4I1TA

Crystal structure of the cap-snatching endonuclease from pichinde virus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
MEEYVSEFKDMVRKWVPEWEELSEQKNNVLAQVKDRAITIEGLKLLSMLVEVDSCKKHSCRHNTRMTVNAILRELKVTCPTLPDVTPDGYCMVGDVLILLEVFVRTSQEAFEKKYNQDFLKLMQLSSDLKRQNITLVPVIDGRSSYYVEYIPDWVVERLRWLLLKLMDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
publication title Crystal structure of the cap-snatching endonuclease from Pichinde virus, a new world arenavirus
rcsb
source organism Pichinde virus
molecule tags Viral protein
total genus 59
structure length 169
sequence length 169
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.300 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4i1tA01
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i1tA02
4I1TA 4MIWA 5J1NA 5J1PA 5IZHA 3JSBA
chains in the Genus database with same CATH superfamily
4QOTA 2GA7A 1ZM4A 1RAEB 3I0SA 1LW0B 2AYBA 4IKAA 2B4UA 3L7PA 4H4OA 4OHXA 4CLUA 2PFFB 1GEHA 3SXLA 2Z4PA 4FN5A 2DHAA 1NAQA 1TVRA 4AL5A 1VQSA 4H4KC 4OI1A 1T9TA 4F36A 2D1CA 3EWGA 2EKNA 4WFXA 2CPHA 3ISNC 1Q4RA 1CQNA 1AFIA 4Z37A 4C3MA 1RTHA 1RCXB 3TEHB 3JAMY 3MR6A 4EGLA 2XM3A 2FHJD 1SV5B 1YWXA 3AT1B 3DRXA 2J0XA 4LF4J 4LT6A 1OSDA 3DLJA 4ILRA 3OR1B 2IAJA 3NS5A 1FTRA 1KRPA 3GJRB 4O3SA 4ICLA 4C11A 3MAHA 3F73A 2FD2A 2HGKA 3QJPA 2NXEA 2GHVC 2ZH6A 3RAMA 3ZZOA 3ITHA 1CJVA 3VQSA 4DLEA 4N5SA 4B3RJ 2ZJQQ 1RA7A 1URRA 1DTQB 2JB3A 3FC9A 3HT0A 5E2QA 3CB4A 1TAUA 3VAJA 2DR7A 1NM2A 4I2PB 3HKWA 3A8KA 4LVNP 1M1KT 2N4DA 2JEJA 3CCWA 1SIZA 1BHNA 2FC8A 4LRFA 1SJ8A 2MHEA 2RU3A 1ZOTA 2GMJA 1LW2B 3ZC4A 2NYHA 1T7PA 2HURA 4RUAA 4CLZA 1N32F 2OH2A 1HIYA 1HWLA 2YQ0A 2BKNA 4DEZA 2EG2A 2J6UA 4OLOA 2FEFA 2AIRB 4ZPWR 2UVWA 4XK8C 4WXWA 3GLJA 2UXBJ 4Y00A 2XSJA 5G0RB 1O6XA 4ANEA 3OFFA 1XMOF 4LFCF 2VPXB 2BW2A 4XPEA 3C19A 4I69A 4C8YA 2CQIA 3R1LA 3ENAA 1PGZA 2R8IA 2K19A 3IG1A 5DQGA 1HNWJ 1C1BA 2VOOA 1D9AA 2MZJA 4I56A 3F4MA 2Z2MA 3M6VA 1T02A 2LEBA 1HQUB 2VDIA 4DFKA 1U8WA 4C8KA 1NHVA 3I9V9 1FXLA 3NBPA 5CZXA 3N5BA 4XDDA 4TLRA 1S6PB 2RF2B 4JI5F 4DSJA 5E3AA 1DARA 1FRKA 1HMVB 1UW4A 3TVYA 3G4SS 3W60A 2YQ1A 5DJBA 2E9TA 2IYGA 2LP4A 2QRRA 4DR7J 1Q8BA 3DYAB 4ILLA 2J6SA 1UW9A 3DCAA 3GR1A 1R0AB 4ANDA 3CJQA 1IKXB 2E5LF 4V19X 5HQ8A 3MM6B 4HKQA 2RAQA 5D4OA 2Y1JA 2FQQB 4Y2IA 5BXIA 1FEHA 2JDJA 4DBQA 3CJ4A 4WPAA 1TZ0A 2J7WA 3DA3A 5IWAJ 2KZZA 1MNEA 3ZTPA 1UPPA 3ZTSA 2KZMA 2BBEA 3MEEA 3MM5B 2FGCA 2EG1A 2EFVA 2DXEA 4HT5A 4M8LA 1RTDA 1VIXA 1JJ4A 3MEGB 3KK3B 2WB1D 1NBEB 3C14A 2GVZB 3H2LA 2HQ3A 3GZ7A 1L3UA 2K8GA 3VALA 1JNZB 1SH3A 5C7PA 3R5CA 5HK4A 2XLIA 2HQFA 1UVKA 1FNXH 1E6YB 2QC3A 5J1EA 5K14B 2K2PA 4I2QB 4NLTA 4P7VA 3DMJA 3FVYA 4CTAB 3BPSP 1I94J 3MMJA 1IBKJ 4CM0A 4J9VA 1QE1B 3MFHA 3LP0B 3ZZPA 2KXNB 3BR9A 5ETQA 1LFPA 4MFBA 1YJTA 5ETPA 1BQNA 1Q7LB 4PL3A 1FJEB 2H3EB 2CJQA 2ZJRQ 2J6TA 2R2TA 4RNOA 4FS2A 5CXTA 3PX0A 1B3TA 4NZ7A 1NDLA 2AF6A 3D0GE 1N0UA 2YX4A 2Y9HA 2E44A 2MZQA 1BE4A 5E33A 1W7WA 3ETMA 3G71S 2XULA 1Q16B 2OPSB 4QIFA 1YZ6A 3LA0A 4HACA 4KKOA 2YNGA 3VZIA 4BS2A 1U24A 2B3TB 1FI4A 2RH3A 1FJ7A 2DRAA 2HMIB 2F9JA 4OYZA 1CQMA 3CCVS 3HM9A 4ELVA 3P4UB 4DSEA 4ZMMA 3M1VA 1WSVA 4WBFA 3MFIA 5DO2A 4C8NA 1MU2B 1KVKA 2CQGA 3L09A 4DR2F 4GXTA 4ZDNA 1YITS 1VYAA 4Z2XA 1RWWB 2BKPA 1N5TA 3QAEA 2NCKL 2AGQA 1YO7A 2OD4A 2DTJA 2YWKA 4J5OA 4DV4F 3LPEA 2XWXA 4CH1A 1H73A 2ASDA 2LEPA 2HZCA 4ALZA 4LF9F 4CH0S 3W2VB 3K58A 1FEEA 2ZJPQ 4HI1A 2XY5A 4JI4F 3U02A 1RCOB 3RB6A 3I87A 5I3UA 3QFHA 1S1WA 4EBEA 1SC4B 1SUQB 3A4TA 5HROB 4PABA 3OFHA 1N5YB 1ZTWA 2WSEC 2DO0A 3IWXA 3KLGB 3IWLA 4FYYB 2BX6A 1RKJA 2QA4S 2DH9A 4LSLB 3W9IA 1C1CB 1N48A 3QT8A 4HDGA 1P8GA 4CRJA 1GMUA 3EXCX 1TL3B 5IV3A 4KFBA 5B0DA 5F8LA 2AV5A 3T5KA 5D77A 5HATA 1IKYB 3IS9B 4TN2A 2KHCA 4ELUA 5C24A 4X4UA 5IT4A 3ICLA 1NO8A 4PQAA 2QYCA 2ERRA 3DLEB 3CO0P 1SJQA 4DQSA 3Q2TC 4EK2A 3K5LA 2ZH2A 4LF7J 1AUDA 1VQMS 3CDWA 1JQGA 1X4GA 1R8AA 2ZC4A 4CO4A 5F8IA 5AXKA 3FUYA 1H38A 3CW2C 2XGQA 2CJ9A 1SXLA 1L5UA 1FERA 3WC2A 3R5AA 1X31C 2E8GA 2E66A 1NKEA 4N77A 3Q2SC 1OY9A 2DXDA 1HBOB 3CJKA 1S9FA 3NCQA 1T9UA 3MAAA 1FWKA 4RU2A 1FK9B 5EWFA 4O0IA 1RAAB 2X3DA 2E29A 5A6PA 1HI0P 2AJ0A 3AJDA 3BQ0A 2FDNA 4DS4A 2XMUA 3NGRA 1SB6A 2KDOA 3C6UA 1RJJA 3F56A 1U7LA 4WFBQ 3DRSB 5KFAA 1U0SA 1X8DA 2OPQA 5LNK1 2KG1A 3PTWA 1OMSA 3POTA 4RR5A 4P6QA 3DGPB 4EO6A 1KHVA 4Y0FA 7AT1B 1VQKS 1VQ6S 5F8HA 4GMKA 4LFBF 4HHHA 4Y2MA 2DKOB 4IUFA 3RU0A 3IR5B 1ZH5A 3FFIA 2WZ1A 3HX9A 2FJAB 4A4JA 2RADA 3UDEA 1TKDA 4USTA 3PW5A 4YHHF 4S0MA 4DV1F 1PBAA 4PUOB 4DUZF 5AT1B 9RUBA 2V2QA 2A1BA 2FY8A 2YXLA 4OJ3A 2RD5C 4JI8F 2BJ1A 4ZHRA 1N6QA 4L74A 5BR8F 2VA2A 1NK4A 3PJWA 3HVTB 3NXZA 2DNOA 4OYAA 2K7KA 4M5DB 5CCMA 4AS2A 2XG8A 3PY8A 5HVFA 2OSQA 3I5CA 5LM7E 1Y7PA 5KOWA 3J7AN 2C2NA 1FDDA 2YBVA 2W8KA 1T05A 1R43A 1T9VA 4Y2AA 1BXNA 5I42B 2VKRA 2AGPA 1NH8A 5F41A 1S6QB 1Q7YT 1M1HA 2GIRA 2XZWA 3I0SB 1QVGR 1VQ9S 2B8QA 4H4OB 4M95A 2EFNA 3AD7C 1ZA2B 2A2CA 2JVOA 1TVRB 2XZDB 5ITHA 3KHLA 1RZMA 2B7BB 4PPZA 2UUAF 3QNWB 5CYJA 3GB0A 3IGVA 1FD8A 2WK4A 2HNYA 3PHEA 1DQAA 5K8PA 1TKTA 4ED1A 4WK1A 1KHWA 1N88A 2IAJB 5U47A 3HSGA 1VC0A 2CQ1A 4QPTA 4C11B 4UW2A 3GIJA 