4I1TA

Crystal structure of the cap-snatching endonuclease from pichinde virus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
MEEYVSEFKDMVRKWVPEWEELSEQKNNVLAQVKDRAITIEGLKLLSMLVEVDSCKKHSCRHNTRMTVNAILRELKVTCPTLPDVTPDGYCMVGDVLILLEVFVRTSQEAFEKKYNQDFLKLMQLSSDLKRQNITLVPVIDGRSSYYVEYIPDWVVERLRWLLLKLMDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cap-snatching endonuclease from Pichinde virus, a new world arenavirus
rcsb
source organism Pichinde virus
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase L
total genus 59
structure length 169
sequence length 169
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.300 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4i1tA01
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i1tA02
5J1PA 3JSBA 5J1NA 5IZHA 4MIWA 4I1TA
chains in the Genus database with same CATH superfamily
1T11A 3E3XA 4A47A 3PW4A 1HBNB 3A8KA 5ETNA 2CIMA 3V5RA 4JI7F 4NOHA 1YJRA 3JS9A 5H9FJ 4A48A 2LECA 4NYOA 2R8HA 3IG1A 1T9UA 2VDIA 3ISNC 4Y65A 1AB8A 1CJTA 1H2UX 1RHJB 3QAUA 1QDUB 2F5GA 3IGVA 4L74A 4RBUA 4URQU 1ITPA 2VG6A 1N6QB 5L1JA 2O67A 3N5BA 2QL5B 3BSAA 2LDIA 4PR6A 5KFQA 3LP1B 3VR1A 4FS1A 2IM3A 4IFVA 1CJVA 2YWEA 3HSZA 3M7VA 3X1LB 4U96A 4EU0A 1TL5A 5T14A 1LV5A 3M2VA 4ZS6A 1IBLF 1WC3A 4U8YA 1UA0A 1JJCB 1X4AA 4P2MA 2DGUA 3SSRA 4ZN3A 5DM7Q 5HK4A 1NUEA 2HLTA 2UXDJ 5A8KA 2RUSA 3CDBA 2WK4A 3DMJB 1RABB 4E8UA 4UZCA 2DNOA 3R7NB 2J7UA 4IKAA 4CH1A 3G71S 5I3UA 2AJQA 1TV6B 3Q8RB 4DFJA 4OL8A 1VGYA 5KFFA 1YJ9S 4K50A 2V9WA 3IN5A 4OZ3A 2H3EB 5CH7B 2I38A 3EYZA 4DR5F 3UD3P 2FJXA 4LRCA 1HI1A 2WRMA 3BB5A 3N01A 1OY8A 4OX9F 1HBMA 2I5JA 1UETA 3CO0P 3KLIB 3UCUP 4MFBA 3LALA 1FJGJ 3KXDA 3DXSX 2RB7A 1NK6A 2IRXA 3EDRB 1Y4ZB 1DARA 3MZIA 1WHXA 4J9VA 4OMFG 4EO6A 3D67A 4YS2A 3BJYA 1PC4A 4FYYB 1KS2A 2KI2A 1U4BA 3OPKA 3W63A 2AX1A 4UF4A 3NGDA 2E9ZA 4GKKJ 2M4MA 1QE1B 1XERA 4J91A 3NGTA 4Y28C 3AAWB 4YDXA 1IKYB 5HLFA 1F9FA 4OJGA 4GO7X 