4I1TA

Crystal structure of the cap-snatching endonuclease from pichinde virus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
b'MEEYVSEFKDMVRKWVPEWEELSEQKNNVLAQVKDRAITIEGLKLLSMLVEVDSCKKHSCRHNTRMTVNAILRELKVTCPTLPDVTPDGYCMVGDVLILLEVFVRTSQEAFEKKYNQDFLKLMQLSSDLKRQNITLVPVIDGRSSYYVEYIPDWVVERLRWLLLKLMDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
publication title Crystal structure of the cap-snatching endonuclease from Pichinde virus, a new world arenavirus
rcsb
source organism Pichinde virus
molecule tags Viral protein
total genus 59
structure length 169
sequence length 169
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.300 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4i1tA01
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i1tA02
5J1NA 3JSBA 5J1PA 4I1TA 5IZHA 4MIWA
chains in the Genus database with same CATH superfamily
3SFUA 2DJWA 3QO9B 3VAHA 5A8KA 1VHFA 5FDLA 3MWBA 4CCHA 5FLXY 4TLRA 4DL2A 4G1IA 4Y2AA 5DZ7A 3F0NA 4WJBA 5ETKA 2JLFA 3ISZA 4L6V3 4IO9Q 3DDIA 3VA9A 2LA4A 2BL8A 3C6UB 2LEBA 4LF8F 1G4CA 4PWDA 3KLIB 2YWWA 2P2CB 4ZVPB 2HSEB 1HQUA 5KFAA 3JYTA 4MH8A 5F0UA 4K4VA 3UN2A 3DDKA 2HHPA 4LRAA 3T5HA 3QIDA 1FRXA 2DCLA 1XERA 3KG4A 1AFJA 4ZLJA 4JI1J 2XYHB 1C0TB 1YZ6A 5IC4B 2IJFA 3POTA 6FDRA 4A47A 1SCJB 3QRPA 1GX6A 3T9ZA 5HGIA 1G7CB 1Y5LB 1FFGB 4P2SA 3DNCA 1TKXB 1KHVA 2Y8YA 3N0VA 2YX1A 2E7VA 1WUUA 2FC8A 3QJPA 4B9MA 2VF3A 4O1OA 1TUVA 4WPAA 1XMBA 4UOFA 4QW8A 2ZNYA 2AYMA 2KT3A 4Q43A 1KBRA 3OQ2A 2B9WA 5L1JA 4MTPA 2YKMA 4LF7J 3D6FB 3MCSA 2XHWA 1IKYB 2MEWA 1N48A 3NNHA 1EP4A 3BGLA 4ZJQA 2DXDA 3Q2TC 1F5CA 5A2QY 1FKOA 1FXRA 1V3SA 2DNOA 2UUWA 4N56A 3LPEA 2MSSA 2HIQA 3DM2A 4ERDA 5KFBA 4H54A 1FDAA 2M0GB 1TL7A 1RDRA 1H2UX 5CYMB 4F2RA 3MFHA 1WOPA 3Q2SC 2JZ5A 4JOUA 1H98A 4DPTA 3F73A 1X4DA 2ZOGA 4F02A 4USIA 3BBFA 3VHQA 3IS9B 3W9IA 2BQ3A 3B54A 3UNGC 5MAOA 4ZOSA 4USKA 4J9VA 3KJQB 2J5AA 2ZDPA 1SJFA 1S1XA 3M8PB 1VGYA 1WOOA 1Q0NA 3KLEB 3Q24A 2HQ3A 3ENVA 3K58A 1QAIA 4OZ3A 1EARA 3ILLA 3CJKB 3ZZOA 2DH8A 2LXFA 4AT1B 4CO3A 5DRKA 3RB4A 1JX4A 1RHJB 4NYPA 3J81j 4B9NA 2A10A 4DV6F 3HFKA 4PYAA 2HVDA 4FZVA 1C0UB 1NDCA 2N4CA 1RU1A 4A8KA 3H5XA 2HHWA 1W7WA 1LWXA 4WXOA 4PXCA 1S4FA 2XWYA 1NJYA 2OEJA 2LU2A 1FRLA 1CJVA 3HULA 4ZPAA 4K4TA 3UCGA 1DQ9A 1O5JA 2JFDA 3Q8VA 2UXCJ 3PIPQ 4WFYA 1FESA 4OYMA 3K7RA 1HI0P 1T03A 4LQ9A 4RJVA 2J0WA 3JSBA 4Y28C 1F9FA 2VBZA 3D4JA 1FO1A 5B0GA 2E5LJ 2XY5A 1YLXA 2GA7A 1U48A 4O4GB 4ZIVA 2F3JA 2LEAA 2EWHA 5D3GB 3SBMA 1DHMA 2HFZA 3PJ9A 2HURA 3PO5A 4O1PA 1NSQA 1H73A 1HBNA 2CUYA 2YX7A 3O44A 5A0YB 2DIUA 2Z2LA 4RW8A 5EX3A 4HLBA 4LF5F 1MU2A 1FT8A 2ZJQQ 2GVZA 4X4RA 3EGWB 1OY9A 3NBPA 1LKZA 5HBMA 2VPXB 3T1YF 2V9WA 2CNKB 4WK3A 2BE9B 1SL2A 3T6JA 5B0BA 1YVFA 1UW4A 3QT7A 4LSNB 3C6TB 4RUBA 4FDFA 3CCUS 3A12A 2POKA 3M1VA 2KB2A 2B8QA 4OI2A 3TA1A 1F3FA 3UDCA 3BN7A 3W2WB 2FLLA 2QJ3A 3CSKA 2ZH2A 3DYAB 2I8EA 3DLKB 2MTLA 1WKJA 3SQGA 1N4LA 3CGIA 1SQGA 1YKWA 2DB1A 1HNVB 2YBVA 4AFFA 2L9DA 3J81Y 5D0HA 3LAKA 2J0QD 1RTIA 1S5ZA 4OI6A 3QZ7A 2VBXA 1WKKA 4DEZA 3PZPA 2W01A 1KLNA 3S1TA 4KGXB 1EKSA 5F9LA 4E8UA 1Q81T 1XQIA 4H4OA 2V5HG 1RT6B 1HNZF 2FHOB 3AOAA 1VC6A 1K0TA 4L3KA 1FRKA 2JOQA 4ZCKA 4RWXA 3BF4A 4KGZB 1B7FA 1RADB 1PG5B 4IG3B 1DARA 4FYDA 2QZ8A 2N3LA 4GVLA 4KE5A 2NZCA 9RUBA 5FJ4A 3CJ4A 4UOGA 3TOQA 2UUAF 3F4MA 5E0OA 3FEZA 5FIIA 2J6TA 1HQEA 4YB5A 1WG1A 5IT4A 4DV3J 4EYHB 1QVGR 2R8KA 1J5OB 2XQCA 1KQKA 2XBPA 4GKJF 3GSDA 3V6HA 2RD5C 3R7BB 3UDLA 4C97A 4JV2A 2LYVA 4J91A 1KWMA 4QOTA 4DR3F 3ZTRA 4C8MA 1OSDA 3DMJA 4Y00A 1IBMF 3BM7A 1VLOA 2B0GA 3EZUA 2HBQB 4LF4J 5LNK1 3U27A 5CABA 4EEYA 3S8SA 1T9VA 4GKKJ 4M8LA 1G3OA 4ZLNA 2GHPA 2E29A 1BC6A 1IM4A 2WK4A 1R8BA 2A6MA 2CDRB 3UW1A 3BDPA 2R7RA 3S6EA 4YQWA 4M1KA 4YY3J 2E1RA 4HTIA 4IOCQ 2ZZNA 3AA8A 5HK4A 3M2VA 2ZDOA 3NMRA 2V68A 3HSDA 1N54B 1JLAB 2ZWPA 1XN9A 3OSNA 3IWXA 3S7RA 4LBHA 5K20B 1OO0B 3VCDA 3D2WA 1NHKL 1QVFR 4C8OA 5CA5A 1Q86T 1CSJA 4KC5A 1RJJA 2J9DE 1AA1B 3HT3A 4KO0A 4ZVUB 4U96A 2BE7D 3TUJC 2K3KA 3OR2A 1AZSB 4WZMA 4M5HA 3KK2B 2CPYA 2RRNA 2MKIA 1C1CA 1KONA 3FBFA 1XWLA 2H54B 3ITHB 2K1RB 4L76A 4LVOP 2AJFE 3TAMA 2E44A 3KXDA 1X4HA 4M63A 1QJHA 4CLFA 2GNKA 3RRKA 3KLFB 3OR1B 2FLOA 3MXHP 3DU6A 2OKQA 2CQIA 5EUHA 4Q7AA 3OXLA 2F8MA 2BL7A 2F7VA 1YRXA 1S6PA 1VYAA 2MY7A 1IKWB 3VGSA 5IT0A 2V4JB 3BBBA 4I56A 4M5DA 4B9LA 3HPOA 3NGKA 3H5YA 2IVYA 1L3TA 3UO0A 1RZMA 1U6ZA 2OSRA 5BYQA 1FEEA 4ZS6A 3H2LA 5AXLA 4ZVHA 2DNRA 2OHDA 2CJBA 3UN5A 4PAAA 1TAUA 1ZPWX 4URSA 1PBAA 5IZHA 1HNWJ 2HKEA 5KFMA 2GIQA 5D4PA 1SH3A 3N28A 4NRTA 4A8MP 1L5UA 3GYGA 4OJ1A 1KOOA 3M8ZA 3CCMS 3Q22A 5I3PA 3LP1B 2Y1RI 3MMCB 2HGKA 4UQTA 4O3NA 3V4IB 3BS9A 1NSAA 3FCWA 4I2PB 2Q79A 2MB0B 4CNZA 3LP2B 1QDUB 1CC7A 4YR0A 4DV2J 3BO2A 4DBQA 4RU2A 3ISND 2LA6A 3I56S 3FC9A 3HHDA 1LWEA 1NEEA 3I87A 4X4TA 2E1CA 4URGA 4NLDA 4Z7YA 3QLHB 1WSVA 4BWJA 2HWHA 2QLFB 1TV6A 4FXWA 3I82A 2UUBJ 2HHXA 1KP6A 2R7SA 4UUWA 1FRIA 4ZK7M 4DPUA 1S59A 2E1PA 4XIUA 1WKLA 3CDUA 2YWEA 4NCGB 3J7A1 4HEA9 2XSFA 3VZHA 2V0NA 4F4KA 4KV8B 2YKOA 4OHXA 3D54A 1RSCA 1VQSA 2ZNZA 2AW0A 2U1AA 4KKOB 3FSIA 1SKWA 5HVFA 3W8PA 1DJ0A 3KHHA 4KHPF 2QG9B 5AXMA 1U1LA 