2MQLA 2IP6A 4BWMA 4N47A 3TAPA 1X9MA 4PG7A 4DN9A 4F4ZA 1YSJA 4ZITA 5CA5A 4IQXA 2Z2LA 3UDVA 4YDDB 1N34F 1T9WA 2QV6A 5ETTA 3P49B 3CUNA 4DF8A 4QIWD 4DUYF 1H2VZ 4UZCA 2XB2D 4Q8FA 3D68A 1Y5NB 2GJIA 3KMSA 1QVFR 4YB6A 1JLGA 3G82A 4OX8A 4UUXA 1N36J 3IM9A 2ZOMA 4X4SA 2HBZB 3TJAA 4RL1A 2M4MA 1EP4A 4PR6A 2HG4A 5HQLA 2C2MB 1C4AA 4Q8EA 2E7VA 1HWUA 1SL1A 4O44A 3H2UB 1Q53A 4JP8A 3OTOJ 3W9HA 2DNQA 4J90A 2XSJB 4HTIA 4LR8A 1XN9A 2CA9A 4K50A 2OMLA 1FJGJ 4CNYA 2DGOA 4DPTA 3V2UC 4LRCA 2LXUA 5AJ3F 4TVAB 3IA0A 1GMVA 3I9ZA 4B9TA 1H2TZ 1YG0A 3PEJA 1HQEA 3NBPB 1ZZFA 4OZNA 2W2PP 5KFZA 2M9KA 5F0UA 3CCES 3ONQA 3HFVA 1X0PA 2JBWA 5ADZA 2XSFA 1T0TV 6AT1B 5HGIA 4DI6A 1EETA 1J5EF 3EGWB 3PXGa 3K8WA 1FE0A 1KEKA 2ZH7A 4CI0B 5BYSA 1VQNS 5KG2A 4J9OA 5M2PA 3MGJA 5DS7A 1IR1A 4F50A 1IBLJ 4K8RA 3NY0A 2ALYB 4X2BA 1RP5A 3V4IB 2FVRA 3I9V1 2B9WA 2UV8G 4A8MP 2A6OA 2RDJA 4ID5A 4MKAA 3UWTA 4WTOB 3Q83A 3MEEB 4YUDA 3KK1A 3R7NB 3W5YA 4X4RA 1RTDB 1PYSB 5E3CA 2X1FA 3HSZA 2MQNA 2VJUA 1SKUB 3C14B 3NLCA 1VQ8S 1LWFA 3W64A 1VR6A 3CDEA 1TP7A 2HVEA 4OFZA 3M2UA 5K8MA 2K1RA 1JLFA 4LF6F 4YB5A 2V0NA 1IKWB 4USWA 4EZ6A 4F2RA 4IRDA 1ZBTA 5F3TA 5C5JA 1PIEA 3IAM9 3M32A 3A8EA 1OQ3A 2MQQA 3VF0B 2QSWA 2HLUA 2B6AA 5DM6Q 1BQNB 4HYKA 3M8WA 3DGVA 2HPUA 4C98A 1UAWA 4K5RA 3FSYA 2MB0B 2VU5A 4Z7CA 1NCLA 1SKSA 2WBRA 4IG3B 3QLHA 2R8KA 1DURA 1YQHA 2QL7B 4KY3A 1X4AA 4HACB 3GIRA 4J91A 4WXOA 4KKOB 2CJXB 3RBDA 2JC0A 3L7UA 1LQ9A 3VV2B 4USKA 2DR9A 2MKHA 3M6WA 3PRBA 1IWAA 2POKA 3M1VB 4HFVA 1N8RT 5DLFA 3PR5B 4N7TA 3DM2A 4NLPA 2D3ZA 1K8AT 4KIAA 5J1NA 1IBCB 3N0VA 2JFDA 2XTQA 3I55S 4LF4F 1EHWA 1HBUA 3MCNA 4Q7AA 4XIUA 1AFJA 3N6NA 4DJBA 2HYIB 3KXDA 2R3VA 1HR0J 3H98A 1MWZA 4YQWA 1RTZA 1EJ7L 3OVSA 2DGTA 2YWEA 2IVYA 1P1TA 4K5SA 2MKCA 5I3UB 4B3RF 1S1WB 4C2MA 3KDOA 3ZZZA 4C8MA 3KJFB 2VOPA 1PYOB 1RAJA 4ZIWA 1D09B 1DY3A 2Z58B 3QGIA 3CDAA 4OLPA 2J9DE 3PDNA 1S77D 1NSQA 3LH2S 1JLCA 4QYZJ 2CZ9A 1C0TA 1CULA 2JSXA 3G8QA 2H65B 4ECZA 5LOQA 4FBUA 4LBIA 1KBRA 3M8PA 5A8RA 3K0JA 3BBFA 3TX8A 3PYGA 4KFBB 2V63A 1XWLA 3KUEA 3G9CA 2W9CA 2CXEA 2HRTA 3H42A 5C24B 4LQ3A 1DTTA 2R9LA 3KHGA 2APOA 5H1SV 1HWJA 4X64J 2DYAA 2EWHA 4F25A 2Y0SD 3M9OB 3CJRA 3JTPA 5KG3A 3I5AA 2EK6A 2ILZA 2UXBF 1RTJA 5GAEU 2M0GB 3CCLS 3LUYA 1S59A 1RHKB 5H9FK 5L39A 4KGMA 1F6TA 2J76E 4ANCA 1H6KX 4F4AA 3KHHA 5DZ6A 4K4SA 2CQHA 1HNWF 4TYBA 3FQKA 2ADCA 1OS5A 2BJ8A 5AXNA 2XYHB 4C0HA 4AQYJ 3MTKA 4LIRA 4C8ZA 3VVTA 4MIBA 3DNCA 4QR0A 4K4ZA 2KRRA 1ZS6A 4DL2A 3CJ5A 3CJKB 1YJNS 1B7YB 2HWTA 2VONA 1APSA 2QN6B 4GO5X 1FDAA 2CQ2A 1H3DA 2AMCB 4XAKA 4U8VA 2B4OA 1YRUA 4P52A 3C6UB 3M8YA 3M2RA 2Y1RI 4CM2A 4IR1A 4QIGA 3LGMA 4OZ1A 4DR7F 2UUBF 2OPQB 1BY9A 3POTB 3RYLA 2BQ3A 3NAHA 1OPZA 2RQKA 1XR5A 2W2NP 1RXOB 3CJ2A 1PAEX 4DX5A 3FFIB 1SJ4P 2GHPA 4IR9A 2IJNA 1HBMA 1GK8A 2WONA 2GMLA 4A8KA 2PEHA 3T1AA 2GO9A 1B0PA 4NLQA 1SJ3P 5IWAF 1GAOA 2I0XA 4OHZA 2MLXA 2DT9A 4NCBA 3T9ZA 4ZHRB 2FIUA 3AD8C 1N6QB 2IDLA 2VQEJ 1FXRA 4HHUA 3FMBA 1FESA 2ZWPA 1LWCB 2VA3A 1UA0A 2VFTA 1LV5A 1S79A 2HFUA 3NMAA 2R7UA 4R25A 3NNHA 2GGPA 3K2YA 1RHMB 2MPUA 5CYQB 5K20B 1T05B 2DO4A 1I94F 3LANA 3CJ3A 3ZZ0A 5IC6B 5AE2A 1IBKF 2ZM6J 4MK9A 1UMJA 1ZM3A 3MPWA 2V6EA 5F8MA 1Q8LA 2EKYA 2ZZTA 1J27A 3BDPA 2JLFA 4RW8A 4RU9A 3M9MB 3R6LB 3HSDA 3ET6A 2C2EA 2NSBA 3DU6A 1JIHA 1IVZA 3DLKA 4GVLA 5B0CA 3QRQA 3C15A 4ZVOB 1KWMA 3TAMA 4V1Ak 4NLSA 4OIXA 4ZVFA 2RLDA 1S4EA 2HNYB 2LCWA 2OO4A 4DF4A 2LQ5A 5F8GA 4I6YA 3MZIA 2V9KA 1TKTB 3UCGA 2GO8A 4B9LA 4F67A 3Q23A 4KYZA 3KJNB 2G13A 2EPIA 3UNYA 1VFJA 5HVGA 3ENQA 4PXDA 2VC1A 3AJ2A 3EGVA 4KH0B 2HLTA 3M7VA 1U5KA 1U45A 2H1YA 2HVHA 4J37A 3RB0A 3JSYA 4DX6A 2AX0A 4I7FB 2E9RX 3L9ZA 3BPDA 5A6WA 3K59A 1RBOB 1DZ5A 1FCAA 1KVIA 1IR2A 1UJ5A 5KFPA 3RBZA 4GKJJ 1NK8A 2BXJA 4X66J 3M8RA 8ATCB 4UZBA 1YZ7A 3OR2A 2F8MA 2RVJA 3CIMA 4ECRA 1JLGB 3G82B 3JB9k 4PQUA 4ZVPB 2ZUAA 5L1JA 3MEDA 4DR1J 3K8VA 2EC0A 2OKQA 2AW0A 1EP4B 3QT7A 1DLOA 4KSEB 3HHLB 1W2BR 2W4CA 2B5JA 2BL7A 1F0XA 3DRRB 3DO9A 4DPWA 1DFDA 5J2QA 5B0GA 3WDOA 2ZITA 5F9LA 4O44B 3RB3A 5HSPA 5J1PA 4ZVHA 4NLGA 4ZCLA 2B43A 3V6JA 1YVFA 2KJWA 1RAOA 4ECWA 4EYHB 1KLMB 3TA1A 4G1QA 1XC9A 2DHSA 4FZVA 3NWRA 1S49A 4FYWB 1G3OA 1JKHB 2HHPA 3KYLA 4NASA 3WQPA 2KM8B 3M2VA 4OMFG 1V3SA 1BGXT 3H8YA 4PKDB 4NV2A 4X65J 1ZM9A 2DNMA 3FZBA 4U9RA 2KI2A 1YBAA 3CMAS 2O66A 3QBCA 4UY85 4LF7F 4CDIA 2EK1A 3MM9A 2ZC3A 4BHQA 3C46A 3VAFA 1HQEB 3NP5A 4CO2A 4Q2LA 2QZ8A 4RNNA 5B0FA 3HO1A 2A3JA 6FD1A 2RIOA 4U7CA 1EETB 5FJ4A 2BJEA 1JMTA 4OV6A 3FCVA 1NJXA 1UKUA 2VASA 1FTCA 3KP9A 3E2EA 2DBBA 3T1HJ 3GV5B 2IC3A 3OPKA 3BH6B 2FJWA 2N3LA 2CJKA 1KNZA 1GX5A 1LK7A 1RT7A 1UZDA 1WKLA 4PAAA 3LGHA 3PW0A 4LF5J 2DR5A 1FFWB 2YWWA 1F9HA 4RLEA 4IG0A 3BKTA 4DPXA 1HFEL 4YY3J 1L3KA 3SEOA 4C3LA 5F3ZA 2FLPA 2YKQA 1N33F 4YZCA 2WVDA 1KVJA 4O1PA 1IQZA 5EDWA 3KK1B 1NDKA 4L72B 2U1AA 1SQEA 4O3NA 3ENWA 2I1RA 4RZRA 2HHXA 1LWFB 4YDXA 2PFDA 1S0OA 1I6JA 2F40A 4BWJA 1Z2LA 1RB0A 4RUBA 3M2UB 3CD0A 2K1RB 3GE9A 5HJXA 3BB5A 4EZ9A 3B6BA 4L6V3 4F26A 1FD2A 1IJFB 3X1LB 5J2NA 1ITPA 1FFSB 1N5QA 5DETA 4RW4A 3M32B 3Q8PB 1HD1A 5JVHQ 2B6AB 2DNZA 3CDBA 3MDFA 2R8GA 1PJ5A 1W3SA 3ULHA 3H7HB 1T9XA 4A8SA 2CG8A 1VMBA 2KH9A 1E6VA 