2LDYA 1U2RA 3G2XA 2MZSA 1SB6A 2DGOA 2FHMA 4X4QA 4QIEA 5HJYA 1S6OA 2CJYB 2W2NP 2VH7A 4U6RA 5B0BA 2MJFB 1UTAA 1NPKA 4X62J 1JKHA 4ZA1A 5KFUA 1JLBA 5EX3A 2IDLA 3HHLC 3Q8UA 4OI3A 5KFOA 2OPSA 1RHUB 5LXYA 3WC2A 1VR6A 3GIJA 2GO8A 3THPA 4G76A 1NDKA 2EKNA 3V4MA 4DPYA 2JOQA 1S97A 5E3CA 4LBHA 1DTQA 1V5VA 3TR5A 1PCAA 1U1LA 4KB7A 1U49A 4IH5A 3PVXA 1FJEB 1YJVA 5AE1A 1GXTA 1RAIB 1EKRA 4DEZA 3DLKA 4DU8A 4R0JA 3VF0B 2L9NA 3FZBA 5HATA 3D6HB 2GIQA 5KFBA 3PEHA 4MK8A 4QWDA 1UCNA 5L46A 1KSPA 3M8YA 4O3OA 2D3ZA 2JLEA 2P22B 1RHQB 1BWVA 5KFIA 2YNHA 3MF5A 3F0NA 3IXQA 3UN2A 4CLFA 3HMJG 2VIHA 1YJ7A 4DWLA 2QMXA 2JB1A 1D3WA 2P8IA 2QT7A 3H59A 4ES2A 1Q7YT 1KNZA 1IKVB 2AZ1A 3JAMU 4WIQA 4I69A 4HFVA 2Q6BA 4TYAA 1RTDB 4I2QA 1QTMA 4LF7J 3MFHA 4YEAA 3M9MB 2EEYA 4DSLA 4N56A 1JQOA 2QIFA 2HPUA 2ZDPA 1T03B 5FJ4A 4K2XA 3EZOA 1S5ZA 3GJQB 3BBCA 2XM3A 1C2PA 1DZ5A 2GMHA 4KHMA 5J2MB 3T3FA 1D9FA 3DLGB 2HNDB 1RLCL 2HS4A 3AOBA 1OMSA 1WDDA 4P74A 4RW7A 2XS7A 3I5AA 2OPRA 5E5NA 3K5OA 2YX7A 1QVGR 4O3RA 3UNYA 4LF2A 1FFGB 4ECXA 2DPJA 2QG9B 5CA5A 1PC5A 3CJ2A 1HMVA 3EJMA 2ALZA 1L5UA 1TMJA 3AH6A 2ZUAA 2NSCA 1VRQC 1TL7A 1QAYA 4NL5A 5E3PA 5IZHA 4ZPDA 2IAJB 2K19A 1PBAA 1NBEB 4GO5X 1YRTA 3BREA 4HEA9 1CBKA 4QR0A 4RW4B 4RW6A 3IA0A 1BQMA 1I6JA 1HBMB 2I5JB 3N4WA 2Q6CA 4KTQA 1I51B 3C6UB 4RUAA 2JLGA 5C42B 3ULHA 2ATLA 2IP6A 2W8LA 4GXTA 3CGIA 4M5GA 4UY8T 2HFSA 2KU7A 2ZUGA 1UVLA 3HKWA 2CVEA 1DAXA 4C0HA 2G2ZA 4IH7A 2HFZA 3OFHA 3W5YA 3TA1A 1OPIA 2VFUA 5LMUJ 3NBPB 2VG5B 3JSMA 1GMUA 2WW4A 2AKWB 1DLOB 2IM1A 1S59A 2HGLA 3IAS1 4X66J 1RT3B 2EW9A 4DHVA 4O0IA 4NLQA 4WYWA 2HHQA 1BGXT 2QTWA 2YFBA 1C4CA 5I4MA 3SYZA 2ADCA 2X1GA 2DH7A 3DDNA 4U67Q 4OI0A 1MWYA 3DCAA 1ZPVA 2J7WA 3RB3A 4RUCA 1S1TA 2V67A 4M95A 3MXHP 1FDNA 2EBEA 4IRCA 5KG0A 1W3SA 5K9FA 2R7XA 3M32A 1YK9A 3OTCA 1FFSB 4MKAA 5D0GA 1NK7A 4JI0J 2DNQA 2QN6B 3DA3A 3D3CJ 5AXLA 3SQGA 3M30A 3P6YC 4M5HA 5HROA 4EZ9A 1MU2A 3NG8A 3IM9A 5CCLA 5K14A 4OZ1A 4RU9A 