1RUSA 2XNQA 4OV1A 3BEGB 1VK3A 2EG1A 2WOMA 3PRBA 4NRUA 3PEJA 3GV8B 1GAOA 2LXUA 2W4PA 4W90B 3K5OA 2HRYA 1NUEA 3TUZC 3DLGA 2JC1A 1LK5A 3I31A 1M5HA 2CPFA 2HVIA 3JXOA 1SC3B 5LJ3Y 4C0BA 3FEYB 3ZZPA 4DQIA 1YWXA 4Q44A 3C14A 3IO1A 1X4GA 3MMAB 1T05B 1ELOA 4CO4A 5H9FJ 3HSJA 3W7BA 4LIWA 3DGPA 2ZHAA 4ZVTB 1T3NA 4NLOA 4M5KA 4IDKB 2QSBA 4ES1A 1RAOA 2ALYB 1UVLA 3O3LA 2FIUA 4ECXA 4C8NA 1K44A 2HWIA 2ALZA 5F8JA 2ZJPQ 1REVA 2JDJA 3EDRB 4DV7F 3MGJA 3M05A 1YBTA 3HDSA 3Q86A 4DR7J 1JKHA 1KHWA 4USUA 4ECQA 4V19J 4DV0F 5GMDA 1HBMA 5GAEI 3QSIA 2AGQA 2G1DA 5D15A 5ITHA 2OPQA 4CLYA 3LGHA 1P6TA 4DN9A 4KT0C 3CD7A 5ETLA 5DDOC 1RT3B 3VALA 3IWNC 1NSPA 2WHOA 1U1KA 2O5DA 1S1UB 2ASJA 4YOEA 1FX2A 1VRUA 5KG6A 1CJKA 2GJ2A 1N0VC 5GAEU 2XMTA 1JJHA 1PBUA 3MM9A 4ANDA 2V2ZA 2DXEA 3NOGA 2IYGA 5EHHA 2HMIB 1XTZA 1TR0A 2LU1A 2H5IB 3NNAA 3KK1A 5J1NA 1ZAWA 2D74B 1EIYB 1IQTA 4OYAA 5B0DA 1NPPA 4WE1B 4I67A 1IBLF 2OPRB 2VC1A 2MLYA 4WCEQ 4LFCJ 3DRYA 3KLGA 1S4EA 3FBBA 2V4QA 4DQPA 3QFWA 3JSRA 4URQU 3VGVA 1FJCA 1GT8A 2KVIA 1RWKB 3VV2B 3H4DA 1S9EB 3DA3A 4CYUB 3MTKA 1V5VA 5IV4A 3G8SA 2BOAA 2JEJA 2L9WA 2C22A 2O3DA 1WD6A 4U6PA 4ED6A 3ZC4A 1XNQJ 2DNPA 2ZBCA 2Y1IA 2NUHA 2G2ZA 1DAXA 4Q8EA 2VODA 2OLWA 2V8PA 2HS3A 2I6WA 2ZJRQ 3ZO7A 1AXQA 1QE1A 2QC3A 3QIPB 3W62A 3M32A 4FF1A 1H6KX 3BGFA 2E7WA 1FFWB 3PR5B 1APSA 5EX0A 3RU0A 2RILA 1JJ2R 5DQHA 2MKKA 4TVAB 2ZZTA 3TJAA 2H51B 2HZVA 4DR6F 2IAJA 2KG0A 3G87A 1QSYA 4HHHA 1N5VA 4M5GA 5A8KB 5FDLB 2IBOA 2F9JA 2KXFA 2MKHA 5LM7E 2MZ1A 4MIAA 1R43A 2FQQB 3CD5A 2CRLA 2OH2A 4DCOB 4HEA1 3OHBA 4LJMA 1EB0A 2MQMA 2QE5A 1QTNB 5K8PA 3JYTB 2UU9J 4O3SA 2BJ7A 3C16B 2NXJA 1RT7A 4QIFA 3OVSA 1ITPA 3FFIA 3QNWB 2B4UA 2V6EA 4LF6F 3IAM1 2QSWA 2D9PA 1VOMA 2IJRA 3POTB 2UXDJ 1JLEA 3TZZA 4ZVOB 3MM7B 1QSSA 2I0XA 1VR6A 1HBUA 1I94J 4X65F 5KFFA 2P8IA 4DR5J 4DR2J 2E5IA 1YO7A 2Q43A 3KMQA 3MM6A 2XLIA 5E5NA 1DQAA 3HT0A 3CB4A 1JB0C 2Y0BB 1RHUB 2CQPA 2WVFA 4DDFA 1UMJA 4JI0F 1HI8A 5AXKA 1I1GA 2VDHA 2VPYB 3QGGA 1MG7A 5HLFA 2LMIA 3Q0AA 3LWLA 1FKOB 3MF5A 2AF6A 1C2PA 5B0EA 4DL0C 3I6PA 3G86A 1IKXA 2CVEA 2RADA 1JJCB 3D28A 5HMZA 1M5SA 3DM2B 4LFBF 4FF4A 2DGXA 1U49A 2F66B 5L46A 2ZD1A 2XTQA 1TL7B 2BJ8A 3OL6A 4LBIA 2IM2A 3EGZA 3AXMA 4QPXA 2AKWB 3EM1A 1F5BA 3NL0A 3R8YA 2HFNA 5IOLA 5K5MA 1IJEB 4PL4A 1HYSA 3T5LA 2QEXS 4LBPA 4AE5A 1S1XB 2DNNA 3M2RA 1FCAA 4JBCA 1CVJA 2EXUA 3KJNB 1K47A 1E6VA 2MQNA 5L1LA 2YH0A 1REGX 2D3ZA 4WYLA 4DSKA 3ICLA 4JI7J 6AT1B 1HHTP 5CAAA 2IVMA 4GXTA 2H48B 1HARA 4ZHRA 3OL7A 1X4BA 2UVWA 5HQLA 1LNQA 2EK1A 2BM1A 3G6ES 4K50A 4DL4A 2EC2A 2ILZA 4UOHA 1FD2A 4A8QA 4QR0A 1OMSA 3DHXA 1TL1A 2R9LA 2NR0A 3D0GE 4TU9A 1KDNA 5AJ3F 5IXUA 2C3OA 2LQBA 1C1BA 1T9YA 2R4FA 2IIHA 1CJVB 3K5NA 4DL3A 4NA3A 3HX9A 3PHEA 2FLNA 1RU2A 4LRCA 5FD1A 2FJWA 4P52A 4K8RA 5A2QU 2C2OB 4GO5X 1T03B 2VFSA 1U6FA 3G82A 1NK6A 2VONA 3Q89A 4O44A 2J8SA 3ELHA 2NXEA 4RNHA 3V6DA 3CCTA 2C2NA 2PT0A 1UFLA 1X9MA 4W92B 2PFDA 2XEXA 3LH2S 2ZFHA 4EI2A 5BR8F 4QWEA 2UVRA 4GMKA 4LFAF 2HNDA 3HD2A 4R0EA 3BR8A 4IO1A 2B6AA 2LQ8A 5DM7Q 4HTJA 3OTBA 4CM2A 5H1SV 5DG9A 2M52A 2AMCB 4RW8B 3MUMP 4R5PA 3PYDA 3C15B 2AT1B 1MU2B 1H2VZ 3MM5A 1Y7PA 3KP9A 2B4VA 2HHTA 2GVZB 2FY8A 1U5KA 2EVZA 1LWCB 4C8YA 5HBMB 1TFWA 3EGVA 1XMOF 2C3UA 2CQ4A 2GX8A 3KJVA 3AH6A 1R3NA 3RRGA 1OQ6A 2HVEA 1T9UA 2ZM6J 1VQPS 2KRRA 2KXHA 4ZLLA 4WFBQ 2AGOA 3PFOA 3IM9A 2V6AA 3OFFA 3MEGA 2FVQA 4P9SA 2RQ4A 4U67Q 4HDHA 3DA4A 5HVGA 2JC0A 3W9HA 3ET6A 4J9MA 3DRPA 3GIIA 5F3ZA 1YTYA 2NSCA 4KSEB 4RR5A 3SQGB 3OW2R 2DGWA 4ECWA 2XO6A 2KKMA 5CH7B 1WC3A 5KT5A 2ROGA 1RTIB 1YX2A 3TVZA 1SJRA 3CJRA 4GO7X 2VQEF 4NMXA 4FYWB 2MZSA 3GB0A 5IQQA 4PWWA 2OAUA 4TQSA 1N8RT 1HNXF 1X5OA 3PYEA 1PILA 3RTVA 2OD4A 3L3CA 4H4OB 1N32F 4CM0A 5JJBA 2DEJA 3ONQA 5F8NA 3CD0A 2OSQA 4NYZA 3IN5A 4WP9A 4JI3J 1NDPA 2XO7A 5D6GA 1L3KA 3MMBA 3SSQA 3FQLA 4CH7A 4TLQA 3MD1A 1HQEB 1SUQB 2M3DA 4ED0A 3FK4A 3AD8C 3NAHA 4AS2A 3VZIA 2IA0A 3V6JA 3HSGA 1JQOA 3DRRA 4RW6A 3Q8YA 4N8NA 2YPYA 2EKNA 2R42A 5KFXA 2RKIA 1DQ8A 3KHGA 1RISA 1HBOA 1XIQA 3V5RA 4TN2A 1VQMS 4ES2A 1H74A 4I2QA 4DR4J 4L73A 5KFZA 3DMJB 1KTVA 1Y9OA 2KM8C 1U24A 2L48A 4FBUA 4X62F 1KFSA 1NZ8A 3MR6A 1XR5A 1S9GA 3CJTA 2JLGA 3RB6A 2J7UA 3CCQS 4DSIA 2E8GA 4YDDB 2LP4A 2G9OA 1U1NA 1BQMA 2YWFA 4QIGA 1CLFA 3M2VB 4ALZA 3LTOA 2DBBA 3CJ2A 4YZCA 3PW7A 3CDBA 3VF0B 5C25B 2KFYA 3IG1A 1RLCL 4DU7A 3UITA 3PACA 3I9V1 2OUGA 2UUCF 2HQCA 1V3RA 1IQZA 3SCIE 1VQ4S 1FKAF 2DY1A 4KO0B 1K0VA 3OR2B 3CMAS 4M5JA 2E66A 2DR8A 1C1CB 5HP1A 1Z1ZA 3AJDA 5I42A 4PZVA 3PHTA 1UAWA 3G9CA 2D3O1 1GMWA 4TYAA 4IR9A 3M8WA 1S6PB 3SCLE 3VAGA 4H4MA 3MOJB 1IWGA 4PPZA 3M9NB 1IBKJ 3QBCA 1A6LA 3A1YG 2NQPA 2X1AA 4I1TA 2HEKA 4U8YA 2R2UA 4ED7A 2P9CA 2ZKTA 4DR1J 4B3RF 3AXKA 2FJXA 4DFMA 2L08A 1QAYA 5EWGA 4USTA 4OI4A 2OO4A 5LJ5Y 1TUGB 5IWAF 1NH7A 3R3TA 4MIBA 4C4WA 1ZM3A 3H20A 2BZ2A 4QR2A 9ATCB 4O23A 1WHYA 2DIVA 2VICA 5HVHA 1QLNA 4J9QA 3T9NA 1BQXA 1ZTTA 4KYZA 2D9OA 3QGIA 1WC5A 1W25A 3M8QA 3CCES 4OV6A 1LWEB 4ILLA 2RLDA 2ZH8A 1FWLA 1UW9A 4NPOA 1GFWB 2JFKA 3GJRB 1PGZA 5LMUF 2WW8A 2W4CA 1KN6A 3GP9A 3P5BP 2XY7A 3PW2A 1RWWB 2QLJB 2UXBF 3B78A 2R8HA 4DL7A 4OLOA 1CC8A 1WF2A 3KLHA 3K2YA 3KUGA 1BWEA 1UA0A 4AYBD 