The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
169
|
structure length |
169
|
Chain Sequence |
b'MEEYVSEFKDMVRKWVPEWEELSEQKNNVLAQVKDRAITIEGLKLLSMLVEVDSCKKHSCRHNTRMTVNAILRELKVTCPTLPDVTPDGYCMVGDVLILLEVFVRTSQEAFEKKYNQDFLKLMQLSSDLKRQNITLVPVIDGRSSYYVEYIPDWVVERLRWLLLKLMDG'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the cap-snatching endonuclease from Pichinde virus, a new world arenavirus
rcsb |
| molecule keywords |
RNA-directed RNA polymerase L
|
| source organism |
Pichinde virus
|
| molecule tags |
Viral protein
|
| total genus |
59
|
| structure length |
169
|
| sequence length |
169
|
| ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
| pdb deposition date | 2012-11-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF17296 | ArenaCapSnatch | Arenavirus cap snatching domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | de novo design (two linked rop proteins) | ||
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |
