4I1TA

Crystal structure of the cap-snatching endonuclease from pichinde virus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
MEEYVSEFKDMVRKWVPEWEELSEQKNNVLAQVKDRAITIEGLKLLSMLVEVDSCKKHSCRHNTRMTVNAILRELKVTCPTLPDVTPDGYCMVGDVLILLEVFVRTSQEAFEKKYNQDFLKLMQLSSDLKRQNITLVPVIDGRSSYYVEYIPDWVVERLRWLLLKLMDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cap-snatching endonuclease from Pichinde virus, a new world arenavirus
rcsb
source organism Pichinde virus
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase L
total genus 59
structure length 169
sequence length 169
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.300 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4i1tA01
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i1tA02
4MIWA 5J1NA 5IZHA 4I1TA 5J1PA 3JSBA
chains in the Genus database with same CATH superfamily
1QTMA 3NOGA 2RS2A 1UEVA 2DGOA 1AFJA 1XMQJ 2XCAA 5H9EJ 2Z8QA 1HL6A 1VLYA 3R5GA 4OI4A 4YR0A 4DPUA 4BBYA 1QSYA 1SJ3P 1XIQA 2XEXA 2ZOMA 2IVFB 1NSPA 3Q8PB 3DLBA 1ACMB 2HGMA 2V8GA 2AYGA 4ED7A 3CCTA 2N82B 1EHWA 1KOOA 3CJ2A 4RW9B 4W98A 5A8KA 2UXDF 1KSPA 2F8EX 4H4KA 4UY85 1TUWA 2O1PA 2VF3A 3OPKA 3POTA 1RJJA 1P8GA 2J9EA 4LRBA 4LQ3A 2AIRB 1BWEA 2RNEA 2OPPB 3K5OA 2JDJA 1RT2B 1IN0A 4LF9J 1X31C 3CC7S 2GFFA 3UDEA 4GRSA 4Z7GA 1Y5NB 1X4FA 2DH8A 4DV5F 3IM9A 2HNZA 4WFNQ 3US5A 1ULRA 5HGIA 2UVUA 1F3VA 3H59A 2YPYA 3D0IE 4U96A 4YEAA 2IP6A 2JBWA 1GX6A 3DO9A 3J7A1 5IV3A 2QX0A 2AD9A 2E66A 3MI7X 2XS2A 4K5SA 2UU9F 2NCKL 2BM1A 3EGNA 1XN9A 2EVZA 3E3XA 1NCLA 3Q8SB 1S9EA 5CCMA 2AHOB 2B4PA 2QT7A 5KFRA 2QSWA 2D3UA 1EAYC 3C6UA 3D3BJ 4RNOA 1E6VA 3JQKA 3N6MA 1JNZB 4KH1B 2Q79A 3OL9A 3QGGA 4KPYA 1HWUA 2CKWA 2RDIA 2V8HA 1RT1B 3I32A 3J7YI 1UZDA 3R6LB 3EZ5A 4DV4J 2BQRA 3LP2B 2ZM6F 2PFFB 2H5JB 1H74A 2IDEA 4N56A 3UCUP 1DTTA 4B3MF 2VL1A 1S9GA 1SJQA 4S0MA 5C24A 3T5JA 3UCZP 4ZMMA 2VFTA 5A0YB 1WHXA 4XPEA 2KM8B 4KBIA 2BACA 2ZVSA 3KFWX 1F60B 2B5JB 3AHPA 1H2TZ 4OX9F 4KQZA 5DZ6A 1FK9A 1K1QA 2VQFJ 2BABA 2AGQA 1LXNA 3AOCA 4KV8B 4WBFA 2AGPA 2Q66A 4OZ3A 2EBEA 4O23A 3CIZA 1LWFB 2YWKA 5L9NA 1JQGA 4J91A 2DNGA 2GZOA 2DNPA 4QR0A 2XTQA 4EYIB 3D66A 4DLEA 2DISA 3M2RB 2DNHA 4ZVRB 3I31A 2W9BA 4P71A 4FN5A 1KQGB 1VQNS 1IJEB 2PDAA 2HWTA 4DPTA 5B0DA 3G71S 1GTHA 3MGJA 5GAHU 2BBEA 4CO0A 2R9LA 1U1QA 2JFKA 3SDEB 4RKUC 1F0XA 1NH7A 1FRJA 3QAEA 3VAGA 1HWIA 2XS5A 5CA5A 3NL0A 2OTLS 2W9CA 3BH6B 1IKVB 3GV8B 3SYZA 3NGDA 2V67A 1JLBB 3GJQB 3CJ8A 3PJ9A 2YWFA 2Y1RI 4RBTA 5HJXA 4QWAA 4I2PB 1PSDA 3EPIA 4ECRA 3QJPA 1Y5LB 3OD2A 1FX4A 2MQLA 1J27A 4GMKA 3SQGA 3N9UC 3ZTSA 2MJUA 4C0OC 7FDRA 2SXLA 2PMZD 1ICEB 2F65A 5LSLA 1HNIB 1HNVA 4GXTA 4KO0B 2KH9A 2GIQA 1S9FA 2HQIA 3CD5A 4J9VA 3H2UB 5CAAA 5KFHA 3PX4A 2IJRA 5CH7B 2FIUA 4WU3A 3TX8A 4J9OA 4R8UA 1YI2S 4BLGA 2K3IA 1XMQF 1AA1B 3SMZA 4DWIA 1NDPA 2LXFA 3MAAB 1R8BA 5DM7Q 3A8KA 3GU0A 1I3OB 2EG2A 4F4AA 4F3MA 5BR8F 2YWGA 1WKLA 2D7SA 3M6WA 4DV1F 1FK9B 3AD8C 4WZQA 2IC3B 1RWWB 2QLFB 5HN0A 4YB7A 2H4WB 2VKRA 1AROP 4LSNB 1HQUA 3DLEB 5DO2A 4YFUA 1REVB 2EBGA 2ZHAA 3CC2S 1U1LA 4X4UA 5CZVA 2KTQA 1UCNA 3NGTA 4NLDA 5F3TA 3ZZYA 1WEYA 3KJVB 3VTIA 4CP5A 4A4JA 2RVJA 2NXCA 3VVUA 4LF6F 2DNMA 3IWNC 3JTPA 2OD4A 2R7TA 3RYLA 4NASA 1DRZA 3H7HB 3Q23A 4OV6A 1D8YA 1S6UA 1REVA 2IVYA 1RU2A 3GSIA 3JXOA 3SIPB 3MMCB 5A8KB 4F36A 2ZDOA 2J7WA 3M4XA 1K8AT 3THPA 4ZVQB 3G82B 2PT0A 4W92B 3DGPB 4URGA 4ED0A 1CULB 2IFXA 3FNBA 2X3DA 2MLZA 3GB0A 4MKAA 1VQ8S 3V4IA 3CJSA 3K2YA 4PXCA 5E5NA 3RRKA 4KSEB 5K8OA 4MFBA 1UL3A 2VFSA 4FPIA 4L74A 5K8MA 2KG1A 4DV3F 4R8UB 1ZTWA 3K89A 3PKYA 4LR7A 3HK2A 3S6EA 3VAFA 4DQQA 3T1HJ 1KD1T 2J6SA 1W2BR 1HBUB 4Y00A 3BH7B 4L3KA 3DOMA 2Z2ZA 3QIDA 4X4PA 2GHPA 4HTIA 3M30A 2VG6A 4WIIA 5IQQA 1FRKA 2GAHC 4ECYA 4LF9F 1VJQA 5KFBA 2YNGB 3B78A 2YNIB 1VRUA 1DHMA 2CPZA 3HHKA 4YB6A 2XY5A 3K5NA 4ZK7M 1YJ9S 2MGZB 2BJ1A 2LQJA 4LR9A 2M88A 1LW2B 1S1XB 1K9MT 2LXIA 1EARA 2MKCA 1O0PA 3KUGA 4V19X 3D6FB 4RX6A 1WG4A 1U0HB 5CXTA 1GMVA 3HZGA 1C1BA 4RBUA 3TW0A 5SZTA 4LF8J 1SV5B 3CMQA 4DN9A 3BO2A 1LW2A 1XMBA 2EFQA 4JI2J 2HK3A 3DRSA 3ZZZA 2MGZA 2FY1A 2HAIA 4X65F 2HFZA 3JSMA 1KQKA 4C3KA 1DTQB 1FDNA 2Z30B 4FVMA 4FDFA 1DLOB 4XK8C 4E8UA 4DLGA 1IBKJ 1Q5YA 4GKJF 1YX2A 2XMVA 3RUBL 4X66J 2DHSA 3KLGA 2KB2A 2YNHA 2GC8A 1FNXH 3O3LA 2XMUA 2CNLB 1QE1B 2F3JA 3CD7A 8ATCB 3DRPA 5EX0A 2C3OA 3BS9A 2ZH5A 4USHA 2QRRA 4NLTA 2KJWA 3PFEA 4JV0A 4YY3F 1HI8A 4P75A 2BJ7A 2GAGC 5KFIA 2DR8A 1RISA 4FNHA 3AT1B 3KOAA 2MZ1A 4DL2A 4ANDA 4NA2A 1FRLA 4P7VA 2NZCA 1SB6A 1XTZA 2AEFA 4IOCQ 2IJNA 4O44A 4U8YA 3HSJA 2GV1A 2OPQA 1TL4A 3BN4A 4LRFA 4RU9A 3T5LA 1BMQB 3PW7A 4JI1J 3EXCX 1NU4A 3CMES 5E7OB 3CDAA 2QL9B 3HFVA 4CLUA 1HR0J 3EZUA 1FRMA 1Q95G 1RTHB 4XAKA 3VGTA 3NMRA 2R7VA 2WVFA 3IAS1 2HZAA 2O66A 1IBKF 4HEA9 3R2DJ 1ZOTA 2CA9A 4ITSA 4C8LA 2F40A 5G4DA 4BDPA 4LF4F 3RB6A 3V81B 1B64A 4B3TF 3FJ2A 1CS4B 4ZVHA 3KG4A 4K5RA 3QRQA 4P52A 3LP1B 2ZH3A 5E3QA 4X4RA 2EKNA 2ZJQQ 2ZC4A 2CPEA 4KE5A 1MNEA 4X4NA 2HLTA 2CQ4A 4P7TA 3QJJA 5I3UB 1XC9A 3KNAA 5I42A 3HO1A 1UFWA 3W66A 1RKIA 2UVRA 1KVIA 3TI0A 3FBVA 4I4BA 4OQJA 2YBVA 4JI1F 2DIUA 3NY0A 2GIFA 2DVIA 3RR8A 2XNRA 2FUG9 3B6BA 4OJHA 2JB3A 