2F1FA 2BR0A 3LJ1A 4ECTA 2YKNA 5HJXA 3QMQA 3OL8A 1SJQA 2AEMA 2WOMB 4I0WA 2CXEA 1VBKA 4PEOA 4CWBA 2E1MC 4J9SA 4ELUA 3DLGB 4UW2A 3IBFB 5A6WA 1HWLA 2YKPA 3RG6A 5ETOA 4NV5A 1XJWB 1VQ6S 1JWWA 1UP1A 2LEPA 3DGPB 4O3OA 2QFIA 1YK9A 4A8XA 4G3IA 1RB0A 2CVIA 1R8PA 2CPDA 2YH1A 1FVSA 1EX8A 3H40A 1Q7YT 4LF8J 2XMKA 1REVB 2DH7A 3CT9A 2GFFA 4PXBA 4WXWA 2RU9A 3RR7A 3ENWA 3ENQA 1EJ7L 3KNAA 5ETVA 3MR5A 2DTJA 4TNOA 1HBMB 1HWIA 5E41A 1FRMA 1O51A 2VA2A 3RRHA 4PRFA 2OPQB 4P7VA 4B3TF 1F9EB 4CRJA 4WTOB 2R7XA 1DTTA 2HVHA 4DF4A 2AYGA 3QATA 4A8WA 2AX0A 1N5SA 3PM9A 4FYYB 3BGUA 1FTRA 4DLGA 1HD0A 2F63A 3H4BA 2VG5B 3CCVS 1CJKB 2MDAA 3W5YA 1O6XA 1VI7A 3MM9B 4Q0BA 4NXNF 2CDQA 4I68A 3EMTA 4ECRA 2RS2A 3KK1B 3QT8A 3GYNA 2C2RA 1HNIB 2W24A 2BABA 2JEGA 2QN6B 3JQJA 4CLZA 4NZ7A 2DNGA 1UWBA 1KQSR 2Y9HA 3MMJA 2XNRA 2V1CC 2W9CA 1MROA 2XLKA 3FUYA 3UR3C 1FJ7A 3MEKA 5IQ6A 1WEYA 2ZH9A 1S7IA 4GVBA 1K1QA 1PYTA 1NK4A 5KG0A 4JP8A 2CJXB 3MOZA 5J2PA 2J7KA 3HVTA 3K17A 4LRDA 1VJQA 5ETNA 4RUHA 4FS1A 4NLRA 2IM0A 2HZCA 2OEKA 1SI9A 2DCUB 2OPSA 2A1BA 4CP5A 1U6BA 4NCBA 5I4MA 2PN6A 4DUZF 2OELA 1S1VA 5F3TA 4D3HA 2HQIA 5KFUA 2QLXA 2GSCA 1M1HA 3OLAA 3N01A 2ZOMA 1VRQC 5C42A 2BQUA 1HR0F 1QE1B 4Y2KA 3K59A 3M32B 3UDVA 4CH1A 3CCLS 1UPMB 3THPA 2PSZA 3CTRA 4IOAQ 1X4CA 3MEDA 1WF0A 3H42A 2FB0A 4ECSA 2BJEA 3R6LB 1KD1T 3BR9A 4ETZA 1TKDA 4P74A 1TL3A 1PYSB 3LF0A 1H38A 1NDLA 2RE1A 2Z58B 3IBCB 2IAJB 2F5GA 2YWKA 4J7CA 4ICLA 2JHEA 3CCJS 1SJ8A 2J9EA 1TKTA 2AEJA 3PW0A 1FXLA 2MJNA 4DV6J 3L0IA 4ED3A 3P4UB 4ZJLA 5GVQA 3PKYA 1F2HA 5LMNF 1YDLA 4FVCA 4IOBA 2W4DA 4TXSA 2L41A 2DGOA 4WBFA 1SJ4P 5J2MA 2RJZA 3V2UC 2V34A 2B9YA 5H9FK 5GMEA 2AGPA 2HGMA 4TKTA 3C2PA 3BBCA 3GR0A 1FNMA 2C42A 3Q8DA 1HPZA 1RT1B 4HVZA 2DGQA 2W9BA 1JLEB 2QA4S 1YSJA 4JV1A 4F50A 3UI3A 4PPDA 3P6YC 3IR6B 1QAJA 1TL5A 1GK8A 4DV1F 3DFEA 3N79A 3CMQA 2KXNB 3KNGA 1JLGA 3I5BA 4RNFA 2ATCB 1TKZA 3M30A 5KOWA 1VMBA 3SDEA 4EUVA 4OJ3A 1FK9A 3HJVA 1OPZA 2C2KB 5JUMA 2BX6A 4N8OA 4UQGA 3K0JA 4QYZJ 4EGLA 2IC3A 5JVHQ 3IA0A 1CBKA 4G1QA 4I7FA 5HLFB 2JB2A 2MPUA 2M4MA 1I3OB 1JLCA 3GG1A 2W7PA 4LF5J 3DCAA 1ZZFA 3BPDA 1IKXB 1IUJA 5HMXA 2JVRA 3NS6A 2GHVC 2ZD1B 5CZVA 3QWPA 4IRCA 4LR8A 3T1YJ 4E2FB 5CD4A 1YZ7A 2V50A 2MKSA 2M70A 1HHQA 1FNOA 2Z2MA 2R3VA 4B3SF 3A3NB 2UP1A 1PJ7A 5B08A 4BWMA 1HYSB 3RGIA 5BYSA 1H72C 4U8VA 3TARA 1NKEA 4QCLA 2ZH3A 2LDYA 4FN5A 2KVQE 2QX0A 4CLSA 3SV4A 3M2RB 4Y0FA 2IM1A 2HFVA 1E6VB 2RHQB 5K8NA 5KT7A 2AP6A 2HFUA 4NLSA 1KOHA 2BJ1A 1U25A 2WBRA 4ZHRB 4ED2A 5KT4A 5D8HB 1GEHA 4YN3B 2XCPA 1WACA 4W98A 3NGTA 1TL1B 1UCNA 2D7SA 4ZLPA 4YS2A 4DHVA 3OT9A 1R6VA 3QYYA 4DQRA 3CCSS 1Z2ZA 3VTIA 1RWMB 1C1BB 1IBCB 2H4YB 2HS4A 3J7YI 4OJGA 3W66A 3I5AA 3PX0A 2AYBA 1LFPA 4HYKA 2PEHA 3L7UA 1FD8A 4U7UD 2KM8B 3PXGa 1RAJA 1N5YA 4FP9A 4YDXA 5L8RC 3G82B 1PAEX 1ZH5A 3CCRS 1UJ5A 1S48A 2UUAJ 3J7YU 2PGCA 4B9TA 1T02A 1ICEB 3GIMA 2AQ4A 1JLBA 1PCAA 3V6DB 3EICA 4G75A 1M5OC 1AB8A 1JXVA 2C1EB 1KRPA 1JXEA 3IR7B 3OUYA 5KFIA 4Q2LA 3LP0B 3FRYA 5KOXA 2ZHOA 3RBEA 1TZ0A 2RSQA 4PYDA 4GKJJ 4J37A 1RT5B 1T95A 2B6AB 4WU3A 2F4VF 3VWSA 4DR3J 3C3LA 3TJ8A 1LK7A 1IBMJ 4CZCA 2WSEC 3OTDA 3CDWA 2BM0A 3IFEA 2XYGB 3NS5A 4R5PB 3M6XA 3MM5B 4AQYF 2GVDA 3GPAA 4C7QA 2ZC3A 4HR2A 3VGUA 4QQBA 2BOPA 3G2XA 1U1PA 3BZQA 3NRBA 1VQ8S 3KJVB 3NGRA 1X9SA 2CJYB 2CJ9A 8ATCB 4PG6A 3R7NB 3R1LA 3N9UC 4IUFA 3I32A 1RKIA 4QIWD 3ZZZA 2I9SA 4PG7A 3GJSB 2HW3A 3W1YC 1N0UA 2HAIA 1F5AA 1HMVA 3ET6B 4NWBA 1U4BA 2XS2A 1TMJA 2ZW3A 5CHCB 1AFIA 3KFWX 4DSFA 1RTJA 2VASA 4B9SA 1M90T 2CQCA 2YTCA 2VQFF 2VJVA 2ZUGA 2B5JA 5KFQA 3THVA 2XMWA 1BGXT 5ETRA 3WQPA 1LQ9A 1RYRA 2QZGA 5F8LA 5BYRA 2HQFA 4BHQA 1VIOA 4LF1A 3BKTA 2O1PA 3LJ2A 1S6QA 1NLKL 2C2EA 1SB6A 2H5JB 2L1LB 4KIAA 2FHJA 5L9XA 2IFXA 3MPVA 2OPPA 2LKZA 2MQPA 3TANA 3VR1A 1HQ2A 4PABA 3RYLA 3VAIA 2IBKA 2W2MP 3PNIA 4LMZA 3KOAA 1IKVA 2QL7B 2DHAA 3MR7A 3FBCA 1TTHB 2I5JA 1Y00A 3C19A 1ZOTA 1LWFB 1TAQA 2QA4G 3MMBB 4R0JA 3QO9A 1IR1A 1ZM4A 2ZBPA 2RU3A 3EVOA 2A3JA 5LXYA 3RAQA 1WTFA 2Q3PA 3ULHA 3SIPB 2HGLA 1U47A 1RTDA 4C11A 3DRRB 1CEZA 2B43A 3HHLA 1HBOB 3OFEA 2UUTA 4I2QB 1NKCA 1OSCA 3A8IA 4QWCA 1KVKA 2XHCA 1N5QA 3G4SS 1VQ5S 4XAKA 3WIUA 1Q8BA 2KO1A 4RBVA 3KUEA 2K8GA 4NI2A 3T41A 3ZZUA 2H1YA 4M5LA 5HAOA 1TL4A 1HHSA 1NU4A 4X66F 1JLFA 5J2NB 2M7SA 3TZWA 2M88A 2G2OA 3GFXA 3QT6A 2XI2A 4FXVA 1YRUA 2GJFA 4NLYA 3D6MB 1BQMB 1HFEL 1SH2A 1FJEB 4O4RA 2WBMA 4UUXA 4KHPJ 3AFGA 5DDQC 3D66A 1IR2A 4O0NA 4OYXA 3V81A 3KMSA 4V19X 3IG1B 2R7VA 3GIRA 2F8HA 1F3VA 2EEYA 2XMUA 4QBUA 5KFHA 4K5RA 3M6VA 4G6VB 4Q2MA 1U09A 4IQXA 3VAJA 3SV3A 2CZVC 2WCXA 2O01C 4S0MA 2RH3A 1ZS6A 4DCPB 1HI1A 2QL9B 4K4SA 4CLWA 2QO3A 5HP1B 5ADZA 4I6WA 2FUG9 2CPEA 2YXLA 2PEBA 2FD2A 1YJNS 2NYHA 4IH5A 5CYMA 2W2QP 2HK3A 4ZVGA 2NPIA 5I42B 4JYAF 4NZ6A 3ZNUA 3IMQJ 3NAIA 4C2MA 1X60A 3GJTB 4ES3A 2DEIA 1Z2LA 4DV7J 5KG4A 1WHXA 3D67A 4EO8A 2FGOA 2V8GA 3D3BJ 3FVVA 1OPIA 3ETOA 4KBIA 1RYSA 5BJRA 4DV0J 4NE9C 2Y8WA 1VBXA 3BYPA 3K5LA 4ZPBA 3M8PA 3F41A 3HHKA 3K8VA 2CPIA 5F8GA 3W9JA 4UZBA 2FJDB 3UCUP 3CJKA 4O3QA 2F8EX 2KYZA 1X5SA 3MCMA 4XPCA 4CO0A 4ZIWA 2M9KA 4LT6A 4DV4F 1RCXB 2VHGA 1XR7A 4NLUA 2CNNB 1C0UA 3H8YA 2CJAA 2HAFA 1IBLJ 3HCXA 