1URNA 2PMZD 3QWUA 1VCTA 4P2XA 2QA2A 1V3ZA 4NLRA 5A76A 2VIHA 3ADAC 3BSAA 5HVHA 1S76D 1O51A 3QLHB 4DG1A 2MQMA 1T95A 2OMOA 3D9BA 3PVXA 2KO1A 2P2CB 2Y1LB 1Y00A 4LSNA 1IKVA 2IJRA 3IAM1 3C3LA 3IBCB 4FF3A 2Z56B 3MPUB 3SZ2A 1YRXA 3WX4A 2LA6A 3BGOP 1I5OB 2ZH1A 2XMMA 2IIHA 1X4HA 4P71A 4M5MA 2VG7A 3DM2B 4G75A 4WF9Q 5DG7A 3DRPA 3IBWA 2V69A 1ZYQA 3TQEA 4NLOA 5CAAA 1YJUA 2H9ZA 4O3RA 2EBEA 2L9NA 2A18A 1P1LA 1YLXA 4RW7A 1EKSA 1ZPVA 2JWNA 2HVZA 2AZ1A 4O23A 1HKAA 2ZDOA 2ZHBA 1T03A 3Q8QB 3AY0A 4PRFA 3BSCA 2KT3A 4DR2J 1SV5A 4M5NA 3GJQB 4WP8A 3FNNA 3GYGA 2B9EA 5IXUA 3OR1A 4KO0A 3EVWA 3PX4A 3D6TB 5LJ5Y 1ELOA 3AODA 4CLLA 4DX7A 1N4LA 2BRLA 1S4FA 2DHGA 2YTCA 5M2RA 1JLCB 5IT9Y 1C0TB 1CULB 4DU8A 4DFJA 4UOFA 2YNFA 2HWHA 2DD8S 1M5KC 1RT6A 3M8PB 5A8RB 1TUWA 3MCSA 1N36F 1RLCL 3R97A 4ZJLA 1UVJA 2DHHA 3PIOQ 4PG6A 1UCNA 2OPRA 3MPDA 2W9CB 4RJVA 4ED2A 3DDKA 1NU4A 4PCQA 4I2PA 4K7QA 1JXEA 4BCAA 2MZ1A 2CDRB 2BYCA 3MF5A 4AXJA 3HHLC 1LW2A 3OTOF 1IWGA 3M4XA 3PZPA 1RTJB 4DLGA 4U8YA 4D3HA 3ZO7A 4ZP9A 3OL8A 4A8WA 3KOAA 5AXMA 2I2YA 1KR4A 1FJGF 2FPHX 2GIFA 1CJTA 3NMRA 4ZVRB 2V94A 2XMTA 3IR7B 4QWCA 2H5IB 1WOPA 2IM3A 4OAUC 3CC7S 2QTWA 3TJ9A 5ETLA 4Q45A 5G0RA 2R2SA 2KM8C 5KG4A 4NEYA 4ED6A 3NOGA 1XNQJ 2MMYA 5J2PA 2IY5B 2G1HA 2XTJP 4YZDA 1GNKA 3SBMA 2ABYA 4NLDA 4QW9A 1P9QC 1WDTA 4PG4A 1KQFB 1HPZA 2HHSA 5ETSA 4H54A 2JC1A 1CC7A 5MAOA 1ZA1B 3D6MB 2GQCA 3R5GA 1NKCA 3TEGA 3M2RB 1TKXA 3AHPA 3PO5A 3RJMB 4CLWA 3TP2A 2BV3A 4J9NA 2G1DA 4R0JA 1KLNA 4UTGA 4E0DA 3BJYA 3D3BJ 5BYQA 1N54B 2ZZNA 2VKZG 5E0OA 1IBLF 4WZQA 3M05A 1HBMB 2RF2A 2WONB 4JB8B 3GTYX 4E2FB 2ADBA 1RWMB 2JVRA 2Q1LA 8AT1B 4LRBA 1T3NA 3AJFA 1ULRA 4U6RA 2DY1A 1R8BA 4J9KA 1C0UB 1WEXA 1FT8A 2JEGA 2GV1A 4QWBA 2QEXS 3MM6A 4WP9A 4DWIA 4KGZB 1JNRB 2MY8A 2X1GA 1KN6A 2W01A 4TU8A 2DHXA 1QTMA 1VS3A 5L1KA 2XS5A 1YJWS 4YHHJ 3PJXA 2AWZA 2LXFA 3AAWB 3H5XA 2GGPB 4URGA 3R27A 2J5AA 1SQGA 3DXBA 2WVBA 3OD2A 4R5PA 1SKRA 4MJKA 2QGFB 4EO8A 3MEGA 1VJWA 3OXGA 3OLAA 3TNVA 1K1QA 3OJSA 2G4BA 3MR5A 3BO4A 2AZ3A 1U6FA 1NSPA 2CPXA 2LU1A 1WOOA 3R5BA 4DV2J 1E6YA 3Q8SB 5KG0A 5K14A 4I2QA 4RW8B 4ECSA 3L4BC 4PL5A 2IMOA 3RAQA 3ET6B 1RAHB 4CTAA 3KG0A 3MR2A 4KGXB 4CCHA 1EQMA 2NPIA 3FRYA 4IOAQ 1UFKA 3QATA 3C15B 3MURP 3AXKA 3LP0A 1CPZA 4LF2A 3TAMB 4PXCA 4ED0A 1RAFB 5HP1A 4PEOA 4M1KA 3OQ2A 4X4NA 2IVMA 1YBUA 1BLUA 3BO2A 4K4TA 5B09A 2DY9A 3T19A 3PNIA 3AOAA 3TW0A 3UFCX 3FVVA 1S1XB 2ATLA 5L8RC 2UUAJ 3CC4S 3H0PA 4JV0A 5T7LA 2XQCA 2Z2ZA 3EM1A 2LDIA 2KVQE 1PC5A 1A6LA 2P9EA 2C1EB 3EZUA 4KGVB 2R2UA 1RKIA 2W25A 1REGX 1RU2A 2JJ4D 2AYGA 4O3QA 1HR0F 3OR2B 4W92B 2GX8A 2GW8A 3TWZA 1FRMA 2HHHF 4QWEA 4TXSA 2GHWA 3MEDB 3DRYA 3UD4P 1YIJS 2IRXA 3IRXB 1JQOA 5ETNA 5HANA 2N3OA 1DLOB 2HBRB 2FB0A 2B5JB 2RILA 3ZTQA 3W2VA 2W9BB 4G6VB 1GMWA 2QGMA 1Q78A 4DR6J 4G1QB 1XIQA 5CYMB 4OHVA 4YEAA 3GJTB 4ZVEA 5F8JA 4LSLA 3K17A 3MXHP 1WWHA 2CJYB 2XY7A 5CQGA 4X64F 2YKMA 3DKDA 4K2JA 4XPCA 5L1IA 2VBYA 3GFZA 2YWGA 3MM9B 1U6BA 1M5HA 4ZIVA 1IKYA 4CT9A 2R7VA 1D3WA 2KU7A 3CC2S 4AQYF 4ZVQB 3A3OB 4FKYA 5KFLA 1VC5A 4ES3A 4Q5VA 4JV1A 4RBVA 4ID8A 3BGFA 4C4WA 2IC3B 2FVQA 2H5JB 1VQPS 5E3RA 2QL9B 1RT7B 2GVDB 5GVQA 4A8XA 1UEUA 2EFOA 4IG0B 3UDCA 4UQGA 4F4YA 1UETA 1LWEA 2DPJA 5FIIA 1S1TA 1NPKA 1FFGB 2K3KA 4YS2A 1G7CB 4ZVSB 2FY1A 4B3TJ 3MM7B 1RDRA 4IQMA 1RAGB 4CP5A 2NXUA 3IP0A 2JB1A 4Y3CA 4LREA 1FK9A 2UV8A 5IQQA 1ZZNA 1HLWA 3A8IA 2HZAA 3DDIA 2V1CC 4C97A 4F0HA 2BANB 1EIYB 2GNKA 4N8NA 2AYEA 3BBBA 2BJDA 3BKFA 4P73A 3GPAA 1X4EA 2OPPA 3QFWA 4HEA9 3P5BP 3Q86A 4MK8A 4QCLA 3MPVA 3S8SA 1FRIA 2BE7D 2M8HA 5J2NB 3M6UA 2AJ2A 3D6HB 1Q95G 2VQEF 4RW4B 5KT7A 3T6JA 2IDEA 1VQ5S 2QA4G 1FNMA 4CH7A 5THWA 3T5LA 4HL9A 2O1PA 3QZ7A 2C3UA 2V5HG 3SCIE 2QJ3A 1Q0NA 2WVCA 3O3LA 3NRBA 4MKBA 5CD4H 3PM9A 2RQ4A 2IPOB 2NXCA 5C2CA 3GIIA 4A8OA 2ZM6F 5E7OB 3QYYA 2ZVIA 3I5BA 2UVUA 5CD4A 4AS3A 2HFOA 4K4WA 3IM8A 4ZPVR 3O8WA 2WBMA 1SJRA 3ZZRA 4LSNB 1IKVB 2XBPA 3UVJB 3JQKA 1HA1A 3LJ1A 1U02A 2KFNA 2BOAA 3BS9A 3RG6A 4NA2A 2QL5B 3D0HE 4NOHA 4O4GB 2VG7B 2KN4A 2HW3A 2RSQA 1OJ4A 1FWPA 3HLUA 3DRPB 1OO0B 4TKTA 3JSBA 1KFSA 3SSQA 4J9LA 3GYXB 3TJ8A 2F4VJ 2QLJB 2DGSA 3BYRA 1S0VA 1MWYA 1RHJB 4RW7B 4FS1A 3AH6A 2ZEJA 2Z2YB 3HHEA 1T03B 3GFYA 2IBKA 4F4KA 4M94A 4TY8A 2ZRRA 4DQPA 1WC3A 2GAGC 4J9QA 1VRUA 2DNKA 2BE2A 4KO0B 1R6VA 2CVIA 3P8BB 4GKJF 2W1BA 3J7YI 3CMES 4X66F 4NA3A 2C3PA 1BD6A 4LFAJ 2CNOB 4UOHA 2YFBA 3TARA 1RT5A 3MR7A 2QLFB 2YNFB 4KHPJ 1HWKA 3QGHA 1RT6B 1N0VC 2RU9A 5IS2A 4OHWA 4F4WA 2QFJA 2Y3YA 4DL7A 4DR1F 1UVNA 2OPRB 2X7IA 2ZFHA 3RGIA 3CMQA 2QLWA 3NEKA 5K8OA 3I6PA 2C2DA 4IFVA 4P2FA 2V8DA 4DU7A 2IM2A 2ZBCA 3NNCA 3JTNA 2QIFA 2GMHA 4WIIA 1JLEA 3QO9A 5D0HA 2X3GA 1N5SA 4Y28C 2GJFA 5SZTA 1HYSB 3V6HA 4EI2A 4KHMA 3HP6A 1YTYA 3KHRA 3A8JA 5D6GA 2R7RA 4B9UA 1S97A 4YB1P 3VAMA 1CJTB 3VGTA 4X4QA 4WCEQ 2DNHA 1X4CA 4TQRA 4L73A 4X65F 1M5VC 1UVIA 3ZZUA 1KDNA 4DV3J 2KG0A 1RGVA 3ISND 1KTQA 2JX2A 2F63A 4PL4A 3SCLE 5J2PB 3QWPA 3KWMA 1NDCA 3GSDA 2YX7A 3GR0A 3OLBA 1HPZB 2MYFA 3J81Y 1TKXB 1NRKA 1TV6A 3PW7A 1G1XA 2VJVA 1RT1A 5D78A 3TOQA 2L9WA 3T1HF 5EWEA 2MJUA 3EDRB 1H7WA 2OP5A 5A2QY 4AL6A 1GT8A 4LF5F 1NJIT 4LIWA 4YY3F 3DFEA 3NL0A 2YVSA 1CJKA 