4I1TA

Crystal structure of the cap-snatching endonuclease from pichinde virus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
MEEYVSEFKDMVRKWVPEWEELSEQKNNVLAQVKDRAITIEGLKLLSMLVEVDSCKKHSCRHNTRMTVNAILRELKVTCPTLPDVTPDGYCMVGDVLILLEVFVRTSQEAFEKKYNQDFLKLMQLSSDLKRQNITLVPVIDGRSSYYVEYIPDWVVERLRWLLLKLMDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cap-snatching endonuclease from Pichinde virus, a new world arenavirus
rcsb
source organism Pichinde virus
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase L
total genus 59
structure length 169
sequence length 169
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.300 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4i1tA01
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i1tA02
3JSBA 5J1NA 5J1PA 4MIWA 4I1TA 5IZHA
chains in the Genus database with same CATH superfamily
5C24B 3TX0A 4UY8T 3H5XA 3W65A 1RBAA 4NLOA 3W61A 2Y9HA 2RIOA 3ZZOA 1XBWA 3W2VB 4LFCF 3CC2S 1L3VA 3I6PA 1RA6A 4AS3A 2OPQA 3R3TA 3OR2B 1U26A 2VV5A 5J1PA 5LJ3Y 3Q89A 3ETOA 3O3LA 4RW8B 1KWMA 3FRYA 1U6FA 3IP0A 5EGYA 4K4VA 4QJVA 4RW4B 1OJ4A 4EYIB 2CQ0A 2LA6A 5C25A 5K20B 3BGRA 3OV7A 2E5LJ 2OTLS 4Y65A 2GAGC 1G4CA 2YTCA 3KUGA 1QTMA 4ZP6A 1U6BA 1DFDA 3CXCR 1FVSA 1E6VB 2UXCF 1KQKA 4LSNB 4YZCA 1IJEB 4ICLA 5U47A 3T6JA 4U7UD 1S48A 2HHHF 2F3JA 1WDDA 2UU9J 2H4WB 3CMES 4F2SA 1RAJA 4USJC 4R8UA 4Q8FA 3DM2B 4CYUB 3D2WA 5AXLA 4KTQA 1N33J 5D15A 2BL7A 2KG1A 4EO6A 2XNQA 4CP5A 4YMEA 2AT1B 1M5HA 1MSWD 3KLVA 1WELA 1RHKB 4QYZK 2N7CA 1QLNA 4WYLA 4DV7F 1ZTTA 2JLEA 3A3PB 3SDJA 2HRUA 2YX1A 3H40A 1BQNB 3AXKA 3EM1A 4DUYJ 2M70A 4MJKA 3TX8A 3Q0AA 2YKMB 3KK3B 1FDNA 3LP0B 5IXUA 5EN1A 2CPZA 4NXNJ 2KT2A 3O6QA 1FT8A 1RAGB 3IGNA 1UP1A 4LRCA 3DGVA 4NI2A 4J9LA 3P5BP 4K4ZA 3DXBA 1P8GA 1S49A 2RIJA 1PC4A 3M32A 4QIFA 4WCEQ 2QFJA 1DJ0A 2YQ0A 2AGPA 5AXKA 1M90T 3PXGa 3IS9A 3R1LA 2R8HA 2FTRA 2C22A 2A18A 1CJVA 3JTPA 2WW8A 3G82A 5ADZA 2BRKA 5LM7E 4ZK7M 5J2MA 2B7CB 3IN5A 1OIAA 1U2FA 3TNVA 3BYPA 2DD8S 3BV8A 3RRKA 2DNRA 1PAUB 3X1LB 1RAEB 1HBNB 4EBDA 2UXCJ 1FRJA 2F8EX 1S0OA 2OEMA 1QSSA 4OYWA 3SQGA 1HMVA 1IN0A 3M30B 3M1VA 1TV6B 2FY8A 5E33A 3C14B 1IKWA 1NZAA 4GXTA 5J2QB 1SQGA 2C1EB 2JEGA 1URRA 1Q78A 2AJFE 3E01B 3PX0A 3MR7A 3R7BB 3KNAA 4R25A 4RW4A 2VBYA 1IQZA 2CYYA 1HWKA 2ZBIA 1ZM4A 2NQPA 5M2RA 1UFWA 1NZ8A 3CMAS 2ZJQQ 1RSCA 4RUCA 3OHBA 4G3IA 2NR0A 1RU2A 3D28A 3V5RA 1C1CB 4ZCMA 1VQ8S 4UUXA 2BX6A 3BS9A 4F3OA 2KDOA 2BE2B 3R5JB 4M5LA 4USUA 1VQSA 3Q8PB 3V6JA 1BLUA 2DO0A 2XSJB 2KI2A 3LWMA 1T02A 3BQ1A 3OJSA 3ZO7A 3E8OA 2E44A 4DMZA 2NPFA 2HKEA 3KG0A 1IKXA 5D0HA 3RAQA 1BUXA 1JJ2R 1HARA 1RLCL 5SUHA 4GKKF 1OMSA 4GO7X 4NLTA 2XQCA 5G4DA 3AOAA 2KKMA 3KLIA 3JTNA 4DR1F 3MHYA 4F4WA 2B8PA 3PRDA 2YX7A 5B0GA 2W2MP 2K7KA 4N77A 3GSDA 4YP3A 4Y28C 3DA3A 2Q6BA 3CCZA 1FJ7A 3QGGA 4NLQA 3MEDA 1XNQJ 2XS5A 2VHGA 2C2DA 2RDDA 4DX5A 4QW9A 1XWLA 2VZ9A 3BN4A 4C3KA 2YNFB 2V9KA 3DOMA 4WE1B 2IIHA 2DNQA 4USTA 1GFWB 2C2MB 1HW8A 1FE0A 1U8WA 4ZVTB 1Y00A 3M8PA 5LSOA 3JSMB 4CTAA 2E9TA 3DCAA 2M88A 3OL8A 3MOJB 2QJ3A 2FGOA 1XNRF 4NXMJ 1F5CA 3LQVA 3VQTA 3NMRA 1I51B 2APOA 2B8QA 3HFZB 2OD6A 3M32B 2RQMA 4ES2A 3TZXA 1P1LA 2GMJA 2OEJA 5K8PA 3RB6A 1TK0A 3HJFA 1RHMB 3ZZ0A 1I94J 4ZLLA 2IM2A 3FBFA 2WB1D 2HZCA 3T19A 1H7XA 4M5MA 4OIXA 1DTTB 1NM2A 2KXHA 1Y3JA 2V2ZA 4KGVB 4OMFG 1S1TB 3W2VA 2B9WA 2ZBRA 3KLGA 2PI5A 2E1RA 5KG4A 4U6PA 1BY9A 3KJVA 1FXRA 1RAFB 1MG7A 3MEGA 5HVGA 1TKXA 4DV4J 1SKWA 2BJDA 2WBMA 4KE5A 1FKPA 2BZ2A 4M5IA 4DR1J 2QEXS 1FXDA 3QAUA 3D7SB 2GQCA 3BN7A 3QWUA 3SDEA 3DM2A 2NXUA 1AYEA 3ILJA 4CYUA 3MEGB 7FD1A 2UUCF 2L9DA 2HEKA 5KG3A 3ZXWA 2AW0A 3PRVA 4NRUA 5KG5A 4FF4A 4B3TF 1W2BR 2ZZMA 1PAEX 1V3SA 1S1XB 1ZAXA 4MKAA 2HIQA 4I7FB 2ADCA 3Q8UA 3C15A 1EIYB 4B3TJ 1YIJS 1V5IB 3OL9A 3ZTQA 5D4OA 4O4RA 2DR5A 1HI1A 2JJ4D 2LXUA 5HMXA 1FTRA 3MCOA 2LCWA 4OJ3A 3KTQA 1UFLA 2CQHA 3NGKA 1U1PA 4U7CA 4QWCA 2Q43A 1QAYA 4LQ9A 1ZAVA 2EG1A 1FA0A 3KLHA 3K57A 4DDFA 4LF8F 3BJYA 1SH2A 3MM8A 1HQ2A 2CQCA 1RLDA 3LGNA 1NMEB 1KLMB 1IR2A 1DLOB 2HWHA 3Q2SC 5ETOA 2XO7A 1SXLA 1MWZA 3NLCA 1TL1B 2V2KA 4C48A 3FSIA 2W1BA 1NH8A 1EARA 1WEZA 2HGKA 3I0RA 3LWLA 3VALA 4JI6J 5KFKA 5J1EA 3MM8B 1K0VA 1BD6A 1RHQB 3CGIA 1Z4UA 4W4MA 1S6QB 2HFNA 2LQJA 3OLBA 2OPPB 2PI4A 3DNCA 4CH0S 2E5GA 3CJ3A 2OH2A 2V8VA 5L1KA 3KJQB 2HFOA 3TYTA 4IQXA 2ZHBA 4JV1A 3CJ5A 4DWIA 5J2MB 4YFUA 4ZJLA 3R1HA 2W4DA 4NXMF 1R89A 4X65F 4DFJA 2UUAJ 3KG4A 3KLEA 2J0SD 2H5JB 4I1TA 3K5PA 2KT3A 3PNIA 3QLHB 3MR3A 3HULA 4KYZA 4O4GB 2V1CC 2HBQB 3WZ0A 2ZHOA 5HMWA 5J2NA 3IGVA 2IRUA 2G1DA 3KDNA 3PYDA 5D3GA 3RB4A 3N6MA 2UUTA 2YWHA 2HAIA 4WZMA 1MN9A 4JI4J 1YJ9S 3A8KA 3RU0A 2OPRB 3SSSA 4DU7A 4DL7A 4DR6J 3QLHA 3VAGA 3W8PA 4DQQA 2BDPA 3N4WA 3SXLA 1RWVB 2KB2A 1XC9A 5L9XA 1NPPA 5DQHA 1VQ5S 1KQFB 2E1MC 1Q79A 2W25A 3CCQS 2I2YA 1FERA 2RE1A 4PZVA 2QTWA 1S6PA 4X84A 3TUZC 2KJWA 3QBCA 5DG7A 3BH6B 1YJNS 1S7IA 1RUSA 4IH5A 3WIVA 2DIVA 4DV5J 1U45A 1ZZFA 3O5TB 1FDAA 3CF5Q 5LMNF 2ERRA 2ACMA 4ZN1A 5DLFA 4L75A 4WF9Q 3TAQA 1TKXB 1U1LA 2XYHB 1RAHB 2JSXA 1EB0A 3F56A 3G71S 1EQMA 2DYAA 4AXIA 1TL3B 2ZKUA 1IBLJ 4KJIA 3EX7B 3CW2C 4EI2A 1QSLA 2Y3YA 2VA2A 1VJQA 2DNYA 