3C46A 3KUHA 2FZGB 1MN9A 1OWXA 3PCOB 3H90A 2CPJA 3H98A 2P22B 2NCKL 2F6MB 1YQHA 3AJ2A 1JK9B 2QRRA 2UVVA 3UVJA 3DDNA 2CWXA 4P75A 4PL5A 4G1PA 4JI2F 2OD6A 3NGSA 2PC6A 2YQ3A 2CQGA 1FFSB 1R27B 1KQFB 3AD7C 2DPJA 4P6QA 3VVTA 5CXTA 1IJFB 2VG6B 1FWKA 4B3OA 2BJDA 3ZFVA 4ECYA 2QYGA 3JSYA 3HHLC 2YKNB 4DS5A 3I96A 3Q8QB 4OZNA 2QA1A 5AE3A 3FSXA 2NYIA 2RS8A 1XEZA 1KSPA 1RBOB 4IR1A 3K5MA 2X1FA 5E33A 2R8IA 1KQGB 2CQ0A 5A0YA 3M8SA 1W26A 4ECUA 4OZLA 2CFXA 4K4XA 1FJGF 3VAFA 5B0FA 3E8OA 2HNZB 1T9WA 3MHYA 5IT9U 3Q8PB 2ZOFA 3VAKA 3UE2A 4MYTA 3Q8RB 1K1SA 4I64A 3IR5B 4RW9A 1LXJA 5A6PA 2F65A 3P8BB 3UWTA 1VQ7S 4HKQA 3CVKA 3SI8A 4RUAA 4DPOA 3UD4P 1QTMA 5DM6Q 2DHHA 4OZ2A 1RHQB 3C6TA 2XWXA 2AD9A 2WONB 2Z2ZA 4JI8J 4JI4F 2E5HA 2FJBB 2WVCA 4CTAA 4DWLA 1B3TA 1D09B 4DL6A 2HNYB 1RTHA 4CO2A 3OTEA 1FVQA 2QMXA 2E9TA 2JWNA 4OHWA 3EWGA 1DLOA 3NLCA 1DTTB 4GC6A 2KL8A 3AJ1A 2YNFA 4LF6J 1SKSA 2VBYA 3EVWA 4P2XA 1MSWD 2RDJA 2GIFA 3DYAA 4CT9A 2N4DA 3DLKA 5EDWA 4NEYA 2VZ9A 4CIOA 2M5YA 1CJUB 4ZP6A 4Q0BB 3TZXA 5G0RA 1RAFB 5ETPA 1IXKA 5ETQA 4EZ6A 3MPWA 4LQ3A 5EN1A 4JV5F 5H9EJ 2FUG1 3GR1A 1UWBB 2PDAA 4CI0B 4MKVA 3T5KA 3R2DJ 4ZCIA 3HJFA 2W9CB 1MROB 4ZKAA 1F60B 3DLLQ 3P45B 4MYUA 1HWKA 2QGMA 1V3ZA 4RW7A 2ADCA 2OFGX 4ZPCA 4GVBB 4XDDA 4LSZB 1N34J 1U2RA 5J2PB 3DLEA 4DV5J 3M6UA 2QV6A 2MHEA 3HVTB 3L4BC 2BEFA 4B08A 1J5EF 1D8ZA 5LL6d 3QQCD 4LFBJ 3TO8A 2OPSB 2W9AA 2C3PA 5I3UB 1ZAXA 2VG7A 2N3OA 1YJWS 2YNIA 1J5OA 2U2FA 2MZRA 2JRSA 2K2PA 5ETSA 4K0KF 2E1AA 3H7HB 4QIVA 3R5DA 4AUKA 4YB6A 4QWBA 7FDRA 1VC0A 4OI1A 3WX8A 2EW9A 2C28A 3P96A 1NJXA 4C3MA 4EWTA 5HSPA 4ENOA 1D9AA 1LEOA 4ICLB 4F0KA 2M8DB 2MQ8A 1TKTB 2B7CB 1SH0A 4RX6A 3A13A 2CQ1A 2J8AA 3DOLB 3LQVA 1B7YB 1N6QA 3GILA 5L1KA 3UCZP 2DNQA 2RRAA 1M1KT 3HHNB 1DFDA 1UZHA 2CQ3A 1JNRB 2ZM6F 1Q79A 4ANCA 2BYCA 3BDEA 5J2MB 3RBDA 4C0HA 2RDDA 2YKQA 2KG1A 1FE4A 2DO0A 2MGZA 3O2IA 1HPZB 4IG0A 2HQDA 4NV2A 4WK1A 4MKAA 1JMTA 1L3VA 1U1OA 4NYOA 3GZ7A 5LOQA 3ITHA 2P9GA 4WKYA 1U26A 3CJ8A 1PAUB 3BH6B 2HS0A 4HI1A 2KRBA 1V6HA 1JLGB 5E2QA 3NG8A 5A8RA 2XM3A 7FD1A 4KH0B 5BR8J 1S79A 1TKZB 2CG4A 2RUSA 4G76A 1LXNA 4LFAJ 3M30B 2KH9A 3SDEB 3OL9A 1N88A 5K8MA 2NS1B 4J9KA 2VU5A 5HROB 1FK9B 1WF1A 3G6XA 3UN3A 1IKWA 1UFWA 1VBZA 2MQLA 1F2GA 3NMAA 2VH7A 4QU7A 4BC7A 1KR4A 2WSCC 4G1QB 5E3PA 4I7FB 4CT8A 4LF9F 2RF2B 1JLCB 3TNVA 2LQ9A 4HFVA 1UEKA 3MEEA 2C2ZB 1NBEB 4XPEA 4YB1P 1VS3A 1AYEA 3JAMU 4ILMA 1FEHA 1XMOJ 1SIWB 3MM8A 3BSAA 3A3PB 1VHIA 3CF5Q 2DO4A 2VPZB 5JXSA 3RBZA 5J2QB 1CPZA 2BMBA 4MAKA 3ZTOA 3PW4A 4C3LA 1DTQA 1ZA2B 3V4IA 3DXSX 3KG0A 4OHYA 1MW7A 4MMOA 1RBLA 4CLKA 5F8IA 2WVEA 4KB7A 1YIJS 5D0EA 2CNLB 1VLYA 2G0IA 3IGNA 2YPZA 3TUPA 3FMBA 3IAS9 2HPUA 2AJ4A 5HJYA 4JV0A 1Q82T 1YJVA 4Q8FA 2HVZA 1UVKA 2WAQD 4PQUA 1JJ4A 4QPTA 4USVA 1FA0A 2HQGA 5DDPC 3ZZTA 4DS4A 1R0AA 3R5GA 4NCGA 3TUIC 2DNMA 5KFRA 3SMZA 5K14B 4N5SA 3HM9A 2VQEJ 4KV8A 2EFOA 3NCQA 1R8AA 4Y34A 4YZ9A 2IP6A 2MZJA 2KU7A 3TWZA 1WWHA 5MLCV 3B6BA 1YJRA 3KDOA 1S0MA 1HNXJ 5DLFA 2NXNA 2NLWA 4JI5F 4MT1A 2UV8G 2APOA 3QRRA 3E01A 2MJUA 2V8VA 4MKYA 3L7OA 3BN4A 2HHQA 1RWUA 4PR6A 4P2FA 3DRSA 2HHHF 4RNMA 4NXMJ 1N5YB 2RRBA 2X3GA 1GXUA 4USMA 5E3CA 4DJBA 1T05A 4J9NA 3U1MA 3TRGA 1ZZNA 3CIMA 1JLBB 3VAMA 2XMVA 2PIIA 1S6UA 2Q6BA 3J7ZT 2Z8QA 3OFHA 4M95A 2R7TA 1Q8LA 4ZP9A 2KT2A 5T14A 4A8YA 3LAMA 3HMJG 2B56A 4Y2CA 4AL7A 2MYFA 2MXYA 2V69A 2OJ3A 4XO0A 3TA0A 4B3MJ 1QAXA 4DPWA 1M5PC 1GTEA 1ZETA 1RHRB 3J7Z5 3GE9A 3QZ8A 4A48A 3OHAA 4IH7A 4MK9A 3WX4A 5KFLA 3TA2A 4HHJA 4DZDA 2KTQA 4O3RA 1UKUA 3AOCA 2CQDA 1Q8IA 5DQGA 1XNRF 2D1CA 5DQIA 2E5GA 3M7VA 2XULA 3AY0A 3RZAA 3LGMA 5KFTA 2YNHA 4J9LA 5D4NA 1ZTWA 3RAXA 2DXFA 2ETDA 3DN9A 2BACA 1SL0A 2BXJA 3T6BA 3PJXA 3BKUA 4RBUA 3DI6A 4QYZK 4RPFA 1NMEB 4F2SA 3OTCA 2PA3A 2OPRA 3HZGA 2GC8A 4EBCA 5F41A 2ERRA 3GFHA 4DSEA 4FNIA 5HO4A 2B9EA 2ZBQA 4WYWA 3HZEA 2UUCJ 1HMVB 5RUBA 2ZWOA 1CG2A 4DG1A 4Y65A 3W63A 3IXQA 3TW0A 4AXIA 1RTJB 3OBIA 1FDDA 1U7LA 3MECA 2F4FA 1U1RA 1O0PA 4KH1B 1UJ6A 2B5JB 1RA7A 4ZN1A 4W4MA 2X7IA 3X3UA 5JVGQ 4B02A 3GV7B 1N33J 2C2DA 2P9EA 2MQQA 1S6QB 4FPIA 4WF9Q 1CULB 2GO9A 3QIPA 2XI3A 1URNA 3TZYA 4YMEA 4ELVA 2JAEA 1WEXA 5B0AA 1MLAA 4OJHA 3W2VA 2ZBRA 3I0RA 4R8UA 3HVRA 2B9XA 4RNNA 4MJKA 4B3RJ 1F6TA 3IAS1 3WBZA 2I5JB 4EFAC 3J80Y 4OIXA 2VV5A 2LCWA 4OX6A 4F4ZA 2YQ0A 3BQ0A 5IWAJ 2RVJA 4YB7A 4TU8A 3EXYA 3CJ0A 4ZVEA 2R2RA 3RAMA 1RTDB 4C11B 4GC7A 1RT2A 1D3WA 2BE2A 1G1XA 1P9YA 4UT4A 2GHWA 3HHLB 3C16A 1Y11A 3HF5A 1RWPB 4YUDA 2AX1A 3GIJA 4WU2A 4OZ5A 4PWDB 3RB3A 1K9MT 1Q5VA 2PI4A 3HD1A 5HMWA 4NI2B 1HQUB 1NK0A 5KFYA 3KK3A 2F9DA 3M2UA 1JLFB 5LMUJ 4M5MA 4AL5A 4ZPDA 1KLMA 3MM7A 1UEVA 1Q78A 3T1HF 8RUCA 2UXBJ 1GXTA 5K9FA 4JI6F 2GMLA 4ED1A 1KS2A 1KFDA 1PKUA 2PMHA 2PO4A 2MHNA 3KG1A 3CUNA 3V81B 2ACYA 2AV5A 2J7WA 5JMNA 1UPPA 1S1WA 2VOPA 3P49B 1CS4A 1H2TZ 4E98A 3SCKE 3JTNA 1FE0A 3D1OA 3W5ZA 5C24A 1HL6A 1H7WA 2YKMB 3EDQB 1KNZA 4ZP7A 1EP4B 1WDTA 3ILIA 2ASLA 2AJ1A 1VQ9S 2XB2D 1YJUA 1RP5A 1NHVA 2D41A 1BD6A 4IYQA 4WFAQ 2MKCA 4KTQA 3IP0A 3UR0A 2PMWA 2BKOA 3DLHA 2FJEB 1SV5A 4WKRA 4Y3CA 4KR0B 2VKZG 3AOBA 3MURP 2DHSA 3SDJA 3KTQA 4Z7HA 5KFDA 4C8KA 1ZA1B 4B3TJ 1S0VA 3M6WA 2G13A 3GTYX 3HHEA 3BSCA 