 5AJUA 4I9GA 3B7YA 2DSNA 3SC2A 4IF4A 5F23A 2PLWA 3NTCH 5EE0A 2WBWB 1CB4A 3V8CA 1XL6A 3E6HA 4YXKH 2CBQA 3ATFA 2HWWA 5FL7A 1I8IA 2D7TL 1QF7A 4YSRA 2CVZA 4MW4A 3HW7A 4MUEA 4M0CA 4M7JH 3VNUA 1LBSA 4D82A 1XOIA 2Z35B 4Q82A 4MITA 4UTOA 3OPZL 3LKZA 4ZEOA 3N39C 1DQNA 1VJCA 4YLGA 4XCEB 4DRXA 1VMDA 4PSPA 2FBRA 4IRZA 4Q58C 1ND5A 1HEHC 1S78C 3NFSH 4G1UC 1N5LA 4RNRB 1D8AA 1WXFA 1H9CA 2HM7A 2DUUA 4E3WA 3Q3GA 3TQOA 1ABBA 4U63A 1FNDA 2G9HA 1LO0L 4TLKA 1C4WA 1LS6A 5IRCD 1E1RA 3UFXA 2XWTB 2DQTH 3E3LA 3ADBA 1PVHA 4DRYA 3SY6A 3HC4L 3ZZTA 2BFEB 4HNVA 1NEZA 1VE7A 3CONA 1PK9A 5GHWH 2GS9A 2WJWA 3G6JE 1E6OH 4R4NC 2KYRA 1EVKA 4BMDA 1H9BA 3HM2A 5GGXA 1G8MA 2WMNB 4KPHL 4XOUA 1WD8A 2A0KA 3EVTA 1TCUA 4OYLA 1FE8A 3EOBB 4LLMB 5CH8A 3NVDA 4C88A 2CL6X 2REBA 1NX6A 3SBXA 5CEXB 3M6MD 3QWQB 5FRDA 3QA3E 1ZMXA 2UYOA 2BOCA 4QTXA 4RGQA 4XIFA 1T36A 2YBEA 3W7BA 4XWOD 1Z6QA 2D2VA 1B9ZA 2C99A 3QSKB 4PJCB 1KY7A 3EH3B 4NFCA 2YCBA 2ZUEA 4AGPA 3DC7A 3P96A 2A5GA 3NFPB 4TSAH 1MXHA 2YLHA 4AMWA 2HGSA 3P9RA 3PXUA 1V95A 3NHPA 3GNML 3JD4A 4X5WA 2VOJA 4E5MA 1MW1A 4HUJA 5JXJA 3H85A 1NURA 4QNNA 2V9TA 1DVUA 1X77A 4EIUA 3PHOB 5DUBA 3UTQA 3NTVA 3GW8A 2QORA 1GVNB 3ZEAA 5DC9B 3RWIB 3HI5L 4TMXA 3MLVL 5F0PB 4A0SA 1DVQA 2BL4A 5EMMA 4WXYB 3DMTA 4BX2A 2UX7A 4NZPA 3I04A 4D0CB 5KG9B 1XKTA 2OM6A 1A98A 1HEJC 3CZRA 3WTTA 1ZWIB 2FX8L 2Q29A 5CIPH 3O0LA 3TNYA 1ECCA 5LGYA 3T4AA 5BWBA 3WEAA 4WUUB 3MJEA 1TEFA 1FJXA 2DDQH 5C0AE 4XVTH 4Y1AD 3AIKA 2CFRA 3JWIA 1L9OA 5FQOA 3RTQC 1AUVA 4R2WA 4K71C 1E59A 4AXWA 2ZVJA 5ABDE 1OE1A 2Q41A 3MUNA 4XP5H 1LO2H 3NP9A 4XFDA 2INGX 2FZWA 2A1WH 3BW9A 2GO1A 4ARAA 3ZZMA 3TW8A 1TEZA 2HMIC 1TO6A 5EN2B 2O1WA 2GVDC 2WNWA 3WNVA 4R97B 5AKIA 4KKLD 4WU5A 5DEGB 2NT4A 3GAFA 1W9MA 1IM3B 1CXZA 3GJ0A 1A3LH 2B16A 4U1JA 1U0EA 3ABSB 3FIUA 5E7FA 3F4BA 4FQJH 4U00A 3NJJA 1EGHA 3T3MB 4DWWA 2XHNA 3HY6A 2AE1A 2FTKE 2VT3A 5KSVA 2GHQA 5CCKH 3J2PA 2MOVA 1XDUA 1MJGM 2O0KA 1QZUA 4NNOA 4KI5F 2ONJA 3USCS 4ZYKB 1TIPA 1BFVH 2PPDA 2DQUH 2Z5VA 3BOVA 4PJBE 4MKRA 3R3ZA 4B3JA 4M98A 5G4MA 5C3MA 3B9BA 3F71A 1U7TA 1HNNA 3TKAA 