3M6XA 5FD1A 3SCLE 2QSWA 2P5VA 3C6TA 1P6TA 1VDHA 3HFVA 2FLNA 3MPYA 1WF2A 1H72C 2Q6CA 1QVGR 3KP9A 1AROP 2EFOA 2WVBA 3KK1A 1X4DA 4ED6A 4CO2A 1RB0A 4RU9A 4G1QA 1GT8A 3ENQA 1M5VC 4XO0A 2F1FA 3OUYB 1TK8A 3W9JA 3DO9A 1BQMB 1KVJA 1IWGA 4L74A 1DQ9A 4TY8A 2XNRA 2CG8A 2C2EA 3H4DA 2ZFHA 1T94A 3TWZA 1RKIA 2DNOA 3UI3A 4A8MP 3T5KA 3PW5A 3POTB 2AJ4A 1EAYC 4OI6A 5CHCB 3U1NA 3D6FB 3VA9A 5CCMA 2XLJA 1Q7YT 3BKFA 4YQWA 2BJEA 2MQMA 1HBNA 4NLPA 2PMHA 2WVDA 3E3XA 3S1TA 3H4BA 2W01A 4DV2J 1HI8A 3PW0A 2AU0A 2IDLA 4DL2A 2ADBA 4TLQA 3AD9C 2WCXA 5ITHA 5GMEA 4DUYF 5I42A 3NNCA 4FXDA 4NCAA 1JLEA 2MZSA 1HBMB 4AYBD 2R2TA 3MCMA 3PR4A 2Z2YB 1JQGA 1VC0A 2QZGA 1F5AA 1XERA 3FZ2A 2E5LF 4O3RA 3CUNA 3G86A 4DCPB 2QGMA 3KJFB 2UV8A 4BHQA 4IKAA 4YB1P 2RF2A 2RNEA 4DV1F 3M05A 2MZTA 3P96A 4NLSA 3VR1A 4KHMA 2I8EA 3QT6A 3R7SB 1LW2A 1DBDA 1B99A 1RTJB 3KUHA 4FKYA 5IWAF 3J81U 3GG0A 1J5OA 3MM7B 1KFSA 3SDEB 1UA1A 3HLUA 3GMGA 1C4AA 3K58A 3TI0A 1VR6A 4ZPVR 2D9PA 3MEEB 2OI2A 4QOTA 2IAJA 3WX4A 4YHHF 2VFUA 4GMKA 4ERDA 3SBMA 1VC5A 1JWWA 3FBCA 5H9EJ 2XSJA 4H4MA 4KT0C 4ALZA 4RUAA 4IRDA 3MPUB 4LF6J 2GGPB 1YJVA 2E66A 3H0PA 4Q9VA 4ED4A 1KEKA 2RDIA 3MMAA 1PC5A 3I5BA 5HROB 1CJUA 1B3TA 3TOQA 3GCWP 3MMBA 5ETLA 2MQPA 4JI6F 4FYVB 3MMJA 3GYGA 3MTKA 3V81B 3DI6A 1KVIA 3W1YC 5FLXU 3RJMB 1CS4A 2GAHC 2YNIB 4KFBB 4WP9A 3U7JA 1VK3A 4WFNQ 3NCPA 1RTHB 1WC4A 2XTJP 2GJFA 2MQLA 5IT9U 3V81A 3I32A 4DG1B 4B3RF 3FGVA 3TAMA 1VBZA 3PV8A 2E1CA 3HKWA 3R5BA 3IAS9 3EVWA 1JLBB 2NXNA 4RNNA 3QYYA 4ILRA 3BPSP 4PWWA 2FJVA 3T1YF 2VJUA 4ZVOB 1UWBA 3IRXB 4JBCA 1TL3A 4R5PA 1U1NA 3CJRA 2ZOMA 2F5GA 1YWXA 4PG4A 2JVOA 2V8GA 2HWTA 3F0NA 2YQ3A 1WKJA 2ZD1B 3GJRB 3QIPB 4BCAA 5BXIA 2XB2D 2BMBA 2ALYB 3JQMA 5F9LA 2B6AB 1F9HA 2J9DE 1SUQB 3N01A 3QO9A 1VQLS 1SC3B 4F4AA 1U2CA 2CNOB 1EP4B 4OHZA 1T7PA 2QZ8A 4DUZJ 1NB7A 4JI3F 1R7IA 2GHWA 3UDLA 2NSCA 5HL7Q 2XMWA 3B4DA 3T9ZA 4NLGA 3D3BJ 1RWNB 2FJEB 1IBKF 5KFCA 4DV3J 2VH7A 3OQ2A 4UOCA 3RW7A 1RT3B 4KRWA 1U02A 3QIDA 2BANB 2VPZB 2H5IB 5CD4A 1NK4A 2GO8A 1NSKL 4C8YA 5FDLB 4IRKA 3DLJA 4Y2IA 1VMBA 2LDYA 2AJ0A 1HWIA 1KVKA 2B9YA 2CJBA 2HNDA 1WEXA 5M2UA 2VQFF 2YKNB 2R8JA 4DFPA 1TVRB 3Q8VA 5EDWA 2C3MA 1T03A 1EETB 3HVTB 4MMOA 4FDFA 4X64J 1SB6A 2HW3A 3AJ2A 1RT7A 2D9OA 3MGJA 4ZPAA 5KFYA 4DSLA 4IOCQ 4IO9Q 3W9IA 3J7A1 1IKYA 3UD4P 4PCQA 3O44A 4U96A 3PJXA 5ETTA 1NJWA 4F26A 3KXDA 3SEOA 3VGSA 4B3SF 4V19X 1WNEA 4EBEA 1M1HA 4CT9A 1R3NA 2HFUA 1NCLA 4G1PA 2DIUA 4ICLB 4X4PA 4B3SJ 3HHDA 4QPTA 3CCSS 4ID8A 3EE3A 1RU1A 4YR2A 4RZRA 3OR1A 4BBYA 2ROEA 5F9NA 2GQ2A 1HD0A 4E8UA 3PM9A 1FFGB 3KLHB 1TTHB 3CCLS 1S97A 1JJ4A 2J0QD 2KO1A 2YPYA 3EVMA 1Q5VA 3LP1A 4A8KA 1R0AB 1FHTA 2FUG9 1LFPA 1K73T 1KHVA 1RDRA 3MWBA 1JXVA 4DUZF 3OW2R 3ONQA 4X4NA 2B9XA 2MLXA 2Y0SD 5HK4A 5KFGA 3NGSA 1X8DA 2OD4A 1UPMB 3HVAA 2EFGA 3LO3A 4M8LA 4DUTA 5LJ5Y 3ISNC 3OJUA 1KOOA 4Z7GA 2BKPA 4PG5A 5MAOA 2DEIA 1REVA 1M5KC 1RACB 3OT9A 2FPHX 1KDNA 1P9QC 3RG6A 1N5YB 4DHVA 1YKWA 2UUWA 3AOCA 5KFEA 2EBGA 1I5OB 2V68A 4FBTA 4YOEA 2Q66A 2UVWA 2VG6B 3FEXB 1OQ3A 5HP1B 2XHWA 1X9SA 4MKVA 5J1NA 1TUWA 1DTQA 4J9RA 2OUGA 1FRXA 2XZDB 4J90A 4P72A 3MURP 4M5NA 4F67A 3SV4A 2XMTA 1NK7A 4NYOA 1PJ7A 1FD8A 2JEJA 3THVA 5H1SV 2KYXA 1FO1A 2A2DA 1U09A 2FC9A 1RA7A 4OYPA 2OGUA 3CCES 2FVSA 1ACMB 3F41A 2EBEA 2HVHA 1LWEA 1MU2B 2AWZA 2ZH4A 3MFHA 5IV3A 3UDCA 3ETMA 2ASDA 2D3OR 3GP9A 1H38A 5KG7A 1SJRA 1NBEB 2NXCA 5KFTA 2DISA 3OD2A 1G7CB 4I2QB 1NHVA 4GVBA 2FVPA 2JC0A 3EMTA 2F63A 4XDCA 2XTRA 5EWGA 1RT3A 2VASA 3HSZA 3DOKA 4ZLJA 5DO2A 4DWLA 5KG1A 4DLGA 3J7ZT 3KNGA 2RLDA 2JWNA 2R42A 3HT3A 4DV2F 3NMAA 2KHDA 2GC8A 2RT3A 2IBOA 4DCOB 5GAHI 4LF5J 3UN5A 1APSA 2OPRA 1IKVA 4ECZA 3CCWA 2CIMA 2MLZA 1FRMA 4DOZA 2HYIB 1HYSB 4NLDA 4K4SA 2N82B 3DGPA 1GMWD 3QSIA 1IXKA 2KVIA 2MDAA 1FEEA 2DKOB 1SJ1A 1VRTB 2ZE2A 5KOXA 3G4SS 3K8WA 3MUVP 3M9NB 2J0XA 2QX0A 2UZAA 4NV5A 3CCMS 1C1CA 1GMVA 2RRNA 2VC0A 4WP3A 3OLAA 4I6AA 4WYWA 1KQSR 1OSDA 3I4HX 3LP0A 1X5SA 4OX9F 3UVJB 2QL5B 4HVZA 4OHWA 2IHR1 2MZRA 4M1KA 5EUHA 3OFFA 1JX4A 5LMNJ 3GB0A 4ZJQA 3NCRA 1UWBB 3A4TA 3IRXA 2JFKA 4YDDB 2PA8D 2QA1A 2GJ2A 3BF4A 4RW7A 5IS2A 1U1RA 4QBUA 1D8YA 2J8SA 4KHRA 4NLUA 2V4JB 4PR6A 2JEFA 3D68A 4KH1B 3DLBA 3TAMB 4IG0A 1R8HA 4TY8B 4URQU 4OZ2A 3EJMA 2MGZB 3DXSX 4F4YA 2NCKL 2RS2A 3R2DJ 5D0GA 1KLNA 5B0AA 1W2IA 2J8AA 3A1YG 4RR5A 1TKZA 3T41A 1GTEA 2F66B 2JDJA 2LLZA 3FMWA 2XS7A 4OZLA 4Y3CA 1JLGB 1NRKA 2QMUB 1XR5A 4NLXA 5DDOC 2V4RA 1V3ZA 4TNOA 1RT7B 5E3RA 3M30A 3RBEA 2KKHA 2ZBPA 4LSLB 3EUNA 1TV6A 2MTLA 5DDPC 1GX5A 3JSMA 2B4PA 1RWOB 2VPXB 2BKNA 3T1AA 4TVAB 4PL4A 2RJZA 2I9SA 2NXEA 5AT1B 4B9MA 1RT2A 1OYEA 2QLJB 2HNYB 2R9LA 2R7SA 1JLAA 1R8CA 1FJGJ 1Q8BA 1VRUA 2W9CA 1X5TA 2YQ1A 1YJ7A 2OPSB 5ETPA 3GYXB 1S6PB 5HVHA 3Q23A 1R8AA 2V0NA 3HHLD 4M5DB 3MFIA 3M8WA 1T03B 4KR0B 3L4BC 3OBIA 2XS2A 3W63A 3BO3A 2XWYA 2CAJA 4WFYA 2FEFA 4WXWA 4OI3A 2PGCA 2CG4A 4IDKB 4KO0A 4QQBA 5HMZA 3CD6S 2DGVA 3PW4A 2HFVA 1S77D 1RT5B 2WVEA 3LPEA 5IWAJ 1CVJA 4U8VA 1HA1A 1FKOA 3LANA 1HIYA 3HSGA 3JSYA 1RISA 1S9GB 1SC4B 3MEKA 2DEJA 3OTEA 5HATA 4JUZA 3CD7A 4FXVA 4HTIA 3DU6A 4YB7A 3GIKA 2LU2A 4Z7CA 2HHUA 1U1KA 2HVEA 3PIOQ 3W5XA 3SI8A 4DPOA 3UD3P 1PJ5A 3WX8A 