3L0IA 4PYDA 4EBEA 1TV6A 1FXLA 4MYTA 5LM7E 4MKBA 2CUYA 3ILLA 3TJAA 3U1LA 5EHHA 4K0KJ 1YITS 2E5HA 2HGLA 3R5JB 1SIZA 4CLLA 4LF5F 3V6KA 1FWLA 2MSSA 1NJWA 1IM6A 2HHHJ 1JLBA 4YS2A 2B56A 1CVJA 3MM5A 1MWZA 2XMTA 4X62J 2XY7A 4OFZA 3HM9A 4J9MA 2HAFA 4Y2CA 4ZPVR 3MR2A 1S0MA 1TAUA 2VONA 5GAEI 4ZOSA 3D0GE 3TEGA 2OMOA 2GGPA 3HSZA 4DSJA 1O5JA 1TK8A 2VOPA 1FI4A 4Y6IA 4O3NA 1RKJA 5ETVA 3KMQA 3FRYA 3VHQA 3MM6A 4YOEA 2E7XA 3P5TL 5D0RA 2AQ4A 1YBTA 4B3SF 3PY8A 2G2YA 2QMUB 1UZHA 2V8DA 2R4FA 2E7VA 1GEHA 3Q89A 1LWFA 2HK2A 2PIIA 1JLQA 3OFEA 3VWSA 1RWOB 2ZVIA 3PYEA 4AUKA 4KV8A 2IMOA 4CO1A 3PZPA 2CJQA 4B3RJ 2RUGA 3CDBA 2E9TA 1CULA 2GS8A 2F1FA 4B9MA 5DRKA 3L7PA 4H4MB 4MTPA 1S10A 2M8DB 5KFXA 3I4PA 1KONA 4O0IA 5HVGA 2FJEB 3MCOA 2DKOB 3EGVA 2AF6A 4NLWA 2ZD1A 3NEKA 3S1TA 3TA1A 1MW7A 1Y3KA 3OFFA 3TX0A 3UR3C 3CCZA 2G4BA 4LRDA 2IBKA 4UOCA 3QNWB 2ZBIA 1RT1A 1SC4B 4WWSA 1Z4UA 4LFAF 4QU6A 1NDCA 1DJ0A 1HBOB 2NPIA 1C0TA 4M95A 2ZZMA 3IA0A 2C2DA 4OAVB 3IGNA 4QIVA 3W3SA 1BC6A 4MIBA 4HLBA 1HA1A 4D3GA 4X2BA 4AXIA 2B8QA 5E3RA 2LEPA 3FBBA 1OY9A 2FC8A 2WB4A 4YQWA 1TR0A 1WD6A 1X0FA 2RQMA 3FQLA 3HDSA 3R97A 3SXLA 4NLGA 1U48A 5CD4H 5THWA 4DR5F 3Q8RB 2B0GA 2M8HA 3MAAA 3W8PA 3MM7A 2HKEA 4J7CA 3PM9A 5B08A 1VHIA 4CYUA 4U67Q 2CZVC 2VIHA 3UI3A 3MMAB 4HHHA 1TDPA 3MURP 5KG6A 3A3NB 3T1YJ 1VC0A 4MH8A 4ZN3A 4WU2A 3M8WA 2HZCA 2UUWA 2KDOA 4G1QA 1VJWA 4OHVA 4ZPWR 3UN3A 4OYMA 5F3ZA 5EWGA 5F41A 1PYOB 1X60A 2H5IB 2NUUG 2VPZB 4BWMA 2HPUA 4F26A 5KFVA 4XO0A 4GKKF 1PJ5A 2YKNA 2H54B 1QJHA 2MKSA 1I1GA 1RQ0A 2UVWA 1S79A 4DV7F 2G0JA 4NMXA 4DX7A 1OYEA 2ZUGA 1R8PA 4OZ1A 2CWXA 5RUBA 3KLFA 4ZIWA 1HNZF 4HVZA 3SZ2A 3BGRA 2JVRA 2GIRA 4ZVOB 4ZP8A 2CQGA 4ZLJA 2CIMA 4ECWA 4EMDA 2D74B 1U4BA 4NXMJ 1MMNA 3WIVA 1TKZA 4ES1A 1KVKA 2W24A 1MLAA 1XR5A 2WHOA 3OR2A 5MAOA 1JLAA 5KTQA 1U6ZA 2W7OA 2CJXB 1RT5A 2G1HA 1FFWB 2XB2D 2C28A 2YQ3A 3T41A 1YLXA 4DOZA 4AQYF 1ZH5A 2YFAA 2E1MC 2OP5A 3QMQA 4IDKA 1WKKA 3IAM9 2ALZA 1CJVB 5I3QA 1J5OB 5CYMA 4O3SA 2WBRA 5HP1A 3A3PB 1JLAB 1WF0A 4MJKA 4F0HA 4ZHRB 2K1RA 3FEXB 4DG1A 3BDEA 2WONB 2O01C 3LWMA 4IUFA 1VOMA 2BE2A 4K8RA 1URNA 4ETXA 4ECXA 2L9DA 2VHGA 2MZRA 2VV5A 3PRVA 4HEA1 2HFSA 1MWYA 3TANA 1BLUA 2E1AA 1R0BG 4QPTA 3Q2SC 3GCXP 1DQ8A 1S9GB 2FC9A 4PL4A 1XERA 1YZ7A 4R5PB 3Q0AA 4KHPJ 2V63A 3FSIA 4NCGB 1QVFR 4OX7A 3K5PA 3ZZRA 1H38A 1TP7A 3M6XA 3G2XA 3EVMA 3KP9A 3H0PA 2E7WA 3AY0A 2WB1D 4DEZA 5DQHA 1KRPA 3DLGA 4PWDA 2GMHA 2DNKA 6FD1A 2V94A 3EPGA 1GQEA 4A8FA 5D3GB 2R42A 4W4MA 2CNOB 4X4QA 2IJFA 4DV0J 3S7RA 1OIAA 4LSLB 2EXUA 2OI2A 2AJ2A 1NLKL 2XMAA 4AL7A 1JLEA 3JTOA 5HQMA 5KFNA 5J1EA 4ECZA 1L5UA 1HHTP 2RDJA 2QLXA 3MM6B 2BOPA 3HX9A 4A8KA 1UVLA 4C8ZA 1U1KA 2VBZA 3AD7C 2DXDA 3BBCA 1NK4A 4ILLA 1IR1A 3RB0A 1V3RA 2VBXA 3D1OA 3J81U 2AYEA 5AT1B 1D9DA 5IOLA 2BKOA 3DRXA 2HHSA 3BBFA 1HKAA 1VBYA 1NK0A 4JI8J 2NUHA 1GNKA 1UFKA 3GP9A 3OW2R 2DGUA 4NZ6A 2V6AA 2IRXA 2I5JB 4LBHA 5HK4A 2M4MA 5HJYA 5LSOA 2VU5A 1X7VA 2NQPA 3ZC4A 2UXBJ 3M8QB 5ETOA 1P6TA 1TK5A 3TVYA 3PDNA 1KWMA 3W1YC 2A2DA 2YKMA 4YZCA 3HXMA 3DRYA 1UVNA 4LF8F 3NNAA 2B8PA 2HFVA 3HSDA 4GO5X 2ZKUA 3CCLS 1J5EJ 1NJZA 5KT2A 1Q78A 2ZE2B 1JLCA 2F63A 2FYXA 3E51A 2I5JA 1AUDA 1YBAA 4I69A 4J37A 4DL4A 2D41A 2MHEA 1RSCA 3MWBA 1T9TA 3M9OB 1T03A 3W9JA 3KLEB 2RHQB 4LR8A 2ZDPA 3SSSA 3KHLA 4M1KA 3R9LA 3WC2A 2K7KA 2KRBA 2QJ3A 1M5KC 4I2PA 1H6KX 1VQ4S 2DPJA 1WC5A 2X1AA 4RUCA 1EP4B 1TAQA 2WZ1A 5A6WA 3BBBA 3OVBA 1YJTA 3DXSX 3GIKA 4K4UA 2CXEA 1DAXA 1NXIA 1WKJA 2KXHA 3CCRS 2E9RX 5JVHQ 3PYDA 5DDRC 1U1OA 4DL5A 1GK8A 1VBZA 3FFIA 1VQMS 3DKDA 4USMA 5D4LA 1TL7B 1FKPA 4YMEA 2H1YA 2V8PA 2ZZTA 2QGMA 3KUEA 2K19A 1S5ZA 2ZFHA 4F2RA 2LQBA 4R25A 1FDDA 3HD1A 4O44B 3DN9A 5AJ3J 2EKYA 3QT8A 3JYTA 1SKRA 3HHLC 2FVPA 2I6WA 3CE8A 4LF4J 1GFWB 1N8RT 3CDUA 1CEZA 1Q53A 3MM9B 1UPPA 3VAMA 1NPRA 4M5KA 4DL0C 1YO7A 5EGYA 4ZP9A 2QZ8A 5JVGQ 4JI4F 3I0RB 2CQ3A 3OBIA 4B9LA 3PW4A 2BE2B 3CCQS 2F8MA 1LW0A 3DU6A 3L4BC 1XWLA 1HI1A 3IS9A 2HVHA 2LEAA 1IBLJ 1UVMA 3J7Z5 3M2VB 3UN5A 1UVKA 4CDIA 2OJ3A 3DOLA 2K3KA 1CJVA 4M63A 4U9RA 3VQSA 4PG6A 2OPRA 1IKXA 5D4OA 4DCJB 4JV2A 1R8CA 1SH2A 1Q86T 2FLLA 3TJ9A 3DOKA 2BA9A 5IT4A 1SBRA 2QYCA 1X5PA 1D09B 1SC3B 1GAOA 3W64A 3FCVA 4TVAB 1E6VB 2CQBA 1YJ7A 2ZBCA 4ZP7A 3VALA 1ITPA 1XK8A 3LA0A 2R2RA 2D69A 2FPHX 5DJBA 3UDVA 1S4EA 2V6EA 1CQNA 1HQ2A 1S1XA 4DJBA 2J8AA 1CPZA 3VGSA 1RAJA 5EN1A 3H98A 5U47A 2F5GA 3CDWA 1SUQB 2DNRA 3BGFA 1WG1A 3PCOB 2VPWB 1B0VA 1OPZA 2DGSA 4ICLA 3OSPA 2HFUA 1TMMA 2XMWA 5K8NA 2BL8A 1WC0A 2R2TA 1KVJA 2OPSA 2XMMA 1UW4A 3M30B 3MECA 4ID5B 2HLUA 4RW4B 4QWEA 1ZTTA 2ZH8A 2W2MP 2NSCA 2EC2A 2RRBA 3VAHA 3ILIA 4P73A 3DU5A 2KFYA 3H25A 2HGKA 1AYEA 3MXHP 3LH2S 1WF1A 3GPAA 2LQ5A 4LF1A 4NRUA 3R7NB 1YQHA 4EO8A 3ELHA 3VAKA 1DLOA 5M2UA 2AJ1A 1FVQA 1SI9A 2J7KA 3B8HA 3I6PA 2KZMA 1NDKA 1B7YB 2ZNZA 2V4JA 3TAMA 3RGIA 2YKMB 2L48A 3P5BP 1C1BB 4GVBB 5KFKA 2XSFA 2CJBA 3W9IA 5DQGA 2HQFA 2XWXA 2M3DA 3M2UB 4F25A 1VQ7S 1IQTA 1FWKA 1PYTA 1V9OA 5DGAA 5BYQA 2JEGA 4B3MJ 3UDCA 2F4VJ 2NXNA 2J0SD 2WVDA 4TN2A 1K0TA 1RAGB 4CCHA 3T3FA 1HBOA 2BEFA 3VR1A 4G1PA 1RP5A 3ZZOA 5HQ8A 3OUYA 3ADAC 5FLXY 4OV1A 2VFVA 4KHMA 2Q6CA 3MEKA 4GO7X 2DHAA 2ZD1B 3U1NA 2YFBA 