4ZXBD 3CH6A 4TS4A 1OLZA 3TIDA 1I7QB 2A57A 1QLHA 2YPVL 2R68A 4BGUA 3B70A 3LKRA 2Z4RA 2IWFA 1S96A 3GGWA 2WPNA 4AUMA 4CN1A 2J56A 1JGLH 5TDPA 2XQ0A 4E9TA 2HOQA 4MHOA 4FHZA 3L3DB 2VLMD 1ZA6A 4CMCA 4U4BA 5AM5A 1Z5HA 2IEIA 3WGNA 2O5NA 3ZQUA 4FQ1H 3KCPA 4A5OA 3GYBA 1TTHA 1J0DA 1KZYC 4IH1A 4KAJA 4QG7A 1C5CH 2YEQA 3GELA 1Z0JA 3QBVA 2WILA 3RWEA 4EXKA 2QDKA 5ADVA 4KVGA 4V1CI 4JMLA 5AO9A 1B8UA 1EVLA 3LX8A 4CMEA 1QQDB 5D86A 1Q0SA 3AFGA 3K5SA 4IRZH 3Q6GL 5K3AA 1OTYA 2DWQA 3KJZA 1VFUA 4HPXB 1U33A 3LYRA 1F2VA 4K9RA 3UJPA 3DZIA 5JWRA 2R0ZH 3HR6A 1OUMA 1UEIA 4MUGA 3BKXA 1V7QA 1QRDA 4WTOA 4AM0B 4S1RH 3QGVA 2ZR0A 3BUPA 5EE9A 2HB0A 1NJ1A 4ERNA 3K80A 5JOFA 5EQFA 1RTTA 3QT2A 5TNXA 4JOBA 3FOLB 2JH9A 1WAEA 4BAGA 4AGNA 2VNJA 2GUYA 5H37G 4IJQA 3RB8A 5MENA 4A3SA 4FFZL 3OKYA 1A7AA 4NUJA 3K6FA 1MWOA 5IQ7L 2CN1A 4KE7A 1AZSC 1T4MA 2NZ9C 1O7JA 1D4OA 4JL6A 2OUIA 2PZ8A 3FHCB 4AEHL 2N0KA 1RVFL 3K71B 2RH0A 1H2BA 2A3RA 3M7FB 1ETJA 3ZDYB 4BWFB 3TFKC 2ZI5A 4WJ5B 3LP5A 1F5WA 4IRXA 1OCEA 3ORRA 1MABA 1B14A 3FJOA 1GXSA 4OL0A 3K2BA 2N1BA 3AO0B 5AK6A 5TGZA 4IXWA 3GJZA 2TECE 2FPWA 1XSKA 1FE8H 4RS4A 5JLJA 3DDZX 4X83A 3WAJA 5C97A 3G5LA 5DM60 1L9RA 3RL1B 5DK3A 3X1DA 2VZUA 5CITA 4N2IA 3CNHA 4G6KL 5CF3A 2JKIS 1EDEA 2YS4A 1RKXA 4B48A 2YV5A 3SDXE 3HB4X 4EB0A 1KOLA 1DZIA 4P84A 2OP4H 5BR8B 2YQGA 3ESPA 3ZTJG 4CM6A 5EU5A 1XLTC 3QPUA 3T7JA 4QELA 4J16A 1Q9OA 4LBEB 2XY4A 2D1YA 1EINA 3LD9A 2HFTA 3I9AA 1EMTH 4KQ0A 3QUKB 4IIFA 1AKMA 1E7YA 3BGVA 2QZJA 5DJDB 4L9RA 2OOSA 4JBXA 3NRBA 5CEZE 4RX4A 2JJTC 2PPFA 3PWNB 1JN6B 4C14A 5ESDA 3EGOA 2BOBB 5H4GA 1RC0A 2WC1A 5K6AA 4HDCA 5TGDA 3BSGA 1CQPA 3SPXA 3W5MA 4F2WA 4QWMA 2OK0L 2B4CC 3QNXB 3W9EA 5A3ID 1K88A 3T0BA 1IIKA 2PBRA 2HJRA 4U6VH 5AHKA 3JQQA 3T1QA 3RARA 3K0KA 1LP9E 2BSSB 1KI1A 4UPVA 1QO0A 1T5BA 2X5KO 3UAWA 3MA9H 3AFOA 3T7SA 3UW1A 2X14A 3T61A 4DM4A 1C14A 2VZTA 3LUBA 5DJZB 3QJUB 4RZCA 3U4CA 2P8JA 3PWVA 1KCRL 1EFVA 2FA9A 3GRVA 1SD5A 3STHA 1QFWM 4Y5XA 4V11A 3SQXA 2ZJAA 4AMXA 3C5VA 1FK8A 2EXYD 3Q40A 4XSHA 4K3UA 2NR6D 5ERWB 3TO2A 2A9NH 3Q8CA 4J29A 1PG7H 3I6KA 3T3MF 