2F9DA 2YNHA 4P2XA 1T3NA 3NNHA 1TL4A 1D0EA 2K2PA 4WFXA 3MM6A 1UA0A 4WFAQ 4OI1A 4MYTA 4OYBA 5KFNA 4X62F 3UR0A 2BKOA 2BA9A 2AX1A 2PC6A 4HTJA 1O0PA 1WORA 4MT1A 4CM2A 4ZLPA 4N5SA 1R0AA 5B0BA 4ED7A 2HZAA 1CULB 4HR2A 4UQGA 4J9SA 4DLEA 1NKBA 4ZHRB 4A8FA 3MF5A 1TL1A 1R27B 7AT1B 1N48A 1U8SA 3WIUA 5C5JA 2V4JA 3OTDA 2V69A 2FU2A 2VFSA 3IS9B 3JTOA 4KPYA 1YRUA 1PGZA 4DV7J 3KHHA 3PFEA 4I2QA 2DY1A 2V34A 2VODA 2K06A 4FBUA 2RDJA 1SIZA 2HQCA 4IQMA 1NB2A 4OHXA 2DRDA 2ZVIA 2AIRB 2ZZTA 3FCHA 2OO4A 3K17A 2A10A 4ZS6A 5A6WA 5C42B 3QJLA 4RW8A 2A1BA 4DPUA 1VLYA 1LWXA 5CXTA 1G3OA 1RABB 3SQOP 3GWCA 5DG8A 3ILOA 3KLEB 1WOSA 2C3OA 2KG0A 2CZVC 2M7SA 3ZZYA 4NA3A 2NYHA 3Q8QB 3HPOA 1Q16B 4P2FA 5HQ8A 3K5LA 2V63A 3NEKA 3VF0B 2BM0A 3HZEA 4ZPDA 3PZPA 2BL8A 3K5NA 4ZN3A 2KXFA 3CDEA 2GVDB 2LP4A 3D6HB 1SKUB 1X4CA 2GFFA 1IWAA 2GZOA 2GIQA 2PN6A 1YRXA 2HGMA 2D41A 2LQBA 2MHEA 4DBQA 5IV4A 1KS2A 2XYGB 4DR4J 2HNYA 2XYPB 1PBUA 2KRRA 1Q8LA 2J6TA 3TR5A 1XQIA 2AZ3A 5DLGA 3L7UA 3K2YA 3BGUA 4DX7A 4PQUB 1OQ6A 3H59A 3OR1B 3CO9A 1PKUA 1YZ6A 2E5JA 1WKKA 2ZOFA 2UVVA 1AXQA 2IC3A 3M8RA 1VQ7S 3AJDA 4JI2F 4ELTA 3NY0A 4B3RJ 2BABA 3D67A 2OEKA 4WTYA 2BVZA 5E3PA 4WTOB 3VGTA 2FJAB 1REGX 2KM8C 3G9CA 1GH8A 2DT9A 3B55A 4A46A 2C2RA 3CJ8A 4A8WA 3LF0A 2VC1A 2E5HA 3CEDA 5KTQA 2IDEA 4M5KA 5IT0A 3F73A 2VICA 3D5MA 4GKJJ 3DRSB 4W90B 1OYDA 2CA9A 2J0WA 5BYRA 1WOOA 3NG8A 2XMXA 5D78A 4DI6A 2GIFA 4B9LA 1YTYA 2OSRA 3RYLA 1T9YA 1UVMA 3BZQA 4DV3F 3LJ2A 1VYAA 3GYNA 2KZMA 3Q8RB 1H0HB 2FHJA 4Y6IA 1WC0A 2HHXA 2P6SA 1HPZA 3NKYA 1AZSA 5IM0A 1NO8A 2V8PA 1HWJA 4QWAA 1BWVA 1YDLA 1N5YA 2G4BA 1MROB 1VQMS 1N36J 3RW6A 4L72B 3LP2A 4H4OA 4TYBA 3MM9A 3P45B 1KLMA 1AUDA 3FBVA 3QT5A 2OHDA 3D0IE 3DRYA 3FRZA 3HHLA 2HNDB 4DN9A 4MFBB 2VDHA 3OTBA 1WG5A 5EWEA 2AJ2A 2Y8YA 4DR4F 1EHWA 4ED2A 1YJTA 3GJQB 5CAAA 2LQ8A 1YG0A 3A8JA 3ZZRA 1N32F 1IBMF 2YNGA 4NA1A 3NWGA 3ICLA 3UR3C 4NZ0A 2CPDA 4F0MA 2I1RA 2LFVA 4OI2A 3OTOJ 1Y5LB 4JV0A 5A76A 5D8HB 4OJ1A 1YBUA 4DV6J 3S8SA 1RKJA 1S1WA 3IG1A 4M5HA 4UZBA 2BW7A 1FXLA 2OPSA 5D4PA 4WPAA 4ECQA 2BBEA 1R31A 4KY3A 4OYXA 1DHMA 3TQ1A 3R5AA 3DLHA 4JV5J 1BHNA 1FK9A 1H7WA 1QJHA 1Y7PA 4ZP7A 5B09A 1SH0A 4UT4A 1KRPA 4IR1A 3JAMU 5B08A 4QU7A 3B54A 3UDVA 1AW0A 1PJ6A 4F0HA 2KFYA 1FX4A 3NGTA 4EK2A 4RW6B 1MN7A 3M2RA 4NZ7A 4JB8B 3HX9A 4P52A 2E7XA 3C6TB 4DF8A 3DHXA 2J6UA 1PIEA 2B3TB 1NDCA 3NP5A 2D3O1 1RQ0A 4BWMA 5A6PA 4OQJA 2DH8A 2C28A 1Q1KA 4K4YA 2CWKA 5CABA 5GAGI 3QSYB 4WK1A 5GMKa 4B9VA 2AV5A 1N52B 4JYAF 3I0RB 1NEEA 3QQCD 5C2CA 1YZ7A 3VVUA 4IG0B 4RLEA 4WJBA 5HMYA 3RB3A 4QWEA 1VI7A 1VIOA 1HR0F 4KHPF 1L5UA 3EPIA 1KR4A 1H2VZ 4CZCA 2AYMA 2J7UA 1D9DA 1LEOA 1XR6A 2GJIA 1F2HA 3M8PB 3P23A 2HBRB 1WDTA 1FESA 1HHSA 1XMBA 2W4PA 2NXJA 4LF7F 5BYQA 4KGKA 3LA0A 4CT8A 5I4MA 3DMJB 2FYXA 3DLKB 2GSCA 4I67A 3N6LA 3C46A 5DS7A 1WTFA 1JLEB 1YO7A 2HS0A 3FFIA 4MAKA 3W5YA 4X4RA 3ZTRA 3WDOA 2FVRA 3FKBA 2BQUA 3D9BA 4FS1A 2BQ3A 1RT2B 4FS2A 2ZC3A 3MUMP 3NOCA 2RF2B 4DR5J 2EC0A 1FRKA 1U0HB 1WI6A 3DN9A 3L09A 3MAAA 2XC9A 4PWDB 2V67A 1D09B 5KG0A 3HSDA 1PBAA 3QGIA 4KKOB 2FZGB 3FFIB 2UUAF 1U4BA 1HBMA 3RBXA 5IQQA 1SPBP 1FTCA 5HJYA 2F4VJ 3M4XA 5JMNA 1KN6A 2EFPA 3KWMA 4FVCA 1SL2A 5I3QA 3A3NB 4MK8A 1PSDA 1SI9A 1B0TA 1BMQB 2B9EA 4W98A 1TKDA 4PWUA 2H4YB 3CULA 4MFBA 2BJ9A 3ADAC 3W8GA 3D3CJ 1LWCA 4J9NA 3PKYA 4QYZJ 1SVDA 4WFZA 3JB9k 3UW1A 1J5EJ 4B3MJ 2R7VA 3HCXA 1S79A 4ZPTR 2XBPA 1QE1B 3MM5A 3MMAB 2KJVA 3HJVA 4GVLA 2X1FA 6AT1B 3CNQP 4LUBA 4ZCIA 3GFHA 4DS5A 1JQOA 1R43A 1U1OA 1NSPA 1I6JA 3FDSA 5LMUJ 2Z0GA 1OY6A 3EXCX 2UXDJ 5KT4A 2L9WA 2ZH6A 2E9ZA 2GS8A 3MZIA 4NOHA 4WKYA 4ZLNA 3I9V1 3OXFA 3BR8A 3SIPB 3ILLA 4YZ9A 1KNZA 4RUHA 4LMZA 4P9SA 3CWJA 2YNHB 3EZ5A 5JVGQ 4LR9A 1YX2A 2OELA 4PYDA 1FVQA 1YJWS 2JBWA 2F4FA 5A8WB 4JI5J 2E9RX 5K14B 3CPWR 4C0OC 1Q53A 2OMOA 2GHVC 4RNOA 3JS9A 2HGNA 2PIIA 3JXOA 3NAIA 2LEAA 2BEFA 4V19J 2ZITA 2ZW3A 2F40A 2BUNA 2IC3B 1ZTWA 4FYDA 1M5SA 2MGZA 2YX4A 3KHGA 4USKA 1NUEA 2CQ4A 2HG4A 3Q22A 1RYSA 1BQNA 2KU7A 3ENWA 1YI2S 3T1HF 3D1HA 1HFEL 2FLPA 1T0TV 2WW4A 1GMWA 2JH3A 3N5FA 1T8EA 1BC6A 3NS6A 1VBXA 1GXTA 4XAKA 4ZP9A 4EO8A 3GIRA 1W7WA 2XMAA 2R7XA 1X5PA 4Q8EA 2FHJD 3UPFA 3ITHA 2QGFB 1T9UA 2VG5A 5HVFA 2G1HA 2Z8QA 3T9NA 2ZD1A 4DX8H 1GK8A 3GR0A 3W2WB 3KK2A 2CXEA 5THWA 1JLFB 3FUYA 4UOHA 1N34F 3CSKA 3HHLB 4V1Ak 2CNNB 5A0YB 3A12A 3S7RA 4LFCJ 3OR2A 2W9AA 1P1TA 2J7KA 2WONB 1JB0C 5DRKA 1XR7A 1WC3A 1S1VB 3H5UA 2LDIA 4M63A 2HGLA 1VS3A 1LOUA 1YLXA 2B4OA 4TY9A 3SQGB 5C25B 2XY5A 3PY8A 2FDNA 4A8OA 5KFHA 4L3KA 2OLWA 4LREA 3OVSA 1HKAA 4QYRA 1S1VA 1YSJA 4P6QA 2PE8A 4J9QA 4B9NA 1WHYA 3CJSA 3GFZA 4ZITA 1HMVB 2X3GA 4UZCA 4ECVA 2Z56B 3IBWA 1DQ8A 1OY8A 3GTYX 2CPXA 2R2UA 3OSPA 3QFHA 1RWXB 3KFWX 3M8YA 2H5EA 2IRXA 4Z37A 1UMJA 2JB1A 1N8RT 3DLGA 1SQFA 4OYOA 2IFXA 4CDIA 2E8GA 2ZBCA 2KHCA 3U27A 1WSVA 4NA2A 3C19A 2O01C 2XEXA 1B70B 3PEHA 2MZQA 3MPWA 3TJAA 4DU8A 4F3MA 2FVQA 2ALZA 1GMUA 1PG5B 4LBPA 4AE5A 1N32J 2VONA 4J7CA 4YZDA 1TL5A 4I4BA 4AL5A 3LJ1A 1WG1A 5KFPA 2XM3A 1KC8T 1JNRB 3CD0A 2M52A 3RTVA 1IR0A 1FX2A 2J9EA 3BKUA 4ANCA 3P49B 2XCAA 2EI5A 4QW8A 4R0JA 2ZNYA 2DNHA 4BLGA 3SZ2A 2IVMA 1EKSA 1MROA 2DH7A 4KIAA 4WU3A 5IT4A 4F4XA 