1F1BB 3V81A 4TU9A 3I96A 5ETRA 1K1SA 5GMKa 4U7UK 4FYVB 2UUBJ 3SMZA 5KFJA 2D9OA 2DNRA 2LQBA 3MMAA 4KQZA 4PYDA 4HH1A 3L7OA 5KFGA 1A7GE 4UT4A 1U26A 1G4CA 1FA0A 1M1GA 2V4JA 3LJ0A 3TAQA 3V4IA 2KYZA 5GAGU 4ZJOA 2CYYA 5T14A 1NK6A 3VTIA 1KQSR 2LA4A 1U4BA 1U2FA 4R5PB 4G65A 4Y34A 1PC4A 3IBFB 2GS8A 3AA8A 4YB7A 1FDNA 1U1LA 3A3PB 2MDAA 1FKOA 1XK8A 3U1MA 5KFHA 3NGDA 5DQHA 1WC6A 1NH7A 1WG4A 2CRLA 3C6TA 1NPRA 3U27A 3V6DB 3DXSX 2XI3A 1QD1A 4JI2J 3UN3A 2R7QA 1RYRA 1IKWA 1AT1B 3D67A 2ACMA 2DIUA 5LSOA 3TZYA 3MM8A 2AU0A 3I4PA 2XMJA 5CCLA 2CZVC 4JYAJ 1H74A 2DNYA 2Z8QA 1ZAXA 3GP9A 2ZBPA 1XEZA 2YWFA 2YKOA 4CO3A 5HP1B 3B82A 2HHWA 2YH0A 4A48A 5C25A 4YR2A 3T5HA 1JLAA 1F2HA 2VL1A 3H90A 2HQDA 3GU0A 2M8DB 2ZOGA 1PBUA 3HZGA 2BL8A 1S99A 3EUNA 1JLQB 4MTPA 4JBCA 2GSCA 2UUWA 4IG3A 5T7LB 2VHGA 2EW9A 4CO5A 4LUBA 5DDRC 2GC8A 1QSSA 2ASJA 2YY3A 1X9SA 1S9GA 4ZP7A 1TFWA 4RO0A 2IRYA 3ETOA 4ERDA 2IFXA 2GAHC 3LPYA 2X1AA 4RWXA 3CJSA 5ETVA 1R3NA 1F5CA 1KS2A 5GAHI 2DEJA 1EZZB 5GADI 3LTOA 3W65A 2CIMA 3G87A 1ICEB 1WC4A 3D28A 2PA8D 1RTIB 1F3FA 4H4MA 5A0YB 4IO9Q 1NMEB 5KFQA 2DR8A 3W8GA 2ZH4A 4IFYA 3OL6A 1WNEA 3DOMA 1HARA 3TA0A 3LAKA 3J7Z5 4HDHA 2QMUB 4J9MA 1H7XA 3BYPA 2P5VA 3UPFA 3LWLA 2HFZA 4DV6J 2D69A 4GVBA 3WIVA 5KAKA 1U2CA 2DGUA 2KT2A 3FGVA 3BR8A 4ECUA 1Q1KA 5L9NA 3OTDA 2YKMB 5D15A 1WACA 3OUYA 3IXQA 3JQMA 2HS0A 3DI6A 4V19J 2KL8A 1Q8IA 4C0OC 4NA1A 2NS1B 5K9FA 2XNQA 4ZA1A 3ZTRA 1X5OA 3HD2A 1O8BA 3D54A 4IYQA 1QAXA 1X9WA 5KFKA 2W2MP 3SDEA 3MMCB 1LXJA 2V8VA 5L1LA 2AJ1A 2DXFA 3R7BB 2LU2A 3MCOA 1U25A 2EXUA 3ELHA 4CO0A 1XNQF 2AEMA 3FKBA 1A0OB 2E5IA 3W2WA 1VBZA 4KE5A 4QBUA 5L38A 3NCPA 3AJ1A 1QSLA 3P3DA 3PW2A 2HZVA 2OAUA 3GCXP 1LWEB 1ZM2A 1BWVA 5FLXU 3NKYA 2WVEA 1S1TB 1QAIA 2AJQA 3SV3A 2RUGA 2P6SA 1TL5A 4G1IA 2BVZA 4M5LA 1KONA 2F9DA 3ENVA 1OY6A 5GMEA 3BGRA 1FDBA 2WW8A 9ATCB 3M30B 4JI0F 4NPOA 4ENOA 1QAJA 3S7RA 4P2MA 1WEYA 4XO0A 1N33J 3V6KA 4ECVA 2FJDB 4KH1B 5JMNA 4F0MA 3NS6A 2OPPB 2DNGA 4LBPA 3OVBA 2QX0A 4DQIA 3DC2A 3UQSA 1VHFA 5FDLA 3IO1A 5J2MB 1S9EB 3KJVB 1XERA 2PDAA 3ISZA 1FHTA 3QIDA 1S72S 3VGUA 2CPIA 3VAIA 2I5JA 4B3OB 3PRDA 2JLEA 2P8IA 2MJFB 3DLBA 4ECXA 5I4MA 2NSCA 3P6YC 5M2UA 3W63A 2EVZA 1LWCA 1JLBA 2Q43A 2O5DA 3GCWP 1R8HA 3SYZA 3R1HA 4W4MA 4DPOA 5E41A 5EX3A 1AUSL 3LP1A 4HEA1 3KKFA 1LK5A 1RABB 3D2WA 4DV2F 3NGKA 3S1TA 2CNKB 5CYQA 3MHYA 3FBVA 1SC1B 1JXVA 2MTLA 4C9DA 2M70A 4L3NA 3MECB 1TTHB 1U49A 1Y10A 4X84A 4CNZA 4DFPA 2FVSA 3DLGA 3LWMA 4GKKJ 3BO3A 2VUGA 2LXIA 2NREA 5KFOA 2B4PA 3H25A 3KDNA 4OX6A 4NXNJ 4LF8J 1CSJA 3RW6A 4EEYA 3LAMA 3LJ2A 4NX9A 1X0FA 2DCUB 2G0JA 4NYOA 2LFVA 5KFVA 3KNAA 2FJVA 1UFLA 3CCZA 5IC4B 1LKZA 4ITSA 4ELTA 4RPFA 3SSSA 3FEXB 3SDJA 2MSTA 2HNDB 1M5SA 3A12A 5F8NA 4EYIB 2HEKA 1TDPA 4TY8B 4Y65A 1KOHA 3BEGB 1XNRJ 1VRUB 2JH3A 2BE2B 1U1OA 3WBZA 3CIZA 3ILLA 4RNHA 2F1FA 1S6OA 2V6AA 1J5OB 4M5JA 4NV5A 1RHUB 5G4DA 2Y8YA 1RT5B 2UU9F 1HI8A 4F3MA 4AYBD 5KT3A 2W4PA 3J81j 4CO1A 4M63A 2EEYA 3D3CJ 3UCZP 3HSJA 4I7FA 1F2GA 2AX1A 4AXIA 3G6VA 3H5SA 4JV5J 4FPIA 2WAQD 3L95X 1TUVA 4YN3B 5HJYA 4MKVA 1FX2A 1AB8A 4DR3J 3ZZTA 1FX4A 1LOUA 4IFVB 1IJEB 2ZD1A 2EFPA 3R5DA 4A8FA 1OY8A 2L3MA 3D6FB 1JLEB 3QO9B 3S6EA 4J9PA 4FNIA 2F7VA 2W7PA 4DR6F 2H4WB 1I3OB 2Q6CA 2VQFJ 1RHRB 4RWWA 2RT3A 3HHLA 4B3MJ 3MOJB 4XDCA 1JJHA 3DRRA 3MPYA 1NXIA 4DXLA 3UD3P 1S7HA 2ZE2A 3EE3A 4A46A 1NHKL 2OELA 4QYRA 3L3CA 4RKUC 5DM7Q 1ZTTA 2ZH9A 1KLMA 5C42B 5DLGA 2LMIA 1JKHA 4NL5A 2VBXA 3FSXA 4HI2A 5IOLA 4OZ3A 3W1YC 2VPWB 1IUJA 4IDKB 3K5NA 1UFWA 3ZNJ1 1PKUA 2QZGA 2H4YB 3NGUA 3R7SB 1Y9OA 1TV6B 1SBRA 2OEJA 2RB7A 2W7AA 2RJZA 1RT1B 1VLOA 3HKZD 4X62J 1UEVA 1OWXA 1NK7A 5EHHA 3KUHA 4FYXB 1QDUB 3AQPA 1JX4A 1YJRA 2F8EX 5E3PA 4P74A 2HFVA 1CJKB 4UQTA 3V81B 2VFRA 2DIVA 5DDOC 5EN1A 1ROFA 5ETOA 2EI5A 1J2VA 4TU7A 5B0BA 2PSZA 3D4JA 4B3TF 2RUSA 3W9JA 5KFDA 3B54A 2HWIA 3MMAB 1NK0A 3UR3C 1LNQA 4NCGB 4HT7A 4DZ6A 4O3PA 4DL6A 2CZ4A 3LO3A 5KG6A 2V4JB 4CLSA 1NJWA 2V50A 1U0HB 2B9YA 1M90T 1RHQB 1TK5A 1K0VA 3DOLA 4ED7A 1GMWD 4L75A 3JAMU 3OVAA 3I0RA 2HGNA 1BQMA 1WORA 5KFSA 4DCPB 2HSEB 3HPOA 4J9UE 2YQ3A 4B9SA 2FZKB 2VD3A 2N82B 1FKOB 2FVCA 4NYPA 3J7ZT 2KHDA 1KQGB 5D0RA 2XYGB 4LMZA 4DL4A 2K3IA 2HVIA 1B0TA 1NSKL 1W26A 3SFUA 3C6TB 4NRTA 2OFHX 4QJVA 4UOGA 3T6BA 5EWGA 2ZWOA 1S7IA 2FHMA 1U8SA 2Y8WA 1B4SA 1NLKL 1S12A 2JLGA 1X4DA 1R27B 5AE1A 3MM8B 2BMBA 2GQQA 1UL3A 3QRRA 3NOCA 3OHBA 3IAS9 4MYUA 3G6ES 1NKBA 3UCUP 4CLKA 3CCJS 2L41A 2QSBA 3SQGA 5C25B 1SJ1A 2PO4A 4RW6A 1JLAB 2C3YA 2G0IA 4TY9A 1IBMJ 2ZZMA 4WJBA 3CCQS 4EBCA 4NEZA 4RBTA 2FLNA 2AKWB 3UN5A 2BA9A 4TLQA 4C0BA 3NS7B 2FHKA 4PPDA 3IFEA 1S9GB 3NWGA 3OFGA 3EGNA 2PD1A 3HT3A 5D0GA 3BN4A 4A47A 5JVGQ 1QM9A 1QLNA 3KG4A 2F4VF 1WDDA 5KFCA 3N4WA 3N6MA 3I56S 2V8PA 2V8HA 1AZSA 1ZPWX 2QO3A 2OUGA 3Q0AA 1RT3A 3P45B 4PWDA 4DMZA 1HD0A 3QPIA 2CUYA 2DNPA 5DG9A 4MKYA 1NJZA 1GX6A 5KFUA 4IO1A 4KAIA 3J81U 4IH6A 4H4MB 5I3PA 4B3SJ 2BR0A 4IFYB 1HNVB 1VISA 1UPMB 2CJBA 4JI3F 3KLFA 5A2QU 4DL0C 3DOMB 1A9NB 3OTBA 3IGNA 4LFAF 2FJXA 3CNQP 3RB4A 3CD5A 5CZVA 4YR0A 3IWNC 4QU6A 2XHWA 2CFXA 4KHPF 4OZ0A 1WC5A 2OI2A 1RACB 2C2ZB 2UXDJ 1EX8A 2HHHJ 1Y5LB 2DR6A 1VRQC 2EBGA 1M0SA 3G96A 2CNLB 