3TCXA 3NMEA 2EC8A 1QGUB 3SS7X 4HFUL 4CLEA 4ZANA 2F1BA 4KK8D 1VHQA 3UTSD 1VHDA 2OZEA 4MQSB 4GKZA 5E0QA 4HQ0A 5EWIH 4YT2A 3QZLA 4XJVA 3AR9A 1O9HA 4TLCA 2FE1A 3BH8A 4MD5B 3GJEA 1JIBA 4GOJA 5A1TA 2E9GA 3Q8FA 4TTRA 4MA7L 2F9LA 4GC5A 2UZ0A 3M9LA 3DW3X 1U2DC 1HDXA 2EE3A 2NU6A 3ONFA 1BZYA 1WYJA 2DE0X 3WLWC 3RJQB 3V4RA 5JPIA 2NY5C 3VXSA 3GGPA 3WA7A 4G01B 4CA4A 3MSPA 4KH9A 2M83A 5E2VL 4P4UA 4Q6WA 4L5BA 2B8EA 2Q1UA 2WXRA 4NIYE 1K7FB 2R8OA 2R87A 3RWHB 3DAPA 2XGMA 4P2RA 1TD9A 3BD4A 1Q92A 4B5ZA 1XTUA 2FAUA 2VDOL 5AW9A 2BIHA 3II6X 1ZVNA 2CPUA 2OB2A 4ZO8A 4EUSA 4N8UA 4AYEC 2ZS9A 4EGCB 3PE3A 2DH6A 4JKOA 2UVFA 4I0PB 1WCBA 5ISZB 5FDYA 3WK8A 4QDUA 5TR9A 3UL4A 3AJAA 5SWZD 2P90A 2FPGA 1WPXA 5K2MA 1HXKA 1VADB 5D6OA 2Y4SA 3KYNB 3O3AB 4C9BA 1KEML 1H3EA 1QP8A 1APBA 2QJTA 3L1FA 1YSCA 4NFBA 3E3QC 4RCAA 4AW7A 5I18L 2W65B 1OH6A 1I4DD 3LRPA 2WHPA 2GEBA 4YYEA 4OD1L 5BQ7B 4QEZA 1TVHA 5JYLA 1A71A 4MNTA 5BSKA 5JXAL 2ODWA 3P2BA 4Q4IA 4PSDA 4L8CA 3PIIA 5HIAA 2SEBA 3KPTA 2X89A 3V7MA 2HF7A 1ZXKA 5DUPL 3GSVA 5H1YA 2AXWA 2PSJA 4JC4A 1CG9B 4BJ3A 2XTNA 3PUYA 1YDEA 2OT3B 4X1YB 3EEFA 1RZFL 4N25A 4GPTA 5JWOA 5JZSA 3KWVA 4LW8A 3RVTC 4H88L 3IBEA 2F54B 4DA0A 4G9FD 1ORDA 3A25A 1F4XL 2LUOA 5AVYB 5CB4F 3AROA 5A6VA 3MNZA 4EIBA 2X6VA 1SYSB 3H0EA 3HA5A 1PWZA 1MX1A 2GLUA 4LCCB 5DQ9A 3WS3A 2QAGB 1IAIM 3FONB 1P4SA 3ISTA 1VL2A 4LJ5A 2JGRA 2B1HL 3IQHX 5C34B 4JLNA 1FL3A 2D8KA 3KZNA 1I4FA 2NACA 4IIVA 3IU4L 2FX5A 4N0YH 5HBBA 3U2JA 2OQJB 5DWQA 1P2TA 3TK1A 3GU3A 4M7WA 3I9LA 3HU3A 2XBMA 1X13A 4C83A 1B4TA 5KS9B 1TVBB 2CD7A 1KJ3L 3TWCL 3OEWA 3J80A 1N57A 4PWIA 2K6WA 4UYQA 2WWIA 5FWXB 1S3IA 3H5OA 2UYHA 5BMOA 5EYPB 4ZOAA 1W34A 3GI9L 4HX1B 4RH3A 1SEQH 3IMKA 2Q5IA 4RSRA 1JDDA 4B44A 4X8OA 5AIBA 4YXHL 3NJVA 1EZVX 4ZOLA 3VO0A 5ELIA 3P9SA 1FGNL 3CXRA 1WICA 2Z4QA 4BLRA 2HT3C 2P24A 1VYUA 1G20E 4WOPA 5AVRA 5FKAB 4DQKA 1AKPA 4M4RB 3OZFA 3TBBA 3B7SA 2WOOA 1YKFA 3DVLA 3LFUA 1GFWA 1AMXA 2R7NA 5F52A 4IIJF 1EUZA 1JNXX 1UIRA 1SUFA 5T64A 3U7JA 3WP1B 2B59A 2CLKB 4J07A 3ABZA 1MAMH 3UEOA 4MZXA 4XH2A 4EOGA 3VYRB 4KI1A 1D09A 