3PW2A 1MMLA 3UN2A 1WACA 3M6VA 4NYZA 5A8WA 1Q81T 2DTJA 2NUUG 2RQCA 3AFGA 3S01A 2Z58B 4ECXA 2HHVA 2X1BA 2IVYA 5LXRA 4ATNA 4JI8J 4K4TA 1NPKA 1UTAA 2BM1A 2M5YA 1AT1B 1T11A 2OFGX 1VQKS 5DQGA 1KHWA 1YVFA 1AZSB 2MJNA 4TKTA 5IM0B 2FD2A 4PG7A 1FRHA 3PYEA 2L3MA 3AB4B 5DDRC 3H5YA 1JLGA 3DA4A 2K1RB 3I9V9 5HI7A 4LJMA 1Y10A 4AD6A 4PXBA 4WIIA 1A0OB 5KFUA 3W2WA 3KK2B 4DQRA 2CPEA 4LF4F 2YNFA 4ZVPB 2XY6A 3GIJA 3FC9A 2D3UA 3K0JA 3IO1A 3IAM1 5CD4H 4OI0A 1IBMJ 2GX8A 4ZVRB 4ILLA 3TZWA 2CDQA 4CTAB 3IXQA 4N47A 4DR3F 3TVZA 2VOPA 2JB2A 1RT4B 4KBIA 1U1QA 4K0KJ 4KGXB 1S72S 1JLFA 5CZVA 2BV3A 5F8LA 2V8DA 2RH3A 1HNZF 3LJ0A 4ZVFA 1V6HA 5LOQA 4W92B 4NL5A 4HH1A 1XTZA 2QSBA 3V2UC 2D69A 3M8SA 2W4CA 3G96A 1RBLA 2ZM6F 5D3GB 4JI1F 7FDRA 3DLEA 1C0TB 1ROFA 2DHSA 1DY3A 3NGDA 1U1MA 4IR9A 3VWSA 8ATCB 3DLLQ 3EDRB 1FKPB 2YWKA 1N56A 2B5JA 1URNA 2Y1LB 3I4PA 1FRIA 1HQUA 3I96A 3MECA 4U95A 5A2QU 2NLWA 3OHAA 3H7HB 1WC6A 3KJVB 2HS3A 1S0MA 2EKNA 4TU9A 2DGSA 1T3OA 1X31C 1IKXB 3W64A 1MW7A 1HNXF 1H73A 2J9DA 2XMVA 2ZC4A 3H42A 2DVIA 3RAMA 1Q95G 5CA5A 4GKKJ 4ECTA 3NGRA 1GNKA 1WOPA 3I5CA 1FKOB 2G0CA 3MAHA 4CLKA 5CCLA 3J81Y 4Q0BA 3IM9A 3R5DA 4LRAA 2UUCJ 2ABYA 2C3YA 1S9EB 2AD9A 3UE2A 3UN3A 4DFMA 2ETDA 4K4WA 4B9SA 2NSBA 1EP4A 4NWBA 2HAFA 2QV6A 3P8BB 3N79A 2QA4S 2YFBA 1Q86T 2JFDA 2DNPA 2FHMA 5J2PA 4OHVA 1Q82T 1F3VA 4DSEA 1O8BA 3SFGA 4Y2KA 2D1CA 3IAM9 4ZHRA 5AJ3F 2DGUA 4ZIVA 1R6YA 4KAIA 5K14A 1K1QA 2BACA 3LAKA 3VAKA 2XGPA 2H1YA 2KYZA 4IO1A 3IRWP 1M5OC 2KVQE 2HS4A 5K9FA 1RAIB 1QTNB 2FJBB 1UPPA 2VFRA 4F0KA 2UXBF 3M8QA 4MK9A 5CQGA 4EBCA 2ZKTA 1Q5YA 1RJJA 2W2NP 2BJ7A 3DRRB 2CJQA 3FQLA 3M1VB 3PJ9A 4NE9C 3CJTA 1YK9A 3WHIA 4EWTA 2DR9A 2RKIB 5IT9Y 4WK3A 3UNGC 4PUOA 3H2VE 4UUWA 3OTCA 3UDEA 1SIWB 2JVRA 3SCJE 2X7IA 3H5SA 5KT5A 2DO4A 2VIHA 1BWEA 3MXHP 5B7WA 4C7QA 3N5BA 1LNQA 2P8IA 3NS7B 3MPDA 1C0UB 2MEWA 1S0VA 1CJKB 4RBVA 4ZA1A 1VC6A 2QA2A 1NJXA 1NK6A 3JYTB 1QUPA 3LW5C 4NX9A 4X62J 3HVRA 1SL1A 4QWDA 3KMSA 1O5JA 1QAIA 2VOOA 1S59A 1C0UA 3HI9A 1XMOF 2PSZA 2CQDA 3DHWC 3L95X 4KQZA 1JLAB 4LIRA 4K5SA 5HBMB 3R5GA 4A8XA 4K5RA 3L3CA 3H25A 2LQ5A 4CLSA 4DQIA 3AAWB 2ILYA 2U2FA 3O1LA 2WAQD 3U1MA 3KMQA 1PYTA 3L9ZA 2H54B 1WTBA 1JMTA 2AP6A 2HRYA 3AD8C 4HI1A 1GQEA 5KFVA 1EX8A 4B9TA 3BDPA 3UITA 2ZH2A 2ZDPA 3V4IA 1WD6A 4QCLA 3T5JA 4JI5F 4LF5F 5IFMA 4C4WA 5EX0A 3CE8A 4AT1B 1D8ZA 3R27A 3SCIE 1LK5A 2GO9A 4IH7A 4U6RA 1Z2LA 4C6AA 2WVCA 1YJRA 1ZM9A 2AYGA 1CPZA 4USVA 2R4FA 3UO0A 2G2YA 4IUFA 1N6QB 2RB7A 3J7YU 3OL6A 1U25A 2DR8A 3N28A 4USMA 5DDQC 2NZCA 2R8KA 2QLFB 4K59A 1IBLF 3TARA 4DQPA 1S9EA 4DS4A 4P73A 2ZRRA 1KKHA 4AS2A 3GFYA 2HFZA 2IP6A 2K1RA 2R7QA 4NI2B 3AA8A 1LW0A 3TA0A 1B7FA 1D1UA 2YVSA 4EFAC 3PHEA 3W5ZA 2M2BA 4XPCA 3TP2A 2Y1JA 3AQOA 3Q83A 5A0YA 1CQMA 1OO0B 3W3SA 2YPZA 3BGOP 3IBCB 4M95A 4HHHA 1BXNA 2ZEJA 4EZ6A 4ELUA 2HVIA 4XPEA 1O6XA 1C0TA 1FWPA 2QMWA 5F0UA 4RX6A 4RWXA 2K7JA 3BBCA 3FSXA 2MXYA 2JB3A 2IYGA 1D3WA 4MKBA 3FSYA 4GC7A 1IKVB 3PKMA 1K0TA 5C42A 1LQ9A 3GV5B 1NJZA 1TU0B 2ILZA 1S7HA 3OFHA 5KFFA 1F9EB 9ATCB 3AOBA 2Y0BB 4C11A 4IFVA 2UUBF 2R2RA 3B6BA 4RWWA 2GV1A 2WBRA 3F44A 5KFOA 1SJFA 1E6VA 1VQ9S 1HYSA 1HHQA 1P9YA 4CWBA 3N0VA 1F6TA 3KDOA 4L73A 1M5PC 4IG3B 1Y0HA 5A8KA 4TQSA 4O3SA 3MTJA 4ER8A 2JZ5A 3NCQA 5K8MA 3H90A 5T41A 4Z2XA 5KG2A 3IWLA 3G87A 2LU1A 2MHNA 3OUYA 2DPJA 4DSKA 2XMUA 1A9NB 4AL7A 1L3UA 1UVKA 3M2UA 4K4XA 1JLBA 1VISA 1RHJB 5E3QA 3QRPA 4OLPA 1UZDA 3PHTA 1RWKB 2YBVA 5ETQA 4ANEA 2ZH8A 4G1IA 4LR7A 2DNNA 2I5JA 4RW7B 5KFXA 3Q86A 2EFNA 3M7VA 4RW6A 1YHQS 4F02A 2MMYA 2FJXA 4WZQA 4LF7J 2YXLA 1NKEA 2N7YA 2ZZNA 3US5A 2JAEA 4KFBA 2MKKA 9RUBA 3TA2A 4F25A 4ZCKA 4B08A 2KXNB 3P4UB 4L3NA 5JJBA 2XLIA 3ITHB 2YKMA 2CJKA 5GVQA 3T6BA 3EZOA 2HBZB 3MOZA 5E0OA 2RMLA 3EICA 4X66J 5IC4B 2W24A 4DV0J 3GFXA 4RU2A 1JKHA 4GKJF 2ZVSA 4C8ZA 2FJDB 2ASJA 3IMQJ 4LFAJ 1SC6A 4EMDA 1D9AA 2BANA 2VDIA 2MQQA 3I0SB 3HK2A 4O0IA 2MKJA 1TP7A 1WG4A 5FDLA 4D3GA 4QU6A 4HH0A 1T9WA 2NPIA 2LQ9A 2ZOGA 1I1GA 2Z2MA 3MMCB 3QNWB 5G0RB 5A2QY 1YGYA 2FB0A 3VAMA 4C3MA 2RUSA 2DB1A 2KH9A 2R7WA 3IC1A 3SSRA 5AXNA 4OX9J 4ILMA 3HSJA 1N5TA 3RRGA 4NLYA 3CIZA 3Q8SB 5L38A 3G8TA 1CG2A 3VQSA 4DCJB 3ILIA 2RS8A 4H4OB 4HEA9 2DGXA 3PACA 1MWQA 4ES1A 3RRHA 1Q0NA 1VGYA 1NU4A 4A8SA 2KL8A 3UD5A 1HBOA 2DJWA 4ZVQB 2F6MB 1W25A 2A6MA 5DG9A 5L8RC 3AY0A 3E01A 4Q44A 1N36F 2MZ1A 2N3LA 2H65B 3CIMA 2PDAA 4OHYA 4LRFA 5HLFA 1WC1A 3PYFA 5A8RB 5I3UA 3RB0A 1EQ0A 1M1KT 4DSIA 1ZM2A 2YH0A 3GE9A 3KLGB 4F36A 4OZJA 1GTHA 2RRAA 4NZ6A 4WXOA 2XTQA 5F3TA 2A3JA 3KHRA 5F8IA 1XNRJ 4X64F 3NL0A 4N7TA 1AFIA 2NREA 4DPXA 5C2GA 2GGPA 4DL3A 4IFYA 2XULA 1KD1T 5T7LA 1UZHA 4ZOSA 4J9OA 4OLOA 4QIGA 2A0FB 3FQKA 1F9FA 2P9CA 4Z7YA 2W8LA 1PO6A 4UY85 4NCGB 1C1BB 1ZPWX 3OXLA 3ISND 5DJBA 1RTIB 2CQ2A 3CJQA 4CLYA 3T5HA 5HROA 3A3OB 5BJRA 2X1GA 2BE2A 4ZPBA 1TAQA 2IPOB 3C15B 1RYRA 1NLKL 1S0NA 1C4CA 4Y0FA 2IRYA 5LXYA 2VPWB 1Y5NB 3CO0P 4ZMMA 3QZ8A 2B6AA 2AEJA 4OYZA 3FJ2A 4OJHA 4PAAA 2CQIA 3RBZA 3CJ4A 1B64A 1U0SA 2L08A 3MAAB 1REVB 3W62A 1SC1B 4IYQA 5F8HA 4PWDA 4U67Q 4R5PB 2W9BA 1NJYA 3C14A 2BOPA 1LK7A 2D3ZA 2VPYB 4OX8A 2AQ4A 2RADA 2GW8A 2WVFA 4TLRA 3C6UB 1F5BA 1XK8A 1NXIA 1LWFB 3VZHA 