4KV8A 5KG5A 4GVBB 2DEIA 2IVFB 2JB2A 3UDLA 1F3VA 2LQ9A 3D66A 3S01A 4FP9A 2P22B 2NXJA 1HW9A 2Y0BB 4K4XA 2KTQA 2C22A 1VC6A 3QIPA 3US5A 3D7SB 1M5PC 5IT0A 3OUYB 2BOPA 1PG5B 4NZ0A 1Y5IB 2CQ4A 4DWLA 3JSMA 3DI6B 4OJ1A 3NGTA 1DJ0A 2ZKTA 3Q8YA 2OSRA 1H0HB 2ASLA 2RDDA 2YNHA 3F44A 3WC0A 3FNBA 4DSFA 3RR7A 2BACA 2VH7A 1GQEA 1CBKA 1H72C 2G2OA 2R8JA 4NWBA 2P9CA 3RRKA 2FGOA 1K9MT 2R4FA 1X4FA 3SDEB 4ZPAA 4IOCQ 2CJAA 2RS2A 3EYZA 3VAKA 4DV3F 3HVRA 4OL8A 2AP6A 3AOBA 2W9AA 4USIA 2QMXA 4JI7F 3OBIA 4RUCA 3QRPA 2DH8A 2HAFA 3DN9A 2YPZA 5T41A 3LW5C 3W2WB 4DL3A 2WOMA 3BH7B 5KG1A 2V2VA 2V67A 2WSFC 3THVA 1D8ZA 3FCHA 2OTLS 4K4VA 1P27B 2C42A 2XHCA 3FBBA 1P9YA 1SH0A 2PI4A 3CT9A 2BRKA 3EZOA 3PR4A 2RE1A 4WE1A 5D8HB 1WI6A 1X4BA 2FYXA 3HHNB 1V6HA 3GMGA 3CGIA 2WRMA 2GQ2A 3BGRB 1KP6A 2F5GA 5FD1A 1F5BA 5H9EK 3OL7A 4BC9A 1VQ7S 1O5JA 1TR0A 3TX0A 3T41A 2IMWP 4Z7GA 1WHYA 4ZP8A 1Q81T 4C7QA 1PO6A 4JOUA 5FDLB 1S1VA 3RUBL 4AUKA 3AD9C 3H5YA 1XBWA 3WX8A 5KFEA 2DB1A 1V5IB 2OLWA 4LF1A 2NZCA 5KFNA 2DK2A 4I67A 3CCTA 2I5JB 1AW0A 4F3OA 1CJUA 5EUHA 1HW8A 1RQ0A 1C0UA 3BGLA 3MAQA 2DGVA 2CQCA 2V9WA 2FJBB 4QU7A 1K47A 4KC5A 3SSRA 1WD6A 1MW7A 4LJMA 1JLBB 2HGLA 3IR6B 3RRHA 4CQ1A 3LP1B 3C16A 5HLFB 2CPDA 1T3OA 2ZHAA 3VQTA 4AFFA 2ROGA 2IBOA 3I82A 4JI2F 3TQ1A 1WF1A 4OI0A 2L1LB 1SC3B 1NPPA 3CXCR 1PSDA 2V68A 1KD1T 3FBCA 2E7WA 3DLGB 1VLYA 1IN0A 3UI3A 4JYAF 2XY6A 1TKZB 4QZVB 2F8HA 2FUG9 3MEKA 2JEIA 2YPYA 3GV8B 4AT1B 2DH7A 1PYTA 1GXUA 2B51A 3E01A 3MR3A 3OT9A 2OD6A 4F2SA 3AB2B 2B56A 4R0EA 2RIJA 5KFXA 3I4HX 3P5TL 4KGKA 3CD6S 3NNAA 1FNOA 3HJFA 1YBTA 3ZFVA 4NLWA 3KLIA 2W2QP 3FQLA 4DV5J 3G2XA 1D1UA 2VZ9A 3AA9A 4EFAC 3JQJA 1CC8A 1G6BA 3CE8A 4ZK7M 4KT0C 5CABA 2LYVA 4K0KJ 4OX7A 3QZ8A 1XMBA 3HCXA 1TL7B 1S1XA 4FF4A 2ZBRA 2W8LA 2XZTB 1Q8KA 5KFBA 1QAYA 2OJ3A 1RWUA 4URQU 3M8ZA 1KSPA 1KTVA 1W25A 1B64A 2MJNA 4CLYA 1UP1A 4DOZA 1YJ7A 3GIMA 3BV8A 2IA6A 5HBMB 1EAYC 5A8WA 5KTQA 1QSYA 1DBDA 3NAIA 4ZLPA 5C2GA 1FKPB 3B8HA 4I64A 4O4RA 4WYWA 4FVMA 2JRSA 2C28A 2J9CA 2QT7A 4X4VA 2BJ3A 2ZD1B 1YK9A 2MXYA 1WF2A 3MCMA 1HNZJ 2ZKUA 3BSOA 4DV6F 7FDRA 1T94A 1AA1B 3TR5A 1RU1A 1VK8A 3IRXA 3PYDA 5F0WA 2ILYA 2QYGA 3TVZA 1ZAVA 3KLEB 3MI7X 1RWXB 2C2OB 3KNGA 3LP2A 2AJ4A 4WKYA 4ZS6A 2W9BA 5K5MA 4C8OA 2ZE2B 2JNJA 3W61A 1UWAA 4BC7A 2HQGA 5HMZA 3GFXA 1SC6A 1SL2A 2HK3A 1YDLA 4HLBA 3I32A 5I3QA 5CYMA 1BC6A 2DRDA 4M5IA 3K57A 4O3OA 2MKSA 3U1LA 1JK9B 2ACYA 2ZW3A 5LSRA 3R9LA 1QTNB 2J0QD 1U48A 4URSA 2LVWA 1R7IA 3TO8A 5ETMA 2YKAA 3CCUS 1PAUB 2LDYA 4PXBA 4OV1A 1MMLA 2KXHA 3ILIA 2JHEA 2J8AA 3VGSA 3J7A1 3P96A 3K7RA 4DZDA 4JI1J 2P6TA 2IM0A 2EFQA 1Y11A 4QWDA 2N7CA 2F3JA 5KT5A 2YKNB 3SCJE 4WU2A 1YX2A 4ZPTR 2EFGA 2Q3PA 5AE3A 4USMA 3D0IE 1BUXA 2GVDA 3H5UA 1UWBB 3KK2A 2HK2A 2VFUA 3FJ2A 2VG6A 5LSLA 1OYEA 1DQ9A 1BQXA 4OHYA 2LKZA 2J8SA 1TL1A 4FPRA 4GRSA 3DOLB 3I0RB 3KUGA 4GC6A 1X60A 3MM7A 1BQMB 3F0NA 2AYMA 4OJGA 2C2RA 3SCKE 2HS3A 2QLXA 2XMWA 2J7UA 2PMWA 4P9SA 4JI6F 3HFZB 4E98A 1VRTB 5DGAA 2RRAA 2K06A 2BW7A 2NYIA 2HHTA 2BANA 2XC9A 2BM0A 2NZ4A 4TNOA 3D1HA 4CYUA 3O2IA 3W66A 4WFYA 4D3GA 2L48A 3M6XA 5GMDA 4N41A 5KFRA 2BJ7A 3DHWC 2ZH5A 2WB4A 3EJMA 4PYAA 4ZPDA 1V5VA 4GC7A 2R7SA 2V34A 4WIQA 1BWEA 1FRJA 1RTHB 3BZQA 3FK4A 1FRLA 1IM4A 3OV7A 4M5GA 2V2ZA 4J7CA 4YR3A 4Q0BA 3FDSA 2XYPB 4P2SA 3G8TA 2MQOA 4PWUA 3SQGB 3UN2A 5KFWA 5GAEI 3Q89A 4RW6B 2KFYA 2XCAA 4ICLB 1H98A 1PILA 4P7TA 2WSCC 3CCSS 3RBXA 3CULA 2ROEA 4GKKF 2MQ8A 2CQBA 3ITHB 1CJVB 4MK7A 1YJ9S 1JWWA 2CQ0A 3K5MA 4LVOP 3R2CJ 3MMBA 4EBDA 3NGSA 2B4VA 2YWHA 1RT2A 4NXNF 4LF8F 5BJRA 3F41A 3CCRS 4Q44A 5DRKA 2QE5A 4FF1A 2N4CA 1D8YA 2XNRA 3A1YG 2UUCF 3UVJA 3IAS1 3IMQJ 4ZCKA 2ZH3A 4OX9J 3Q8UA 2CWXA 1FVSA 2AJFE 3MOZA 5E5NA 2HVDA 2D9PA 4G76A 1HHQA 1H2UX 1AZSB 1B70B 3AOCA 1RT3B 4O4GA 2MGZA 1X5SA 1MN9A 4PWDB 4ZN1A 4AE5A 2CPFA 2O3DA 5BYRA 4DV7F 3PKMA 4DR4J 1XNRF 4QQBA 5MLCV 4MIAA 1Z1ZA 3KLFB 2XI2A 1DQ8A 2NUHA 4IRCA 3I31A 3VR1A 3O6QA 1B0VA 3LALA 3CVKA 4LBHA 1T8EA 4HVZA 4MH8A 4X4PA 3K5PA 5HMXA 4BBYA 3Q22A 4RNMA 4KV8B 4JV5F 1OYDA 3IG1B 5HI7A 3RTVA 3FBFA 3JYTA 1RUSA 5LMNJ 2XS2A 1C1BB 2IHR1 4DR3F 4F0KA 4G1PA 1RADB 2MKYA 4QR2A 3MUTP 4DHVA 3QIPB 1TK0A 3RAXA 4CLPA 4DDFA 2MHNA 2XEXA 1R31A 3JSMB 4B08A 1V9OA 2V2KA 2XLJA 2WCXA 2VQFF 2YNHB 3EVOA 3IC1A 1RT4A 4QPXA 4B3MF 4DPUA 3N79A 3JS9A 2KKMA 3GG1A 1AROP 3HD1A 3AFGA 4MT1A 2E1AA 4ETXA 1RWVB 2UXCF 2IYIA 3M8SA 1HYSA 2JL9A 2J9EA 4NXMJ 1L3SA 3TANA 2FLLA 3EZ5A 2HGMA 2FZGB 2WOMB 1RA6A 3RZAA 1RWKB 1U6ZA 4KJIA 4DR5J 3R6GB 5B08A 4EWTA 3DHXA 2ZVSA 4X62F 4ZOSA 5LMUJ 3W3SA 3CJ0A 4WE1B 1EB0A 1XMQJ 3EICA 1NB7A 2O67A 4N76A 2FLOA 1NJYA 3D5MA 4OQJA 1UEKA 3VGVA 5J1EB 1Y3KA 2PE8A 3PYEA 1HHTP 4EUVA 4OYXA 4JCVE 1GXLA 2RRBA 3DMJB 3WHIA 2LQ8A 2RHSB 3HJVA 1S1UA 1SL0A 2XLKA 1S1VB 6FDRA 4CWBA 2XMVA 1WC0A 4P72A 3T1YF 3PRVA 2EC2A 4MFBB 4JI0J 3LOUA 2ROPA 1RLDA 4ZPBA 3OXLA 1YHQS 4ZVTB 4OI3A 5HO4A 1CJUB 3V5RA 2RRNA 1VI7A 3HDSA 2DGQA 4A8YA 2J0WA 4CZCA 1YJVA 3B55A 1JJCB 4KBIA 4NI2A 3HHLD 1VBYA 1HNIA 3TZWA 1HNXJ 3D1OA 2D41A 3TRGA 1WG5A 3DU5A 1D9DA 4HH0A 2NQPA 2ALZA 2Y1IA 1L3VA 3C16B 4FNHA 3BBCA 2YNGB 2XWYA 4YOEA 3EGZA 1FRXA 1RBLA 4DQQA 4LRDA 3UD5A 3GONA 1Z4UA 3WZ0A 1SJFA 1ACMB 3FRZA 4ZPCA 1TFYA 4U7UD 2RKIA 3OSNA 4HTJA 3V6DA 4I68A 3UO0A 3KLHA 3E01B 2HBYB 2BUNA 1RWNB 5B0EA 2AGOA 1REVA 2HIQA 1IBMF 3VA9A 3N28A 1WSRA 2HFNA 3TVKA 3CJTA 3M8QA 3KLIB 3SIPB 4DS5A 2JAEA 2HFSA 1R89A 2DNNA 4Z7YA 2HNZA 3BKUA 4UY8T 2X1BA 2XS7A 3GSIA 2AQ4A 1VIOA 3BDEA 4ZCMA 4FF2A 4DX8H 1WI8A 4F7VA 2ZBIA 2FUG1 1XR6A 3PCOB 1JLQA 3QGGA 3OTEA 3SI8A 2XTRA 4ZJQA 3R8YA 2V4RA 4F4XA 2B0GA 2WVFA 4B3SF 4XTTA 2B9XA 1R0CB 5A8WB 3MD1A 4OZ2A 3CDUA 4I6WA 2RS8A 2D3O1 2HIYA 2UU9J 4ES1A 2ZHOA 4DV0J 2CPYA 3BN7A 2I6WA 2HKEA 2UXDF 4DSKA 3PHTA 3GQCA 1RTIA 2MKIA 4OZJA 5A0YA 4C6AA 3UW1A 1XTZA 2H54B 2UVRA 1Y4ZB 2LEAA 3LP2B 1U1NA 4ILMA 2LLZA 2VPYB 2C3OA 3J80Y 2HHVA 3FZ2A 1C2PA 5HMYA 4RNFA 3MAAB 2GFFA 1W2IA 2LECA 3IN5A 3GWCA 4JV2A 3WIUA 1VGYA 2QFIA 3DLLQ 1WC1A 1S57A 3HMJG 3BM7A 1B7FA 2YH1A 2H5EA 1MMNA 3X3UA 1MSWD 3KTQA 3CO9A 2OHDA 1LWXA 3R2DJ 3PACA 1HBNA 1VHIA 4Y6IA 3CPWR 2DPIA 2H48B 3BGUA 2CQDA 1MMDA 3N5FA 3GJSB 2NUUG 4X4OA 3GILA 2A10A 2D3OR 1X7VA 2FHJA 4R8UA 2HQCA 2CPEA 1WG1A 3EMTA 4B9NA 2E7XA 2GCFA 7FD1A 3MMCA 3KMQA 3U7JA 1CS4A 3U1NA 2VG5A 2CAZB 3OTCA 1WTBA 2BABA 4U6PA 5A8KA 3H20A 5KFYA 2W4DA 3PV8A 2KRBA 3N6LA 1HI1A 2UUTA 2KYXA 3KK2B 2W7OA 3HI9A 4ZP6A 3RRGA 3FMWA 5EX0A 2VG6B 2MKJA 3KLVA 4FXWA 1HL6A 2R42A 1WTFA 3AQOA 1MN7A 2VBZA 1UTAA 3E3XA 3LF0A 4OI6A 2A2DA 1RBAA 1TL1B 3OL9A 1YKWA 3Q8DA 4ZVUB 2K7JA 4PWWA 2O01C 4DSIA 1R6YA 4KR0B 4B02A 2VFSA 5HN0A 2ZNYA 4L76A 4OYMA 1I1GA 3M30A 2M2BA 3HVWA 1U47A 2GJ2A 4CYUB 5JUMA 4UOCA 5KT4A 5HAOA 1Z2ZA 1OIAA 3RW7A 3TUJC 4ZLNA 1PJ7A 4ED5A 4IH5A 3GYNA 2UZAA 1S5ZA 4OI2A 2KB2A 1VQYA 2QA1A 5IM0A 3CF5Q 2R7XA 5J2MA 1S9EA 3KJVA 2D7SA 4KHRA 2RMLA 4E8UA 4H4KA 1T9YA 1WHXA 5DZ7A 2GZOA 3FSIA 2MLZA 4C8LA 4Q0BB 3HULA 4B3OA 1TL4A 4ZLJA 2B7CB 3EDQB 1Q82T 2UVVA 5KG7A 2H51B 3MUVP 1YRTA 4ER8A 3DLHA 2GIQA 2SXLA 1KOOA 4ECTA 1XJWB 2X51A 1LXNA 3AB4B 3QMQA 3MMBB 2PA3A 1FE4A 1UA1A 4Z7HA 1RT2B 2D3UA 3LQVA 4DCOB 1PJ6A 2WHOA 3MECA 4N8OA 4RW9A 1N5VA 3ZNUA 5AXLA 1UVLA 4QIVA 2VICA 2E1MC 2DGXA 5KFMA 3QSYB 3RBEA 4ZKAA 4DV5F 3ILJA 3K89A 2VDHA 4K2XA 2MZRA 3VVUA 2MGZB 4PG8A 4U96A 3RR8A 1TMJA 3B4DA 4I0WA 3BREA 4USHA 4J9SA 5K8NA 5HMWA 1MROA 4K0KF 2DISA 4U67Q 2XMXA 2BJ9A 3N9UC 2HNDA 1X5PA 2JOQA 2NLWA 4M5KA 2QG9B 1N32J 4OZ5A 4U95A 3UR0A 1OSCA 1VQLS 3JYTB 1DRZA 1WHWA 4JI3J 1J5OA 1SIWB 4NMLA 2QMWA 2W2OP 3W7BA 1MG7A 4FKXA 3G8SA 3P23A 4I1TA 2MZSA 1XMOJ 4LFCJ 1R0BG 1HNZF 2MQPA 1WELA 1PCAA 5LL6d 4AL7A 1UZHA 3ZZYA 1WEZA 4DN0A 1RSCA 2YNIA 5DG8A 1RT4B 2XMAA 1RISA 3PW4A 1NZAA 4DL5A 1FO1A 1TQLA 4BDPA 3GV7B 4LSZB 1RI7A 3OW2R 3G6YA 3O1LA 1KC8T 4Q2MA 5IZHA 3HZEA 1P6TA 2XO7A 1QY7A 4JI5J 4HHJA 5D3GA 1NHUA 2LQJA 2M5YA 5B0AA 3OXFA 4P75A 1GTEA 4M5HA 4OYOA 4TYAA 5F9NA 4LQ9A 2PC6A 4CT8A 1SVDA 2VC0A 4WTYA 4ID5B 1IR0A 2KVIA 2NPFA 2E5LJ 5C42A 1X5TA 2AEFA 2HS4A 4JI7J 2AEJA 4N56A 3DOKA 4QR1A 2R7WA 1RWOB 3M9NB 2R7TA 2XMKA 3C8YA 4IDKA 4JI1F 3C2PA 3R5JB 5E3QA 1JLFB 1FRHA 2RQCA 2U2FA 2E1RA 2DGWA 1U1PA 1KKHA 2ZBQA 4WWSA 3BQ1A 3OFEA 1YGYA 2KXFA 4IH7A 4MIWA 1Q5VA 2JEFA 1S1UB 3HK2A 4DPYA 2MZTA 2IRUA 1I51B 3EVMA 1Y3JA 1NUEA 4NCAA 3UITA 4NZ6A 2F66B 5L46A 2PMHA 2R7OA 1SI9A 1ZETA 2VV5A 4ECYA 4C48A 2J9DA 2KJVA 1TAQA 1V3RA 2CG4A 2OGUA 4NCGA 2M52A 4QIEA 4I4BA 2FU2A 4NI2B 4ZLLA 2KFZA 1HNIB 2BKOA 4WK3A 2CPJA 2MSSA 3SQOP 4WFAQ 2FVPA 1U0HA 2YKPA 2W24A 2MKKA 3OJUA 3IRWP 3CD7A 1S0MA 1FF2A 4ZCIA 3B4MA 1KFDA 2CWKA 2BEFA 4PZVA 2IJFA 4P10A 3QJLA 1U09A 3CSKA 4KPCA 3TA2A 3JSRA 1WHVA 2G2ZA 2ASYA 1LW0A 3QSIA 1AXQA 1IM6A 5D4PA 5IT9U 1R8PA 4L3KA 2RKIB 3QJJA 4FDFA 5KT6A 2FZCB 1HBUB 3KLHB 2L08A 1U1QA 1SKWA 3TUIC 1REVB 1NDPA 2DITA 3TI0A 4GO7X 3L0IA 2MLYA 2CNNB 3NG8A 2KT5A 4RX6A 3M8QB 3HF5A 4QWAA 1FKAF 2F4FA 2HNZB 2PIIA 2CQ3A 1S6UA 2MEWA 3MD3A 1WJ9A 4WFZA 4DV4J 3MWBA 1VBXA 3H40A 1T11A 3MTJA 4B9MA 1Q5YA 5LXRA 2V8GA 5DQIA 1VBKA 5H9FJ 4LF9J 3THPA 4OX9F 4CLTA 5L9XA 1S0NA 4JI4J 2B8PA 2A6MA 2HRUA 1WKJA 2Q79A 1JJ2R 4ED4A 1DTQA 4DSLA 1FJCA 1CG2A 2WW4A 4DR4F 4DQRA 3W8PA 4ES2A 4QW8A 1DTTB 4WKRA 2CPZA 4B17A 3ZXWA 2G0CA 1JXLA 1AYEA 1WUUA 4OYPA 2M3DA 4C3KA 1C4CA 5D0EA 4K59A 3DA4A 2WTFA 3ILOA 4DUTA 5KOXA 4OI4A 3FCWA 4IRKA 5H9EJ 2BQUA 2DRBA 1CVJA 2JZ5A 2OIHA 3UNGC 3HFKA 3FBEA 3FEYB 3H4DA 1NSAA 1HNVA 2PI5A 5LMNF 2RNEA 4RUHA 1K73T 1L3TA 2J0SD 4YMEA 1Q86T 5D4LA 2PEBA 4DFMA 3Q8VA 4JUZA 3DDNA 4K4UA 3ZTOA 2ZOFA 3N01A 4NLYA 2DVIA 2NXNA 2KKHA 1UJ4A 4PG5A 3TUZC 1DAXA 2R8HA 1HQUA 2E9ZA 3W5ZA 1F9FA 2P9GA 2RDIA 4Q9VA 1TK8A 2Z57B 4LR7A 3EX7B 1HBNB 1N56A 3HHDA 4NXMF 2CVEA 1QUVA 1NK5A 1S6PA 1F5AA 3TYTA 2E5JA 3OSPA 1HMVA 4EMDA 3PEHA 2Q6BA 4O1OA 4KPYA 2YX1A 1DHMA 3PIPQ 4R8UB 3QAUA 3DYAA 3PX6A 1MWQA 5DDPC 4DR5F 2Z30B 1R0AA 1VK3A 1IQTA 1CS4B 4W98A 4LFBJ 1IKXA 2VG5B 4AD6A 4FBTA 2FJEB 5CHCB 4MAKA 3J7YU 3KFWX 5A8KB 1SPBP 4QYZK 1KQKA 5LMUF 1UJ6A 3E51A 2UP1A 3LGNA 2RHQB 2I38A 1XMQF 1OQ6A 1RK8A 4DV1J 2ATCB 4DUZJ 1WF0A 5SUHA 4DCJB 3MM5A 1UVMA 4I6AA 5KFTA 1QJHA 4JI8J 2C3MA 4F04B 3KK3A 5BR8J 2BM1A 2GVZA 4PXEA 4KTQA 3W62A 1JB0C 3T9NA 1G2EA 3NCRA 2J7KA 1QUPA 2VFVA 4FVCA 4ECQA 3PFEA 2PN6A 4UF4A 2IA0A 1N52B 3QT5A 4F8RA 3GIKA 4FXDA 2XGPA 1B99A 2IM1A 2BE9B 1U2RA 3DLKB 5FLXY 2HAIA 5IM0B 1GXTA 2AT1B 