1CLFA 3SV4A 4P10A 2IY5B 3FSXA 2PO4A 3BV8A 2RKIB 2W01A 3MPWA 3HHDA 1X5TA 1RAAB 5ETPA 1NK5A 1SQEA 1RT3A 2FJAB 3EWGA 3N5FA 3KKFA 2VQFF 3QGIA 2DBBA 3G8TA 1R89A 1LOUA 2C2OB 2R3VA 4IFYB 5HBMB 3CT9A 2F6MB 1TMJA 5D3GA 2AMCB 1QDUB 2ETDA 3K17A 5IC6B 1CJUA 2DH9A 2OSRA 1UA0A 1TELA 5C42B 4PUOA 1CG2A 4RL1A 3FZ2A 3NWGA 1OSDA 1QTNB 1Y5IB 5F0UA 4A8YA 4LFCF 2EK6A 2F4VF 1CSJA 1P9QC 1XQIA 5KFUA 1WSVA 2ASLA 4IYQA 3G9CA 1R31A 3OR1A 1Y11A 3QLHB 1FF2A 5SUHA 2BQUA 1RWNB 3N79A 4OLOA 4PKDB 5ETMA 1U8WA 2MEWA 2CAJA 1KHWA 2POKA 4A8WA 1IWGA 3BKFA 3Q83A 2VBYA 3MHYA 4P2XA 1YGYA 5E2QA 4Z37A 2FVRA 2JEIA 3Q2TC 2KL8A 2N7CA 2I0XA 2GJ2A 3WBZA 2HHTA 4C97A 1U2CA 2ACMA 4MK9A 4IG0B 5F8JA 4LBPA 2DEJA 3ISNC 4L72B 4LJMA 4C0BA 1H2VZ 3OV7A 1NK8A 4QW8A 3Q22A 4PXEA 2CQHA 2V4JB 4UW2A 4RWXA 1S7HA 2H3EB 4DR5J 1J5OA 1UWBA 1XMOF 2GJFA 4UOFA 3QRPA 1FJ7A 4G1IA 2ZHOA 4KC5A 1GH8A 1EKRA 3KNGA 3IM8A 2W2PP 3HVWA 3ENVA 1MG7A 2LMIA 4IG3B 5DG9A 3DM2B 1UP1A 3BEGB 2H51B 1M90T 1JK9B 3CF5Q 5HATA 4DWLA 2VA3A 1A9NB 3HI9A 1BQNB 1UVIA 2LLZA 2QFJA 3D0HE 3UVJA 4X4VA 3L9ZA 2ROEA 1PAEX 4KAIA 3W2WA 5DLFA 5J1NA 4KH0B 4EGLA 4HACB 4ZJOA 1NSKL 2Y0SD 5ETTA 3TNVA 4C11A 2MKIA 5I3UA 2NREA 3AOAA 4ZVSB 4QW9A 4LRCA 4OMFG 3OXLA 1RAIB 1TVRA 2GQQA 1ZPWX 2WVEA 5C24B 1HBNB 2GVZB 2YKNB 1ZM2A 2UUBF 3DLJA 1O6XA 2JX2A 5I3PA 4FS1A 5IT9Y 3KLVA 4LFCJ 2DR9A 2C22A 2BXJA 4TLRA 2MTLA 2XC9A 1HMVA 1T9UA 3K0JA 3J7AN 1RTJB 2EFOA 2ADCA 2YH1A 4CO4A 5T7LA 5KFZA 1DZ5A 4YR3A 4IOBA 3CCES 1HPZB 3QPIA 1XNQJ 2B9XA 3MPDA 4ANCA 2MQQA 1KLNA 2W1BA 2Y9HA 1EETB 1HWKA 2DTJA 2X7IA 3TZXA 4DUZJ 3TUZC 1KLMA 3IR6B 2IYGA 3IN5A 4ECSA 4HH0A 4K0KF 3DOLB 3J80Y 1UJ5A 2XMXA 1HHQA 1H2UX 1KFDA 3M32A 2R7OA 3DC2A 4QZVB 5IZHA 1JMTA 5DGBA 3EGWB 2RH3A 3FVYA 4DQRA 1KC8T 2BJDA 4ZPAA 1EX8A 1LW0B 1WTFA 3CJ3A 3NGKA 4NZ7A 4YN3B 5GMDA 4AYBD 4BC7A 4DX5A 1Y4ZB 1GXTA 1KQSR 3GJRB 2OSQA 2AX1A 4ES3A 1WWHA 1EQ0A 1CJKA 3CWJA 4M5GA 3V4MA 3GR1A 4ED1A 3TA2A 2XO7A 2HHVA 3HF5A 4TY9A 1PJ7A 5L1LA 3HHLA 3TRGA 4KHPF 3G87A 3GYGA 5ETQA 3ZZPA 4JI3J 1N5QA 5J2MB 2AEJA 3W65A 2HS3A 5KFDA 1IKWA 1HFEL 1QUPA 1SJFA 1UJ4A 2OFHX 2CWKA 3CO9A 4CIOA 3CC4S 4G75A 3AOBA 2C3YA 3SV3A 1Y3JA 2XYPB 1T3OA 3A8JA 4N7TA 1MSWD 1LWCA 4PQUB 2HQDA 4WIQA 2KFZA 2HRYA 3MUMP 2J6UA 1S6OA 1HNXJ 3IR7B 5ETSA 4XDDA 4QYRA 1HHSA 5E3CA 5B0AA 2BRKA 4DV1J 1TKXA 4OL8A 4KY3A 4WFYA 4XIUA 3BN7A 2KU7A 4DZDA 4TLQA 2HHHF 4X65J 2DNNA 1Q16B 4M8LA 4J9SA 1KNZA 3BR9A 4GVLA 2B9YA 3C14A 1WSRA 4LF2A 2IM3A 4FP9A 2V2QA 5H1SV 2W4CA 5LSRA 1H7WA 3PIPQ 4M94A 1YG0A 2FJBB 4JI7F 2Z58B 3NBPB 4LVOP 1UVJA 3AJ1A 3D28A 1NM2A 3G8QA 2IDLA 4CLSA 3I55S 3POTB 4OYBA 4NLSA 1YBUA 1ZETA 4FF2A 2QGFB 2UXBF 3EJMA 1BQMA 1WI8A 5HROA 2QO3A 4MFBB 1H73A 3VV2B 4ZLNA 1RYSA 4G3IA 4RBVA 1SC6A 3KK2A 2YH0A 3HHEA 4ZJQA 4U6PA 2XNQA 1F1BB 3GMGA 4NLRA 3GIJA 1RAFB 1RAOA 2V69A 4H4KC 4WTYA 1N0VC 1Z2ZA 3ILOA 3LAKA 4M5MA 4USIA 4C11B 2VG5A 4DF4A 4DSIA 3NMAA 3TQ1A 3GIMA 1BD6A 2JVOA 2KN4A 4FYYB 5ETNA 3WDOA 4C6AA 5H9FK 2KG0A 1BQNA 2AJFE 1FXRA 2HNYA 2BANB 3D6MB 3O2IA 4HDHA 5BYSA 3TZYA 1NB7A 1S57A 4QOTA 3OHAA 2FHJD 1BGXT 5DQIA 4UQGA 1PBAA 4IRDA 1FD8A 1RWPB 3IAM1 1AB8A 5F8HA 5I42B 2RSQA 3D67A 3KJVA 2LQ9A 4DV4F 1P1TA 4B3TJ 4ZITA 1IQZA 4DR6F 3WX8A 2D3OR 1LWXA 1HW9A 2E5LJ 3OTOJ 1IXKA 4IG0A 4FYDA 1BXNA 2GW8A 3ISND 5F0WA 3QFWA 4DXLA 1VCTA 2QV6A 5KG7A 2ZH6A 2W9AA 1VQOS 3FQKA 3HVTB 2GQCA 3ZFVA 1RWMB 4L6V3 1GMWA 3LGNA 5GADI 5LMUJ 1SJ4P 3R5CA 4OI2A 1S59A 3MEDB 2QYGA 2QEXS 2ROGA 2QL5B 3MEGB 3KXDA 1R0AB 2XI2A 5C25A 1LNQA 1A0OB 4G65A 4PWDB 1V5VA 4EK2A 2KXNB 1C4AA 5IC4B 2XY6A 4I64A 1G1XA 4LSZB 2PE8A 1W7WA 1NJXA 1NK9A 3MEGA 2QLJB 2V9KA 5K5MA 3IXQA 3H5SA 2JOQA 1KDNA 3I0SA 4USUA 4Y2MA 1OMSA 5GMEA 2V2KA 3VF0B 3PEHA 5C2GA 2W9CB 3QZ8A 2QC3A 1ZYQA 1YTYA 4OZLA 5A8RB 1T94A 2WONA 1VQPS 1WC3A 3OVSA 1QE1A 3BSNA 4J9PA 2E8GA 3MCSA 5EUHA 2DRAA 1S48A 2F9JA 2LA6A 4Q2MA 4DUYF 2O3DA 2MB0B 1N32J 3MPVA 3VVTA 3KK1B 2J7UA 2ROPA 4IO1A 1A7GE 4PCQA 2H4YB 4FKXA 3OUYB 2AYMA 2HQCA 4IH6A 1Q8LA 1RTIB 4MIWA 3W61A 5K8PA 5HO4A 4X4TA 1TK0A 3HJFA 4L76A 4LFBF 3SSRA 4NRTA 5FLXU 2J76E 4RUAA 1LKZA 2GSCA 4MKYA 4JP8A 4ZCLA 2B4VA 2LU1A 5GAHI 1K1SA 3A8EA 3NGRA 5JUMA 2HNDA 3L7OA 1W25A 4DF8A 4CLYA 3L95X 3JQJA 2FD2A 2A0FB 2VBWA 3CB4A 3IWXA 2OO4A 3KJFB 3QFHA 4NL5A 5ITHA 3KLFB 3LANA 2ZH1A 1OSCA 1RDRA 5A8WB 2JSXA 4Q44A 4DS4A 1BQMB 4MT1A 4ENOA 2R8JA 1JKHB 3MCNA 5LT5A 3F44A 1AT1B 2ZC3A 3R1LA 2UUTA 1N4LA 2BKNA 2EFPA 4HHJA 3M1VA 4F7VA 1U1NA 1U8SA 4KPCA 2RD5C 3PFOA 3NGSA 2NYIA 3D3CJ 3Q8QB 3MOJB 1VYAA 1SH3A 4OHWA 4AL6A 1U1MA 2IRUA 3CCUS 2YTCA 1U49A 4UUWA 2OPSB 1K73T 3EZOA 4CYUB 5IV4A 1JKHA 1M1GA 3RBDA 1CC7A 1S6QB 2VDHA 3CW2C 2FZGB 1N56A 2DCUB 7FD1A 3DLLQ 3QRRA 5F8NA 3KLIB 4F4ZA 4J9UE 5GMKa 1G6BA 3CJTA 4CLZA 2QZGA 1TKXB 4OLPA 3ZNUA 4O3PA 3QWPA 4NCBA 1F2HA 1S1UB 1WHYA 3AD9C 1RHJB 1H7XA 1X5OA 2M7SA 1UFLA 1F5AA 2HBQB 1RGVA 3CO0P 5FIIA 4FXDA 1QUVA 4Z7YA 3I87A 2YXLA 1R8HA 3LF0A 4HL9A 1R27B 4OJ3A 1QSLA 4DR7J 1U6FA 3NNCA 1UEKA 4KGVB 2XLJA 3ILJA 4K4TA 4RNFA 3B82A 4NLPA 1RA7A 3VZHA 3KLHB 3LWLA 1AUSL 2ATCB 1QSSA 4JI8F 3KK1A 1RCXB 2PC6A 3BZQA 5AXMA 1VHFA 1WNEA 4JI4J 3R7SB 1HQUB 2MYFA 1NSAA 1SKWA 4UY8T 1KN6A 4UT4A 