3CE8A 3M8QB 2V2QA 5KFPA 4PG6A 1X31C 5HMZA 1N54B 3EDQB 2HLUA 3D0GE 4DFMA 4PZVA 5F8MA 1UZDA 1JNRB 1NXIA 1X8DA 3I0RA 4FKXA 5KFSA 4B9LA 5KFDA 1HBNA 3NCRA 4Y2IA 1N0VC 1Y11A 4ZCKA 4FPIA 1E6YB 2WOMA 3DGPB 4PKDB 4C3MA 2RE1A 1GX6A 2LVWA 4QIFA 2AGPA 3BN7A 1EQ0A 1HHTP 4PQUB 4WBFA 3QZ8A 2YKNA 2CG4A 4KY3A 4P75A 4PXDA 3MMAA 4R5PB 1F5BA 5DDOC 2V63A 3D6TB 4LVNP 1F5CA 3QNWB 3S8SA 3I4PA 2XMAA 3BPDA 3D66A 2UXBF 1FJCA 2ZJQQ 3HPOA 2WW8A 3FEZA 1MWQA 2PC6A 5KFZA 4J9QA 3T5KA 4M5DA 1M5PC 2ZH8A 1VLYA 5A6PA 2NR0A 4C6AA 2DY9A 4Q0BB 1TKXB 1YGYA 2EC2A 1RWNB 3NAIA 1J2VA 4DX8H 3MR2A 2XEXA 5ETQA 2D3O1 1UVKA 4O3QA 3JYTA 1Q8KA 3H7HB 3OUYB 2BM0A 3Q8SB 4F4WA 3Q23A 1FE0A 4AT1B 2OPPB 1YQHA 2KB2A 3DRSA 4PXEA 4IUFA 2UXCJ 1UL3A 1ZA1B 4OYWA 3KLGB 2CQGA 1RZMA 2K1RA 4DOZA 4J9OA 2Q66A 4Q44A 1VQLS 1UAWA 3I9V9 3PHEA 3EPIA 4FS2A 1MSWD 4KPYA 4OI1A 4NRUA 2C28A 1S99A 2V6EA 1P1TA 4HLBA 2IBOA 3DOKA 4OYBA 3LP0A 4YB5A 5B0FA 4ZIWA 4N5SA 4LFCF 3JSRA 5DETA 3RAQA 1Q0NA 3AHPA 4ITSA 4RW9B 2H9ZA 1Z2ZA 3MI7X 4NEZA 5EWEA 1RAFB 3H5YA 4C11B 1LOUA 3UWTA 3EX7B 1XWLA 3P23A 2RDJA 2PMWA 2KZMA 4OHXA 4BC7A 4CO2A 3FSYA 1XEZA 4F8RA 4X84A 2P6SA 5IT0A 1KRPA 2CZ4A 2HBRB 4BBYA 1W25A 3T1YJ 3KLGA 2E44A 2HWIA 3TANA 2FJDB 2GIRA 3BO2A 4CLZA 1HQEA 1MROB 4LF7F 2CZVC 1RHRB 2ZHAA 4ECVA 5DLGA 1WF1A 3NWGA 3MTJA 5HMXA 3SIPB 4M5IA 1X4DA 4KKOB 5L9NA 2V1CC 2XZTB 4J37A 4NLSA 4TU9A 3G6XA 1XMQJ 2CAZB 1TK0A 4F04B 2EFVA 2EK1A 3BS9A 3V6DA 1ICEB 2YNIB 1LWXA 2DBBA 4ZVHA 1NJYA 3HFZB 5HSPA 1WKJA 1G7CB 2CPFA 2NS1B 1WC5A 3OXFA 1NJIT 2W2QP 3ILOA 3I0SB 3CJKB 3N9UC 3FQKA 3LANA 4LSZB 1JWWA 5K8OA 2QL9B 2YNHB 1KD1T 5F8JA 5EX0A 3LPYA 1LW2A 2GX8A 1ZTWA 1LNQA 5D4NA 4YQWA 2XMUA 4GRSA 5H1SV 4FKYA 2E1AA 2RILA 4PQAA 3TA0A 1U45A 2JEGA 2KKHA 3C66A 1FJGF 3OD2A 4DV6J 4GKJJ 3B6BA 4UOHA 3X3UA 2QLBB 4C97A 2ZJRQ 2JEFA 2J8SA 1CVJA 3A8IA 1TFYA 2HQFA 2DNMA 3PG9A 3OLBA 5LXRA 3KJNB 3MR6A 1PSDA 1FK9B 3H4BA 2BABA 2IJRA 2HGMA 2QSFA 1YWXA 2Z2LA 4DR7J 1G6BA 