4JI6J 4OZLA 1QE1A 3W5XA 3BQ2A 2VODA 2HRYA 1FWLA 3PKYA 1HNXF 1K44A 1Q79A 3QT6A 3VAHA 3T3FA 4USJC 5KFFA 1VQ4S 4OYIA 4K4YA 4USVA 2E1PA 2I9SA 4Q43A 2BZ2A 3O5TB 4ED8A 2F65A 1WOSA 3EPGA 1NNDA 1BMQB 3VHQA 3A3NB 4BLGA 1TUGB 4CIOA 3PG9A 3JXOA 1NK9A 5JXSA 4IOBA 2G9OA 3E8OA 1YI2S 4KB7A 3J80U 4OAVB 2OPSA 3TZZA 5HLFA 5CH7B 5HL7Q 3MUMP 4UUWA 5IV4A 3CWJA 1VDHA 2HHUA 2NR0A 1NB2A 2DJWA 1NZ8A 3KG1A 2HMIA 4ETZA 4WFNQ 4RW9B 2Z0GA 4RBUA 1Y0HA 3GFHA 2F6MB 1HWIA 2JFKA 5KFIA 1MU2A 2N7YA 1TKZA 1N34J 2V4QA 4PQUB 4F02A 2HHQA 4OYWA 4X4TA 2BQRA 4DUYJ 2DNLA 2E5HA 2CQPA 1FXDA 4ED3A 3PFOA 2ETDA 2UUCJ 3VZHA 4NE9C 1U1RA 1MROB 2A0FB 4G3IA 1D0EA 5J2QB 2R2RA 3CCMS 3H4BA 2CADA 4YP3A 1LFWA 4EU0A 1VOMA 1SUQA 5HROA 1TU0B 3FEZA 5LXYA 1N5YA 2CAJA 2ZNZA 3HVAA 3UE2A 1GH8A 4DV7J 4MYTA 3KLGA 2PGCA 3EXYA 1SH2A 2XCPA 3QQCD 2YFAA 2L9DA 4YFUA 3HHKA 1O0PA 1C1CA 1EARA 3M2VB 1TL7A 3K5OA 2OTJS 1D9FA 1EQ0A 2BDPA 1TL3A 1FVQA 4DV0F 5ETKA 1K0TA 3T5JA 1F60B 2XO6A 5RUBA 5GAGI 2FHOB 2HQIA 3PYFA 2FTRA 1LEOA 2G2YA 3IS9A 8RUCA 4NRUA 4OJHA 4W90B 1NEEA 2VPZB 5HBMA 2ZDPA 4CLFA 2C2KB 3DLEA 2YNIB 1FKPA 2RQMA 2ZUGA 5AJ3J 5KT2A 5IQ6A 2AD9A 3R3TA 4LRAA 1VQOS 3SV4A 4NLVA 3O44A 3Q8RB 5DDQC 3CTRA 4HR2A 3KJQB 4J9RA 4WU3A 1HQ2A 1ZAWA 1F9EB 2E1CA 1RWPB 1TELA 3KLEA 4WYLA 1TMMA 5D3GB 5HQMA 3VCDA 1GTHA 2PT0A 3EPIA 1J5EJ 3TUPA 1SCJB 1HBOA 4ZVGA 5EGYA 2UXCJ 1U1MA 1GFWB 4NMXA 4MMOA 1OPIA 3BSNA 4Y2KA 2D74B 4NLUA 2OEKA 2CKWA 2ZH8A 2I8EA 1RYSA 2E5GA 3DOKB 1RAIB 4ATNA 3VAGA 5GAHU 3PJ9A 1XQIA 3V4MA 1WKKA 2CDQA 3Q24A 5GADU 1IXKA 3H59A 1U1KA 3D1QA 3DRSA 5LJ3Y 3DGPA 2HBQB 1CEZA 1CLFA 1SQFA 1S10A 4A8QA 3CEDA 4O0NA 3VWSA 2FC9A 3JTOA 2QLBB 2M88A 4NYZA 4KRWA 4USUA 4Y2CA 1XR7A 3C66A 1EKRA 4PUOA 1R8CA 4TQSA 5IFMA 2VBWA 1M5OC 2OEMA 5DGBA 2YKNA 3B78A 4LF6J 2VB6A 1E6VB 3GG0A 3THTA 4B9VA 2M7SA 1HHSA 4WP3A 3HXMA 5B7WA 3A13A 3SFGA 3HVTA 1RE1B 3H2VE 1UWBA 5LT5A 4M5DA 3OHAA 3G6XA 5JJBA 2Q66A 3TZXA 4DG1B 3BF4A 5D4NA 3AXMA 3T1YJ 1MLAA 4YZ9A 2OFGX 4NLXA 3G86A 4ZN3A 4WZMA 4FYDA 4F3QA 1S48A 4FXVA 2AHOB 3PO4A 3QGPA 2VF3A 2COLA 2DCLA 2MY7A 5I42A 2QSFA 4OYBA 1VJQA 3CJ8A 1VRTA 1S6QA 4LR9A
chains in the Genus database with same CATH topology
4QOTA 3PW2A 2GA7A 3M8RA 1ZM4A 4NA1A 5J1EB 1Y3KA 3I0SA 2PE8A 1LW0B 1HHTP 2AYBA 4EUVA 4JCVE 4IKAA 1GXLA 2NS1B 2B4UA 5K9FA 2RRBA 3DMJB 2XNQA 3OR2A 4ZA1A 3L7PA 4H4OA 4OHXA 2F8MA 2PFFB 2RVJA 3CIMA 4ECRA 3SXLA 2Z4PA 1X5OA 1JLGB 3JB9k 4FN5A 1O8BA 3D54A 4IYQA 2DHAA 1NAQA 1QAXA 1TVRA 4PQUA 1S1UA 1SL0A 5L1JA 4AL5A 1VQSA 2XLKA 4H4KC 4OI1A 1X9WA 1S1VB 6FDRA 5KFKA 3MEDA 2D1CA 2XMVA 3K8VA 2EC0A 2OKQA 2AW0A 3SDEA 4WFXA 2CPHA 3MMCB 1LXJA 2V8VA 3ISNC 1Q4RA 5L1LA 3T1YF 1CQNA 1EP4B 2AJ1A 1DLOA 4KSEB 4MFBB 3HHLB 1W2BR 2W4CA 1AFIA 4Z37A 2LU2A 4C3MA 1RTHA 1U25A 3LOUA 2ROPA 2B5JA 4ZPBA 3OXLA 1YHQS 4CO0A 1XNQF 1F0XA 3DRRB 3DO9A 3JAMY 3MR6A 4EGLA 4OI3A 1DFDA 5J2QA 2FHJD 1SV5B 5B0GA 2ZITA 3WDOA 2E5IA 5HO4A 1YWXA 4O44B 5F9LA 3W2WA 3RB3A 1VBZA 3DRXA 5J1PA 3V5RA 4ZVHA 2J0XA 4ZCLA 4NLGA 4KE5A 4QBUA 5L38A 2RRNA 3NCPA 3AJ1A 4LT6A 1VI7A 3HDSA 1OSDA 1QSLA 3P3DA 3DLJA 4ILRA 2DGQA 4A8YA 2B43A 2OAUA 2IAJA 3OR1B 2J0WA 3NS5A 4CZCA 1FTRA 3V6JA 1LWEB 1YJVA 1KRPA 1ZM2A 4KBIA 1YVFA 3NKYA 2KJWA 3HHLD 4O3SA 1VBYA 4ECWA 1HNIA 1S1TB 4ICLA 4C11A 4EYHB 1QAIA 2AJQA 1KLMB 3MAHA 3TA1A 3SV3A 4G1QA 3F73A 2FD2A 3D1OA 1XC9A 2D41A 2RUGA 2DHSA 4FZVA 3TRGA 1S49A 1WG5A 3QJPA 2GHVC 1G3OA 1JKHB 2P6SA 3DU5A 2ZH6A 3RAMA 1D9DA 4HH0A 3ZZOA 2NQPA 2ALZA 2Y1IA 2HHPA 3KYLA 1L3VA 3ITHA 3VQSA 1TL5A 4DLEA 4G1IA 2BVZA 4FNHA 2KM8B 4N5SA 3M2VA 4OMFG 1V3SA 1BGXT 1KONA 3H8YA 2YNGB 4PKDB 2ZJQQ 1RA7A 4NV2A 1URRA 1Q8IA 2XWYA 4YOEA 3EGZA 1DTQB 1FRXA 1ZM9A 2DNMA 2F9DA 3FZBA 3ENVA 4U9RA 2KI2A 1YBAA 2JB3A 5E2QA 3CB4A 4DQQA 3BGRA 1FDBA 3CMAS 2O66A 2WW8A 3M30B 4UY85 1TAUA 3VAJA 2DR7A 4LF7F 4JI0F 2EK1A 3MM9A 3HKWA 1Z4UA 4I2PB 4NPOA 2ZC3A 1QAJA 4LVNP 3S7RA 4BHQA 1WEYA 3C46A 3VAFA 4XO0A 3WZ0A 3V6KA 4ECVA 1M1KT 1HQEB 2FJDB 3NP5A 1SJFA 4CO2A 2N4DA 3FRZA 2JEJA 3NS6A 4ZPCA 2OPPB 1TFYA 3CCWA 4Q2LA 1SIZA 2DNGA 3OVBA 2QZ8A 2FC8A 2RKIA 1SJ8A 3OSNA 4RNNA 4DQIA 2MHEA 3DC2A 4HTJA 2RU3A 5B0FA 3V6DA 1ZOTA 3HO1A 2GMJA 1LW2B 4I68A 2A3JA 6FD1A 3UQSA 3ZC4A 2RIOA 1VHFA 3E01B 5FDLA 3KLHA 3IO1A 5J2MB 4U7CA 1S9EB 1EETB 2BUNA 1T7PA 5FJ4A 3KJVB 5B0EA 1XERA 2BJEA 1REVA 2AGOA 4X4NA 2HIQA 2PDAA 3ISZA 1FHTA 1JMTA 1IBMF 3VA9A 3N28A 3QIDA 4RUAA 1S72S 2HFNA 1NJXA 1UKUA 2VASA 3TVKA 1N32F 1FTCA 2OH2A 3KP9A 3E2EA 2CPIA 3VAIA 2DBBA 1HWLA 3GV5B 4DEZA 3M8QA 2EG2A 2IC3A 3KLIB 3OPKA 2J6UA 4OLOA 2FJWA 2N3LA 2CJKA 1KNZA 1GX5A 1LK7A 2I5JA 4ZPWR 1RT7A 4DS5A 4B3OB 3PRDA 3PW0A 2JAEA 2DR5A 1R89A 2UVWA 2DNNA 2HNZA 4RLEA 2JLEA 4IG0A 1HFEL 4XK8C 1L3KA 2MJFB 4UY8T 3DLBA 4ECXA 4WXWA 2X1BA 2XS7A 3SEOA 2AQ4A 1VIOA 4C3LA 5I4MA 2NSCA 4Y00A 3P6YC 2XSJA 5G0RB 5M2UA 3OFFA 5F3ZA 1XMOF 4LFCF 2VPXB 2FLPA 2BW2A 3BDEA 4ZCMA 2EVZA 4XPEA 2YKQA 4FF2A 1LWCA 4I69A 4C8YA 4DX8H 1JLBA 4YZCA 1N33F 2Q43A 2O5DA 1KVJA 1WI8A 4O1PA 2CQIA 1IQZA 2ZBIA 3R1LA 2FUG1 1R8HA 3SYZA 3R1HA 4DPOA 5EDWA 1PGZA 5E41A 5EX3A 1XR6A 3LP1A 2K19A 2R8IA 3IG1A 4HEA1 3KKFA 5DQGA 3KK1B 1JLQA 3QGGA 4L72B 1LK5A 2U1AA 3D2WA 4DV2F 