1LW0B 3LALA 1ITPA 3V6HA 3M6UA 1XIQA 3RGIA 4EU0A 1QM9A 2ZWOA 3CDUA 1VK8A 4UOGA 4B9UA 2JLFA 2E1PA 2YY3A 3C16B 2QT7A 1FJCA 2JL9A 2HQIA 3DYAA 2R8IA 4PABA 3VAHA 1KOHA 4C3LA 1AUSL 4FXWA 4CCHA 4PRFA 2AHOB 4H54A 3GIIA 3JQJA 3NGUA 3BGRB 3MPVA 2YKNA 1RBOB 3IR7B 1W26A 1YBAA 5LSRA 4QPXA 2FQQB 4ZVEA 3AD7C 2C3PA 4LIWA 3TANA 3NXZA 3T5LA 2FZKB 2OSQA 2XI2A 4OZ3A 2CQPA 1IKWB 2HQ3A 2V6AA 4YB6A 3W66A 5KFSA 4O1OA 3W9HA 4C98A 3D0GE 1WSRA 3UCUP 1ZH5A 1UVNA 4J5OA 1TUVA 4DV0F 1N88A 3H20A 4HI2A 3K8VA 4X4VA 2RHQB 4CH7A 1ZAWA 4CLFA 2G2ZA 1XEZA 2B56A 2Z57B 1X0FA 3SFUA 5GAEI 1RTDA 4OYIA 4TU8A 2G2OA 3UVJA 3FK4A 3M2VA 4GRSA 5HANA 3ZTPA 5AJ3J 3BSOA 5H9EK 4BC7A 2UXDF 5KFRA 3ZZPA 2W2QP 4ZVSB 3DMJA 2WB4A 1GXLA 4P7TA 3HDSA 3Q8YA 4MIAA 2OTJS 3R6LB 3QGHA 4I0WA 2DNGA 4OAUC 2CADA 4J37A 4UOFA 2ATCB 3MD1A 4C8KA 4NCBA 4CRJA 4PUOB 5RUBA 2KZZA 4NLVA 1AFJA 1RCXB 2VG7B 1VJWA 4P74A 3DLKA 2CPYA 5EHHA 2K3KA 2MKIA 5B0DA 5DGAA 1XJWB 5L46A 1RAAB 5B0FA 4PYAA 1UEUA 2QYGA 5D4NA 2CFXA 1CC7A 3I9ZA 1SL0A 1DRZA 3BO2A 2RRBA 3TQEA 1UW9A 5KFJA 3G8SA 4HACA 2VJVA 5DGBA 4CLPA 4AQYJ 1TQLA 2WSEC 1R0CB 2RSQA 4FZVA 2EXUA 1CJTB 2O67A 3DC2A 2IVFB 2WONA 3MUTP 1EETA 4A48A 2BXJA 1G6BA 3HF5A 1DTTA 2AKWB 4CH1A 1UKUA 2C2NA 3EYZA 2LXFA 2NZ4A 2FGCA 2HMIA 5I3UB 2V2VA 1K9MT 2UVRA 4RO0A 3FBEA 3LAMA 3LUYA 1QUVA 4FNHA 1LWEB 1MU2A 4LQ3A 4G76A 1FK9B 2GCFA 1EZZB 2DBBA 3BSCA 3HVTA 4KGZB 2CRLA 4PPZA 2N3OA 1J5EF 3IM8A 1S76D 2R7UA 2HHQA 3G8QA 4K2XA 4LF9J 1S1WB 3IG1B 1KSPA 4EGLA 2W2PP 1RTJA 4ZP8A 4I7FA 3KOAA 3R97A 1LWCB 4LF9F 1KFDA 1NHKL 2VB6A 5HSPA 3BQ0A 1SV5B 1B4SA 3ZZUA 3HD2A 2L48A 4U7UK 1RXOB 2IAJB 4KSEB 1FRLA 1PYOB 4PL3A 2QL7B 4DXLA 5FIIA 1FNMA 2VQEF 1L3KA 5IOLA 2DNLA 3VCDA 3L7PA 4OI4A 4A47A 3MAQA 2PMZD 4LF1A 1X0PA 4B3MF 1ZOTA 1N54B 4G75A 4RKUC 1UEVA 1IUJA 4UW2A 5ETNA 3R8YA 4YR0A 4DR3J 2CQ3A 1RWUA 4YY3F 2ZE2B 5B0EA 4YB5A 2RU9A 4I56A 5KAKA 1J2VA 3QIPA 5BYSA 4AQYF 1NKCA 1X4AA 5LMUF 2YWWA 2QFIA 2ZH5A 3ZTSA 3QMQA 2M3DA 3PRBA 3R7NB 4NV2A 2EEYA 4A4JA 3ISZA 2QO3A 4DZ6A 3C2PA 1HR0J 4ED5A 4RNFA 3J7Z5 2VQFJ 3BSNA 5B0CA 1N0UA 2VBXA 5J1EB 4RNHA 3EGZA 2B43A 2Q1LA 5D77A 3ULHA 1DLOA 4X66F 2DGQA 5AE2A 5LSLA 3DRSA 3G6YA 4MIWA 2E5IA 2KTQA 2HPUA 1TKTA 3BREA 3LGHA 4QZVB 3THTA 4DL6A 4HDHA 2V6EA 5KG6A 3QRQA 2GMLA 1CEZA 2CNKB 3J81j 1RE1B 2ZH9A 3CJ2A 4Q7AA 3GILA 1U2RA 3CVKA 4NEYA 3DDIA 3N9UC 1ELOA 4XIUA 5F8NA 1Q4RA 1LXNA 3CD5A 4O44B 2QL9B 3QGPA 3DRRA 4MK7A 4NRTA 1L3SA 3PO5A 4H4KA 1FEHA 1CJTA 3CDBA 4KB7A 5AE1A 3TZYA 4ED0A 2FHKA 3NOGA 2RQKA 5L1LA 1X5OA 4J9MA 4F2RA 1N0VC 4ES3A 4CLTA 5K5MA 2CPHA 1HBUA 1ICEB 2B4VA 2PO4A 4ID5B 3OSNA 3GJTB 1NSAA 2MKYA 5D4LA 2ZH1A 1JIHA 4CQ1A 2WOMA 2HQDA 1HBOB 2OFHX 4FN5A 2HFSA 3DRXA 4QIVA 4DPYA 2F8HA 4YUDA 2RQ4A 5ETMA 1LWFA 1S9GA 2CQBA 5GMDA 3S6EA 3TZZA 4NLWA 4WU2A 1JNZB 4Q45A 2Q3PA 1HQUB 3MECB 3GPAA 2R3VA 5K8NA 2MYFA 4FYXB 3PO4A 1JXEA 4JI7J 4KHPJ 4BS2A 4E0DA 3PVXA 1CJKA 1SH3A 1LFWA 2YKAA 1KTQA 2DGWA 5HBMA 1UJ6A 3DKDA 5HN0A 2XI3A 3OXGA 4YR3A 3PDNA 2DXEA 2DHGA 2BQRA 1FDDA 3THPA 1IQTA 5GAGU 2M8DB 2P9GA 4HLBA 1BQMA 3BSAA 2BYCA 5GAHU 2RHSB 2ZDOA 4Y34A 1L3TA 3HXMA 2W7AA 3L0IA 1V3RA 4O23A 3PIPQ 2XO6A 1XMQJ 4CO3A 3QJJA 2RUGA 1SJ8A 2CVIA 3WBZA 2MQOA 2K19A 3MMBB 4C8MA 2OJ3A 4NYPA 3EXYA 1UJ5A 3PCOB 2MSSA 3FEYB 4DG1A 3G6XA 2LEBA 1T9VA 3T1HJ 4F4KA 1RI7A 2HRTA 2HHSA 1AA1B 1FF2A 4OJGA 2F7VA 2BJ3A 3M8ZA 4NCGA 4HACB 2PMWA 4O3OA 4Y2CA 1S4FA 1X4EA 3FZBA 1S6QA 3GIMA 2JOQA 5L1IA 2Y8WA 4G1QB 2CNLB 1CLFA 1UW4A 2X1AA 1TKZB 2PFFB 5MLCV 4OYMA 4CLWA 1NNDA 3VAIA 2RILA 4P75A 2HWIA 1TMJA 3ZTOA 2J6SA 4S0MA 1VCTA 4TYAA 1ULRA 4DSFA 4F7VA 2K3IA 3K5OA 3M9OB 1Y11A 4JI0J 1MMDA 3MM6B 1PYSB 3SV3A 4HEA1 2MKHA 4A8QA 2PFDA 3FMBA 3DOLB 5KFLA 1YQHA 3I31A 4JI0F 1UVLA 4N56A 4JCVE 2LVWA 4G6VB 1RHUB 4I2PB 3PYGA 5E41A 2QA4G 8RUCA 2DXFA 3DFEA 3MEEA 4J91A 3V6DB 2AJ1A 2OPQB 4OZ5A 2FUG1 1T95A 2ZBQA 1NSQA 1F1BB 2EW9A 3MM7A 3CCJS 1K1SA 4BC9A 4Y2MA 4IH6A 2NUHA 4ECUA 2LMIA 2FY1A 4PEOA 2HLTA 3EGWB 4NMLA 2DR7A 1X4GA 4Y2AA 4PKDB 1MLAA 1S12A 3PFOA 4JI7F 2KFZA 1ZA1B 2ZH7A 4MKYA 4J9PA 1S10A 1UFKA 4ZDNA 1P27B 2BW2A 4E98A 2B7BB 1XMQF 4RBTA 1LXJA 3AJFA 3H2LA 3AQPA 3PR5B 5AE3A 1F60B 2XWXA 4WKRA 2JNJA 3VTIA 3JYTA 2V94A 5DZ7A 3HMJG 4HHUA 1TFWA 4RW9A 1LW2B 4IOBA 2HHPA 3F4MA 5KFIA 1R8PA 3DRPB 3E51A 1N5VA 2BOAA 2GHPA 3HHLC 4WBFA 3FVYA 5F8JA 2Z2LA 2QRRA 4L6V3 2DCUB 2P9EA 1C1BA 1VHFA 3MM5B 2OP5A 3EGVA 2MPUA 3J7YI 1U47A 2IMWP 1N4LA 1I94F 1UVJA 2W2OP 5KFWA 2H51B 5T14A 1ZYQA 1U5KA 1IBCB 5LT5A 4R8UB 2DRBA 3LP1B 1U6ZA 5H9FK 2C2OB 2J76E 3D6TB 2MSTA 4LSNA 3KK1B 4C9DA 2CWXA 3IWXA 3OVBA 1H98A 2I5JB 1K44A 4OX7A 1OSCA 2XY7A 3M2RB 4TU7A 4ED3A 1N34J 3EZUA 4PPDA 2CQ1A 5DETA 1NK9A 2DH9A 4K7QA 1N5QA 4O3NA 4MYUA 5DQIA 4DSJA 2MQNA 4FNIA 3J7AN 5CYJA 5C24A 5E3AA 4DJBA 4DV1J 1LV5A 1FKAF 3CB4A 4HFVA 2ZWPA 4BWJA 1R8BA 1SJ3P 2UVUA 1R0BG 2RVJA 4IOAQ 2IM0A 1VRQC 4BDPA 2YH1A 2DHHA 3KLFB 3K5MA 5FJ4A 1Y3KA 3AXMA 4KKOA 2AYBA 2DNMA 3T3FA 3TUJC 2VFVA 4YHHJ 4A8YA 4LFBJ 1CQNA 4USHA 4TQRA 4QWBA 4C0HA 2WSFC 1DURA 4F8RA 2CPJA 2BE9B 2OIHA 1TR0A 1KBRA 2EVZA 1NHUA 3P3DA 1T9XA 2CQGA 2IM3A 4DPWA 6FD1A 2CZ9A 3KG1A 4XK8C 5I42B 2A6OA 4JYAJ 3B82A 1SV5A 2Y1RI 1JLQA 