2Z4PA 3DLJA 1RGVA 4CQ1A 3EX7B 3PYFA 4X4SA 4NXNJ 1C4CA 3KKFA 5E3QA 1SC4B 4YHHF 4OYZA 3T19A 4Y2MA 2R7UA 3W5XA 2R7QA 3V6KA 2JEIA 2OMLA 2RDIA 4ZVSB 2BANA 2XG8A 3JTPA 5HMYA 1TU0B 3EYZA 4ZITA 5BXIA 2B4OA 2C3MA 3G8TA 4KQZA 2ZVSA 3RJMB 4IFYA 2EKYA 3AHPA 1EZZB 2JB1A 4QU6A 2DYAA 3TAQA 2RQCA 3UVJB 1RAIB 2W2OP 1JIHA 3GG0A 4OQJA 3DOKA 3DLBA 1BUXA 2CQHA 2W1BA 5CD4H 1GNKA 4LUBA 3AQPA 3KJFB 2B8PA 2R8GA 1OYEA 4N76A 3EVMA 5M2PA 1NK5A 4DUZJ 4L3NA 6FD1A 3MAQA 4N77A 4MFBA 1Q1KA 3PX4A 4PXDA 4ER8A 4Q45A 1WEZA 4B3OB 4KGVB 1P8GA 3PYGA 3NGDA 4RLEA 1HR0J 4OFZA 2YKAA 1RWOB 3J7AN 3T5JA 2HHSA 1PJ6A 2J76E 2K06A 1R0CB 1TFYA 3GONA 1FRHA 2ZH6A 3CXCR 1KC8T 1KVJA 2GW8A 1S97A 5EWFA 3C15A 4WFZA 3KDNA 3NP5A 1KKHA 3TAPA 5CZXA 4OAVB 1HBNB 4OYOA 4F3OA 4ZMMA 4H4KA 2OIHA 1NH8A 3MCNA 4PCQA 1P1LA 1LWCA 1J27A 2ZHBA 4RW9B 3GFYA 2Y1JA 1XMQJ 1T9TA 5A8WA 3R9LA 1P9QC 5KFGA 4KHRA 4A8OA 4Y6IA 3BGRA 3NBPB 1RCOB 2QT7A 3NS7B 5LMNJ 3WZ0A 3WDOA 4CTAB 2PD1A 4AD6A 4RUCA 1RTHB 2WW4A 1DLOB 1QUVA 1SXLA 2CZ4A 1SVDA 2ZUAA 2YNFB 2B4PA 5KFWA 2EPIA 1UL3A 4RBTA 2PFFB 1SJ3P 1UVNA 1H7XA 2V8DA 3EZ5A 2UV8A 4AL6A 4EK2A 1U2FA 3M1VB 2WB4A 2JL9A 1KTQA 3CJ5A 5G0RB 2R7WA 4DV1J 1VFJA 3E3XA 3WHIA 4U7UK 2IY5B 2W7AA 1U45A 3EGNA 3JS9A 2EK6A 3U1NA 1QSLA 3NEKA 5KFSA 4KFBA 3FBVA 4DPYA 4KAIA 1GX5A 2L9NA 2KFZA 2FGCA 4RW7B 4LRFA 1RT4A 1V9OA 1SC6A 2YWGA 2IMWP 2V2KA 2LVWA 2FHKA 3DLEB 3WIVA 4BC9A 1YI2S 4RNOA 4P7TA 1FX4A 2MY8A 4P73A 5KT2A 1RABB 4HH0A 4UY8T 2IDLA 2ZE2A 2XGPA 4DQQA 3PX6A 2WSFC 3B4DA 1NK9A 3R7SB 1Q5YA 2I2YA 5SUHA 1SUQA 3UPFA 1BMQB 3VQTA 3OJSA 2VG7B 1R7IA 4UY85 1RTZA 4C0OC 2YNIB 4KPYA 3AQOA 4B3SJ 4NX9A 1BQNA 1RWNB 2EC0A 2DVIA 4HACA 3W3SA 4QYRA 3NKYA 2WRMA 3IRXA 2QLWA 1SJ1A 2HFOA 3MR3A 4ED5A 3GU0A 3PIOQ 1GMWD 1RXOB 1DY3A 3GCXP 1D9FA 1SIZA 2V4RA 4K7QA 5L39A 1T94A 3I0SA 1GH8A 3LGNA 1NK7A 3AB2B 1N56A 1WG5A 2DY9A 3CC2S 4USJC 4QW9A 2SXLA 5D4LA 3OVBA 2K7JA 4F4WA 1N6QB 4RL1A 3EPGA 2IJNA 2XZDB 3ZTQA 2DGUA 4X4QA 1UVIA 4D3GA 4ZPTR 1XK8A 1B99A 4X64F 5C25A 2FYXA 1OY6A 2HIYA 1M0SA 4MK8A 2BVZA 2AEFA 2MGZB 1HD1A 1N36J 2YVSA 1F9HA 5HATA 3N5FA 4IG0B 4H4KC 3HKWA 1TK8A 4B9VA 1UA1A 5U47A 1R31A 2YNGA 4P71A 3OVAA 1OJ4A 1RHKB 2MQOA 4OL8A 4ZPVR 4FS2A 1G6BA 3OTOF 3CO9A 3IBWA 4ED4A 2Z30B 3SZ2A 5KFNA 2XY6A 5CCMA 1W2IA 2QMUB 3HXMA 3K57A 4C6AA 5A8RB 1T7PA 4NL5A 3HI9A 5L1IA 1A9NB 4U7CA 3TAMB 2KJWA 3K89A 1BWVA 3QFHA 5B7WA 3B8HA 2VFRA 2F4VJ 2A18A 1VBYA 3OSPA 4G65A 3WC2A 1YBAA 3TYTA 3A8KA 3CJQA 4KGMA 5KFEA 4AQYJ 2XYPB 4OX9J 4YP3A 4F36A 2DISA 5H9EK 4RW4A 2MSTA 4WFXA 4Q5VA 1YJ9S 3MEEB 5KFVA 2OP5A 3TP2A 2KT5A 1HIYA 4JB8B 3D6TB 2VDIA 4M5DB 3CO0P 3O6QA 1RWXB 2GZOA 2ZH1A 4DUYF 3DC2A 3MM8B 3EPIA 2C2MB 5IT9Y 2GV1A 4K4YA 5KG7A 1DTQB 5LXRA 3I55S 3TR5A 2V94A 3JQMA 3QAEA 1RHMB 1Z4UA 3I5CA 3FKBA 2OEMA 3LPYA 3RBXA 3SCJE 4P72A 2D3OR 4KRWA 1X9WA 2GJIA 1UEUA 3HLUA 1WI8A 1Q53A 3L9ZA 1OQ3A 4DI6A 3GJQB 3QAUA 4C9DA 2NUUG 4RZRA 3FMWA 4ZA1A 3FEXB 3OD2A 4NEZA 2ZKUA 3E2EA 2GAGC 3JTOA 4PQUB 1X4EA 5B0CA 1WNEA 3OPKA 2J9DA 1R0AB 2VQFJ 1S57A 5KAKA 3RB0A 1TV6B 2Z56B 4JI1F 2DNKA 3X1LB 3DU5A 3N5BA 4ZVRB 1DRZA 5D4OA 1RK8A 3GSIA 4PUOA 1BXNA 2VBWA 2W2PP 2WTFA 3ETMA 2H3EB 4DFPA 4CLPA 3IAM9 1LV5A 3E01B 2K7KA 4BDPA 1S76D 4V1Ak 4EBDA 4F8RA 2BRKA 2CKWA 3DRSB 3RW7A 1M1GA 3GQCA 4LF7F 1TQLA 2HRTA 5IM0A 4DX5A 3D0HE 2W7OA 5DETA 4IFVA 1U0SA 1GQEA 2NXCA 1MWZA 2KN4A 4ECZA 4DFKA 1DZ5A 3C14B 4P2MA 5T7LA 2ADBA 4EYIB 1NHUA 2DNLA 2GGPA 2DHXA 3PVXA 1M5VC 4ED8A 2KI2A 3CULA 2V67A 1Q95G 5DJBA 3D68A 1NJZA 2XZWA 1Y5NB 4XK8C 3T1AA 5HANA 5L38A 2VB6A 3P5TL 3JQKA 3LO3A 4TQRA 1CQMA 3JSMA 3NOCA 3M8YA 1JKHB 2H65B 3TVYA 1UZDA 2ACMA 2XTRA 3N6LA 4X66J 4FPRA 2QGFB 3QT5A 2VG5A 3O1LA 5THWA 2YNHB 3H59A 3ZXWA 2J9CA 1Y4ZB 3NY0A 4Z37A 3D1QA 1HNIA 4Z7CA 1FKPA 1VRUB 2G2YA 3DI6B 4FVMA 5A76A 3H25A 2X3DA 5KFKA 2BV3A 3E51A 2QMWA 4A46A 2DKOB 1U0HA 2MMYA 2H5EA 1LW2A 2DR7A 5K8OA 4ID5A 3A8JA 2EBGA 1R8HA 3CJSA 3UFCX 4CNYA 3HVWA 2FVPA 1WC1A 3Q8SB 2O66A 3QSYB 2YQ1A 2WZ1A 1BHNA 4Z7GA 3PW5A 3BSNA 1CJTA 4DG1B 3KLGB 1TK5A 3MI7X 1GMUA 3G96A 2BQRA 4DN0A 3ZZYA 3G6VA 1URRA 2UXCF 3MECB 1KVIA 3FZ2A 3I9ZA 1ZM2A 4JYAJ 2RHSB 3M8RA 2JBWA 1A0OB 1S99A 3CE8A 1NJWA 4PL3A 2XMXA 2G0CA 1I51B 4UF4A 2XCAA 5KFJA 3R6GB 4Q9VA 2A6OA 1U02A 2IA6A 1B70B 2JSXA 2XSJA 2E5LF 3W2VB 3HSZA 1X4AA 3I0RB 4R8UB 4OX7A 2IYIA 4PG8A 1ULRA 5ETTA 2BA9A 2XGQA 4FKXA 2FU2A 2JEFA 1WC0A 2FY1A 4LSLA 3GV5B 4BS2A 4DV4J 2VUGA 3FNBA 3BH7B 4J9UE 2DNHA 4GRSA 2X1GA 1ROFA 1RT2B 3TX0A 4B9UA 2BE2B 2YFAA 3JAMY 5KTQA 4JI8F 5F0WA 2LXIA 4FYXB 3UD5A 4KY3A 5G4DA 2JLEA 2MLXA 2N7YA 2DGSA 3KK3B 1RT1A 4KGKA 3SEOA 4JI2J 5KFCA 1RT7B 3M2UB 1QY7A 1B4SA 1HWJA 4ILRA 4B17A 3H0PA 1EETA 1KLMB 2ZITA 1TUWA 3FFIB 3R5CA 4CDIA 5ETMA 3PKMA 2IDEA 2ROPA 3PY8A 4OI0A 2CAJA 4WZQA 2ZRRA 2VKRA 3KHLA 3HK2A 4YFUA 1FDNA 2GS8A 2IHR1 3ISNC 5IV3A 2BW7A 4E0DA 3DRXA 2R2TA 1HBUB 3KHRA 5DGAA 3S01A 4ZCMA 2ZC4A 2GQ2A 1S1WB 3L95X 3MM6B 4L75A 1CS4B 1N34F 2LQ5A 2VFVA 3GLJA 4DV5F 1FJGJ 1K8AT 2MKYA 5C24B 4PWUA 2P5VA 2GMJA 1NAQA 3R5AA 3J80U 5HL7Q 1UWAA 4RKUC 2PMZD 1IWAA 2HHVA 4DLEA 3AJFA 1Q16B 3BPSP 3ENAA 4C3KA 3BV8A 3OJUA 5FLXU 4X2BA 5SZTA 3QPIA 2N82B 4ZJOA 3FGVA 1H0HB 5CYQA 