1Q5YA 1GAOA 3LAMA 4AS2A 3HDSA 5E3AA 3T5LA 1TL3A 2SXLA 3V81B 3ZTPA 2MQNA 3BGLA 4OLOA 1CULA 3WBZA 3GJSB 3FUYA 4CH7A 3CUNA 4L6V3 1Q81T 3PY8A 4ZHRB 1F3VA 1FRXA 3NS6A 4YY3F 1A7GE 5GAEU 1RU1A 4DV7F 4MFBB 1SKWA 1K9MT 3J81j 4ERDA 2YWHA 2OFHX 2GO9A 3C6TA 4NZ6A 1S49A 3H2VE 4ZLPA 9RUBA 1FXDA 2MHNA 2ZH1A 3GP9A 4MIAA 4DV7J 2DHXA 3KNAA 1H38A 2FYXA 1KC8T 4DR3F 1PAEX 1XMOJ 2K7JA 4FVMA 4DI6A 4P6QA 2RVJA 2RF2B 3MM8B 3EVWA 5D4LA 2DH9A 2N3LA 5A2QY 1PJ6A 2R2TA 2CJKA 2ZVIA 4BCAA 3K58A 3GSDA 4DS4A 4X64J 1FKPA 3S7RA 5J1EA 4F0MA 2OMOA 2FLNA 4DR1F 4O3SA 4RW9A 1TKZB 4OHVA 1LWEB 3A3NB 5F8NA 4PPZA 2RRBA 5GMKa 3L3CA 2MKIA 2YXLA 1KBRA 1RJJA 3PYGA 3L0IA 3OVSA 2R2UA 4GC6A 3OVBA 1Y10A 4HTIA 3NGUA 2BEFA 4PCQA 1FTCA 5ETMA 2JLFA 4X4OA 2I8EA 1WNEA 4F02A 3H98A 5E3RA 4KE5A 4X66F 1N36F 3OTEA 3RRGA 2JVOA 5E3QA 3W60A 4ATNA 3W9HA 4EFAC 3QZ7A 2V4JB 4FF2A 4TYBA 4QJVA 5JVHQ 1F2HA 4DUTA 2LEBA 2BKOA 4LF9J 2M70A 1G2EA 4CQ1A 1JQGA 3FEXB 1WC4A 4LIRA 2RLDA 1D9DA 2M8DB 1WOSA 2QGFB 4F25A 3IRWP 1QSSA 2WSCC 3CCTA 3NWRA 1RXOB 4I6WA 2A6MA 5SUHA 4ES1A 1NK0A 1YI2S 5K14B 1VC0A 5C25B 2CVIA 3M1VB 3KJFB 2ZH2A 1VQSA 3VTIA 1YIJS 2MDAA 4WU3A 1QUVA 4QYZJ 1O5JA 1WG1A 2Z56B 5DGAA 2VQFJ 1VC6A 3EMTA 1HQUA 1V3RA 2ZWOA 1RT4B 6FDRA 1NK4A 4YR2A 4IOBA 2IRUA 2IYGA 1E6YA 1RWVB 2YBVA 3IS9A 5IWAF 3F56A 1RYSA 1SI9A 2IVFB 4USUA 3KLEB 1IUJA 4CO1A 2FB0A 4HDGA 1UEUA 3HVTA 2W9BA 1Q82T 2I9SA 3KG0A 5ETPA 1RISA 2C3PA 3D0IE 1M5VC 3LA0A 2BJEA 1TL1B 2C3OA 3BKFA 4RW6B 4PXBA 3FQLA 2V9KA 3DRRA 1S0OA 1N5SA 2B6AB 2WOMB 3DGPA 4LRAA 1XC9A 2FZKB 3HLUA 1F6TA 1B0TA 2AZ3A 5L9XA 1EARA 5DG8A 1FRIA 1S7HA 2GZOA 3TA2A 2HQIA 2PN6A 2JC0A 3AODA 5C24A 3EXYA 3A1YG 3NGSA 2HRYA 4ZPCA 3H5XA 2DR7A 4KBIA 4ZMMA 2DGXA 3THTA 5C42A 4ZP7A 4ANEA 1Y7PA 4NXNF 3OBIA 3N0VA 3LWMA 2MXYA 5B0AA 2DB1A 3AOCA 2YNGB 3QO9A 2HS3A 3CDWA 1PGZA 3H5UA 3DLLQ 1C4AA 1HHSA 4RW4A 3NKYA 1BLUA 4UTGA 1I5OB 3POTA 4RWXA 1HNXJ 4JI2F 4CT8A 4DQIA 2FC8A 3BKTA 2Y1LB 4F4KA 