3BEGB 2BRLA 1X4HA 4URSA 2HVDA 3R9LA 4C0BA 3HO1A 4DV6F 1GX6A 3MM9B 1HBUB 2IJNA 4IDKA 3K59A 1JXLA 2B51A 1NDPA 4KPCA 1M0SA 1DQAA 2VUGA 3TEHB 2MY8A 3DOKB 2MZJA 3UCZP 3GCXP 1PCAA 1NK0A 4X4QA 1RT1A 2H9ZA 2DXDA 3NWRA 5H9FJ 4OL8A 3VVTA 3BGLA 4URGA 3FBBA 4HT7A 1T05B 5HLFB 3FNBA 3Q2TC 2CJAA 4FPRA 4LF8J 3D6MB 3QFWA 4ID5A 5F8GA 2IYIA 2Z30B 4DX6A 4OYAA 1IKYB 4JV5F 4RL1A 3Q8DA 2A2CA 1RT1B 2VBZA 3U02A 4NPOA 3VHQA 1TELA 1UVIA 4X65J 1VOMA 3TAPA 1T05A 1VQ6S 3AB2B 4Q2MA 2O1PA 4DL5A 4C11B 3TVKA 1S1XA 3UFCX 4ZKAA 4JOUA 1G2EA 1S57A 1WKLA 4JV2A 3DRPA 3BGFA 4JP8A 3M9MB 2W9BB 1HWLA 1ZS6A 5ETSA 3SCKE 2DGTA 4F3QA 4DV4F 1XMOJ 4C8LA 1MMNA 4Q0BB 5J2PB 5GAEU 4CIOA 5F0WA 2L1LB 4EUVA 5HP1A 2K8GA 3CDAA 1B0PA 2U1AA 4YEAA 2GIRA 2LECA 3V4IB 1K8AT 2FJWA 1BQXA 4J9KA 1HWUA 4CO5A 4P2SA 1RCOB 2AGOA 1RT6B 4ZPCA 5ETKA 4CI0B 2UXBJ 2XMJA 2H48B 4G65A 1JKHB 2E1AA 4C97A 1U24A 2UV8G 1F2GA 4LFBF 2AYEA 4OV1A 4XDDA 1HI0P 3GU0A 3J80U 4X4UA 1UCNA 3I82A 1Q7LB 2H3EB 2VG5B 4ZIWA 1JJCB 2HURA 3HM9A 2C3UA 2XSFA 4H4KC 4HL9A 3V6DA 4DR7F 2Y1IA 2FIUA 4LF2A 4YS2A 3QJPA 4LR8A 1U48A 3IR5B 2RKIA 3EPGA 4YN3B 4O3PA 1OS5A 2X3DA 2XMKA 4UQTA 1SBRA 5F8MA 3I56S 3AHPA 1IJFB 4DFKA 3ZFVA 3CCRS 4N41A 4F4ZA 2MKSA 1NDKA 4O44A 1M1GA 4K4UA 3P5TL 1QDUB 5E5NA 5F3ZA 4I6YA 3CJ0A 2C42A 2IJRA 1X9MA 3DOLA 2PD1A 1FNXH 4OZNA 3HVWA 1X4BA 3A8IA 4LRDA 3O2IA 3BKTA 3TVYA 4PXCA 1FWKA 3UCGA 4MTPA 3D0HE 3H2UB 4ZVGA 2ZH3A 4HYKA 4ECRA 2IA0A 3QRRA 1A6LA 2QN6B 3PX4A 1TVRA 1ZA2B 3GQCA 2BJ1A 4U9RA 4CLLA 5DM7Q 2OAUA 2RAQA 1IR1A 4ANDA 5K8OA 2QLWA 2CVEA 3GZ7A 2XHCA 4WWSA 5KT7A 4ECWA 1VQPS 3IA0A 3JSRA 2CJ9A 4USWA 1UJ4A 2EWHA 2V9WA 3CC4S 1VQNS 1FI4A 1H74A 4ELVA 3NNAA 2JEIA 5CYQA 1WF0A 1WWHA 4HKQA 2XLKA 1TUGB 2MJFB 1Q8KA 3AA9A 3BBFA 2QLXA 4ZVHA 2AJQA 1QE1A 4LBHA 3CCTA 2JX2A 4PQUA 3C3LA 4RW9B 4CNYA 1RADB 2QE5A 1CC8A 2UUBJ 5KFMA 2YWEA 2IMOA 1TAUA 2R7RA 1G1XA 1WC5A 4ETXA 1ZZNA 3FVVA 1YITS 4QR2A 2M8HA 1SUQA 3QO9B 4Z7HA 1KONA 1KTVA 2B0GA 2CJXB 3QAEA 4N8NA 2HHWA 4EYHB 3BR9A 3GJSB 3M2VB 3ZZTA 5BR8J 1DZ5A 2MY7A 4C8NA 4I2PA 1QVFR 3LP2B 4ECYA 1IM6A 2GQQA 4EEYA 3KLFA 3KJNB 2G9OA 1RWPB 3POTA 1Q8IA 1XN9A 1IVZA 1TMMA 4FF2A 1S1UA 3QATA 2BR0A 2LEPA 3VGVA 4FPIA 1Y5IB 2COLA 2QMXA 2B4UA 5KFDA 2EKYA 1HNIA 3MD3A 4GVBB 4N8OA 3V4MA 3R6GB 1WUUA 4HHJA 3KKFA 4CLZA 3G6ES 1B0VA 1O51A 2DHXA 3D1QA 3O8WA 5E3CA 2GVZB 5FLXY 2IA6A 5J2QA 4D3HA 2IBKA 3ZNUA 2Z4PA 4JI8F 4OZ0A 3T1YJ 2UP1A 4ZJOA 2JLGA 3RBDA 1UAWA 3M6WA 3QT7A 5I3PA 3TUPA 3ZNJ1 1N5SA 1XNQF 3R2CJ 1MWYA 1RP5A 4DL4A 3CC7S 1QAXA 4RNMA 1T9TA 3NRBA 3DDKA 4X2BA 2VU5A 4LF4J 1ZM3A 2IJFA 4I64A 3GV7B 1B7YB 4IFYB 3B4MA 3IFEA 1YBTA 3H98A 2CPIA 2ZUAA 4IFVB 4ZVUB 3PJWA 1J5OB 1S4EA 5D6GA 3HHKA 1FDBA 2C2ZB 2PEBA 4K8RA 1JLQB 4K0KF 1S5ZA 3D54A 1R6VA 3IBFB 3IWNC 4KO0B 1HQEB 2NS1B 3MR6A 1FCAA 1RTZA 2RU3A 4LBIA 4AUKA 2DY9A 1W3SA 4M5DA 5L39A 2I0XA 2HHHJ 4Q43A 5CZXA 2ROGA 4CO1A 4LT6A 2SXLA 1K47A 3BYRA 4QIWD 4USIA 3NBPB 5BR8F 4ZPWR 2DNKA 3ZZZA 2EC2A 1F0XA 3I55S 1KQGB 1VRTA 3I87A 5IZHA 1V5VA 3ET6A 1F3FA 3RZAA 2EK1A 2DPIA 3JQKA 1UL3A 5ETRA 2ZM6J 1RTIA 1ZBTA 4O0NA 1X7VA 5L9NA 2WTFA 3LH2S 4NXNF 5KFQA 4DQSA 2OPPA 1H3DA 3LPYA 1GXUA 2O66A 4PG6A 5HJXA 3HP6A 1DAXA 1FFWB 1C2PA 2HK3A 2WRMA 1TL7A 2FLOA 5IQ6A 3QWPA 2HK2A 4K2JA 5D0RA 3CJKB 3EWGA 4LVNP 3TO8A 3D4JA 5KOWA 4X4OA 2IY5B 4RJVA 1FFSB 4GC6A 3KYLA 3FCVA 1N6QA 4DR6F 3JSBA 1V9OA 3BB5A 3IAS1 2CDRB 3ELHA 3L7OA 4YDXA 5EWFA 2L41A 1SKSA 1HNVA 1VFJA 2EG2A 3DYAB 2G0JA 2ZNZA 3VZIA 2E29A 3WQPA 3CJKA 3AT1B 4MH8A 1FWLA 1HNIB 3Q24A 4ECSA 2HMIB 1RAOA 4OAVB 2JC1A 3OFGA 3PW7A 2JRSA 5ETVA 3HD1A 5KT3A 3PG9A 5SZTA 2WSCC 3GONA 3C6UA 3CTRA 4WP8A 4P7VA 5L1JA 2VKRA 3B78A 3G82B 4FYWB 3VGUA 1NK8A 3C66A 1QAJA 4ZCLA 1U49A 5A8RA 1RWMB 1Z2ZA 2XMMA 3HFKA 2LXIA 4JI3J 2CAZB 2E7WA 4PXDA 4QR0A 5EX3A 4CO0A 4YY3J 1SKRA 1UEKA 3C16A 4H4MB 3TA1A 4TN2A 4MIBA 3LOUA 4X4SA 1EKRA 4L76A 2N4DA 1N33F 2GMHA 3DLEB 5D0EA 5JUMA 2ASLA 3WC2A 4I68A 4QIEA 4B3OB 2O5DA 5HAOA 2F9JA 4GO5X 4UF4A 2GVDA 3OPKA 1HD1A 2WOMB 1RT5A 1WHVA 4FVMA 4QR1A 5KFAA 5DM6Q 4ED1A 2OMLA 4NEZA 3WC0A 2GNKA 3DLGB 1OPZA 3LGMA 1GEHA 5M2PA 3J80Y 1NPRA 2V4QA 4RUBA 3OFEA 8AT1B 4B02A 3NS5A 1DARA 4M94A 3OVAA 4RPFA 2F4VF 3LTOA 1SCJB 4WIQA 4FP9A 3RUBL 5CYQB 4OFZA 3D1OA 1GAOA 2KT5A 2AX0A 4FKXA 1JK9B 1VBKA 3EVOA 1Y9OA 3W60A 1E6YA 4FYYB 2QG9B 1RTHA 2KN4A 2YKQA 5KT2A 1SJQA 3ENAA 3ZC4A 2HNZA 1JLCA 3CT9A 3K7RA 2P2CB 3KUEA 2DGOA 2DK2A 2YFAA 2HQFA 5LNK1 2MKCA 3G2XA 3M8QB 3N6NA 1QD1A 1BE4A 3JAMY 3HHEA 2AEMA 2MB0B 2CKWA 2NYIA 2V5HG 1A7GE 1JLCB 1VLOA 3OL7A 4LVOP 5KT6A 1AB8A 4U8YA 2QSFA 4XTTA 3SYZA 4JI4F 3A8EA 3BM7A 2AMCB 3UQSA 2VL1A 3RR7A 1H6KX 5E7OB 2RD5C 4Q2LA 1X60A 2VG6A 3QT8A 2VBWA 4UTGA 2VG7A 2QYCA 3HHNB 2DITA 2PT0A 2V8HA 4LSLA 2XG8A 4M5GA 4RBUA 3VAJA 1QY7A 2M9KA 3U1LA 3PX6A 1NH7A 2G0IA 2GVZA 4HT5A 4PQAA 4Y00A 3VV2B 6FDRA 1HNZJ 1HNWJ 3TJ8A 1NAQA 1TL7B 2ZHAA 1Y4ZB 1NDLA 2J5AA 2LA4A 2FZCB 4DV5F 5F41A 3HT0A 4DPTA 4P10A 3BQ2A 4J9UE 4KV8A 1ZPVA 5HO4A 3OTOF 1WHWA 3K89A 2O3DA 2ZUGA 1VBYA 4DZDA 1VQYA 4O4GA 5J2NB 2BJ8A 2EFQA 2GA7A 3DDNA 4LSZB 4CLUA 5HQMA 2AZ1A 1U0HA 3NAHA 2KM8B 4JI1J 2BE7D 1TFYA 3C8YA 3EGNA 2P22B 1J27A 1FNOA 2B5JB 