1S0OA 2EC0A 2LCWA 2IC3A 4RLEA 1PO6A 2RF2B 2W8LA 4HI1A 3ZZ0A 4EYHB 2WOMB 2UUAJ 3H5XA 2IBOA 2QA4S 3CJ5A 1FRIA 4TYBA 2UXCJ 4M5LA 1T95A 1TQLA 3U27A 3G6VA 5IWAF 2D9PA 3R8YA 5C5JA 4DV2J 1ZM4A 4NEYA 4JV1A 3WZ0A 3I9V1 1RWKB 2RIOA 2MZSA 4ZCMA 2ZH4A 3C15B 4EWTA 2UV8G 3ZTQA 2YKPA 1VI7A 1S4FA 3D1HA 5HMWA 2X1GA 3OFHA 4I7FA 3KJNB 2WW8A 1P27B 2ZBRA 3IAS9 3LPYA 2DR5A 2BYCA 2CG4A 1Q8IA 4C48A 5KFCA 2JWNA 4DSKA 3P49B 5K9FA 4HH1A 2NS1B 3ICLA 2L08A 3FGVA 3R5DA 5HVFA 4TYAA 5IQ6A 2O67A 4AS2A 1SIWB 1S12A 5EWEA 2Z0GA 2A6MA 1ELOA 1N52B 2DH7A 3HVTA 2N4CA 3P45B 4H4OA 1JLGB 3P96A 2CQDA 1FRHA 3JSRA 5KFYA 1HBNA 2GVZA 1T9YA 4ZVUB 4DR2J 4ILMA 4G6VB 1NEEA 3IBWA 2B9WA 3D9BA 1I51B 2VJUA 5LXRA 1X8DA 3V6DA 3LTOA 3EGZA 4DR1J 1IUJA 2JRSA 2HIQA 3KLEA 3G8SA 3OLAA 1QAJA 3KTQA 3ISZA 4PEOA 2YWEA 4DV2F 3T5HA 1HYSB 3FUYA 2OUGA 3C6TB 3X3UA 5AE1A 4RNNA 2C3MA 3HULA 2JH3A 2CPDA 4YZDA 4AQYJ 2KKHA 3BYPA 3EUNA 3LPEA 3W5ZA 2COLA 4C7QA 2W9BB 1S72S 7AT1B 2L1LB 1YK9A 3UITA 3D6TB 1IBMJ 2KXFA 4U7UK 1ZAXA 2ALYB 1WC1A 2DCLA 2IM0A 4QR2A 2Y8WA 2W2QP 2ZWOA 2B5JA 3DDIA 2FTRA 4TY8A 1YJWS 4K50A 2MPUA 3K5MA 3WHIA 4NLQA 1HWLA 5DETA 4IH7A 5JXSA 3PR4A 3GTYX 3WQPA 3O8WA 4DN0A 5AE2A 3ENAA 2DNQA 4O4GB 4O4RA 3HLUA 4PZVA 3SEOA 4A46A 3BR8A 2CRLA 1B99A 3K57A 3V5RA 1WF2A 4LMZA 2BE9B 2CPIA 2RE1A 3MEEA 3MTJA 2IM2A 3QLHA 2GVDB 2JLGA 3D54A 4DV5J 1RTHA 4F3QA 5L1JA 5A2QU 4MAKA 2ZRRA 2E1RA 1L3TA 5GAEU 5IWAJ 2VOOA 3AAWB 5JMNA 9RUBA 4IFVB 2K7JA 2RAQA 3M9MB 4USKA 1D3WA 4I2QA 3KLIA 2CPJA 5BR8J 3RTVA 4DQPA 5D4PA 1ZA1B 1S1TB 2OAUA 4UF4A 3KHGA 1XNRF 5IXUA 2AJ4A 2CDRB 2LP4A 3E01A 3MD3A 4QIFA 5KFFA 2P6SA 1Q7YT 5DDQC 2FVQA 3R2CJ 5T14A 4OHYA 2OTJS 2R7QA 4ED6A 2CFXA 2FJDB 1WEZA 4DI6A 2CJKA 2FLPA 3LW5C 1SPBP 1HARA 4LF7J 5HMZA 1F5BA 3GYXB 2HZVA 2J9CA 1RTDB 2HSEB 4FVCA 2HVEA 5KG0A 2KT5A 2NPFA 2YPZA 1U2FA 1U26A 2BW2A 1CQMA 3TZWA 1NZ8A 4J5OA 1TL3A 5KFSA 2ZWPA 4RZRA 2W7PA 2RRAA 1L3SA 1C0UB 3HT0A 4PRFA 2KFNA 1FKAF 2CVIA 3OTBA 4JI6J 3CD6S 1PIEA 2P6TA 2R8GA 3GSDA 3QYYA 3HSGA 2CNNB 2A6OA 2ZW3A 2AX0A 5F8GA 3Q8YA 4PR6A 4DG1B 3HJVA 5KFTA 4USTA 3MR7A 1XMOJ 1FKOA 1LWEA 5G0RB 2NXUA 2YKAA 2J9DE 2U1AA 5HLFB 1KHVA 3JB9k 4PL3A 2H5EA 2PFDA 5K20B 4RW8B 3MMBA 4OI1A 4XTTA 3BGUA 3RZAA 3JTNA 4AE5A 3C3LA 1DY3A 1NBEB 3BYRA 4M5DA 4CLPA 3T1YF 2YNGA 2RU3A 2NZ4A 2AEMA 5C2CA 4ZPBA 2EG1A 2VG6B 4QPXA 4O0NA 3HP6A 4GC6A 3PKMA 1RTDA 1N33J 2VG7B 1X9SA 4I6YA 4UZCA 1N54B 3MM8B 3PX6A 3ETMA 3SDJA 1TL5A 3D4JA 2A2CA 1HBUA 2IYIA 2W2OP 2E5LF 2HHUA 3FSYA 3DA4A 1FHTA 4C8MA 4DDFA 1QAIA 1JNRB 2AV5A 3HKWA 1C4CA 3G86A 3IFEA 1JXEA 3KG1A 3ET6A 4HT5A 5AXKA 1WHWA 1X4DA 4RNMA 4DFJA 2C2RA 2UP1A 5AXLA 1ZZNA 3HFZB 2MXYA 2BMBA 3EVOA 4NLOA 2PI4A 2ZH9A 4O3RA 1E6YA 1YVFA 2MJFB 2G2OA 3CGIA 3HD2A 4OJ1A 1RHQB 3B4MA 2XG8A 3CD0A 3UVJB 4E2FB 1VBKA 1VC6A 2IAJA 3P6YC 2B6AA 3GG1A 4C0HA 2DK2A 3MM7B 3R7BB 4ZPTR 3RJMB 3W5XA 3KDOA 4UZBA 4IG3A 1OJ4A 1SL1A 3D5MA 4O3QA 3UNGC 1YHQS 3DFEA 1N33F 2OPRB 4PABA 1YIJS 4ED4A 3TEHB 2HMIA 3OTEA 3GILA 1PCAA 2PN6A 2PEHA 1VQLS 5J2QA 2JL9A 2NXEA 3M2VA 3OTOF 4O3OA 3I5BA 2CNKB 3IP0A 5B0FA 3D6HB 5HAOA 1Q1KA 2AZ1A 1B70B 3H8YA 1NHKL 1FJEB 2EFNA 1PC5A 2EWHA 4K4ZA 1B3TA 2DIVA 3FMBA 1WOOA 2BJ9A 5KFPA 1R0CB 3BKTA 3FBEA 5B7WA 2B6AB 2MQMA 5FDLA 2CAZB 1Z1ZA 1Y9OA 1Q79A 2DO4A 1QAXA 4JOUA 2N3OA 4KTQA 4OZJA 1HYSA 1HNIA 1HNVB 2F9DA 4WE1B 3GCWP 1FJCA 4WYLA 1CJUB 1VQYA 1RWUA 2OEKA 2Q6BA 2W7AA 2P22B 2ZOFA 3TR5A 2PI5A 1PAUB 4Y65A 3AJFA 4J9RA 2XGPA 4OJGA 3A13A 1WDTA 1VISA 4QR1A 1JLGA 1T02A 2CADA 2DNZA 1T9WA 1YSJA 2QE5A 3AB4B 4JUZA 4Y2AA 1S99A 1DQAA 1KR4A 1X9WA 1RT3B 3DXBA 2DNYA 5D15A 1NUEA 2VUGA 2HQ3A 2YNFA 4MK8A 4PQAA 4ZIVA 4YP3A 4U7UD 3MM8A 4OYAA 2NXJA 1NNDA 1R8AA 2Z2LA 1I6JA 4K4SA 1MMLA 3W9HA 1SC1B 2M2BA 4PG5A 1LEOA 2C3PA 2D3ZA 4EBDA 4Q43A 1CBKA 3PR5B 3QT5A 4N47A 2FHOB 1GMUA 3AXMA 4MK7A 1SKUB 2Q43A 5B09A 4AS3A 3N0VA 2ZE2A 5HLFA 3ONQA 2KHDA 4KGZB 1UETA 1MMDA 4U6RA 1F9HA 3I5CA 3J81j 2HWIA 3TAMB 2E44A 4ATNA 2DNOA 2RF2A 4F67A 4DL7A 3PVXA 1YKWA 3THVA 2C3UA 1BUXA 2JLFA 2W4DA 3F41A 4X62F 2KI2A 1C0UA 5L8RC 1S1VB 2V0NA 5ADZA 3W7BA 3P3DA 4X66F 5FDLB 1DTTB 1EJ7L 1FXDA 2E1PA 2XHCA 3HHLB 4ED3A 2HBRB 3D2WA 1SL2A 4EEYA 2RDDA 3L7UA 4Q2LA 2LDYA 2C2EA 3NS7B 3UR0A 4IRKA 4G76A 3M8SA 4C8NA 4KFBB 2B7CB 2Q3PA 2V9WA 1OS5A 1UWAA 1R6YA 3MECB 3G96A 2GMJA 5A6PA 2OEMA 1YJNS 1BHNA 3OSNA 1NJYA 3C14B 5D77A 1UA1A 4GC7A 1C1CA 4FYXB 4JI5F 4FF4A 3W62A 1N5SA 2VPYB 5KT3A 4DSEA 1RUSA 4A47A 1N6QA 5KG1A 2CQ1A 4B9SA 1AFIA 3UPFA 4DU7A 1N6QB 1MU2B 2GHWA 1HNXF 3D68A 1WORA 1YDLA 1EETA 4QU7A 4OZ5A 2P8IA 3CVKA 1S0NA 1LWCB 4AXJA 1S6PB 1J5EF 1YJUA 4PQUA 1VK8A 4L3NA 2YWWA 3H42A 1RAHB 4X4OA 1M5PC 4OHZA 1DQ9A 5LMNJ 1RT6A 4ECQA 3LJ1A 1X4GA 4TU7A 1Q4RA 4FZVA 2YQ0A 1JIHA 3AQOA 4NOHA 1HMVB 2FDNA 3M1VB 2DHHA 1BWVA 2RU9A 2G0CA 2C2MB 4HFVA 2YWHA 3T1AA 4AT1B 1VFJA 4Y28C 1JJ4A 1RBOB 2DY9A 3IRXA 2R2SA 5KFWA 1V6HA 2VQEF 2LDIA 5D78A 2FZCB 3ET6B 2X51A 3T9NA 2HS0A 4NPOA 4RW7A 3TUJC 5J1PA 4TU9A 1HIYA 2RMLA 4NI2A 3DDNA 1QVGR 1VBXA 2CZ9A 2IIHA 3J80U 1JWWA 3T19A 3AB2B 2ZHBA 3OXFA 2V1CC 4N77A 4USJC 2DRDA 4OZNA 1MROA 1IKYB 2BJ3A 2C2NA 4ZVEA 4A48A 4FS2A 2K1RB 2VG7A 2YNHB 5E3PA 4QBUA 3MAQA 