3IP0A 1WEXA 2DXDA 2XNQA 1WC1A 2AYBA 1CC7A 3C6UA 3V4IA 1XMBA 4ELUA 1AYEA 1S9GA 1WSVA 5LM7E 1U2FA 2CQDA 2K8GA 4DSEA 2FTRA 2HQ3A 1DJ0A 3D0HE 1PO6A 4A8FA 3K5MA 4J9PA 2DPIA 4LF6F 2NXEA 3DLBA 1PAUB 3GCWP 5MLCV 3RTVA 4LMZA 2HMIB 4HTJA 5F8IA 5HP1A 2MSTA 3OFFA 1ZA2B 3R1LA 1MWZA 1T7PA 1GFWB 4ZITA 4CLKA 4USMA 1N32F 2GQ2A 3OTDA 2RD5C 4TXSA 4DR4F 3MOZA 2QRRA 2O1PA 1SKUB 4ZVOB 3OL7A 3EVOA 4DUZJ 3SZ2A 2J6TA 3M2UA 2Y8YA 4JI0F 1WDTA 2LA4A 5EUHA 1X9SA 3FRZA 4LBPA 3UR3C 4Y2AA 1FVSA 2IPOB 1RWXB 2CQBA 1FD2A 3JXOA 3KJVA 4DR7F 2ZNYA 2CXEA 3W8GA 2LXFA 1RDRA 3ZZUA 5LMNJ 1NH8A 4PPDA 3WX4A 4DPUA 4TU7A 1IBKJ 3J7ZT 3Q0AA 2FVSA 4HDHA 2YKNB 4R5PA 4QPTA 1H7WA 4DR5J 3AD7C 1KP6A 3D6MB 2FU2A 2XCPA 1HWKA 1RHMB 4V19X 1OO0B 2IM2A 1NDPA 1WF0A 3ZZOA 5I42B 2B51A 2FZCB 1RP5A 3MOJB 4B9SA 5AT1B 3OT9A 4QIVA 1UW4A 2CWKA 4F0HA 4DCOB 1PJ7A 1SQEA 2C2EA 5HLFB 3ITHA 4H4MA 3FSIA 5LJ5Y 3NCQA 3PRVA 2E1RA 4UUXA 3P96A 1NB7A 1TU0B 2O3DA 5ETSA 2XO7A 2F8EX 4A8WA 1FWLA 1YX2A 1PYOB 2X51A 2RKIA 3BR8A 4B3TJ 3HO1A 2KYXA 2XZWA 2ZNZA 3GCXP 3U7JA 5KFTA 2XZDB 3KYLA 2AIRB 3I56S 4K5SA 2XY5A 3C19A 3W8PA 1VRUA 4WFBQ 5CD4H 4UOGA 2DITA 1XN9A 5F8GA 4G1QB 2DR8A 1FT8A 1R6VA 3HD1A 4AFFA 4PAAA 3FCHA 4WCEQ 2V68A 1HNVA 4MK9A 3M8WA 1C0UA 4JI3F 3U1MA 5DM6Q 4C8MA 2C3YA 2Y1JA 2BOPA 2FD2A 1XNQF 5DQGA 1CJKB 3J7A1 4QZVB 5KFMA 1J27A 2PDAA 1O6XA 4KFBA 3VGSA 1WKLA 4YR3A 3AQPA 4YHHJ 3IC1A 2DTJA 4WKRA 3E2EA 1TUVA 1TKZA 3BQ2A 4DUYF 1OJ4A 1YRXA 2AEMA 4ZVGA 3UN3A 4KYZA 2B9WA 1FKPB 1FDDA 2D7SA 5J1EB 3GWCA 2B9EA 4NX9A 1WHWA 2E7XA 3HVAA 4WFZA 4Y0FA 1RE1B 5B0GA 2NSBA 3R5GA 5GAHI 3H8YA 3K17A 2VOPA 3GQCA 5AE3A 4DV2F 2YWKA 1NPRA 1BD6A 1XK8A 1YHQS 1U47A 4LQ3A 3NNCA 3MPUB 3JTNA 1VLOA 4EBDA 1R0AA 4KHPJ 1Q5VA 1SVDA 2OLWA 5D0RA 5DJBA 2QSWA 3IR5B 1JNZB 3PJWA 4NLTA 4N47A 1T8EA 2HK3A 1S79A 2XSFA 4WTYA 2FVPA 5EHHA 1VQ7S 1T9VA 3MMAB 4HVZA 5CXTA 1K1QA 4OV1A 5ETKA 2APOA 3DM2A 1FKOB 4I6AA 1WUUA 2ZOMA 1SKSA 2Z57B 3C16A 2GNKA 4AQYJ 2RMLA 