4FCTA 2YW9A 4URZR 3ZHTA 2E3JA 2D7OA 1FNFA 4YJHB 4CM4A 4KAQH 5KYWA 1ET7A 1DKOA 3P73B 1YEGH 3BISA 1EXVA 3WWPA 3LZLA 1WXDA 1P5FA 2PKQP 3LKQA 3C7KA 1E40A 3I53A 5AI9A 1N0IA 2G5RA 1P1VA 4UHBA 3HOGA 3MYRA 3DUHA 4JQCA 3WX0A 1U91A 4Z7UF 1HE5A 1INEL 2WSYB 4WNAB 1X5XA 3FZUC 4G1BA 3PABA 4I7EA 1KJIA 4YCJA 2GKOA 3VDNB 5K9KA 3E81A 5KMGB 2GK6A 5FHBH 4EF4A 3GHYA 1HFUA 5B7MA 4KWHA 1A7QL 3FDJA 3LHFA 5JBQA 5AVKA 4GOND 4WX2B 1SC3A 2GFBB 2WTEA 1JF1B 2F18A 1XGKA 1DBJL 4FDAA 4ON9A 5HZKA 4X7SL 2XDQA 3D3QA 1KS2A 3LMKA 2IQ9L 1U3ZA 4DDHA 1TZJA 1Z5NA 1JAHA 4JFWA 3B6ZA 3GS0A 2XNSA 5GIPE 1UAGA 2HFEB 3G5ZA 5HHPB 1OKKA 3W5DA 1EFHA 2ONZA 2QT1A 4HPJB 3I61A 1YYCA 1MCDA 2DJ4A 5BRJA 3DPSA 5I5JA 2AZAA 1UDWA 2H5IA 3F12A 4ONHB 2OFFA 3SSGA 1NAHA 4MMYB 4ANFA 1ZZEA 4TL6A 1EDQA 4L1TA 3O6ML 3INRA 4IMKC 2O93L 4B87A 3CN2A 3TBCA 1USVA 1JK9A 4WMLA 1Z39A 2P2ZA 1OD6A 1DG1G 1E7MA 1XRQA 4Q1BA 4XWTA 4JE0A 3S0JA 3V8BA 1QG6A 2BD0A 3N2GB 1DL7L 4RSYA 3BMNA 4TT3D 5GGRB 4YHIA 1JL3A 5A6SB 5DPMA 3GFQA 3VI3A 2FLBT 3B2UC 2EE6A 4YDLC 3TLCA 2JI3A 4OLFA 1RZKH 4IWYA 1YA8A 5BO1L 1MAHA 1Y5MA 3FTNA 3WQBA 4I77L 3JYOA 5HK9A 4DT2A 2WJ6A 4IBWA 2KZBA 3Q7TA 3OJWA 4F2EA 4KZEH 4JRXD 5I2IA 4LX0A 1AGEA 5LXVA 4FQ5A 1BVHA 4WUTA 4LRNH 1Z25A 3DWIA 1US8B 4LLWB 4IGKA 5CKAA 5C2BH 4R8MA 4Z76B 1XMOB 5FA4A 4UNSA 3MX0B 3WOHA 1CEEA 1X7XB 4FWIB 1UWFA 2AFIB 3HLYA 4N0DA 4NCIA 5D9SA 1Y5LA 2QADB 1NC3A 4JUIA 2ED6A 3ZX1A 4HDIA 3PWPA 4PW0A 3ZK8A 5YASA 2NSDA 3VM5A 3H42H 3MCAA 4DUGD 4AQ7A 1JKJB 2EDOA 4JQXC 4AJHA 4Q48A 1SN5A 4FR5A 1WIPA 1OM9A 4GKSB 1L3NA 4HPWA 4ZUVA 1SAYA 3DV6B 2QKIB 1Q1EA 1JJVA 2HLHA 1W36D 4MCMA 3RAJL 4YRQA 2HA2A 3A67H 1T80A 3IRCA 4U7GA 4LU5L 3R3JA 4AYSA 4E68A 2QY6A 5K01A 3L1IA 1BAFH 3Q87B 1ETZA 1LVEA 1DUYA 4BINA 3ATAA 1ZL2A 5D1ZB 1RZRD 2YCLA 3SKMA 3AL3A 4KBYA 4TVBA 3UKOA 1AQ6A 3O8CA 1NC4D 4MXQD 3FSVA 4M61A 3H1BA 2A77H 1E3FA 1C5DB 5E9DA 1V8OA 3GZ4A 1H3GA 3QIBA 4OGAD 5KVFH 3I2IA 3NB0A 4TS9A 5B57C 3VGHA 1CUAA 3FCTA 5KS9F 3OLGA 5ALCL 2XXBA 4RVDA 1UPFA 4CVUA 4HRYA 5CXXA 3V7AG 2H7VA 4RK5A 1MHPH 3D09A 5DD6A 1Z56C 3NW9A 2VHCA 4OGXH 1HNXB 2FQEA 2NY4C 2O8FB 4OUDB 2BNRA 2X0KA 5EUOB 4Z1OA 1RHHB 4LK2A 2I03A 5GOZA 2IFFL 1NGSA 3DGDA 4GR9A 2HP4A 4PGBB 4C43A 5IUKC 1OGAD 1X80A 7FABL 2HFFB 2XOKA 2VNSA 4ID9A 2CLDX 3PJSB 3BPNB 2J7PD 2IXGA 3HN5A 4ZN6A 5CVTA 3OMAB 1ZI9A 4PTYA 4IIQA 2GIXA 3FDIA 5IVXE 5CZXC 1BO6A 4CCAA 4JY4A 3NAAL 4Z3HA 4F3RA 2ERYA 5EC1A 4PYRA 4G8DA 3DOEA 2WWKO 3S98A 4KX8A 2CCLA 1JV2A 3EWSA 1MAUA 1XH1A 1HSAA 5JMRA 5AVUB 4DMKA 2APTA 3EIUA 2NNFA 2QX4A 2ACKA 1ID8A 1K8QA 1TPXB 4DY6A 2VIRB 4QXTB 4B3GA 3G0BA 1H85A 1ND6A 2FSGA 4FFMA 4AQ1B 2EVIA 1LBTA 3O3NB 1F2QA 1AB6A 5EQJB 3AG2B 1FI8C 2AI2A 3NETA 4Z1MD 1NCDL 4BYGA 3OAYK 1LNUA 1EK5A 1H6DA 1B93A 3HZZA 1N8SA 2RG7A 4D4JA 4UQIM 3V0JA 1B4JL 4OCWL 4A2DA 1UURA 4PTZA 2LFGA 2JK5B 3NJHA 1P4UA 2E18A 4DNLA 3UG3A 1YMMD 2K8MA 1Z8NA 1QYWA 5HQ3B 1PTJA 1CZ8H 1BMFA 5GS2D 4ZHSA 4WCYH 4KH2A 2OMYA 4U5XA 2MINB 1Y7IA 3OHXA 5IM4A 4YCLA 1BA9A 2GB4A 1ZLUK 5AM1A 3AU0A 4ORGB 1OWMA 3SDAD 4OHUA 3CVIH 4O4YH 3RASA 2WQSA 3MA0A 1NUPA 5JPDA 2R1TB 1QSFA 3RIHA 3EYOA 4BCDA 1QRSA 4IK7A 2R84A 1KN4L 3RW9A 3KLBA 3GZOA 3ILQD 1TQHA 2ZSWA 1DJWA 2VUYA 4WDRA 3WYFA 3V0EA 5HYSA 1GUYA 1QG3A 4ONOA 2ZBFA 1CRLA 5GGYA 1CRZA 3L8YA 1GL7A 1AO0A 3QDGD 2ZOKA 5LWYH 1C9MA 3O2JA 5IAAA 3VXRB 1UKZA 5KO2A 2HWZH 2QN7A 4PG5A 1T0MB 2H29A 3NOXA 1C9NA 4BV9A 3M1BB 1JG3A 3QVOA 4XTRA 2YPLA 1HWWA 2IALA 4AJ4A 4EECA 2FH8A 1YPZA 4C4PA 4RFSB 3K92A 1D7CA 2EARA 3UPRB 2J5QA 2BFOA 4RGVA 3ZQKA 4XUEA 3K70D 2DQ4A 1VIMA 2QG9A 4KI0A 4YDHB 1NNLA 1C3OB 1DR9A 3V5HA 2GJJA 4GP4B 3CPHA 4C0LA 2MWCA 1IFRA 2BMAA 3WQQA 3P9MB 3IMFA 3LUFA 1ZBDA 3HZKB 3F1LA 2G80A 4XNZB 1N9KA 2PN5A 3P9PA 1F45A 4AYID 2QV7A 3G7TA 3R5HA 2XWEA 4Y98A 1OR8A 4FZ8L 3G79A 3L7MA 1I13A 3REVB 4N40A 3QH3A 4RGNC 2ZICA 4PJDA 4HUXB 2X8BA 5JYMA 3S34L 4JC5A 1M4KA 3RU9A 4EQZA 1RP9A 4BB6A 4H7IA 2UXCB 2QV2A 3SQLA 4HJ0D 1U0BB 2BEUA 1N0XL 4PJAE 2VT2A 4V0RA 1OLUB 4K5QA 4IOLA 2BY2A 2E4ZA 4P3KA 2NY1C 3U7YH 4HPOH 4DNPA 3CIOA 3AYZB 1H0HA 1T2AA 1ZGLB 1MJ5A 3T6VA 3B5GA 3LB6D 3KQKA 4PJXB 3GIZH 1J8HB 5E8PA 3O6FA 3RS5A 2OSLB 1K98A 2ATKA 2YW2A 2TSBA 2MPVA 3E4DA 2NU8A 