3NGKA 1C1BA 2VOOA 1SQEA 1D9AA 4O3NA 3OTEA 3S1TA 2MZJA 3SI8A 2XTRA 4I56A 3F4MA 2Z2MA 3M6VA 3ENWA 2I1RA 5CYQA 1T02A 2LEBA 3MHYA 2V4RA 3FBVA 4RZRA 1HQUB 2HHXA 4DFKA 1LWFB 4F4XA 4C9DA 2B0GA 4C8KA 2M70A 4L3NA 3MECB 1NHVA 1U49A 4YDXA 3I9V9 4X84A 4CNZA 4DFPA 1S0OA 1I6JA 2FVSA 2F40A 4B3SF 3DLGA 3LWMA 4BWJA 3BO3A 1Z2LA 2LXIA 2B9XA 2VUGA 2NREA 1FXLA 3M2UB 5A8WB 3CD0A 5KFOA 2K1RB 2B4PA 3H25A 3NBPA 3GE9A 3MD1A 3BB5A 3CDUA 4I6WA 4EZ9A 5CZXA 3N5BA 2RS8A 4XDDA 4OX6A 4TLRA 4L6V3 4F26A 1FD2A 1IJFB 3X1LB 4ES1A 1S6PB 2ZHOA 5J2NA 2RF2B 4JI5F 1CSJA 3RW6A 1N5QA 4EEYA 3LAMA 4DSJA 5E3AA 2CPYA 3LJ2A 1DARA 1FRKA 1HMVB 1UW4A 4NX9A 3TVYA 3G4SS 3BN7A 5DETA 4RW4A 2UXDF 1X0FA 2DCUB 5DJBA 2E9TA 3M32B 4DSKA 2IYGA 4NYOA 3GQCA 3Q8PB 1RTIA 2QRRA 2MKIA 5KFVA 3KNAA 1Q8BA 3DYAB 4ILLA 2FJVA 4OZJA 1UFLA 5A0YA 3CCZA 2J6SA 3DCAA 1HD1A 5JVHQ 3GR1A 1UVLA 1LKZA 4ITSA 2B6AB 2DNZA 1R0AB 4ELTA 3UW1A 3CDBA 3MDFA 1XTZA 2UVRA 3SSSA 2R8GA 1W3SA 1IKXB 2E5LF 1Y4ZB 4V19X 5HQ8A 3FEXB 3ULHA 3SDJA 2LEAA 3MM6B 3LP2B 1U1NA 4HKQA 5D4OA 2MSTA 2Y1JA 4A8SA 4ILMA 1VMBA 4Y2IA 2HNDB 1M5SA 1E6VA 2KH9A 2LLZA 5F8NA 4EYIB 1FEHA 2JDJA 1URNA 2VPYB 2C3OA 4TY8B 3J80Y 2PMZD 4Y65A 3QWUA 2HHVA 1KOHA 4DBQA 3CJ4A 3FZ2A 3BEGB 1C2PA 5HMYA 1TZ0A 2J7WA 3DA3A 2KZZA 2QA2A 1VRUB 2JH3A 1V3ZA 2BE2B 4NLRA 1U1OA 4RNFA 3WBZA 2GFFA 1MNEA 3CIZA 3BSAA 4RNHA 2F1FA 1S6OA 1S76D 1W2IA 2KZMA 1O51A 2BBEA 3MEEA 3QLHB 4DG1A 1J5OB 3MM5B 2FGCA 2MQMA 4NV5A 2EG1A 2EFVA 5G4DA 2LECA 1T95A 2OMOA 3IN5A 3GWCA 1RT5B 2UU9F 4JV2A 4HT5A 4M8LA 1RTDA 1VGYA 1VIXA 3PVXA 1HI8A 1JJ4A 2KO1A 3MEGB 3DLLQ 3KK3B 1Y00A 2WB1D 3HMJG 4F3MA 4AYBD 3BM7A 5KT3A 2W4PA 4LSNA 1IKVA 3H2LA 2HQ3A 3GZ7A 1B7FA 3IAM1 4CO1A 1L3UA 4M63A 3C3LA 2K8GA 3VALA 2YH1A 3UCZP 1JNZB 1SH3A 2H5EA 4FF3A 4I7FA 1F2GA 1MMNA 3SZ2A 1YRXA 3X3UA 2AX1A 3R5CA 3WX4A 4AXIA 3G6VA 1MSWD 2LA6A 3H5SA 3KTQA 3CO9A 2XLIA 2ZH1A 1NK4A 1UVKA 2WAQD 2XMMA 3L95X 1FNXH 1TUVA 3PACA 1X4HA 1E6YB 1HBNA 5J1EA 5K14B 2K2PA 4I2QB 4Y6IA 3CPWR 2VG7A 3ZZTA 2DPIA 3DM2B 3BGUA 4NLTA 4P7VA 1LOUA 4G75A 2CQDA 3DMJA 1MMDA 4WF9Q 3FVYA 3N5FA 4IFVB 4CTAB 5DG7A 3DRPA 1IJEB 2NUUG 2EFPA 2ZD1A 4X4OA 3IBWA 1ZYQA 3GILA 3R5DA 4A8FA 2A10A 2D3OR 1X7VA 2L3MA 2FHJA 4NLOA 4R8UA 3MMJA 1JLEB 3QO9B 1YJUA 3S6EA 4J9PA 4FNIA 2H9ZA 2F7VA 1QE1B 3MFHA 4O3RA 2CPEA 1WG1A 2EBEA 2W7PA 2L9NA 3LP0B 4DR6F 4B9NA 3ZZPA 2KXNB 2A18A 2E7XA 2GCFA 7FD1A 1P1LA 3MMCA 3KMQA 3U7JA 3BR9A 2Q6CA 1LFPA 4RW7A 1ZPVA 2JWNA 4RWWA 3U1NA 2VG5A 2HVZA 2RT3A 2CAZB 4MFBA 3HHLA 4O23A 1YJTA 3OTCA 1WTBA 3MOJB 1BQNA 2ZDOA 4XDCA 2BABA 2ZHBA 1Q7LB 5A8KA 4U6PA 1JJHA 4PL3A 1T03A 3Q8QB 3H20A 3AY0A 4PRFA 5KFYA 2W4DA 3DRRA 3MPYA 3BSCA 3PV8A 2KRBA 1FJEB 2KT3A 3N6LA 1HI1A 2UUTA 1SV5A 2KYXA 3UD3P 1S7HA 3KK2B 2CJQA 2W7OA 2ZJRQ 3HI9A 2J6TA 4ZP6A 2ZE2A 2R2TA 4RNOA 4FS2A 3FNNA 4A46A 5CXTA 3PX0A 3RRGA 3FMWA 5EX0A 2VG6B 2MKJA 5IXUA 4FXWA 3KLVA 4NZ7A 3OR1A 1HL6A 4KO0A 4QYRA 3PX4A 1WTFA 3AQOA 3L3CA 5LJ5Y 4RKUC 2AF6A 1ELOA 5DM7Q 1ZTTA 2VBZA 2ZH9A 3D0GE 1N0UA 2YX4A 3E3XA 1KLMA 3LF0A 5C42B 5DLGA 1N4LA 4OI6A 2A2DA 2BRLA 1S4FA 2DHGA 2YTCA 2E44A 2LMIA 2MZQA 1TL1B 5M2RA 3OL9A 5E33A 1JLCB 5IT9Y 1C0TB 1JKHA 4NL5A 2VBXA 3G71S 4DFJA 2XULA 3FSXA 2YNFA 4HI2A 1Q16B 2HWHA 2DD8S 2OPSB 1M5KC 3Q8DA 4QIFA 1RT6A 2VPWB 1IUJA 3M8PB 4IDKB 2K7JA 3MCSA 5A8RB 3K5NA 1N36F 1UFWA 4KKOA 2YNGA 3VZIA 2O01C 4BS2A 1U24A 2B3TB 4DSIA 1R6YA 2RH3A 4KR0B 4B02A 1FJ7A 1UVJA 2VFSA 5HN0A 2DRAA 2ZNYA 2HMIB 2F9JA 3PIOQ 1I1GA 1Y9OA 1TV6B 1CQMA 1SBRA 2RB7A 4PG6A 3CCVS 2W7AA 3HM9A 2OPRA 2RJZA 3M30A 2W9CB 2M2BA 4ED2A 4ELVA 3DDKA 3HVWA 2GJ2A 1U47A 1NU4A 4DSEA 4PCQA 4ZMMA 3M1VA 4I2PA 1RT1B 3HKZD 1UEVA 5JUMA 3MFIA 5DO2A 4UOCA 4C8NA 5KT4A 1MU2B 1OWXA 1Z2ZA 2CQGA 1NK7A 3L09A 1JXEA 4DR2F 4GXTA 4BCAA 1OIAA 3RW7A 4ZDNA 5EHHA 1YITS 3TUJC 4Z2XA 2MZ1A 4ED5A 2BYCA 4IH5A 3GYNA 1N5TA 3QAEA 3MF5A 2UZAA 4AXJA 3HHLC 3AQPA 4OI2A 2AGQA 1JX4A 1YJRA 1LW2A 1YO7A 1VQYA 2KB2A 2OD4A 2DTJA 2F8EX 2QA1A 5IM0A 2YWKA 5E3PA 3OTOF 3CF5Q 2R7XA 5J2MA 4J5OA 4DV4F 3M4XA 4UQTA 2XWXA 1S9EA 4CH1A 3PZPA 1RTJB 4DLGA 3KJVA 2ASDA 3V81B 2LEPA 2D7SA 2VFRA 4KHRA 2RMLA 2DIVA 4D3HA 5DDOC 4E8UA 5EN1A 1ROFA 4H4KA 4ZP9A 1WHXA 2EI5A 3OL8A 4A8WA 3KOAA 2HZCA 4ALZA 1J2VA 4LF9F 5AXMA 2I2YA 4CH0S 1KR4A 4TU7A 1FJGF 5B0BA 2PSZA 3FSIA 3W2VB 4B3TF 3K58A 2FPHX 1FEEA 5KFDA 2ZJPQ 4HI1A 2XY5A 4C8LA 4JI4F 3U02A 3NMRA 3RB6A 3I87A 2V94A 2XMTA 4Q0BB 2HWIA 3MMAB 5I3UA 3IR7B 3UR3C 4QWCA 1NK0A 1TL4A 4B3OA 1S1WA 2B7CB 4EBEA 2IM3A 4NCGB 4HT7A 1SUQB 4LQ3A 4O3PA 4DL6A 1Q82T 5HROB 2CZ4A 2UVVA 4OAUC 3CC7S 3OFHA 1N5YB 1ZTWA 3LO3A 2WSEC 5KG6A 2V4JB 2DO0A 1NJWA 5KG7A 4Q45A 3IWXA 3KLGB 5G0RA 2R2SA 3MUVP 2KM8C 1YRTA 3IWLA 2B9YA 3DLHA 5KG4A 2GIQA 2SXLA 1M90T 1RKJA 1TK5A 2QA4S 1KOOA 2DH9A 4ED6A 2MMYA 1K0VA 5J2PA 4LSLB 1C1CB 3DOLA 4ED7A 4ECTA 1N48A 3OVAA 3I0RA 4HDGA 4YZDA 1GNKA 2X51A 1LXNA 3AB4B 3QMQA 2HGNA 1BQMA 3MMBB 5KFSA 1P8GA 2ABYA 4NLDA 2PA3A 3HPOA 4QW9A 1P9QC 1FE4A 3EXCX 2YQ3A 4PG4A 1KQFB 1UA1A 4B9SA 4Z7HA 1RT2B 1TL3B 2D3UA 3LQVA 1HPZA 2HHSA 4H54A 2JC1A 2VD3A 1CC7A 4KFBA 5B0DA 2N82B 5MAOA 1FKOB 2FVCA 5F8LA 2GQCA 1NKCA 2WHOA 4NYPA 3J7ZT 3M2RB 1TKXA 3AHPA 3PO5A 2AV5A