2DHXA 1HNWJ 2WBMA 2JZ5A 4Q8FA 1K47A 1DTQA 4MIAA 2IRYA 3MF5A 1RACB 2KRRA 4F50A 3RRHA 2GCFA 5CHCB 1RWXB 2VJVA 2BUNA 4FKYA 4URQU 2LQ8A 1Q7LB 1NHVA 4CNZA 4ED5A 4Q7AA 3ENQA 2BOAA 3SQOP 3GZ7A 3M8PB 3R6GB 3Q8DA 4ZPDA 1JLFB 3KHRA 3WC0A 1T05B 2ZH7A 1W26A 2WRMA 2M9KA 4ES2A 2OIHA 1HBMA 5B0GA 3TOQA 4JYAF 4ZN1A 1SJ1A 1TTHB 4ECVA 2UUBJ 3M9NB 3DYAB 4CQ1A 3I0SB 4X64J 3Q86A 4ZVGA 1OYDA 2V2VA 1WG5A 2MKYA 4HYKA 3HKZD 3V2UC 4JB8B 1U45A 2EPIA 2V4RA 3QJLA 3W2VB 4G1QB 5KG2A 4ZDNA 2ZBPA 3DA3A 1ZM3A 1YWXA 3DOMB 4HACA 1SQGA 1VK3A 4K4YA 4ELTA 3PRDA 2NLWA 5BXIA 3QZ7A 1NK6A 1HNWF 1R43A 4RNHA 5L9XA 2VA2A 2CZ4A 3FBFA 4CWBA 1NZAA 2CQCA 3MTKA 3HFKA 3E01B 2YX1A 3MEDA 3QQCD 1VIXA 3QO9B 4EZ6A 3NXZA 3K8WA 4AD6A 5L1KA 5HBMA 2CG8A 5L46A 2MY8A 1D1UA 4OIXA 1S76D 3KWMA 3P8BB 2RIJA 1M0SA 2JJ4D 1UWBB 9ATCB 2FU2A 2FUG1 1RHKB 2WSEC 3RAMA 4QIEA 3G82A 1N5TA 2D1CA 3UN2A 5B0CA 4DU8A 3BB5A 1FX2A 2MY7A 3GQCA 4KIAA 2FJXA 1BE4A 2HVZA 5D0GA 1HQEA 3T5KA 4F3OA 4KGMA 4IRCA 3MPYA 4M5JA 1EZZB 2IA0A 3H90A 4KFBA 5K14A 3MZIA 4B3OB 4HHUA 3QSIA 1N48A 2OFGX 1FDAA 3H40A 4DQSA 3TP2A 2CDQA 4B9UA 2XSJB 4F4WA 4DFPA 1QY7A 2CQPA 3ITHA 2J0QD 4UOGA 1XR6A 4ZKAA 3ETOA 4ED2A 1S1VA 5KOWA 2L9NA 4LSNA 1Y00A 1RWVB 3LP0B 4QIWD 3TYTA 2DJWA 2VG5B 3DLKB 3CULA 2F8HA 4TY8B 2UXCF 3GFYA 5M2RA 4PL5A 3KK2B 5F8LA 4C8OA 1U25A 1JLQB 1ZPVA 3RR7A 3GLJA 2HVDA 4DV3J 4ERDA 1JB0C 2QFIA 2QA4G 3QO9A 4F02A 2R8KA 3NWRA 4KHRA 3SCLE 4OYWA 2CQ2A 1OY6A 1VLOA 1X0PA 3EDQB 2XQCA 2BR0A 1LQ9A 4RW6B 1JX4A 2VB6A 2DD8S 4JCVE 1G7CB 1RABB 1RB0A 1WHVA 1FTRA 2J9DA 3MDFA 4KJIA 1QM9A 3GE9A 4IQXA 3CSKA 3E2EA 3CDEA 2JEJA 1LFPA 4Y2KA 5BJRA 2WTFA 2RQCA 2VQEJ 3BQ1A 4ZA1A 4ETZA 4JI7J 4NYPA 3LJ0A 1ZZFA 3JSBA 2C42A 2XZTB 3U1MA 4A8XA 4NV2A 5F8IA 2DGQA 4J9LA 2C1EB 1SUQA 3QATA 5LXYA 3I9ZA 1IBLF 3SSQA 2QG9B 1HWJA 1T9XA 2DHGA 2ZUAA 5D0HA 1M5HA 1VR6A 3R5BA 4OX6A 3OL6A 1RXOB 4DV6F 4WKRA 4M5NA 3KK3A 1WTBA 1SCJB 4GVBA 2VICA 1S1WB 2ZEJA 2UZAA 2XTRA 2DB1A 5KG5A 4A8SA 2BQ3A 2HHXA 1RTIA 2FQQB 2HG4A 2Z4PA 2XO6A 2E29A 3M7VA 2I8EA 2PD1A 4NLUA 2FLOA 3DRRA 2BZ2A 2DR6A 3PG9A 1K44A 4CH0S 1IBMF 1FJGF 3DCAA 1RT5B 3I96A 1F9FA 1OY8A 3THTA 3VAJA 3O6QA 2VDIA 3UWTA 2DY1A 5ETKA 1IKYA 4FXVA 5B0EA 5A8RA 3MR3A 4NLXA 4WFXA 2P9CA 3BGOP 2BL7A 2L9WA 3BSAA 2DNLA 3NCPA 2XZWA 5BYRA 2F66B 4JI0J 2N3LA 4QWCA 1RAEB 5F9LA 2W8KA 3K7RA 1V3ZA 2BX6A 4RWWA 3FNNA 3H4DA 4EO6A 5CZXA 1GMWD 1FEHA 2RHSB 4I68A 4PXBA 3W63A 4B17A 3JYTB 4J9QA 3DRRB 5ETRA 5KG3A 4C9DA 4K2XA 3KLHA 2V2ZA 5IT0A 1T7PA 3FEYB 4WPAA 3UE2A 1TFYA 3KYLA 1P9YA 1X4AA 4FYVB 4NA3A 5DM6Q 1G2EA 2MQ8A 2MZTA 2RS8A 4Q5VA 5C25B 2E5IA 3G6YA 3AODA 1X4CA 3KK3B 3EDRB 3M8RA 4NXNF 2ILYA 1JXLA 1E6YB 2MKKA 4KYZA 2V34A 2FB0A 3GV5B 4O4GA 1U02A 3GIRA 1FERA 3M05A 3OLBA 2KM8C 4UTGA 1VDHA 3S01A 5IM0B 1IJFB 4I6WA 1NK7A 1KFSA 2XZDB 3BDPA 1XNRJ 2AT1B 3I5AA 1KOHA 3G4SS 2AJQA 3FZBA 3GG0A 2UXDJ 1LV5A 1FE0A 2RADA 5KFGA 3FVVA 1KTVA 1JXVA 1YZ6A 3CXCR 2MMYA 3A12A 2VC0A 1JJHA 2HBYB 2KVQE 2WSCC 1T03B 4UOHA 3QGHA 1F9EB 2OPPA 2WW4A 3CJKB 4U95A 3CCSS 3F56A 3M6UA 4RU2A 4EBCA 3F4MA 2Z2YB 2JAEA 1Q5VA 1XBWA 4M5IA 4ZCIA 2ZJPQ 1WUUA 1JJCB 3BSOA 2CVEA 3MMBB 2DPIA 4K7QA 1TL7A 3L3CA 3TO8A 4IH5A 3V6DB 1J2VA 4PG7A 5G0RA 5H9FJ 2AJ0A 2KJVA 1M5SA 3FKBA 2YX7A 3H2LA 4P74A 4CH7A 3EICA 2OMLA 4FNIA 5KFMA 4H4OB 3ITHB 3DDKA 2J0XA 4KGXB 3LUYA 4ANEA 1NB2A 4PYAA 4ZPCA 2UUCJ 1B4SA 3IMQJ 3DMJA 4IR9A 2XMJA 5KFAA 1VRUB 3NBPA 3N28A 3TQEA 1REGX 3C16A 5DG8A 3BJYA 2VFUA 1FNMA 2MSTA 4NLVA 4FBTA 2M5YA 2FGOA 4I7FB 1NSQA 4WXOA 4JI3F 4QCLA 4C8YA 3SI8A 1U5KA 1NO8A 1SH0A 2GGPB 1Z2LA 1RBLA 1GX5A 2BV3A 2X3GA 2H65B 4B9VA 4OI0A 3D7SB 3C15A 2YX4A 4RUBA 3CCMS 2IA6A 4DFKA 4LFBJ 4C3MA 4OZ2A 4FF3A 4DS5A 3MUTP 1M1KT 1RU1A 2BE7D 1FWPA 3BQ0A 4WE1A 4JI2F 3D1QA 5L38A 2DT9A 3I9V9 1NKEA 2ZOGA 2ACYA 3IC1A 2JFDA 3PYFA 4J90A 2QSFA 2RT3A 2B43A 1OQ6A 1FRXA 4K2JA 3UFCX 3ZTOA 5LMNF 3T1HF 3EVWA 2UUCF 3NKYA 4UQTA 3MEEB 4LF7F 1ROFA 2AU0A 3TUPA 2OKQA 1OPIA 2XSJA 1NAQA 4N41A 3DYAA 2JEFA 5LNK1 4A8OA 5E41A 4MKVA 1G3OA 1LK7A 1PC4A 3PW2A 3SFGA 3WIUA 1HBMB 4IO9Q 3O44A 2DXFA 1RA6A 1JLFA 3GFHA 1FDBA 3P4UB 1SJRA 3EXYA 3Q8VA 4X84A 5DDOC 3RW6A 1VGYA 3HMJG 2LVWA 4YDDB 1TFWA 2HHPA 5FD1A 4DV6J 4NCAA 1UKUA 3CEDA 1CS4A 1I5OB 2IPOB 2Z56B 1K0VA 5J1EB 2LFVA 2Y0BB 2FGCA 3RBXA 1RCOB 5T41A 5EX3A 2GJIA 5E33A 2Y3YA 3ZO7A 1IM4A 4LREA 3AH6A 3PHEA 5T7LB 1RT4A 1N5VA 2EFGA 1HLWA 3FCWA 3C2PA 4RPFA 1TUGB 3SFUA 4GKJJ 1ZAWA 2H48B 1WI6A 2AW0A 2QMXA 4CLFA 2IHR1 2OEJA 4KO0A 4DR7F 3GONA 2L3MA 3MD1A 4OYOA 2Q1LA 3PRBA 2V4QA 2N7YA 3W2VA 5KOXA 2GNKA 1PBUA 4NX9A 1IR0A 3SQGB 3U7JA 1F3FA 2FVSA 3LQVA 4ZP6A 4V1Ak 3G6ES 4GKKJ 3PEJA 1L3KA 2FHMA 4DMZA 4CLKA 4EZ9A 1UPMB 5GVQA 1TVRB 4NYZA 3N01A 3HPOA 4DR6J 2E5GA 3EX7B 4NYOA 4DL6A 4NWBA 3UCGA 1TUVA 1VQSA 2KT2A 3M8PA 3O1LA 1T05A 1PKUA 4DR1F 4L73A 4NEZA 1AW0A 4C98A 2WVBA 3MMAA 1Q82T 1QD1A 3K58A 4DPXA 2RB7A 4ZJLA 2PEBA 3DOKB 2ZITA 2W2NP 1MU2A 3RG6A 2NSBA 2I2YA 4RW8A 5CYQB 3CMAS 3GYNA 4FXWA 3BREA 4CO3A 1FCAA 4KR0B 1RT7A 1SV5A 2YY3A 1C1CB 4OYZA 5I4MA 1U1PA 1FKOB 1LWEB 4TKTA 1VQ9S 4JV5J 3IS9B 2XWYA 4HT7A 4PPZA 3LJ2A 4URSA 1VMBA 1Y10A 3GWCA 8AT1B 3KMSA 4F8RA 1IVZA 4TU8A 3I0RA 3JAMY 1VRTB 