1LK3H 5AJVB 3HB9A 5TE7L 1HLFA 4PS8A 1VXRA 2IYXA 3MTAA 4GG6B 7PCYA 1CJKC 2ZI7A 2PUEA 4FVTA 3V7NA 1BXGB 4FE4A 2Q76B 5CLWA 3NTLA 1NKOA 5AKXA 3MRGB 1YZUA 2QQNL 5CM1A 5BMVF 2BI4A 3K4ZA 1E3EA 1XQ4A 1GAJA 3M8KA 3STLA 1E3MA 2PO7A 5CGTA 2IEZA 3O1HB 1XAIA 1E3SA 5F0MB 3WC4A 3GBSA 3V55A 4M48L 3C3AA 1SXJB 4NUQA 1JDAA 4OP3A 3HUJA 4OH2A 3AW9A 3AUSA 2WN3A 5FDFA 1MIEL 1E1RD 1R5IB 5D5MF 4DSUA 1NY5A 4P57B 5E56A 4WOBA 5J43A 4RQUA 2W2LA 1FLRH 3UX9B 3RC2A 1C5BL 4YSOA 4BCCA 3HBFA 4ZYUA 1J05A 4RORA 2EX1A 1UQRA 4QMEA 2EQAA 1J33A 5FAXA 5B55A 1FRFS 3AG5A 3M6VA 4AZ3B 5JPNA 3L8HA 4Z5RB 5KBLA 1MCOL 1Q1JH 3QO0B 5EMJA 4NZZA 3Q3IA 3KB2A 4N87A 3LKNB 4F2GA 3E0XA 1YZFA 3QPXH 4BC1A 1Q3HA 5CW1A 3T2NL 2X1WL 2F5BL 5L3VA 3TV8A 3LLVA 1NGZB 1N5KA 4GGPA 3BXNA 3IV6A 1VKXB 2FX7H 4GXVL 3ROPA 3KVYA 1JVBA 4N90E 3RGWS 2NMVA 2SHKA 3HRZB 1SKYB 3AERA 2GBUA 1DNPA 4C01A 2EWVA 5BVGB 3IUNA 1ML3A 5DBHX 5IBUB 1UR5A 4GEIA 2CXGA 1FBIH 4DKXA 2F2HA 3LNEA 1T6NA 2CMKA 3MNMA 5DLPA 1KY5A 1QOZA 4DV4B 4EDXA 5BVPL 4CDNA 3E0QA 1KJVA 4LHVA 2PQ2A 5EAIA 4CTNA 2XCOA 4QO1A 5DJAA 3BXXA 1NR1A 1QH1A 2TRYA 2PR4H 3QY0A 1KDPA 4JYMA 4X84A 4LSTL 5KVEL 1VACB 1PN3A 2J4DA 3US1A 3P9CA 1UXIA 3EZGA 2IXEA 3CN1A 2L7EA 1VJGA 2AJ8A 3KKPA 4FFYA 3WXWL 5DI9A 3ZT6A 5AW3A 4MMXA 4F7TB 1CFQB 3BYTA 1UK9A 1IAKA 4WDIA 4YCNA 2WLZA 3OQMA 1EV2E 3H7BB 2NY0C 4FQ8A 2DWPA 4FQLH 1FDIA 5BURA 4BN4A 1A7RL 5KC9A 1CIUA 4AQEB 2HMWA 1WFIA 4HUQB 2QQ5A 2WW8A 1UASA 5JW4N 4OLHA 2EDEA 4ECAA 4HKTA 2QJRA 3GI1A 5IVIA 3TO5A 3PAVA 5BSHA 1T04B 1PFQA 1EEYA 4HQ6A 4KTGA 3PIQA 3TXAA 4F7CA 2DC1A 3PC6A 2O4EA 3BGFB 3QF4A 1QAQA 4Q9JA 4BC0A 4DLVA 4EB8A 2V3DA 4NBSA 4AKSA 2CO1A 4RA3A 4EN3B 1S7VB 3L1OL 3IHLA 4FNSA 3WFBL 3NTUA 4OZIE 4S12A 1S46A 5JO5A 1RW4A 2H2HA 1V2GA 1GPDG 3QZWA 2AEEA 4RZSA 5KBKA 4PLTA 1MHTA 3VSUA 1O57A 3TSYA 4M1WA 3CN4A 4CSPA 2V5YA 3AR5A 2HU8A 3H9GA 1KXTA 1HYQA 5L88L 2WKOA 2I6XA 4EFKA 2J4FA 3IQDB 3D33A 1VIVA 1A1NB 1DBKH 1AH2A 5B3SB 1UCBH 1GRWA 2ZX7A 1Z5WA 3ZTCC 3TMAA 2W2KB 1X92A 2BZDA 2DN7A 1KJMA 4ZS7H 4FQXB 3H5VA 1UPTA 2DEWX 3BN9C 4DADA 4OSEA 1RKBA 4XWOA 3IKMB 