4IRCA 4LF6F 1S9FA 2DRAA 4DF4A 2XZWA 1SJ4P 3UWTA 2VF3A 3GV8B 1VIXA 4ITSA 4DR5F 3GG1A 3FCWA 1BGXT 4TXSA 3QPIA 5CH7B 3A13A 2MJUA 4B3OA 1OY9A 4KGMA 2EK6A 2HSEB 2QIFA 3BH7B 1RWWB 3BPDA 5E2QA 1RZMA 5AXMA 5LL6d 4WFBQ 2AGQA 1WJ9A 1RTDB 4FF1A 3AODA 3GLJA 2V50A 3SMZA 3MR5A 2VD3A 5HQLA 3CDWA 1WF1A 5DZ6A 1OWXA 3X3UA 1FD2A 5HGIA 3AJ1A 3MCNA 4M5JA 1CJUB 3BBBA 4OX6A 4DN0A 3RR8A 1NJIT 1TDPA 2QLBB 3CCUS 2M0GB 4FF3A 2LYVA 2WHOA 4P2MA 1UWAA 2I6WA 4B17A 4KC5A 1HPZB 2W7OA 3GSIA 4AL6A 1SQEA 1CULA 1Z1ZA 2DCLA 4F04B 1WEYA 2L9NA 3H8YA 1TKTB 2DR6A 4OV6A 5T7LB 4AXJA 5KFBA 1VQOS 1TK5A 4EZ9A 2CZ4A 1S1UB 1S6UA 1HNVB 3W7BA 3IR6B 1D9FA 1HLWA 5JXSA 4CNZA 3R5CA 1CJVB 3CMQA 3FNNA 3SSQA 1I3OB 2HLUA 1EJ7L 5GADI 3P6YC 3MCSA 2YKOA 1TZ0A 1DTQB 2R7OA 2PA3A 2YKPA 4F50A 4X4TA 4DR2J 3KHLA 5IC6B 1CSJA 2KRBA 2V2QA 1H2TZ 2XZTB 2J9CA 1ZETA 4ENOA 2DHAA 2M4MA 3I5AA 2AF6A 3MEDB 3PTWA 1VHIA 2CUYA 2FVCA 2POKA 4LRBA 4PXEA 5C7PA 2VKZG 1KP6A 3TJ9A 2YWGA 3TRGA 2OKQA 1HL6A 2VFTA 3AH6A 3G6VA 1RT4A 2ATLA 2HHTA 2ASYA 2G13A 3EDQB 1UETA 4OZ1A 3RAXA 2ZJRQ 4I69A 4C8OA 4J9VA 1RHRB 4NLRA 4K50A 2YNGB 2R2SA 2ZJPQ 4JI2J 4DL0C 4C2MA 1FE4A 3I0SA 3TEGA 2E7VA 3HKZD 4ED8A 1CBKA 1HQEA 1HNXJ 2FLLA 1IM4A 3QZ7A 3PEJA 4CO4A 3D66A 3CCVS 1RK8A 2VQEJ 3DI6B 2WZ1A 2D7SA 3GR1A 3FEZA 1S99A 2C2KB 1HHTP 2R8GA 3B8HA 2XCPA 4NMXA 2W7PA 1MNEA 3ENVA 2MQ8A 3DGPB 2JHEA 2QC3A 2MLYA 2W8KA 1VRUB 2EFVA 1S6OA 4NASA 1WHXA 2F8MA 2W9CB 1IBKJ 1NK5A 1FJEB 4O3QA 2D74B 4I6WA 1OPIA 1FJGF 1JJHA 1CS4B 2ROPA 2YNIA 1U7LA 1H2UX 2WK4A 1VQ4S 1QSYA 2YWFA 1X4FA 4AFFA 2F65A 3BO4A 1HNWF 3V6KA 1WI8A 2P6TA 3BDEA 4CM0A 3ET6B 1YJUA 3M2UB 5GADU 2FC8A 2LKZA 1RGVA 4Q5VA 2HZVA 3DOMB 1E6YB 4IG3A 1HW9A 4KH0B 4WE1A 5A8KB 4DR2F 3NBPA 2HBYB 2I38A 3VAFA 2Q79A 2HIYA 3KK3A 1X9WA 2XGQA 2UU9F 3DU5A 4DR7J 4E2FB 2PEHA 3MMCA 5G0RA 2HQGA 3MI7X 5CYMA 1YRTA 2CJYB 2HVZA 1LKZA 3UNYA 5KFZA 2X51A 2DNZA 4DEZA 4P71A 3TW0A 2N4CA 4PL5A 2IM1A 4HDGA 4ETZA 2KFNA 3HZGA 2HNZB 3MR2A 4LFAF 2EPIA 2VA3A 3E2EA 3KLIB 4O1PA 2J7WA 3TUIC 4N76A 1RT6A 2ACYA 2FHOB 3MDFA 5CYMB 5JVHQ 1PILA 2R7TA 2CPFA 1S1TA 2Z2ZA 4R0EA 4PG8A 2AEFA 4KV8B
chains in the Genus database with same CATH topology
5C24B 4UY8T 3H5XA 4NLOA 2RIOA 3ZZOA 1XBWA 3W2VB 4LFCF 3CC2S 1L3VA 3I6PA 1RA6A 4AS3A 2OPQA 3R3TA 3OR2B 1U26A 2VV5A 5J1PA 5LJ3Y 5EGYA 3ETOA 3O3LA 4RW8B 4K4VA 3FRYA 1U6FA 4QJVA 4RW4B 4EYIB 2CQ0A 2LA6A 5C25A 3OV7A 3BGRA 2OTLS 4Y65A 1QTMA 2YTCA 4ZP6A 1U6BA 1DFDA 3CXCR 1FVSA 1E6VB 2UXCF 1KQKA 4LSNB 4YZCA 1IJEB 4ICLA 5U47A 3T6JA 1S48A 2HHHF 2F3JA 3CMES 4F2SA 1RAJA 4USJC 4R8UA 4Q8FA 3DM2B 3D2WA 5AXLA 4KTQA 2KG1A 4EO6A 2XNQA 4YMEA 1M5HA 1MSWD 3KLVA 1WELA 2N7CA 1QLNA 4WYLA 4DV7F 1ZTTA 2JLEA 3SDJA 2HRUA 2YX1A 3H40A 1BQNB 2M70A 4MJKA 3TX8A 3Q0AA 2YKMB 3KK3B 1FDNA 3LP0B 5IXUA 5EN1A 2CPZA 2KT2A 3O6QA 1FT8A 3IGNA 1UP1A 4J9LA 4K4ZA 3DXBA 1P8GA 1S49A 2RIJA 1PC4A 3M32A 4QIFA 4WCEQ 2QFJA 1DJ0A 2AGPA 5AXKA 1M90T 3PXGa 3IS9A 3R1LA 2R8HA 2FTRA 2C22A 2A18A 3JTPA 5ADZA 2WW8A 5J2MA 3C2PA 2BRKA 4ZK7M 2B7CB 3IN5A 1OIAA 1U2FA 3TNVA 2DD8S 3RRKA 2DNRA 3X1LB 4EBDA 1HBNB 1FRJA 2F8EX 1S0OA 1QSSA 3SQGA 1HMVA 1IN0A 3M30B 3M1VA 1TV6B 5E33A 1IKWA 1NZAA 4GXTA 5J2QB 2JEGA 1URRA 1Q78A 2AJFE 3E01B 3PX0A 3KNAA 4R25A 4RW4A 2VBYA 1IQZA 2CYYA 1HWKA 2ZBIA 1ZM4A 2NQPA 5M2RA 1UFWA 3CMAS 2ZJQQ 4RUCA 3OHBA 4G3IA 3D28A 3V5RA 1C1CB 4ZCMA 1VQ8S 4UUXA 3BS9A 4F3OA 2KDOA 2BE2B 3Q8PB 1CVJA 1VQSA 3V6JA 1BLUA 2DO0A 2XSJB 2KI2A 3LWMA 1T02A 3BQ1A 3OJSA 3E8OA 2E44A 4DMZA 2NPFA 3KG0A 1IKXA 3RAQA 1JJ2R 1HARA 5SUHA 4GKKF 4NLTA 4GO7X 5G4DA 2KKMA 3KLIA 3JTNA 4DR1F 3MHYA 4F4WA 5B0GA 3PRDA 2YX7A 4YP3A 2K7KA 4N77A 3GSDA 4Y28C 3DA3A 2Q6BA 3CCZA 1FJ7A 3QGGA 4NLQA 3MEDA 2XS5A 2C2DA 4QW9A 1XWLA 2VZ9A 3BN4A 4C3KA 2YNFB 2V9KA 3DOMA 4WE1B 2DNQA 1HW8A 1FE0A 5LSOA 3JSMB 1Y00A 3M8PA 4CTAA 2E9TA 3DCAA 2M88A 3OL8A 3MOJB 2FGOA 1XNRF 3NMRA 1F5CA 3LQVA 3VQTA 2APOA 2OD6A 3M32B 2RQMA 4ES2A 3RB6A 1P1LA 2GMJA 1TK0A 5K8PA 3HJFA 3ZZ0A 2IM2A 2WB1D 2HZCA 3T19A 1H7XA 4OIXA 4HYKA 1DTTB 2KXHA 1Y3JA 4OMFG 1S1TB 3W2VA 2B9WA 3KLGA 2PI5A 2E1RA 5KG4A 4U6PA 1BY9A 3KJVA 1FXRA 3MEGA 1TKXA 1SKWA 2BJDA 2WBMA 4KE5A 1FKPA 2BZ2A 2QEXS 1FXDA 3QAUA 3QWUA 2GQCA 3BN7A 3SDEA 3DM2A 2NXUA 3MEGB 7FD1A 2UUCF 2L9DA 5KG3A 5KG5A 2AW0A 4NRUA 4FF4A 4B3TF 1W2BR 2ZZMA 1V3SA 1S1XB 1ZAXA 4MKAA 2HIQA 4I7FB 2ADCA 1YIJS 3OL9A 5D4OA 4O4RA 2DR5A 1HI1A 2JJ4D 2LXUA 5HMXA 1FTRA 2LCWA 4OJ3A 3KTQA 1UFLA 2CQHA 3NGKA 1U1PA 4U7CA 4QWCA 2Q43A 1QAYA 4LQ9A 1ZAVA 2EG1A 1FA0A 3KLHA 3K57A 4DDFA 3BJYA 1SH2A 3MM8A 2CQCA 3LGNA 1KLMB 1DLOB 2HWHA 3Q2SC 2XO7A 1SXLA 1MWZA 3NLCA 1TL1B 2V2KA 3FSIA 1NH8A 3VALA 1WEZA 3I0RA 3LWLA 5KFKA 5J1EA 3MM8B 1BD6A 3CGIA 1Z4UA 1S6QB 2HFNA 2LQJA 3OLBA 2OPPB 2PI4A 3DNCA 4CH0S 2E5GA 3CJ3A 2OH2A 2V8VA 5L1KA 2HFOA 3TYTA 4IQXA 2ZHBA 4JV1A 3CJ5A 4DWIA 5J2MB 4YFUA 3R1HA 2W4DA 1R89A 4X65F 4DFJA 3KG4A 3KLEA 2J0SD 4I1TA 3K5PA 2KT3A 3PNIA 3QLHB 3MR3A 5HMWA 4O4GB 2V1CC 5J2NA 3WZ0A 2ZHOA 1K0VA 3IGVA 2IRUA 2G1DA 5D3GA 3N6MA 2UUTA 2YWHA 2HAIA 4WZMA 1YJ9S 3RU0A 2OPRB 3SSSA 4DL7A 3QLHA 3VAGA 4DQQA 2BDPA 3N4WA 3SXLA 2KB2A 1XC9A 5L9XA 5DQHA 1VQ5S 1KQFB 2E1MC 1Q79A 2W25A 3CCQS 