4IQMA 2VZ9A 5DG7A 2AGOA 4YHHJ 2J6TA 2XULA 4NI2B 1U1RA 4ELVA 3HVAA 4X64F 2A18A 1VIOA 2HQGA 2GQ2A 4WK1A 3ZTPA 2Y1IA 1T0TV 2G2ZA 2YNIA 1SJ8A 2XTJP 2Y1LB 3HZEA 3IRXB 2XGQA 2R2UA 1SVDA 2FY8A 4LIWA 1T9VA 1APSA 1WOPA 3BPSP 3PYGA 4LQ9A 3TZZA 2RLDA 2CPHA 4P2SA 4WJBA 4JI6F 1FVSA 2HWHA 3LAMA 3K59A 4QYZK 1S1WA 5J2PA 3DI6B 2B3TB 1N5YB 1N34F 2G13A 1FFGB 3NG8A 3BF4A 4R0JA 3M32B 3TVZA 4DV0F 4IFYA 1UMJA 5KG4A 3W5YA 3CCVS 2D3O1 3SCIE 3X1LB 2R7RA 2N4DA 4JV5F 1XR7A 4I2QB 5LL6d 3ZZTA 4ECTA 1KLMB 4U8VA 2RRNA 1MN7A 1AXQA 2B4OA 4PWWA 3N4WA 4IFVA 2RKIA 1U09A 3TJ8A 2UVVA 1HPZA 1YJRA 2CQIA 2QN6B 2WSFC 3F0NA 1NRKA 3MMCA 4FPRA 4HDGA 4QIGA 5KFLA 2V68A 3NNHA 1V5IB 2GVDA 3C16B 4DFMA 4KKOA 4P2MA 3VQTA 3V6JA 4IKAA 1PILA 1WACA 4LFAJ 3UNYA 3DMJB 3NRBA 4FBUA 2HBZB 3I56S 2GO9A 4LF6J 4Q45A 2L41A 3FEZA 3BPDA 3GV7B 3NCQA 1S0VA 2BANA 1NDLA 1Q8KA 3QGPA 1NPKA 3R3TA 5HMYA 3M2UA 4W90B 1AZSA 3CNQP 3L09A 2QIFA 2R8IA 4JYAJ 5MLCV 1RLCL 3C19A 3FDSA 1KTQA 1N34J 3NAHA 3KUHA 3JAMU 1RK8A 2LA4A 2JC1A 3IGVA 3O5TB 2R7XA 4ZVPB 1UAWA 2HNDB 1RZMA 4BC9A 3QSYB 3W2WB 4WKYA 3GIIA 1TKDA 4YUDA 2OH2A 4PG8A 2QLBB 3OFGA 4OYXA 3FRZA 2APOA 3MR6A 3RBZA 2KT3A 2ZH2A 4V19J 2AWZA 3FK4A 2C2KB 3MCMA 2VC1A 1ZS6A 3CJKA 3M8YA 2FHJA 4DR3F 3RB4A 1DFDA 3QBCA 3BO4A 4DUTA 1W2IA 4QJVA 2J0WA 1CJTB 2J8SA 5K14B 2ZM6J 1VQ6S 4B3OA 3QT6A 4N5SA 3A4TA 3H5YA 1FA0A 4EFAC 2BJEA 4B9TA 3MUVP 4QWDA 4DV7J 2PA8D 2MZQA 3B54A 3H4BA 3DLHA 1GTEA 1IKVA 3MPUB 4N8OA 1N0UA 4WYWA 4OAUC 3MM5B 3WX4A 3ZZUA 1JLEB 3V81A 4TNOA 3ZTRA 3ENWA 4PAAA 5D6GA 5E3AA 3SDEA 4OI3A 1TL1A 1RHUB 5J2NB 1M1HA 5F8MA 1KKHA 3OR1B 4RJVA 4DPYA 3V6HA 2XI3A 3UQSA 5J2PB 2MKJA 1HI0P 2KYXA 4DR4J 4Q0BB 2RJZA 2FHKA 2XMKA 3AJDA 4CLTA 5IS2A 5IT9U 2HRUA 1U6BA 2HYIB 2BW7A 1RE1B 5J2MA 1H98A 5LJ5Y 3FBCA 4AFFA 1FJGJ 1EKSA 2KKMA 1YRTA 3IBCB 4WFZA 4X4SA 2XM3A 3BQ2A 3K5LA 1XJWB 4EU0A 3E8OA 4NE9C 4OYIA 4Z2XA 4J9KA 1RI7A 4EUVA 5ETLA 2HFNA 3MAHA 3OTCA 1VRTA 4PXDA 4UUXA 4DPWA 3NOCA 3DRPB 3IBFB 4P6QA 1SXLA 5A0YA 2G9OA 5AXNA 2LKZA 3LP1A 2BJ8A 2CJ9A 1LXJA 3KLGB 4DUYJ 2HMIB 1N32F 3LP2A 4Z7CA 4ZCKA 5KFQA 1QAYA 4JBCA 4OHXA 1T8EA 4WP9A 1LK5A 2CJAA 3CJRA 4I56A 2RQ4A 5EDWA 4WP8A 4DR4F 1S77D 1FNOA 1WEXA 2IAJB 3LALA 3OHBA 2LECA 4ZS6A 3EMTA 2X1BA 5E0OA 4CO5A 4I1TA 3PX0A 4TQSA 3MFHA 5A2QY 1MROB 4M5HA 3U02A 5KT6A 4WCEQ 3MFIA 2DRBA 4B3RF 3UO0A 2HW3A 1T3NA 3RU0A 3W8GA 2FLNA 1EB0A 1OQ3A 3BGRB 2M52A 1WJ9A 2XHWA 3NS5A 3OQ2A 5CQGA 2GHVC 3T6BA 4CI0B 5M2PA 4BS2A 2FZKB 1M5OC 3JS9A 2UV8A 3AQPA 4RW7B 5KFJA 1N36F 2CPXA 2BKPA 2CJYB 1S6QA 3R27A 3OL7A 3PW0A 5DLGA 4YHHF 2DO0A 1FT8A 3OTDA 2HHWA 2FJWA 2V8VA 2HVIA 2W25A 4WFAQ 4P72A 4F0MA 1SQFA 3KG0A 2MLXA 1RT2A 4OI6A 4J9NA 2EK1A 1ZAVA 3B55A 2ILZA 4RW6A 1PG5B 4OZ0A 2E9ZA 1NPPA 4F04B 4YZ9A 1RT4B 2QLWA 1VQ5S 1S6PA 2YVSA 3K8VA 2XLKA 3P23A 2K2PA 4MMOA 3CPWR 1XNQF 5A8WA 3H2VE 3VGVA 3C66A 3RW7A 1HD0A 1PYSB 3SCKE 3DRSB 4C3LA 2P9GA 4Z7HA 3IR5B 2R7UA 2V50A 1G4CA 3DGPA 3B4DA 1URRA 2C2ZB 2MKHA 2LU2A 3DLKA 1U0HA 1N5YA 1TU0B 2KO1A 1L3VA 1IWAA 1NKBA 1KQFB 3IWLA 3EYZA 2VH7A 1RLDA 3OXGA 2PA3A 3Q8UA 2GO8A 5D0EA 5HQLA 1X5SA 1N36J 4HTJA 3Q24A 2X1FA 1FE4A 4C2MA 4WP3A 4A8MP 4O1PA 2HEKA 1IKWB 2HFOA 3NCRA 2CPYA 3CUNA 1IKXB 1Q81T 2ZZNA 1TL3B 2YKOA 2LXUA 4Y3CA 5H9EK 2JB1A 2CPFA 1HQEB 4BCAA 3NGUA 1IR2A 3DLEA 5KT7A 3SCJE 1NHUA 3PTWA 5L1IA 2ZBQA 1CJKB 2JLEA 4ID8A 2OELA 4ER8A 2JC0A 2K06A 3TAPA 4YR2A 3RBEA 2MLYA 4NV5A 5F9NA 2MQNA 2CYYA 3IG1B 4JI5J 3JSYA 5KT4A 4CRJA 3MM9A 2FEFA 3N6LA 3NS6A 2UU9J 2RQKA 2QA1A 1S1TA 1XEZA 3R1HA 2GX8A 3PACA 3ZNJ1 3J7YU 4A8QA 2DITA 4WFBQ 1O8BA 4WK3A 2B7BB 1U24A 4CTAA 1GXUA 5CYJA 5HI7A 1HR0F 1SKSA 1FKPB 3LOUA 2DXEA 3DHXA 3QIPA 3VZIA 4K4VA 1U2RA 3IO1A 4CNYA 3TAQA 3TARA 1R0AA 3A1YG 4R5PA 1RTJA 2KHCA 1TL1B 5J2NA 2IMWP 1LFWA 2OHDA 3BM7A 2XYGB 3DGVA 2YNFB 3QAUA 4N8NA 1TZ0A 1Y0HA 3TUIC 4I67A 2OD6A 4I0WA 4ED8A 1U47A 4JI0F 3A8IA 3AXKA 1UW9A 5HL7Q 1KEKA 3KDNA 4L75A 3HVRA 1FEEA 4K4XA 4C8KA 1S7IA 3VA9A 2PSZA 4OYPA 2EI5A 1GXLA 3BSCA 2E1CA 4FF1A 2DYAA 3N5BA 3PXGa 4F0KA 3OVAA 5HP1B 3R5AA 2O5DA 1CJTA 2AP6A 1D9AA 2ZKTA 4DBQA 5EWFA 2B9EA 2DGWA 2EFVA 3SBMA 2B51A 2HRTA 4QYZJ 5IFMA 4BWJA 3VGUA 3M2RA 2YKQA 2Y1JA 1R3NA 3MMJA 1MWQA 1VC5A 1JLCB 2ADBA 2Z57B 3CJ4A 1BQXA 4CT8A 1D8ZA 3A3OB 2YQ1A 3RB3A 1WC6A 3AJ2A 3C8YA 1ZBTA 2G1DA 4P2FA 1NMEB 2ABYA 2G0IA 4OX8A 2ASYA 3PJWA 1KS2A 1Q0NA 2A10A 2WOMA 2OLWA 3LGHA 2M70A 1WELA 3NLCA 4ZLPA 3CCJS 1U7LA 4F4YA 3EM1A 2LEBA 2VFRA 3CIMA 1B0TA 1WDDA 3FCHA 4ID5A 2KYZA 4RW4A 4DHVA 1AZSB 2B4UA 1JJ2R 1P1LA 4ICLB 4NZ0A 3ZXWA 4YY3J 4PPDA 4CZCA 1DBDA 5IM0A 3IRWP 1RHMB 3RAQA 4Q8EA 2D9OA 1PJ6A 4DR2F 4DZ6A 4ALZA 1YJVA 1NJIT 4ELUA 3UW1A 5HSPA 2ASDA 2XYHB 3M8ZA 4FYWB 2HS4A 4LUBA 2E5JA 3NAIA 5D8HB 1RT6B 2I38A 2I9SA 4KKOB 4IOAQ 1T11A 2DGTA 3LGMA 1QLNA 4I6AA 4KT0C 2RILA 2MZJA 5GADU 2GA7A 4R0EA 4B3SJ 1W3SA 2AKWB 1Y7PA 3CTRA 4HR2A 4DUZF 4F4KA 4WXWA 5FJ4A 1S9EB 2NR0A 5C42A 4PUOB 1YRUA 3RRGA 3UD4P 2U2FA 2HURA 2RUSA 3H20A 1D0EA 4NXNJ 1A6LA 3QT7A 4NMLA 4LVNP 3BGLA 2NYHA 4ZVFA 1FD2A 2DEIA 4RR5A 3MR5A 1HW8A 4U7CA 2R7WA 2HNZB 2F4FA 1UEUA 3AA8A 3DI6A 3I4HX 4PG4A 2BM0A 5GAGI 1PGZA 1D9FA 3DLGB 4LIRA 2QA2A 5DS7A 3T6JA 1RYRA 