3NL0A 1S48A 4RNHA 4ZJLA 5HMYA 1BWEA 5KG1A 5CD4A 2CNNB 3ZZZA 1LW2B 1FRKA 4IH6A 4M5KA 3BGRA 3V81A 1VQ5S 2NXJA 3F4MA 2HHHF 4WXOA 3ET6B 1WC6A 5D4PA 3HXMA 1W2BR 2R3VA 3GIMA 1HIYA 1RSCA 2FHOB 1UMJA 2ZE2A 4PWWA 1L3VA 1TFWA 4JI1F 2F4VJ 2DGWA 2FUG9 3PV8A 2C3UA 4YMEA 2VU5A 3QYYA 4TVAB 2BM1A 1H73A 2DO4A 2NCKL 2ZOFA 4A8YA 2ROEA 1S1VA 3OSPA 1RTJB 1IKWA 3ETMA 3M2UB 1JLFB 2GJIA 1Q86T 1RT6B 2ZBRA 3ILIA 3R5DA 2Y1IA 4B3TF 5FDLB 3GG0A 3TUZC 3AXKA 2LA6A 2E5GA 5CHCB 2WVFA 5HQ8A 3NRBA 1L3SA 4YB6A 1HBOB 3LO3A 2UVWA 2RIOA 4NXMJ 1IJEB 1YRUA 2VFVA 2LU1A 4RW8B 5JVGQ 3W2VB 4ECUA 1N5VA 3MMCA 2L9DA 5F3TA 4F4ZA 2FHJD 4RKUC 3HHLD 3I9ZA 5DDRC 1JK9B 1ELOA 2B0GA 3MMJA 1PKUA 1N5YB 2F7VA 3R5CA 5DG7A 2WHOA 3IWLA 3UNGC 3ICLA 3ENQA 2C2NA 4J7CA 1Y0HA 4OYMA 2VZ9A 1FEEA 3OR1B 5LT5A 4UOCA 2F6MB 2XYPB 5FD1A 2W7PA 1IBLJ 2JRSA 3IBFB 3KFWX 2C42A 3V4IB 2DEIA 2QLJB 5HN0A 3BKUA 3HFKA 4FYDA 2LQBA 1RTHA 3BH6B 1LQ9A 3C14A 4LSLB 2HZVA 2ILYA 4NLYA 3THVA 1IKXA 1FI4A 2XB2D 4LIWA 2PE8A 1UKUA 3EUNA 1HWIA 2D9OA 2QMUB 4NLRA 4USWA 5KFGA 1SV5B 1VBYA 3NMRA 1P6TA 1AUDA 5HP1B 3K5NA 4C3KA 1H2TZ 4L3NA 4V1Ak 4C98A 1KHWA 1Q1KA 4B3RF 2Z0GA 1K44A 5KT5A 3KOAA 3A8EA 3CT9A 1N32J 2CQCA 2W2PP 3TVZA 3MAHA 2HBYB 1VQYA 4O4RA 3J7YU 1T03A 1NZ8A 1HFEL 2HRUA 1R0AB 3GV7B 2HHTA 1ZAWA 4FNIA 2F4FA 2MLXA 1J5OA 3VAHA 2N7YA 4F3QA 1NMEB 3FMBA 1U6FA 1XNRJ 2MB0B 1X60A 1KONA 3G6ES 3GR0A 3OR2B 3QLHB 4O3NA 2HHSA 4OI6A 3DRSB 3FSXA 1TKDA 1L3TA 2D69A 1HNWJ 2JBWA 4XDDA 2QX0A 3MEDA 2CQ4A 4Y2KA 4E2FB 3JSBA 2ZJPQ 1EQMA 1UEKA 1OSCA 3VZIA 3PRDA 2MKJA 3T41A 1WTBA 2E5LJ 1OYDA 2EKYA 4C8OA 5D3GA 4K4ZA 3DRRB 5CYMB 1M1HA 1LWCA 2GVZB 4Q45A 2VC1A 3J80Y 3K5LA 1YBAA 4KGKA 4L76A 4ZPAA 1VK3A 3FMWA 5BXIA 1O0PA 5F0WA 3QATA 5KFRA 4FZVA 4M5NA 5MAOA 5A2QU 4Q5VA 3IGNA 3KHRA 2HVZA 4M5LA 2XS5A 1MLAA 2DR6A 5K8MA 3D2WA 1YSJA 5A76A 3CVKA 5IV4A 3GB0A 2COLA 1Y00A 4IFYB 4LSNB 3KHLA 3PKYA 1P8GA 2R2SA 1FNMA 2EI5A 4IFVB 4NCGB 2DIVA 1RT7B 1EJ7L 1HNXF 2EBGA 