3I4PA 5D78A 4DF8A 2V2QA 2FHMA 4K4ZA 1JNZB 1PIEA 2XMJA 4DX8H 1SV5B 4K5SA 4DV3F 4JI4J 1YGYA 3MDFA 1RI7A 4F25A 3QWUA 2HRUA 3N4WA 2VA3A 1W2BR 3PRDA 1ZM9A 4IQMA 3W60A 5T41A 4QWAA 3D1HA 3LALA 5CCLA 2GMHA 3R5JB 1HW8A 4EO6A 2CA9A 4R25A 1B0PA 2A0FB 3IM8A 4LRBA 3H5SA 3QGPA 4LF4F 1V5IB 2RT3A 1JQGA 2DR9A 1G2EA 1WSRA 1JXLA 4PG4A 4JV5J 4C8LA 4GKKF 2Y1LB 2ASYA 1LW0A 2BANB 5IC6B 2ZBIA 4DL5A 1NRKA 3LOUA 2RIJA 1D0EA 3OV7A 3M4XA 1WTBA 3HFVA 4DSJA 4AS3A 4YY3F 4IFYB 3Q23A 5HQMA 5E3AA 1SPBP 5KT6A 3LANA 2I38A 3R27A 5EWEA 2Z2YB 1T9XA 4X4PA 4CLTA 2QLBB 3AA9A 1J5EJ 2ZZMA 1TVRA 4ZVFA 3DOKB 1HNZJ 1P1TA 2YY3A 2DRAA 4OI3A 1X8DA 4RWWA 2C3YA 1R8CA 1GTHA 4BBYA 1WDDA 3SYZA 2HLTA 4MFBB 2FZCB 3C8YA 2KHCA 1S72S 4ID8A 4LR9A 4O44B 3LP0A 4K0KJ 5M2UA 2L3MA 3I9V9 2CYYA 5F9NA 4OHVA 3AD9C 1TELA 1RT5A 4F0HA 3VVUA 4LVNP 1IM6A 4TU7A 4C8ZA 3FDSA 1S1TA 3MAAA 3QJJA 3CNQP 4TY8A 3US5A 1LFWA 4UTGA 2PA8D 2R7OA 2HNDB 4KJIA 5C5JA 2HBYB 2BRLA 2FHJD 2ZEJA 3DO9A 2DNZA 1BE4A 3OXFA 2W8KA 5AE1A 3AAWB 2LQJA 2EFVA 3NWRA 1UFKA 2IVFB 3TQ1A 5D0GA 1AW0A 5A8WB 5F8HA 1Q7LB 1B0TA 4X4OA 1VRTA 1E6YA 2KFNA 3IGVA 5KG1A 4F67A 1VIXA 3BGRB 3GMGA 1VQNS 1JLQA 3G8QA 1HNWF 1WG4A 4NASA 1S6OA 3PO4A 3BYRA 5DLGA 1X5TA 2DH9A 2OI2A 3OFGA 3TJ9A 2W25A 2AJ2A 1AT1B 3RW6A 1BY9A 1UVJA 5KFOA 4FKYA 2DR6A 4NLVA 2E9RX 3CC4S 3SSRA 1RQ0A 3PDNA 4DV2F 3HHLD 4F4XA 1W3SA 3DOMA 3MEGB 1FXDA 2BUNA 5B09A 4NOHA 1FI4A 3MZIA 3CW2C 3PR4A 3NXZA 2FVCA 3DRPB 3RUBL 1AUSL 3FVYA 2UUBF 1F1BB 2DRDA 2OGUA 1FNXH 1QD1A 1QM9A 5HQ8A 5J1EA 1FERA 3HO1A 4KFBB 2BDPA 2IM3A 5LSOA 1F0XA 3DKDA 1RACB 1C4AA 3W61A 1VQYA 5LT5A 4OX8A 3LJ0A 1RT4B 1SQFA 5CQGA 1WJ9A 4OYWA 3L7PA 3CCZA 4ANEA 4LF9J 1IVZA 4NXMF 4DFJA 4WWSA 3CDAA 2ZE2B 2DT9A 1LWFA 3NNCA 2NZ4A 1HWUA 1N5TA 2I1RA 4OMFG 1X7VA 3NCRA 3LW5C 3W64A 4L72B 3PJWA 4USHA 2FVRA 4CO1A 2XZTB 1BQNB 1YHQS 4HACB 4B3MF 1LOUA 2HK2A 1A7GE 2FLPA 4DU8A 3IRXB 4I6AA 3FZBA 1S12A 3CIZA 3C6UA 2XLJA 3MR2A 4RW6B 3BQ2A 1UJ4A 4HHUA 5DDRC 2RKIB 3KLIA 2HYIB 4DR7F 2CPZA 4J9PA 2BJ9A 1X0FA 3I0SB 2OFHX 3HVAA 1SKRA 1T11A 5J2NA 1MNEA 3MUVP 1B64A 1OYDA 3N6MA 3J81U 3R2CJ 5DGBA 2MKJA 4A8FA 1C0TA 2CAZB 1S9GB 3M9MB 2JB3A 1R89A 4U9RA 1FTCA 1YITS 4UOCA 3GWCA 3RR8A 3R5BA 1TKXA 4JI5J 2VC0A 3O8WA 4L74A 1J2VA 4OYPA 1RBAA 2NSBA 3ZNJ1 2RB7A 2G1HA 2ROEA 3NCPA 4LFCF 2HHHJ 1NJIT 3F56A 2YX4A 1Y3JA 3I4HX 2R2SA 4N7TA 1RAGB 2ILYA 1IKYA 1N52B 1U2CA 4I6YA 2YNGB 3UD3P 2EBEA 3CMES 1CQNA 1S0OA 4DX7A 2BJ3A 3MCOA 1L3UA 2FVSA 2EI5A 4NLXA 1RE1B 3Q83A 4NCAA 3UQSA 1NSKL 2K3IA 4N41A 1N33F 2EG2A 4XTTA 3QGHA 1XNQF 2EFQA 1OS5A 4IRKA 2PI5A 3BREA 3EZOA 2YFBA 3IS9A 3TQEA 2FZKB 2V9KA 1S9FA 4H4MB 2VJUA 4J90A 1SC1B 3PEHA 2COLA 3CDEA 5HI7A 4M94A 3ZTSA 2DR5A 1XNRJ 4RW4B 2J0XA 2GCFA 4K4WA 4X84A 2Q66A 2FEFA 5L9NA 2ZH4A 1NNDA 4C98A 1MWQA 2IRYA 3D3CJ 3KLEA 3OLBA 1DURA 1VK8A 1ZAVA 4EU0A 2CZ9A 1Q4RA 5AXNA 4J5OA 4Y2IA 4OZ1A 3JB9k 2DK2A 3BO4A 1EKRA 3OXGA 4J9RA 2RIOA 5CYJA 2YWHA 1NK8A 4NLTA 3H2VE 3UDEA 4WIIA 1PO6A 4YEAA 2HZAA 3TEGA 2JNJA 2IPOB 1B0VA 4O3PA 1RLDA 2UU9F 4EZ9A 4NZ0A 3ADAC 5AT1B 4QZVB 3M8QB 1YRTA 4M5NA 3W65A 1EHWA 2IMOA 4PXEA 2DD8S 4DUTA 5GMKa 1S49A 2IRUA 3U02A 1BLUA 2VG6A 2HBRB 3TX8A 2FPHX 2UXDF 2PE8A 2AYEA 4PUOB 2MJFB 2GAHC 2XC9A 4LIRA 2AZ1A 8AT1B 4X4NA 1X31C 2H9ZA 5E7OB 2WVBA 2B51A 3KLHB 1I94F 3EE3A 3EJMA 3GCWP 4DR5F 2CPHA 1NDKA 4DR2F 3GYXB 5DG8A 1TDPA 4ETXA 1SQEA 2JH3A 3DXBA 1UETA 2Y3YA 2VFUA 4O4GA 4F0MA 4X4VA 4LF2A 4F7VA 2CG8A 3CPWR 5D3GA 2HNZA 4NLPA 2LLZA 1Y0HA 2KYXA 5IM0B 2XMAA 1WHWA 2GQCA 4PG5A 1FDBA 4IFVB 1WI6A 3P3DA 2KZZA 4IKAA 3WC0A 1RA6A 3BO3A 3AT1B 4DR6J 2G0JA 4DPXA 2MZQA 3VGTA 2VIHA 5T7LB 4F04B 1ZYQA 1Y10A 1RAAB 3O5TB 4YR2A 2JJ4D 2GGPB 1Y5IB 2WONA 2BBEA 4N47A 5DO2A 1MMLA 3PRVA 3K5PA 1U1MA 2X1BA 4WP8A 1T3OA 1X0PA 2V8HA 2HNYA 4K2XA 5I3QA 5GAHI 4LSNA 2OMOA 5KFPA 3B4MA 3T3FA 1VJWA 4ITSA 3JSMB 1O8BA 3SQOP 1EQMA 3ILOA 3K8WA 1EAYC 4P10A 1NB7A 1CJUA 1WHVA 1R0BG 2GIRA 3GFZA 3W2WA 5GAHU 3T1HJ 5IS2A 3BGOP 4JI6J 4XDCA 5LSLA 3EXCX 1FKPB 4TYBA 4JI7F 2FTRA 3PV8A 1S77D 4DX6A 1MMDA 1HNVA 3BJYA 7AT1B 1U0HB 4ZPWR 2Z57B 4X65J 2CQ2A 4FNHA 3B55A 1LW2B 5J1PA 4ID5B 2E9ZA 2MZTA 3L09A 3THTA 5GAGI 1ACMB 2OTJS 1FRJA 2VOOA 5KG5A 1CJTB 1TMMA 4WIQA 3BKFA 4X4UA 1RT6A 4O0IA 4JI0J 5C7PA 3U1LA 2RQKA 1QUPA 3D0IE 5D77A 3SFGA 3HP6A 4IG3A 1YJTA 2JVOA 1I5OB 5GAGU 1SKUB 5KG3A 2CQBA 5I3UA 3FRZA 4CLLA 2QIFA 4F26A 4F4YA 2IRXA 4CO5A 2ZH5A 1SL1A 3SSSA 4C48A 2XS5A 2FJVA 2XS7A 2CJKA 3KYLA 2DRBA 2VL1A 3LWMA 4YZDA 2EFPA 3R1HA 2NPFA 1FWPA 1RAHB 4IH6A 1S1VB 3D7SB 4F3MA 4FF3A 3BSOA 4I69A 2F40A 4DOZA 3A8EA 3PTWA 2XSJB 5C42B 2Z0GA 4NLWA 1TP7A 2BW2A 2A2DA 3QJLA 4OLPA 1FHTA 4K59A 2DPIA 2Y0SD 3PFEA 1NPRA 4OHZA 3MEDB 3C66A 4LSLB 1MMNA 1XMQF 1TL3B 4YHHJ 2M8HA 2Q1LA 5KG2A 3D6HB 3DOLA 3MD3A 3P23A 2AJ0A 3H5UA 2FC9A 4MIWA 1VQLS 3SXLA 5LSRA 4HH1A 4F4AA 1OY8A 2HBZB 3R97A 2LFVA 1UTAA 2BKPA 4FYVB 3CC7S 2B7BB 5DG7A 1VQOS 5AJ3J 2DNYA 1IN0A 1MWYA 1JLAA 4U6RA 4BCAA 2DGVA 2AZ3A 1Q8KA 1NB2A 2HHUA 4AXJA 1AROP 1EETB 2ZVIA 2AJQA 1PYOB 2Q6CA 1AZSA 4DMZA 1R6YA 1PSDA 1VDHA 4UZCA 3KK2A 2W9BB 2NXUA 4KHMA 2KZMA 4ECVA 2K1RA 2QA2A 1ZPVA 2R8JA 4ZVQB 2MLZA 2VD3A 4CH0S 2H4WB 5HROA 3KLFA 