4B7IA 2NZ2A 4A8JA 2EZUA 3BQUC 2WNGA 4RIGA 3IA7A 1K86A 2CKNA 1TUEA 5ICZB 2YD8A 3RJOA 1R3JB 3DLHA 3ZZLA 1CVSC 4R6WA 1CFSB 3VI4A 3ED1A 5LVEA 2WJ4A 3OKNA 4I55F 4KFMA 3JQAA 3IUSA 4YRNA 3RSFA 4ZI7A 1P8JA 5AG9A 3O4GA 3WSQH 3HMXA 3SMQA 5HYIA 2VN7A 3VZBA 1RFDL 4HGWB 2IYEA 4KYIB 5DVKA 4X45A 2V1UA 3AQYA 4LF3A 4LKXA 2EUVA 1PV1A 4WDQA 4RVNA 1CS6A 3DIFB 3TI7A 3AW5A 1OOWA 3KJ6H 1OV6A 2HK9A 4G1FA 4X7RA 3A5VA 3HFML 1BM3H 5G4KB 2ZCJA 3L08A 1NVTA 4WBNF 3SHQA 4BXOB 4OJTA 3FOFC 5AVTA 4R3WA 1U2TA 3CB2A 3QYCA 3P71T 4PWGA 1NCCL 2MTBA 3UMRA 3U31A 2MQCA 5IMSA 5KSOA 4BFIA 1H66A 4M0EA 1HVXA 5EZLB 3HHMA 4LF4B 3ANNA 4TQHA 4LSWA 4K3GA 2PXYA 4Y1AA 3RVJA 2QD3A 3QR2A 4MJIB 1VZ3A 2UVQA 2OMWA 2FK9A 3M5CA 2YOGA 4EIZC 4EJ0A 2HMYB 5IVNA 5FO7B 5D8DA 4RAHA 2EF1A 4PPNA 2QXUA 4UVIA 1ADBA 5MEND 1AQMA 4E9VA 4I9FA 5B7NA 4UNIA 2ZYWX 3UGQA 2FR8A 4XNDA 2VAPA 3FHJA 2CXRA 4Y2HA 5DD3H 1UTDA 1OQAA 1NDGA 5K1NA 2IF2A 3ZZUA 2IS4A 4FFDA 4HU2A 4F72A 5NULA 3X43A 4QUEA 2BZ7A 4AY2A 4V38A 3IVMA 1M2HA 1XRRA 3ILYA 3PG5A 3MRMA 1UFUA 2FLMA 4WNSA 2TMDA 5H37A 3IP5A 4NQCA 1L6IA 2W0LA 5U4XA 3VO1A 3FRPB 1CL7L 4M37A 1Y1QA 5E6SB 5FIUA 2CDRA 3FN9A 1IAQA 4IF6A 3DWFA 4C3VA 2EC9U 2YWYA 3U4KA 3T3NA 4YMLA 3DFFA 1BAWA 4X54A 2CVQA 1G8KA 1YZYA 2HU7A 2ZKIA 2HX1A 2K7FA 4P3WA 5KW9L 2M1ZA 2IGFL 3FM9A 2C2YA 3MBWA 1OYOA 2NXYC 4ODTH 4C59B 2YWDA 4JRFA 1Z07A 5D51S 3H6AA 4QRFA 3NYQA 2C42A 2N01B 5FYKE 3UK6A 2AN1A 4R2GB 2K4WA 1LE9A 4M9ZA 1KAQA 3QISA 3TBFA 3S1AA 1YVEI 2R69L 2UYYA 5C7LO 4N85A 3RNQB 4PVCA 3K6SA 3WDMA 4LYDA 3NSXA 5EF1A 4P93A 3R18A 3U5ZB 1YEHL 1OX5A 2PW2B 4P9MH 2JANA 1O9VA 1JFHA 2BSDA 2QN1A 2B14A 1SJEA 2DQFA 1Z0ZA 2IELA 3SOTA 5I17B 2YL2A 4C87A 4ZQFA 2GUOB 3LTVA 4GRLB 4GG8A 5T3UA 2QTTA 4EKIA 1NCAH 4MOWA 1RK0A 1L5OA 1F86A 1QJ4A 2G71A 1YE5A 3JZYA 5ECJE 3GSNB 4EYSA 1U8NB 4X7DC 2V9QA 4XYBA 1G4HA 3NXKA 3OTOB 1EBPA 5EBMA 5FDWA 4Q9QH 2BS8A 4O4LF 4PFJA 3RFXA 2X1XR 1G21A 1MIMH 4WOCA 3AOGA 4N49A 5HEKA 4YBRA 1CRQA 5KOVC 2AJ3A 5C0CA 2P44B 2AAAA 2FE0A 2IDQA 5DMGC 1NUQA 3PX3A 1A4KA 4M8KA 5B1IA 2YQBA 1QO0D 3FNQA 4OLUH 2HSWA 5HTSA 