1FERA 2RE1A 3TUZC 5DG7A 1S6PA 4X84A 1YJNS 2KJWA 4IH5A 2DIVA 1U45A 1ZZFA 3O5TB 1FDAA 3CF5Q 5LMNF 2ERRA 5DLFA 4WF9Q 3TAQA 1TKXB 1U1LA 2JSXA 3F56A 3G71S 4KJIA 4AXIA 1TL3B 2ZKUA 3EX7B 2VA2A 3M6XA 2DNYA 5FD1A 3SCLE 2FLNA 2QSWA 2P5VA 3C6TA 1P6TA 3MPYA 1WF2A 2Q6CA 1QVGR 3KP9A 1AROP 2EFOA 3KK1A 1X4DA 4ED6A 4CO2A 4RU9A 4G1QA 1GT8A 3ENQA 1M5VC 4XO0A 2F1FA 3OUYB 1TK8A 3DO9A 1BQMB 1KVJA 1DQ9A 4TY8A 2C2EA 3H4DA 2ZFHA 1T94A 1RKIA 2DNOA 3UI3A 4A8MP 3T5KA 3PW5A 3POTB 2AJ4A 4OI6A 5CHCB 3U1NA 5CCMA 2XLJA 3VA9A 1Q7YT 4YQWA 2BJEA 2MQMA 1HBNA 4NLPA 2PMHA 3E3XA 3S1TA 3H4BA 1HI8A 3PW0A 2AU0A 2ADBA 4DL2A 4TLQA 2WCXA 5ITHA 4DUYF 5I42A 3NNCA 4NCAA 1JLEA 2MZSA 1HBMB 4AYBD 2R2TA 1VC0A 3PR4A 4N76A 2E5LF 1F5AA 1XERA 3FZ2A 4O3RA 3CUNA 3G86A 4BHQA 2UV8A 4YB1P 4IKAA 2RF2A 2RNEA 4DV1F 3M05A 2MZTA 3P96A 4NLSA 3VR1A 4KHMA 2I8EA 3VCDA 5IWAF 1LW2A 1DBDA 1RTJB 2ASDA 1KFSA 1J5OA 3GG0A 3MM7B 3SDEB 1UA1A 3HLUA 3GMGA 1C4AA 3K58A 3TI0A 3WX4A 4ZPVR 2D9PA 3MEEB 4QOTA 2IAJA 4YHHF 2VFUA 4GMKA 4ERDA 1VC5A 1JWWA 5H9EJ 2XSJA 4H4MA 4KT0C 4ALZA 4RUAA 4IRDA 2GGPB 1YJVA 2E66A 4Q9VA 1KEKA 2RDIA 3MMAA 1PC5A 3I5BA 5HROB 3TOQA 2MQPA 3MMBA 4JI6F 3MMJA 3MTKA 3V81B 1KVIA 3DI6A 2YNIB 4KFBB 3U7JA 1VK3A 4WFNQ 3NCPA 1RTHB 2MQLA 3V81A 3I32A 4DG1B 4B3RF 3FGVA 3TAMA 1VBZA 3PV8A 2E1CA 3HKWA 3R5BA 3IAS9 4RNNA 1JLBB 2FJVA 3QYYA 4ILRA 3T1YF 4R5PA 1UWBA 3IRXB 4JBCA 1TL3A 1U1NA 2ZOMA 1YWXA 4PG4A 2JVOA 2V8GA 2HWTA 2YQ3A 2ZD1B 3QIPB 5F9LA 2B6AB 2J9DE 1SUQB 3N01A 3QO9A 1VQLS 1EP4B 4OHZA 1T7PA 2QZ8A 1NB7A 4JI3F 1R7IA 2GHWA 3UDLA 2NSCA 5HL7Q 2XMWA 3B4DA 3T9ZA 4NLGA 2FJEB 1IBKF 5KFCA 2VH7A 3OQ2A 4UOCA 3RW7A 1RT3B 4KRWA 3PW4A 3QIDA 2BANB 2VPZB 1NK4A 4C8YA 2GO8A 5FDLB 4IRKA 3DLJA 4Y2IA 1VMBA 2LDYA 2AJ0A 1HWIA 2B9YA 2CJBA 2HNDA 1WEXA 5M2UA 2VQFF 2YKNB 2R8JA 4DFPA 1TVRB 5EDWA 2C3MA 1T03A 1EETB 3HVTB 4MMOA 1SB6A 2HW3A 3AJ2A 1RT7A 2D9OA 3MGJA 4ZPAA 5KFYA 4DSLA 4IOCQ 4IO9Q 3J7A1 1IKYA 3UD4P 4PCQA 3O44A 3PJXA 1NJWA 4F26A 4V19X 3SEOA 4B3SF 1WNEA 4EBEA 4CT9A 4X4PA 1R3NA 4G1PA 4ICLB 2DIUA 3HHDA 4QPTA 3CCSS 4ID8A 4YR2A 4RZRA 3OR1A 4BBYA 2ROEA 5F9NA 2GQ2A 1HD0A 4E8UA 3PM9A 3KLHB 3CCLS 1S97A 1JJ4A 2DR9A 4PUOA 2KO1A 3LP1A 4A8KA 1R0AB 1FHTA 2FUG9 1LFPA 1K73T 1KHVA 1RDRA 3MWBA 4DUZF 3OW2R 3ONQA 4X4NA 2B9XA 2Y0SD 5KFGA 3K5LA 1X8DA 2OD4A 3HVAA 3LO3A 2EFGA 4M8LA 5LJ5Y 3ISNC 3OJUA 1KOOA 4Z7GA 1M5KC 4PG5A 5MAOA 1REVA 2FPHX 1P9QC 1N5YB 4DHVA 2UUWA 5KFEA 2EBGA 4FBTA 4YOEA 2Q66A 2UVWA 2VG6B 3FEXB 1OQ3A 5HP1B 2XHWA 1X9SA 1DTQA 1FRXA 3MURP 4NXMF 3SV4A 1NK7A 4F67A 2XMTA 4NYOA 1FD8A 3THVA 5H1SV 2KYXA 1FO1A 2A2DA 1U09A 2FC9A 1RA7A 3CCES 2FVSA 3F41A 2EBEA 2HVHA 1MU2B 1LWEA 2AWZA 2ZH4A 3MFHA 1H38A 3UDCA 1AFJA 2D3OR 5KG7A 1SJRA 5KFTA 2DISA 1G7CB 4I2QB 1NHVA 2FVPA 2JC0A 4XDCA 2XTRA 5EWGA 1RT3A 2VASA 3DOKA 5DO2A 4DWLA 5KG1A 4DLGA 3J7ZT 3KNGA 2JWNA 3HT3A 4DV2F 3NMAA 2KHDA 2GC8A 2RT3A 2IBOA 5GAHI 1APSA 2OPRA 1IKVA 4ECZA 3CCWA 2CIMA 2HYIB 1FRMA 4DOZA 1HYSB 4NLDA 4K4SA 2N82B 3DGPA 1IXKA 2KVIA 2MDAA 2ZE2A 1FEEA 1SJ1A 1VRTB 5KOXA 3G4SS 3K8WA 3MUVP 3M9NB 2J0XA 2UZAA 4NV5A 3CCMS 1C1CA 2RRNA 3OLAA 2VC0A 4I6AA 4WYWA 1KQSR 1OSDA 3I4HX 3LP0A 1X5SA 4OX9F 4HVZA 4OHWA 2IHR1 2MZRA 4M1KA 5EUHA 3OFFA 1JX4A 3GB0A 3NCRA 1UWBB 3IRXA 2JFKA 4YDDB 2PA8D 2QA1A 2GJ2A 3BF4A 4RW7A 5IS2A 1U1RA 4QBUA 1D8YA 4KHRA 4NLUA 2V4JB 4PR6A 2JEFA 3DLBA 3TAMB 4IG0A 1R8HA 4TY8B 4URQU 2MGZB 4F4YA 3DXSX 2RS2A 1KLNA 5B0AA 1W2IA 2J8AA 3A1YG 1TKZA 1GTEA 2F66B 2JDJA 2LLZA 3FMWA 2XS7A 4OZLA 4Y3CA 1JLGB 1NRKA 2V4RA 1XR5A 4NLXA 5DDOC 1V3ZA 4TNOA 1RT7B 5E3RA 3M30A 3RBEA 2KKHA 4LSLB 3EUNA 1TV6A 5DDPC 1GX5A 3JSMA 2B4PA 2VPXB 3T1AA 4PL4A 2RJZA 2I9SA 4B9MA 1RT2A 2HNYB 2R9LA 1JLAA 1R8CA 1Q8BA 1VRUA 2W9CA 1X5TA 2OPSB 3GYXB 1S6PB 3Q23A 1R8AA 2V0NA 3HHLD 4M5DB 3MFIA 1T03B 4KR0B 3OBIA 2XS2A 3BO3A 2XWYA 4WFYA 4WXWA 4OI3A 2PGCA 2CG4A 4IDKB 4KO0A 4QQBA 5HMZA 3CD6S 2DGVA 1S77D 1RT5B 1HA1A 1FKOA 3LANA 3JSYA 1RISA 1S9GB 3MEKA 3OTEA 4JUZA 3CD7A 4FXVA 4HTIA 3DU6A 4YB7A 3GIKA 2LU2A 1U1KA 3SI8A 3PIOQ 4DPOA 3UD3P 1T3NA 2F9DA 2YNHA 3NNHA 1TL4A 1D0EA 2K2PA 4WFXA 3MM6A 1UA0A 4WFAQ 4OI1A 4MYTA 5KFNA 4X62F 3UR0A 2BA9A 2AX1A 2PC6A 4HTJA 1O0PA 4ZLPA 4N5SA 1R0AA 5B0BA 4ED7A 4UQGA 4J9SA 4DLEA 1NKBA 4ZHRB 4A8FA 3MF5A 1TL1A 1R27B 1N48A 1U8SA 5C5JA 2V4JA 3OTDA 2VFSA 3IS9B 3JTOA 4KPYA 1YRUA 1PGZA 3KHHA 3PFEA 4I2QA 2VODA 4FBUA 2RDJA 1SIZA 4IQMA 4OHXA 5B09A 3FCHA 4ZS6A 2OO4A 5A6WA 2A10A 5C42B 3QJLA 4RW8A 2A1BA 1VLYA 5CXTA 1G3OA 3GWCA 5DG8A 3KLEB 2C3OA 2KG0A 4J9RA 2CZVC 2M7SA 3ZZYA 4NA3A 3Q8QB 3HPOA 1Q16B 5HQ8A 3VF0B 2BM0A 3HZEA 4ZPDA 3PZPA 3K5NA 2KXFA 3CDEA 1X4CA 2GIQA 2GFFA 2PN6A 5J1NA 1YRXA 2HGMA 2D41A 2LQBA 2MHEA 4DBQA 1KS2A 2HNYA 2KRRA 1Q8LA 2J6TA 3TR5A 5DLGA 3K2YA 3BGUA 4PQUB 1OQ6A 3H59A 3OR1B 3CO9A 2ZOFA 2E5JA 2UVVA 1AXQA 2IC3A 3M8RA 1VQ7S 4JI2F 4ELTA 2BABA 4WTYA 5E3PA 3J7YU 2BVZA 3RB4A 2KM8C 1GH8A 2FJAB 3G9CA 2DT9A 4A46A 2C2RA 4A8WA 3LF0A 2VC1A 2E5HA 3CEDA 5KTQA 3F73A 3PKMA 5IT0A 3D5MA 3DRSB 4W90B 2J0WA 5BYRA 3NG8A 2XMXA 5D78A 4B9LA 1YTYA 2OSRA 3RYLA 3BZQA 4DV3F 3LJ2A 3GYNA 2KZMA 3Q8RB 1H0HB 2FHJA 4Y6IA 2HHXA 2P6SA 1HPZA 3NKYA 5IM0A 1NO8A 1HWJA 4QWAA 1N5YA