3OR1A 2J6UA 4ATNA 3CEDA 3GIKA 2CIMA 2QYCA 2LECA 3MUTP 3IC1A 2LDIA 1M5KC 3D5MA 3FBEA 1FF2A 2RF2A 1AUDA 1GMVA 2FDNA 3DHWC 4FXDA 1U8SA 4HT5A 2HG4A 1XC9A 2KDOA 4USWA 2V4JA 2WB1D 2IC3B 5KT3A 4YR3A 4WTYA 1MN7A 3AODA 2P6TA 5GADI 5CYQB 5E3RA 3TI0A 4JI3F 1ZBTA 3QRQA 5J2QA 2B3TB 3LA0A 2J6SA 1PC4A 1WELA 2HGNA 4PQAA 3NWGA 4DWIA 2HWTA 1D9DA 3FCVA 1X5PA 3HFZB 1HKAA 1DBDA 1KEKA 3IRWP 1VCTA 3LP1A 1WORA 5GADU 3MMCA 3D9BA 4LREA 4K2JA 4I2PA 4A4JA 2N7CA 2DITA 3LP2A 4DXLA 3F44A 2VPWB 4DR4F 1HA1A 1NXIA 4ZCLA 1NKBA 2ATLA 4NA2A 5DS7A 3ZZRA 2CPXA 3FJ2A 1PJ5A 4PKDB 2UVUA 2AHOB 3CJ3A 3QLHA 1YG0A 2ABYA 3A3OB 2ASDA 1Y3KA 5K14A 5C2CA 4OAUC 2KKHA 1T8EA 2DHGA 1LW0B 3CD6S 2RUGA 4HI2A 4BLGA 3VQSA 2VFTA 1T0TV 2M2BA 1H3DA 5IFMA 2AU0A 4KKOA 5D0RA 1IR0A 1D8YA 4DQSA 3FCHA 4RO0A 4IRDA 4DSLA 3MFIA 3U7JA 1EQ0A 1N36F 4LR7A 4OZ0A 1XBWA 4WP3A 3CWJA 1N32J 1TVRB 2AWZA 1NM2A 5DZ6A 2UZAA 3W8GA 5M2RA 2W8LA 2BKNA 3TVKA 2ZH7A 3MPDA 1NO8A 5HN0A 4NLQA 4HL9A 4WFNQ 2KJVA 2HLUA 3MMAA 5F8MA 2W2NP 4OYBA 1S7HA 3BQ1A 2QL5B 1VISA 4ZDNA 4IDKA 2XTJP 1RKJA 2E7XA 1X4FA 2OTLS 2FJAB 4MKBA 1S1TB 2JX2A 3MAAB 2NREA 3OUYB 4EMDA 4Z2XA 3B82A 3A4TA 4TY8B 2KHDA 3FNNA 2D3UA 1VQKS 2GQQA 3CCWA 1I6JA 3Q8UA 1S0NA 2HFSA 1IBKF 2CADA 4OX9F 4ZN3A 1OIAA 2RNEA 4MK7A 2A2CA 4QIEA 1VC5A 2XMMA 2D69A 1U1QA 1UVMA 4JUZA 2V63A 1RT3A 4X62J 4DR1F 4A8SA 2GVDB 2RAQA 1S1UA 2QTWA 1NZAA 4OZJA 4NMLA 4NLGA 4QJVA 1VRTB 4NA1A 1D1UA 1E6YB 4HDGA 4J9OA 1HLWA 2J0SD 4OYIA 5C2GA 1JLQB 4ELTA 2HMIA 1WOSA 4X64J 1S10A 1YBUA 4DZ6A 1U8WA 4U95A 3ZZ0A 2V2VA 5AE2A 2EFNA 4HT7A 4WE1A 3G71S 1TK0A 3H2UB 3IWLA 2AIRB 3G6YA 1RAEB 2GO8A 3BB5A 3DOMB 3AB4B 2G4BA 3M9OB 2O67A 3ZTPA 3UNYA 4CLUA 2CWKA 1GXLA 3MPYA 4I4BA 1RWVB 3NGUA 3OTOJ 1S9EA 3PG9A 1K73T 1YJ7A 4CYUA 4M5IA 4FBTA 1XR6A 3FSYA 1WC4A 5J1EB 1PC5A 2K19A 2CJQA 4FF2A 2E5JA 3KLVA 1CULA 2RMLA 3TEHB 3KWMA 4RU9A 2CNOB 1NCLA 4KPCA 1SBRA 4QR1A 4QWDA 4K4UA 3MPUB 3MTJA 1L3SA 3EUNA 3HKZD 3ILJA 2QSFA 2P6SA 1HW9A 2OPPB 4JCVE 3FQKA 3N6NA 4EBEA 1WC6A 2WVDA 2QFJA 3V4MA 3MAHA 4DCJB 2X51A 1IKVB 2DGTA 2EFGA 4DUYJ 4TY9A 4F3QA 3DGVA 5EGYA 1NPKA 1P27B 3LUYA 4ZP8A 2RQMA
chains in the Genus database with same CATH topology
2FY1A 3SFUA 2EW9A 3DRRA 2DJWA 3QO9B 4LSLA 4RW6A 3VAHA 5A8KA 1VHFA 5FDLA 3MWBA 4N8NA 4CCHA 5KFXA 5FLXY 3GV5B 4TLRA 4DL2A 2RKIA 2C28A 4G1IA 4Y2AA 1DQ8A 3P96A 3KHGA 4BS2A 1NJXA 4C3MA 1RISA 4EWTA 1HBOA 4WJBA 3V5RA 2VUGA 4TN2A 2JLFA 3ISZA 4L6V3 4ES2A 1VQMS 4I2QA 4IO9Q 3VA9A 2LA4A 3C6UB 2LEBA 2DNHA 5KFZA 1D9AA 3DMJB 4LF8F 1KTVA 2X1GA 4ICLB 1Y9OA 1ROFA 1RT2B 2M8DB 4PWDA 4B9UA 1TKTB 2B7CB 2KM8C 1U24A 2L48A 4FBUA 1SH0A 2BE2B 3KLIB 4RX6A 4X62F 2YFAA 3JAMY 2CQ1A 2J8AA 5KTQA 4JI8F 1HQUA 5KFAA 3JYTA 1KFSA 3DOLB 4MH8A 3LQVA 1N6QA 5F0UA 5F0WA 3MR6A 3GILA 2LXIA 1XR5A 5L1KA 3UCZP 4K4VA 2DNQA 2RRAA 1S9GA 1M1KT 3HHNB 3DDKA 5G4DA 2JLEA 1DFDA 2HHPA 2JLGA 3T5HA 3RB6A 3QIDA 2J7UA 2CQ3A 1JNRB 2ZM6F 3CCQS 1FRXA 4DSIA 2N7YA 2DCLA 1Q79A 2E8GA 1XERA 3KG4A 5A2QY 1AFJA 2BYCA 4YDDB 2DGSA 3BDEA 3KK3B 1RT1A 4KGKA 1C0TB 5J2MB 3SEOA 4C0HA 2G9OA 2IJFA 5KFCA 3RBDA 1U1NA 1RT7B 3POTA 1BQMA 1QY7A 2YWFA 3M2UB 4A47A 6FDRA 4QIGA 1HWJA 1CLFA 4ILRA 4B17A 1GX6A 2YKQA 3T9ZA 3M2VB 4ALZA 2KG1A 1FE4A 1EETA 1KLMB 2ZITA 5HGIA 1G7CB 2DBBA 3FFIB 3R5CA 3CJ2A 2DO0A 2MGZA 4YZCA 1Y5LB 3PW7A 3CDBA 3O2IA 3PKMA 4P2SA 3VF0B 3DNCA 2ROPA 5C25B 1TKXB 1KHVA 1HPZB 4IG0A 4NV2A 3N0VA 2YX1A 4MKAA 4WK1A 1JMTA 2KFYA 3PY8A 3KMQA 3IG1A 4OI0A 2FC8A 1L3VA 3QJPA 1U1OA 4WZQA 2ZRRA 2VKRA 4B9MA 4NYOA 3KHLA 3GZ7A 4O1OA 1TUVA 3HK2A 3UITA 1XMBA 3PACA 4YFUA 3I9V1 4QW8A 3ITHA 1FDNA 2P9GA 4WKYA 2ZNYA 2IHR1 3ISNC 2UUCF 1U26A 1V3RA 1IQZA 2AYMA 2KT3A 4E0DA 3SCIE 1VQ4S 1FKAF 4KO0B 4Q43A 3DRXA 2R2TA 1HBUB 3KHRA 5DGAA 1K0VA 2HS0A 2B9WA 3OQ2A 3OR2B 3CMAS 4HI1A 3S01A 5L1JA 4MTPA 2KRBA 1V6HA 4ZCMA 2YKMA 1JLGB 5E2QA 2ZC4A 2E66A 2GQ2A 3NG8A 3MCSA 2DR8A 5A8RA 1C1CB 1S1WB 5HP1A 2XHWA 3L95X 1IKYB 1Z1ZA 3MM6B 1N48A 3NNHA 7FD1A 1EP4A 1N34F 2LQ5A 1S79A 1TKZB 2CG4A 2VFVA 4G76A 1LXNA 3M30B 3BGLA 2KH9A 4DV5F 3Q2TC 1F5CA 3SDEB 1K8AT 3OL9A 5C24B 1FKOA 1FXRA 1N88A 1V3SA 2DNOA 2NS1B 2P5VA 2UUWA 4PWUA 5K8MA 5HROB 2GMJA 5I42A 1FK9B 1WF1A 1NAQA 4N56A 3G6XA 1IKWA 1UFWA 3R5AA 1VBZA 2MQLA 5HL7Q 1F2GA 3NMAA 2MSSA 2VH7A 4RKUC 4QU7A 4BC7A 2PMZD 2HIQA 2HHVA 1UAWA 3DM2A 3G9CA 4DLEA 3AJFA 1Q16B 4ERDA 5KFBA 1KR4A 4H54A 2WSCC 4G1QB 5E3PA 4C3KA 3OJUA 4I7FB 4CT8A 1FDAA 2M0GB 4TYAA 4X2BA 5SZTA 4IR9A 3QPIA 2N82B 1RDRA 1H2UX 4LF9F 5CYMB 1S6PB 4F2RA 3SCLE 2RF2B 3MFHA 1JLCB 3VAGA 4H4MA 3Q2SC 2JZ5A 3MOJB 4JOUA 3FGVA 4PPZA 1H0HB 5CYQA 3M9NB 3I4PA 1H98A 4J9KA 5D78A 3F73A 3TNVA 4DF8A 1X4DA 2LQ9A 2FHMA 2ZOGA 1A6LA 4K4ZA 4HFVA 3MEEA 4F02A 1JNZB 3A1YG 4USIA 4XPEA 2NQPA 4YB1P 2XMJA 4DX8H 1SV5B 4K5SA 3IS9B 2X1AA 4I1TA 2R2UA 4ED7A 2BQ3A 4DV3F 1VS3A 2P9CA 2ZKTA 3UNGC 4B3RF 4ILMA 5MAOA 4ZOSA 1FEHA 1YGYA 1SIWB 1RI7A 3MDFA 3MM8A 2HRUA 3BSAA 3QWUA 4F25A 2FJXA 3CF5Q 3N4WA 2L08A 2J5AA 2DO4A 4DFMA 2ZDPA 2VPZB 1QAYA 5JXSA 5EWGA 5J2QB 1SJFA 1CPZA 3PW4A 4MAKA 2VA3A 1W2BR 3PRDA 4C3LA 4OI4A 1ZM9A 4IQMA 1S1XA 1DTQA 3M8PB 5T41A 3V4IA 2OO4A 5LJ5Y 4QWAA 3DXSX 3D1HA 3KG0A 1VGYA 4OHYA 3LALA 1MW7A 