4M94A 1NSKL 4QPXA 4ZPBA 4TQRA 3SI8A 3OL9A 1I94F 2EK6A 3DYAA 3EZUA 3UVJA 2DRBA 2DHSA 3ET6A 3NS5A 4I2PA 5HAOA 3GFXA 3MM9B 3MM6B 4Q9VA 2D74B 3UDCA 2HFVA 1RK8A 1U09A 1YBTA 2UV8G 1BC6A 3A3OB 2AU0A 5GMDA 3D4JA 1LWEA 4PL4A 1U1MA 4XK8C 3KDNA 1SJ4P 3KG4A 4NXMF 2DGSA 4QYRA 1XQIA 2JFDA 3DRPA 2HZAA 4EYIB 4X65J 5IFMA 1ZAVA 2ZHBA 5KT3A 1M1KT 2QA4S 2KT2A 2XS2A 1NHKL 3KMSA 3GIKA 3T5HA 4B3MJ 1B70B 3Q89A 4DX6A 2ZFHA 2CQ2A 3PIPQ 3A8JA 2K3KA 4RBVA 1VQKS 3HT0A 2OJ3A 4RU2A 4ZLNA 1S9FA 1UZHA 4ZVFA 3NP5A 3DGVA 4K4SA 4LF8J 1R8BA 1ZYQA 1U0HA 3MMCB 4F4YA 2XY6A 2CPZA 2F1FA 4ENOA 2XGQA 3CCVS 2FY8A 1FEHA 2A18A 2HURA 4JV5F 1KVKA 2VQFF 2RIJA 2CYYA 2ZBCA 3MTKA 1IKXB 1HNIA 4EMDA 7FDRA 2WB4A 2E5LF 2RUGA 4WP9A 2QE5A 3KLEA 5KFCA 2IDEA 2BMBA 4ECYA 3K8WA 2ROGA 4JYAJ 4WIIA 3SCKE 1OSDA 2MMYA 4FF4A 1PYTA 1D09B 3O44A 2WAQD 3KHHA 1RAJA 3BQ0A 4ALZA 2RS2A 3AJ2A 5D0EA 3MM7A 4K4WA 2U2FA 4CLYA 1X5SA 3V2UC 2ZC3A 2JSXA 3DHXA 4HACA 4P9SA 1JLEA 1LK5A 2YFAA 2LU2A 2LQ5A 4NPOA 5M2PA 1SBRA 3HVTB 2W9BB 4HI1A 3OJUA 1SL1A 3W3SA 2P2CB 2RQKA 5KT6A 1XMOF 1S1WB 1EZZB 1M5HA 2GMLA 2P9CA 2NUUG 2XULA 3KLHA 4ZOSA 1UFKA 1R7IA 4F3OA 4JI4J 3WIUA 3PW7A 4TN2A 4OZ5A 5G4DA 3CCSS 4TY8B 1D9AA 1F2GA 2G13A 4BHQA 5C24B 3RUBL 3B54A 2DGQA 4RWWA 5GAEI 2R8KA 3R2DJ 2W4PA 1S1VB 4KO0B 4AXIA 1CEZA 2XSJB 3IRXA 2YX4A 3KUEA 4WE1A 2QYCA 4EUVA 1NKCA 2ILZA 4BS2A 4OX9J 3CJQA 4K59A 1B0VA 3W9JA 3CCLS 5KG3A 1GMWD 2JWNA 3MPDA 3QGGA 1MMNA 1C1BB 5HANA 1K0TA 1RKJA 2CG8A 2MQLA 3VAKA 1HBOA 4DSJA 3B4DA 2R7OA 2CPEA 1D0EA 1R89A 3UITA 3P5TL 1GH8A 3IBWA 5FDLA 4MMOA 3SQOP 2CJXB 2KFNA 2VC0A 4IG3A 1H72C 3RBZA 3SDEB 1SUQA 3K0JA 2WSEC 4QU6A 4ZP6A 2B8PA 1F9HA 1KQFB 3UCGA 1IBMF 3QGHA 1FF2A 2VONA 3R8YA 4DLEA 2V2ZA 2BQ3A 5DDQC 5K8NA 2WTFA 1B3TA 3DLHA 1UW9A 3G82A 5LMNF 4DSFA 5L39A 3IFEA 1J5EJ 1U2CA 2NZCA 2I0XA 2MYFA 1RAOA 3KDOA 3QWUA 1RHKB 3QT5A 4Z7CA 3T6JA 3PX6A 4OYZA 2ADBA 2VUGA 3HHKA 1RWOB 1RTHB 1VDHA 3C14B 1HR0J 2YY3A 4LJMA 2FVQA 