2HIYA 3J81Y 5AE3A 5HVHA 2IM1A 4NCGA 3N6NA 3HHLD 3VAIA 4CLWA 3PJXA 2AYBA 4F2SA 4USWA 3CJ0A 8RUCA 2MHNA 5CABA 4XPCA 1L3UA 3M6VA 3C46A 4XDCA 1X4HA 4Y2IA 1H3DA 1ZM9A 4PWUA 2VODA 2P9EA 1GT8A 1I94J 6FDRA 2WCXA 3FFIB 2DGVA 5KT5A 2ATLA 1JQOA 5DZ7A 3TA0A 4DSFA 2JHEA 4CM2A 5B0BA 4DCOB 1M5VC 3C6UB 5D4NA 3W60A 3OJSA 3H5UA 4CT9A 1ZA2B 5C7PA 2EEYA 3ULHA 4CO2A 1RADB 1RT7B 3I82A 3G6XA 4CM0A 1S1UA 4ILRA 5CYMB 4B02A 3UD3P 4N76A 4LF5J 2QMWA 4IDKB 5CYQA 2FJVA 2BDPA 1B0PA 1TKTA 4ECUA 1RHRB 3PIOQ 4CH1A 4NA1A 4K4WA 5AJ3F 1UTAA 2JB2A 2P5VA 3OT9A 2ERRA 1B7FA 3BKUA 4QQBA 3GFXA 4RUHA 3MOZA 3OR2B 4DX8H 2XCPA 3KHHA 5LMUF 1TKZB 4ZLLA 2IVMA 4DQIA 1VS3A 5HMXA 5KFEA 5KAKA 1V3SA 3F73A 2I1RA 4HI2A 1HNZJ 4C4WA 4WTOB 4O1OA 3DNCA 2OGUA 4RW9A 3OJUA 3PV8A 3OL8A 2M0GB 2FVCA 6AT1B 3V4IB 3GJTB 3UDLA 5CCLA 2XS7A 4Q9VA 1OWXA 4LRAA 3S8SA 2VASA 3BO3A 1TV6B 1S97A 4E98A 3CCWA 2XBPA 2F7VA 5JJBA 2A3JA 2EW9A 3AA9A 1C2PA 3LP0A 5GAGU 3PHTA 4IR1A 3HCXA 3M8QA 3GR0A 1U0SA 1WOSA 3RAXA 1F6TA 1FFSB 4Y34A 4K59A 1RBAA 1IBCB 3DM2A 2GMLA 2BVZA 5HROB 2P2CB 4DR3J 1KBRA 2HHQA 1F2GA 4P9SA 4YDXA 1H0HB 3CJQA 4B9NA 4USVA 5DDPC 2H9ZA 2ASJA 1UJ6A 2MQOA 4DL3A 2K8GA 2PMWA 2V5HG 3FC9A 2W4PA 4DSLA 3EE3A 3UD5A 2XLIA 1WC4A 5J2QB 1S49A 3HT3A 4Y0FA 4LBIA 4OX9J 3GJSB 5CD4A 4NXMF 2R8HA 1C0TB 1H72C 4TQRA 2UUAF 3HHNB 1CC8A 1F5CA 2WK4A 4AL5A 1BY9A 4LSLA 4F4XA 3GFZA 1FESA 1R6VA 2HGNA 3NP5A 4KB7A 3AFGA 4TXSA 1MN9A 1O51A 1Q8BA 2HNYB 1EQMA 2JNJA 2DGXA 2KVIA 4MYUA 3PNIA 3J7ZT 1VQKS 4HKQA 4KGKA 2VPXB 3QIPB 2WAQD 3C6TA 4RO0A 4KRWA 4EI2A 3VCDA 2LYVA 4H4MA 3PO4A 4Q0BA 1X4EA 1KP6A 4WZMA 2R7SA 4CTAB 2OPQB 2Z2MA 2ZJRQ 2MQPA 4ZVTB 2PGCA 2VD3A 4YB1P 3JQMA 2BRLA 2MJNA 1SL0A 2DR7A 3FMWA 3TVKA 2CQ0A 4QWBA 1N88A 1X4BA 2J5AA 1DARA 5HANA 2VKZG 1NKCA 3KJQB 1R7IA 1X9MA 2QTWA 3LO3A 4WF9Q 3IG1A 4D3HA 3PW5A 1VRQC 4H54A 1EP4A 1EIYB 2Y8YA 4LT6A 1HD1A 2MDAA 2QL7B 1FTCA 3QWUA 4E0DA 5L39A 5LJ3Y 3TWZA 4ZHRA 4DPOA 4BHQA 5LOQA 1RTZA 3DHWC 4B08A 2A1BA 2ZNYA 1NH8A 4DCPB 4M5DB 5A76A 2AZ3A 5KFOA 2QSBA 1YRXA 1OO0B 1TKTB 4NLYA 4YB5A 2PMHA 2WVCA 4DX6A 3JSMB 1I94F 2KZZA 1FO1A 3PO5A 3T9ZA 1DURA
chains in the Genus database with same CATH topology
1QTMA 2RS2A 1UEVA 2DGOA 1AFJA 2XCAA 5H9EJ 2Z8QA 1HL6A 1VLYA 4OI4A 4YR0A 4BBYA 1QSYA 1SJ3P 2XEXA 3Q8PB 2ZOMA 2IVFB 3DLBA 2HGMA 2V8GA 2AYGA 3CCTA 2N82B 1KOOA 3CJ2A 4RW9B 2UXDF 1KSPA 2F8EX 4H4KA 4UY85 2O1PA 3OPKA 3POTA 1RJJA 1P8GA 2J9EA 4LQ3A 1BWEA 2RNEA 2OPPB 3K5OA 2JDJA 1RT2B 1IN0A 3CC7S 2GFFA 4Z7GA 1Y5NB 1X4FA 2DH8A 4DV5F 2HNZA 4WFNQ 3US5A 1ULRA 5HGIA 2UVUA 3H59A 3D0IE 4YEAA 2IP6A 1GX6A 3DO9A 3J7A1 2AD9A 2E66A 3MI7X 2XS2A 4K5SA 2UU9F 2BM1A 3EGNA 1XN9A 2EVZA 3E3XA 3Q8SB 1S9EA 5CCMA 2B4PA 2QT7A 5KFRA 2QSWA 2D3UA 3C6UA 4RNOA 1E6VA 3N6MA 1JNZB 2Q79A 3OL9A 3QGGA 4KPYA 1HWUA 2CKWA 2RDIA 2V8HA 1RT1B 3I32A 3J7YI 3EZ5A 2BQRA 2PFFB 3LP2B 2ZM6F 4N56A 3UCUP 1DTTA 2VL1A 1S9GA 1SJQA 5C24A 3T5JA 3UCZP 4ZMMA 2VFTA 5A0YB 1WHXA 4XPEA 2KM8B 4KBIA 2BACA 2ZVSA 3KFWX 1F60B 2B5JB 3AHPA 1H2TZ 4OX9F 4KQZA 1FK9A 1K1QA 2BABA 2AGQA 1LXNA 4KV8B 2AGPA 2Q66A 2EBEA 4O23A 3CIZA 1LWFB 2YWKA 5L9NA 2DNGA 2DNPA 4QR0A 2XTQA 4EYIB 4DLEA 2DISA 3M2RB 2DNHA 3I31A 2W9BA 4FN5A 1KQGB 1VQNS 1IJEB 2PDAA 2HWTA 5B0DA 3G71S 1GTHA 3MGJA 5GAHU 2BBEA 4CO0A 2R9LA 1U1QA 2JFKA 3SDEB 4RKUC 1F0XA 1NH7A 1FRJA 3QAEA 3VAGA 1HWIA 2XS5A 5CA5A 3NL0A 2OTLS 2W9CA 1IKVB 3GV8B 3SYZA 3NGDA 1JLBB 4QWAA 2YWFA 2Y1RI 4RBTA 3EPIA 4I2PB 1PSDA 4ECRA 3QJPA 1Y5LB 2MQLA 4GMKA 3SQGA 3N9UC 2MJUA 4C0OC 7FDRA 2SXLA 2PMZD 5LSLA 2KH9A 3L3CA 1HNIB 1HNVA 4GXTA 4KO0B 1S9FA 2GIQA 2DR9A 2HQIA 3CD5A 3H2UB 5KFHA 3PX4A 5CH7B 2FIUA 4WU3A 3TX8A 4J9OA 4R8UA 1YI2S 1XMQF 2K3IA 4DWIA 3SMZA 2LXFA 1R8BA 2EG2A 4F3MA 5BR8F 2YWGA 2D7SA 3M6WA 4DV1F 4WZQA 1FK9B 2IC3B 5HN0A 4YB7A 2VKRA 2AU0A 1AROP 4LSNB 1HQUA 3DLEB 5DO2A 4YFUA 1REVB 2EBGA 2ZHAA 3CC2S 1U1LA 4X4UA 5CZVA 2KTQA 4NLDA 5F3TA 3ZZYA 3KJVB 1WEYA 3VTIA 4A4JA 2RVJA 3IWNC 4LF6F 2DNMA 2R7TA 3JTPA 2OD4A 3RYLA 1DRZA 3Q23A 1D8YA 1S6UA 1REVA 2IVYA 3MMCB 5A8KB 2ZDOA 2J7WA 3M4XA 1K8AT 3THPA 2PT0A 4W92B 4URGA 4ED0A 2IFXA 3GB0A 4MKAA 1VQ8S 3V4IA 3K2YA 4PXCA 5E5NA 3RRKA 4KSEB 5K8OA 4MFBA 1UL3A 2VFSA 5K8MA 2KG1A 4DV3F 1ZTWA 4R8UB 3PKYA 3HK2A 3S6EA 3VAFA 4DQQA 1KD1T 2J6SA 1W2BR 1HBUB 4Y00A 3DOMA 3QIDA 4X4PA 2GHPA 4HTIA 3M30A 2VG6A 4WIIA 5IQQA 1FRKA 4LF9F 4ECYA 5KFBA 2YNGB 3B78A 2YNIB 1VRUA 1DHMA 2CPZA 3HHKA 4YB6A 2XY5A 3K5NA 4ZK7M 1YJ9S 2MGZB 2LQJA 2M88A 1LW2B 1S1XB 1K9MT 2LXIA 2MKCA 1O0PA 4V19X 4RX6A 1WG4A 5CXTA 3TW0A 3HZGA 1C1BA 4RBUA 5SZTA 1SV5B 4DN9A 3BO2A 1LW2A 1XMBA 2EFQA 3DRSA 3ZZZA 2FY1A 2MGZA 2HAIA 4X65F 2HFZA 3JSMA 1KQKA 4C3KA 1DTQB 1FDNA 4OI0A 4FVMA 4XK8C 1DLOB 4E8UA 4DLGA 4GKJF 2XMVA 2DHSA 3KLGA 2KB2A 2YNHA 2GC8A 1FNXH 3O3LA 2XMUA 2F3JA 1QE1B 3CD7A 3DRPA 5EX0A 2C3OA 3BS9A 2ZH5A 4USHA 2QRRA 4NLTA 2KJWA 3PFEA 4JV0A 4YY3F 1HI8A 2DR8A 5KFIA 1RISA 4FNHA 3KOAA 2MZ1A 4DL2A 4NA2A 1FRLA 4P7VA 1SB6A 1XTZA 4IOCQ 2IJNA 4O44A 2GV1A 2OPQA 1TL4A 3BN4A 4RU9A 3T5LA 3PW7A 3EXCX 1NU4A 3CMES 5E7OB 3CDAA 3EZUA 1FRMA 1RTHB 4XAKA 3NMRA 2R7VA 3IAS1 1IBKF 2O66A 4HEA9 1ZOTA 4ITSA 4C8LA 2F40A 5G4DA 4BDPA 4LF4F 3RB6A 