5CCLA 5IWAF 4MMOA 1NH7A 2GMHA 5F8IA 3KLEB 3R3TA 4MIBA 4KB7A 3Q24A 1HW8A 2HQ3A 1YIJS 3ENVA 3K58A 1VLYA 4EO6A 1ZM3A 3H20A 1QAIA 2BZ2A 4C4WA 4QR2A 3IGNA 3FMBA 4O23A 3IAS9 1WHYA 3CJKB 3ZZOA 2DIVA 4R25A 2DH8A 1B0PA 2AJ4A 2HPUA 2LXFA 4CO3A 5DRKA 3RB4A 1JX4A 3H5SA 4NYPA 4JV0A 1QLNA 3QGPA 1Q82T 4B9NA 1YJVA 4LF4F 2A10A 4J9QA 3T9NA 2DR9A 2RT3A 1G2EA 1JXLA 4Q8FA 4DV6F 1BQXA 4PG4A 1ZTTA 3HFKA 2HVZA 1UVKA 4C8LA 4GKKF 2ASYA 4FZVA 2D9OA 3QGIA 1C0UB 2WAQD 1LW0A 4PQUA 1JJ4A 4QPTA 2BANB 1FA0A 1W25A 3M8QA 2N4CA 3CCES 2ZBIA 1LWEB 5DDPC 4ILLA 4DL5A 1NRKA 3ZZTA 3LOUA 2RIJA 4DS4A 4A8KA 3OV7A 1D0EA 3H5XA 3M4XA 1R0AA 2ZH8A 2HHWA 4NCGA 4NPOA 3TUIC 2DNMA 1WTBA 4WXOA 2JFKA 4PXCA 5KFRA 3SMZA 1S4FA 5K14B 4N5SA 4DSJA 3HM9A 4AS3A 1PGZA 4YY3F 2XWYA 2WW8A 4KV8A 2LU2A 5LMUF 1FRLA 4IFYB 2EFOA 2W4CA 3Q23A 1KN6A 3NCQA 1R8AA 4Y34A 5E3AA 4YZ9A 2IP6A 4ZPAA 4K4TA 5KT6A 3LANA 2XY7A 3UCGA 2I38A 2MZJA 2KU7A 3PW2A 1DQ9A 1WWHA 3R27A 5EWEA 1O5JA 2JFDA 5MLCV 1YJRA 3PIPQ 4WFYA 1S0MA 1FESA 5DLFA 2UXBF 2NLWA 3B78A 2R8HA 4X4PA 4DL7A 4OLOA 1CC8A 3K7RA 4JI5F 1WF2A 2UV8G 2APOA 3KLHA 3K2YA 3AA9A 3E01A 1HI0P 1T03A 2ZZMA 1TVRA 4ZVFA 4LQ9A 3DOKB 2MJUA 1BWEA 2V8VA 4MKYA 1UA0A 3L7OA 4AYBD 1P1TA 2YY3A 2F1FA 2DRAA 3BN4A 4OI3A 1X8DA 2BR0A 2HHQA 3LJ1A 1RWUA 2J0WA 2C3YA 4RWWA 1R8CA 2YKNA 4ECTA 1GTHA 3JSBA 3QMQA 3OL8A 4Y28C 4BBYA 1SJQA 4PR6A 1F9FA 3DRSA 2HHHF 3SYZA 4RNMA 2VBZA 2HLTA 2WOMB 4I0WA 1N5YB 4MFBB 2RRBA 2X3GA 3C8YA 2KHCA 1FO1A 1S72S 1GXUA 4ID8A 5E3CA 4DJBA 5B0GA 1T05A 4O44B 3LP0A 4J9NA 2E1MC 4J9SA 2XY5A 5M2UA 2L3MA 2GA7A 4ELUA 3U1MA 3DLGB 4UW2A 1U48A 3TRGA 3I9V9 4O4GB 1ZZNA 2CYYA 3CIMA 5F9NA 4OHVA 1JLBB 3VAMA 2XMVA 2PIIA 1RT5A 2F3JA 1S6UA 2LEAA 2EWHA 5D3GB 4LVNP 2Q6BA 3J7ZT 2Z8QA 3OFHA 5A6WA 1HWLA 2YKPA 1DHMA 2HFZA 4TU7A 4M95A 2R7TA 4C8ZA 1Q8LA 3PO5A 4ZP9A 4O1PA 2KT2A 5T14A 4A8YA 4NV5A 3LAMA 3FDSA 1S1TA 3HMJG 1HBNA 2B56A 1VQ6S 3QJJA 1JWWA 2YX7A 4Y2CA 3O44A 4AL7A 2MYFA 4TY8A 2MXYA 5A0YB 3US5A 2OJ3A 1LFWA 1UP1A 2DIUA 4XO0A 3TA0A 2LEPA 2PA8D 4O3OA 1QAXA 2Z2LA 2R7OA 2HNDB 4RW8A 5EX3A 4HLBA 4KJIA 5C5JA 1M5PC 2BRLA 4A8XA 2FHJD 4LF5F 4G3IA 3DO9A 1GTEA 2DNZA 1ZETA 1MU2A 1FT8A 3J7Z5 3GE9A 2CVIA 1R8PA 3OXFA 2ZJQQ 3QZ8A 2CPDA 2W8KA 4A48A 2YH1A 3OHAA 1FVSA 4IH7A 5AE1A 4X4RA 3H40A 1Q7YT 3EGWB 4MK9A 3AAWB 2XMKA 1REVB 2DH7A 2LQJA 3WX4A 3CT9A 3NBPA 2EFVA 5KFLA 2GFFA 1LKZA 3TA2A 4HHJA 2IVFB 3TQ1A 2KTQA 4O3RA 1AW0A 1UKUA 5HBMA 2VPXB 4PXBA 3T1YF 2V9WA 2CQDA 4WXWA 1Q8IA 5A8WB 2RU9A 3RR7A 5F8HA 3ENWA 3ENQA 4WK3A 3KNAA 1Q7LB 1SL2A 3MR5A 5DQGA 1B0TA 2DTJA 4TNOA 1XNRF 1HBMB 2D1CA 1HWIA 5DQIA 2E5GA 1VRTA 3T6JA 5E41A 1FRMA 1E6YA 1O51A 5B0BA 1YVFA 4X4OA 2VA2A 2XULA 3AY0A 3RZAA 3LGMA 3RRHA 2KFNA 3IGVA 4PRFA 1UW4A 5KG1A 4F67A 1VIXA 2OPQB 3BGRB 4LSNB 4P7VA 2YNHA 5KFTA 4J9LA 3C6TB 5D4NA 4B3TF 3GMGA 1VQNS 1JLQA 1ZTWA 2R7XA 1DTTA 3G8QA 1HNWF 2HVHA 3CCUS 4DF4A 1WG4A 3RAXA 2AYGA 4A8WA 1S6OA 3PO4A 3DN9A 2BACA 5DLGA 1X5TA 2DH9A 1SL0A 2AX0A 2BXJA 3OFGA 1N5SA 3PM9A 3BGUA 1FTRA 3T6BA 2W25A 2POKA 3M1VA 2KB2A 3PJXA 4DLGA 1HD0A 3RW6A 3H4BA 4RBUA 2VG5B 4OI2A 1BY9A 3TA1A 3CCVS 1UVJA 2MDAA 3DI6A 5KFOA 3UDCA 4F2SA 4NLVA 3OTCA 2E9RX 1VI7A 3MM9B 3CC4S 3SSRA 1RQ0A 3BN7A 4Q0BA 2PA3A 3PDNA 2OPRA 3W2WB 4NXNF 2FLLA 4DV2F 2CDQA 4I68A 3HZGA 2GC8A 4EBCA 3HHLD 4F4XA 3CSKA 4ECRA 2RS2A 5F41A 1W3SA 2ZH2A 3DOMA 3KK1B 3MEGB 3DYAB 3GYNA 1FXDA 2ERRA 2C2RA 1HNIB 3GFHA 2W24A 4DSEA 2BABA 2I8EA 3DLKB 4FNIA 2JEGA 2BUNA 3SQGA 5HO4A 1N4LA 4NZ7A 2DNGA 5B09A 3CGIA 4NOHA 1UWBA 1KQSR 2DB1A 1HNVB 3MMJA 2XNRA 4WYWA 3MZIA 2V1CC 3HZEA 1HMVB 2W9CA 3PR4A 4AFFA 2L9DA 3J81Y 1MROA 2FVCA 3LAKA 1CG2A 4DG1A 2J0QD 1RTIA 3DRPB 2XLKA 4OI6A 3UR3C 3QZ7A 1FJ7A 4Y65A 3FVYA 2VBXA 2UUBF 3IXQA 3MEKA 3TW0A 4AXIA 1RTJB 5IQ6A 3OBIA 4DEZA 3PZPA 1WEYA 2ZH9A 1FNXH 1QM9A 5HQ8A 5J1EA 1K1QA 1FERA 1FDDA 1NK4A 5KG0A 1U7LA 3HO1A 3MOZA 5J2PA 3MECA 1U1RA 2J7KA 4KFBB 1KLNA 3S1TA 2BDPA 2IM3A 1O0PA 5LSOA 5F9LA 4E8UA 1F0XA 1Q81T 1UJ6A 2B5JB 3HVTA 1C4AA 1RA7A 1VQYA 5LT5A 4H4OA 2V5HG 4OX8A 1RT6B 4RUHA 1HNZF 2FHOB 3X3UA 1VC6A 1K0TA 4FS1A 1FRKA 5JVGQ 4B02A 4NLRA 3LJ0A 1RT4B 2IM0A 2HZCA 2JOQA 4ZCKA 3GV7B 5CQGA 4RWXA 3BF4A 2C2DA 2P9EA 2MQQA 1S6QB 1SI9A 3L7PA 1B7FA 4WF9Q 2DCUB 2OPSA 2A1BA 1U6BA 2GO9A 3CCZA 4IG3B 3QIPA 2XI3A 4NCBA 5I4MA 2PN6A 1DARA 4DUZF 4FYDA 2QZ8A 1URNA 2N3LA 1NJYA 4KE5A 4NXMF 1S1VA 5F3TA 4YMEA 4D3HA 4DFJA 4ELVA 3CDAA 2HQIA 5KFUA 2ZE2B 5FJ4A 2JAEA 2QLXA 1WEXA 2DT9A 3CJ4A 1LWFA 3OLAA 3NNCA 3N01A 5B0AA 3TOQA 2NZ4A 2UUAF 3F4MA 2ZOMA 4OJHA 5C42A 3W2VA 5E0OA 2BQUA 1HR0F 3FEZA 5FIIA 1HWUA 2J6TA 1HQEA 1N5TA 3I0RA 4R8UA 4YB5A 1QE1B 1WG1A 4Y2KA 5IT4A 2B9XA 3M32B 4RNNA 3HVRA 3K59A 4MJKA 4EYHB 2I1RA 4OMFG 4CH1A 3CCLS 1X7VA 3NCRA 3THPA 3LW5C 1QVGR 2PSZA 3IAS1 2R8KA 3WBZA 1J5OB 2I5JB 4EFAC 3J80Y 4L72B 3PJWA 4USHA 4OIXA 2VV5A 3CTRA 4IOAQ 2LCWA 1KQKA 2FVRA 4CO1A 4OX6A 1X4CA 2XBPA 3MEDA 1BQNB 1WF0A 1YHQS 4GKJF 4F4ZA 3GSDA 2FB0A 4ECSA 3BQ0A 2BJEA 2RD5C 3V6HA 4B3MF 1LOUA 2RVJA 1KD1T 1A7GE 2FLPA 3UDLA 4C97A 3BR9A 2LYVA 4JV2A 3IRXB 4ETZA 1TKDA 1TL3A 4I6AA 3LF0A 4YB7A 4TU8A 1H38A 3FZBA 4QOTA 2RE1A 3CIZA 4DR3F 2IAJB 4C8MA 3EXYA 3CJ0A 2YWKA 1OSDA