3VUAA 3GXFA 2YD5A 1EANA 3L2NA 1QPBA 4LTDA 2HT2D 4BSVB 2WXLA 3OJDB 4F9FA 4F56A 4MAZA 2MCAA 3HFFA 2VO1A 3F5FA 4IHOA 1H9DA 1GPOL 4ENVA 4IV8A 2YAFA 1I82A 1FC2D 1EBAA 3FHEA 3BRWA 1FYTE 2MYPA 1PX3A 5C53B 3FJTA 4UZGA 1CFVH 1T83A 3OH8A 3ZU4A 4BHTA 1KO7A 1BD2A 2X1OA 1E9RA 1CTQA 1EP1B 5BW7C 4PC6A 1Q0YL 1L7XA 1LSOA 1NA5A 1ZGLM 2DWTA 5FYJH 1YOBA 5BPHA 2HG5B 8FABA 1W6LA 3DR3A 2QLMA 2IYUA 4P3NA 3X1XA 2EG9A 2JA1A 4NT6B 2A4MA 1U0JA 3RDTC 4IGBD 2XT6A 1XH3B 3IPBA 5TC4A 1KC1A 1AA6A 1FDSA 4QO7A 1RS0A 1S7XB 3VXSD 4KQ6A 2CHZA 3DUWA 1DKUA 3T5AA 5ABAA 3ILPB 5GY7A 3AQZA 3FUCA 5AK3A 4Z8XA 1HO3A 4DDMA 5BCAA 1NLMA 1KA9H 2GABA 3N44F 3CX5K 4YE0A 3L48A 3ER9A 4YRRA 3W1WA 1LX6A 5KX5A 5H7XA 4B9GA 4KZKA 4GXQA 3QHFH 1MUJB 4BZXA 3M9XA 4Y2DB 5DFVC 2JGNA 4RKYA 2WIGA 3HG5A 4ZMPA 2CMDA 2PRJA 4MIKA 1S5IL 4MNQE 1HHHA 3HMXH 3GEWB 1DCTA 4NQXA 2M98A 3WDSA 3UZEA 4LQ4A 4NUPA 3LYHA 4QXOA 4DDTA 5DT9A 1FS6A 4O4JA 1OLLA 2B5IC 3V5NA 2EIDA 1I0IA 2P75A 1WUTA 4QLOA 1A2KC 5DNDA 3MXWH 5HP4A 1T0OA 3DX4A 1H15A 2Z30A 3ESNA 1J7VR 2YGQA 4LO9A 3H2IA 1K89A 4F2MB 4DOMA 1VGKA 2ZIXA 1FHNA 4JUBA 4I36A 3Q98A 1F3OA 1JE1A 1SCAA 1W9XA 5IGXL 2ZKWA 3GBLA 2AKYA 4R0LA 4YE4H 4O2AA 3X3GL 2JK1A 4UM5A 3WNMA 3HG7A 2X89D 2H32A 2QMUA 2IH3A 4MEJA 4E41B 2FWJA 1W5AA 5IP5A 1KFEB 4BNDA 1S4MA 4WAUA 2QX7A 5KVQA 3I64A 4UBNA 2BCKA 1ZIBA 2OAAA 5A2BA 1A4AA 3COSA 3SXUA 1DBPA 4PRDB 1V3UA 2JAOA 3E2IA 2V6HA 3TF5A 2V9ZA 2IBZX 2HYMA 1E0KA 5CFPA 4KKBD 4Q12A 4BVAA 1AQYA 5K45A 2QF7A 3P9YA 3L0OA 2WHRA 4NQDB 4P5MB 5H37H 4EY7A 3UTSA 5EKXA 5B30A 2O52A 3WBKA 4GI7A 4OCRH 4G7RB 3Q8XB 2AQ2A 4N0UB 3W90A 1N33B 1GPKA 1ZLWH 3HI1A 5FOUA 2I3ZA 1LH0A 1QLEL 1OU4A 5CNJA 4TXVB 4ROSA 2F1RA 2EVWX 4JO8A 4IKIA 1LY1A 3RVMA 4P0DA 2PIAA 4JDEA 1V3QE 2W11A 4HFNA 4GIPD 3VXQB 3DTXB 3KS9A 4P54A 1W47A 2Q0SA 4NFSA 4DF9A 5F7HA 1U28A 5HVNA 4N3TA 3G6AA 4MPDA 4LK4A 3IKVA 4C0QC 1EG7A 4N68A 4PGFA 3BESR 1H3PL 1TQCC 1K8RA 5JAHA 2BTQA 4JZJB 5SX5H 2DMKA 4C20A 1IPEA 1K7SN 1P9OA 1E6UA 3UC5A 3C97A 3ISJA 3H19A 4Y89A 2MCFA 1IBYA 3OGCA 1MMFB 5BRQA 1XSJA 1F0PA 1SOQA 3ZTJH 4KJXA 4U3XA 4DSYA