3V81B 1B64A 4B3TF 3FJ2A 4ZVHA 3KG4A 4K5RA 3LP1B 2ZH3A 5E3QA 4X4RA 2ZJQQ 2ZC4A 2CPEA 4KE5A 1MNEA 4X4NA 2HLTA 2CQ4A 4P7TA 3QJJA 5I3UB 1XC9A 3KNAA 5I42A 3HO1A 1UFWA 1RKIA 2UVRA 1KVIA 3TI0A 3FBVA 4I4BA 4OQJA 4JI1F 2DIUA 2DVIA 3RR8A 2XNRA 2FUG9 4OJHA 2JB3A 3L0IA 4EBEA 1TV6A 1FXLA 4MYTA 4MKBA 3U1LA 5EHHA 1YITS 2E5HA 2HGLA 1SIZA 4LF5F 3V6KA 2MSSA 1NJWA 1JLBA 2B56A 1CVJA 3MM5A 1MWZA 2XMTA 2XY7A 4OFZA 3HM9A 4J9MA 4Y2CA 4ZPVR 3MR2A 1S0MA 1TAUA 2VONA 5GAEI 4ZOSA 3D0GE 2OMOA 2GGPA 4DSJA 1O5JA 1TK8A 2VOPA 4O3NA 4Y6IA 3KMQA 3FRYA 3MM6A 4YOEA 2E7XA 3P5TL 2AQ4A 4B3SF 3PY8A 2V8DA 2R4FA 1LWFA 2PIIA 1JLQA 3OFEA 3VWSA 4AUKA 4CO1A 1UVJA 4KV8A 2IMOA 3PZPA 2CJQA 2RUGA 3CDBA 2E9TA 2F1FA 4B9MA 5DRKA 3L7PA 4H4MB 4MTPA 1S10A 2M8DB 5KFXA 3I4PA 1KONA 4O0IA 2FJEB 2AF6A 4NLWA 2ZD1A 3TA1A 3S1TA 2ASJA 1MW7A 1Y3KA 3OFFA 3UR3C 3CCZA 2G4BA 2IBKA 4UOCA 2ZBIA 1RT1A 4QU6A 1Z4UA 4LFAF 4M95A 1HBOB 1DJ0A 2NPIA 1C0TA 2ZZMA 3W3SA 3IA0A 2C2DA 4OAVB 3IGNA 4QIVA 1BC6A 4MIBA 4HLBA 1HA1A 4D3GA 4X2BA 4AXIA 5E3RA 2LEPA 2FC8A 2WB4A 4YQWA 1TR0A 1WD6A 1X0FA 2RQMA 3FQLA 3HDSA 3SXLA 4NLGA 1U48A 5CD4H 5THWA 4DR5F 3Q8RB 2B0GA 2M8HA 3MM7A 3PM9A 5B08A 4U67Q 2CZVC 3UI3A 3MMAB 3MURP 5KG6A 1VC0A 4MH8A 4WU2A 2HZCA 2UUWA 2KDOA 4G1QA 1VJWA 4OHVA 4ZPWR 5F3ZA 5F41A 2NUUG 4F26A 2VPZB 4BWMA 2HPUA 4XO0A 5KFVA 4GKKF 2YKNA 1QJHA 2MKSA 1I1GA 1RQ0A 2UVWA 1S79A 4DV7F 2ZUGA 4OZ1A 1R8PA 1HNZF 3KLFA 4HVZA 3SZ2A 3BGRA 2JVRA 2GIRA 1SKRA 4ZP8A 2CQGA 4ECWA 2CIMA 1U4BA 2D74B 1MMNA 1TKZA 4ES1A 2W24A 2WHOA 1XR5A 3OR2A 2W7OA 5MAOA 1JLAA 5KTQA 1U6ZA 1RT5A 2XB2D 2C28A 2YQ3A 4DOZA 4AQYF 1ZH5A 2YFAA 2E1MC 2OP5A 3QMQA 4IDKA 3IAM9 2ALZA 5I3QA 1J5OB 5CYMA 4O3SA 2WBRA 5HP1A 1JLAB 1WF0A 4MJKA 4ZHRB 2K1RA 3FEXB 4DG1A 3BDEA 2WONB 2O01C 3LWMA 4IUFA 1VOMA 2BE2A 1URNA 4ETXA 4ECXA 2L9DA 2MZRA 2VV5A 4HEA1 3TANA 1MWYA 1BLUA 2E1AA 4QPTA 3Q2SC 1DQ8A 1S9GB 2FC9A 4PL4A 1XERA 4R5PB 3Q0AA 3FSIA 4NCGB 1QVFR 4OX7A 3K5PA 3ZZRA 1H38A 1TP7A 3M6XA 4DEZA 3KP9A 5DQHA 2E7WA 3AY0A 2WB1D 1KRPA 3DLGA 4PWDA 2GMHA 2DNKA 6FD1A 2V94A 3EPGA 1GQEA 4A8FA 5D3GB 4X4QA 2IJFA 3S7RA 1OIAA 4LSLB 4AL7A 1JLEA 3JTOA 4ECZA 5KFNA 5J1EA 1L5UA 1HHTP 2RDJA 2QLXA 3MM6B 2BOPA 3HX9A 4A8KA 1UVLA 4C8ZA 1U1KA 2VBZA 1NK4A 4ILLA 3RB0A 1V3RA 2VBXA 3D1OA 2AYEA 1D9DA 3DRXA 2HHSA 1VBYA 1NK0A 2NUHA 1GNKA 5HROA 4ED7A 3OW2R 2DGUA 4NZ6A 2IRXA 2I5JB 5LSOA 2M4MA 1X7VA 2NQPA 3ZC4A 3M8QB 1P6TA 1TK5A 3TVYA 3PDNA 2A2DA 2YKMA 4YZCA 3HXMA 3DRYA 1UVNA 4LF8F 3NNAA 4GO5X 2ZKUA 3CCLS 1NJZA 5KT2A 1Q78A 2ZE2B 1JLCA 3E51A 2I5JA 1AUDA 1YBAA 4I69A 4J37A 4DL4A 2D41A 2MHEA 3MWBA 3M9OB 1T03A 3KLEB 3KHLA 2ZDPA 3SSSA 4M1KA 2K7KA 2KRBA 1M5KC 4I2PA 1H6KX 1VQ4S 2DPJA 2X1AA 4RUCA 1EP4B 1TAQA 5A6WA 3OVBA 1YJTA 3DXSX 1DAXA 2KXHA 3CCRS 2E9RX 5JVHQ 5DDRC 1U1OA 4DL5A 1VBZA 3FFIA 1VQMS 5D4LA 1FKPA 4YMEA 2K19A 2ZFHA 4F2RA 2LQBA 4R25A 1FDDA 4O44B 3DN9A 2EKYA 3JYTA 3HHLC 2FVPA 3CE8A 1N8RT 3CDUA 1CEZA 1Q53A 3MM9B 3VAMA 4DL0C 1YO7A 5EGYA 4ZP9A 2QZ8A 5JVGQ 4JI4F 3I0RB 2CQ3A 3OBIA 4B9LA 3PW4A 2BE2B 3CCQS 2F8MA 1LW0A 3DU6A 1XWLA 1HI1A 3IS9A 2HVHA 2LEAA 1UVMA 3J7Z5 3M2VB 1UVKA 2OJ3A 3DOLA 2K3KA 4U9RA 4M63A 3VQSA 4PG6A 2OPRA 1IKXA 5D4OA 4JV2A 1R8CA 1SH2A 1Q86T 2FLLA 3DOKA 2BA9A 5IT4A 1SBRA 2QYCA 1X5PA 1GAOA 4ZP7A 1E6VB 2CQBA 2ZBCA 3VALA 1XK8A 2R2RA 3H25A 2FPHX 5DJBA 4DJBA 1DZ5A 2V6EA 1CQNA 1S1XA 2HYIB 2J8AA 1CPZA 5EN1A 1RAJA 3H98A 5U47A 3CDWA 1SUQB 2DNRA 3BGFA 1WG1A 2VPWB 1B0VA 1OPZA 2DGSA 4ICLA 5K8NA 2XMWA 2R2TA 1KVJA 2OPSA 2XMMA 1UW4A 3M30B 3MECA 4ID5B 2HLUA 4RW4B 4QWEA 1ZTTA 2ZH8A 2NSCA 2RRBA 3VAHA 2KFYA 3DU5A 3MXHP 3LH2S 1WF1A 4EO8A 2LQ5A 4NRUA 3VAKA 1YQHA 1DLOA 5M2UA 2AJ1A 1FVQA 1SI9A 2J7KA 3B8HA 3I6PA 2KZMA 2ZNZA 2V4JA 3TAMA 2YKMB 2L48A 5KFKA 1C1BB 2XSFA 2CJBA 5DQGA 2XWXA 2M3DA 3M2UB 4F25A 1VQ7S 1IQTA 1V9OA 2JEGA 5DGAA 5BYQA 2J0SD 3UDCA 4TN2A 1K0TA 4CCHA 3T3FA 1HBOA 3VR1A 5HQ8A 4G1PA 1RP5A 3ZZOA 3OUYA 5FLXY 4OV1A 2VFVA 4KHMA 2Q6CA 3MEKA 4GO7X 2DHAA 2ZD1B 3U1NA 2YFBA 1CLFA 3SV4A 3FSXA 2PO4A 2RKIB 3MPWA 3HHDA 1X5TA 1NK5A 1SQEA 1RT3A 2FJAB 3N5FA 3KKFA 2VQFF 3QGIA 2DBBA 3G8TA 1R89A 1LOUA 4IFYB 5HBMB 3CT9A 2F6MB 5D3GA 2DH9A 2OSRA 1UA0A 5C42B 4PUOA 1CG2A 3FZ2A 3NWGA 1OSDA 5F0UA 1Y5IB 4A8YA 2F4VF 2EK6A 1CSJA 1P9QC 5KFUA 2ASLA 4IYQA 3G9CA 1R31A 3OR1A 3QLHB 1FF2A 5SUHA 2BQUA 4OLOA 3N79A 4PKDB 2POKA 1KHWA 4A8WA 2JEIA 2VBYA 3MHYA 5E2QA 1YGYA 4Z37A 2FVRA 3Q2TC 2N7CA 2I0XA 2GJ2A 3WBZA 2HHTA 4C97A 4MK9A 4IG0B 5F8JA 3ISNC 4C0BA 4L72B 4LJMA 1NK8A 1H2VZ 3OV7A 4QW8A 3Q22A 4PXEA 2CQHA 2V4JB 4UW2A 4RWXA 1S7HA 1J5OA 1UWBA 1XMOF 1FJ7A 4G1IA 2ZHOA 4KC5A 1GH8A 3KNGA 5DG9A 3HVWA 4IG3B 3ENVA 2LMIA 1RKJA 1M90T 2HHQA 3DM2B 1UP1A 3BEGB 1JK9B 3CF5Q 4DWLA 2VA3A 1A9NB 3HI9A 1BQNB 1UVIA 2LLZA 2QFJA 3D0HE 4X4VA 2ROEA 4KAIA 3W2WA 5DLFA 5J1NA 4EGLA 3TNVA 5I3UA 2Y0SD 4C11A 2MKIA 2NREA 4QW9A 4OMFG 3OXLA 2GQQA 1TVRA 1ZPWX 5C24B 1HBNB 2YKNB 1ZM2A 2UUBF 3DLJA 2JX2A 5I3PA 4FS1A 3KLVA 2C22A 2BXJA 4TLRA 2XC9A 1HMVA 3K0JA 1RTJB 2EFOA 2ADCA 2YH1A 4CO4A 5T7LA 5KFZA 4YR3A 4IOBA 3CCES 1HPZB 3QPIA 2B9XA 2MQQA 1KLNA 1EETB 1HWKA 2DTJA 3TUZC 1KLMA 3IR6B 2IYGA 3IN5A 4ECSA 4HH0A 4K0KF 3DOLB 3J80Y 1UJ5A 2XMXA