4B9UA 1NAQA 2M7SA 4RL1A 1SJQA 1K73T 4JP8A 2DGTA 4DF4A 4I2PB 4C0BA 4UY85 4CH0S 3D1QA 5FIIA 1RCXB 3W1YC 1RWUA 3T1HJ 1JXLA 1YZ7A 2W1BA 2C2KB 1IBKF 1U8WA 3GILA 3M2VB 3NGKA 2FQQB 4URSA 1Q8BA 2QFIA 3NS7B 2YQ0A 2CKWA 3VGVA 1SV5A 2ZH3A 2VBZA 3ONQA 4O44A 1UVIA 2K2PA 2YWFA 5EDWA 4ZHRA 1U1KA 2W4DA 1NO8A 3PKMA 5J2PA 2PO4A 1IVZA 1VC5A 3A12A 3E01B 3H2UB 1S1XA 2L3MA 3CD5A 3IR7B 3LW5C 3RU0A 4OHYA 4WZMA 4JI6F 1P9YA 2KYZA 4FXVA 3A4TA 4LR7A 1QAJA 4DUZF 2J9DA 1OIAA 1RQ0A 2AJ0A 3CC4S 4JI1J 3PX0A 2F4VF 1RT6A 1LFPA 2HHPA 2RADA 2RSQA 2ZEJA 3MAAB 3SV3A 1KOOA 5BYQA 5HO4A 4M5DB 4DCPB 3HP6A 3DNCA 4K4TA 2FJWA 3CDAA 3AFGA 3MUMP 3WX8A 3RGIA 2RS8A 4DL7A 4P2XA 2OSQA 3KJQB 3KLHB 4ANCA 1KTVA 2JH3A 1NZAA 4ILLA 4PUOB 2GQCA 4QIWD 1T3NA 2AYMA 3GFHA 1LXJA 2GW8A 2EG2A 3UD4P 4PL5A 1RAHB 2XHWA 4R8UB 2C3MA 2J0SD 2BXJA 3FK4A 2DHAA 5HQLA 2ASDA 2V0NA 4RPFA 1VOMA 5KT7A 2GHPA 1M90T 1XNQJ 3BYRA 4CP5A 2PA3A 3P5BP 1JLEB 3R27A 1WACA 4I7FA 4C9DA 5C25A 5IT9U 3CJTA 2OO4A 1H3DA 3QGPA 2FGCA 4OYPA 4WP8A 3M2RA 5E33A 5CABA 4WFNQ 2HHUA 4S0MA 3F73A 2YPZA 4ZLLA 4NCBA 3B55A 2YVSA 2KG1A 3V6HA 2GAGC 5HVHA 2VA3A 4XAKA 2KZZA 1P1LA 1VJQA 4ID8A 3TZXA 3QFWA 3DDIA 4W92B 1OPZA 4NLWA 4C48A 1TAQA 4USKA 4NA3A 2Q79A 4FXDA 3CDUA 3TZWA 1KQGB 2RU9A 3SSQA 2CQPA 3LQVA 5JMNA 2XHCA 2VG5A 3JSMB 4X65F 2FIUA 1FKOA 3AJFA 2AX0A 2MEWA 4KQZA 2PFDA 2YNFB 4KPCA 3MR7A 4DCJB 2ASJA 4JI3J 4W4MA 2J76E 4KT0C 5GAGI 4P7VA 1RKIA 5B0DA 3KK1A 4OZNA 1TELA 5IC4B 1B7FA 1S0VA 4ZDNA 3QSYB 5T41A 5ETOA 2VF3A 4GVBA 1FVQA 1TKTA 1HNIB 3PW5A 4EK2A 4FYVB 4P2SA 1EETA 3DI6B 1ZETA 3CC7S 2VV5A 2ZBPA 5J2QA 4CCHA 1S9EB 5KOWA 1U0HB 4HYKA 1RTJA 2ZZTA 1WEZA 4ED8A 4CLPA 4AUKA 3OSNA 1HNWF 1YVFA 1NB2A 1EP4A 2OD4A 2UUBF 1IQZA 1NU4A 2L08A 2WVEA 4N8NA 2VG7B 1RTIB 1RU2A 4YR0A 5L1LA 3HJFA 1Y5IB 3CJ4A 2FVCA 4YZCA 1NSAA 4NA2A 3KWMA 2AYEA 2RQCA 5J2MA 1B64A 1C0UB 1T05B 3UVJB 3NY0A 3CCWA 4R25A 5LMUF 1RLDA 2F65A 3BF4A 1CS4B 1FDBA 1ZM4A 2VBYA 4PYDA 1VJWA 3PEJA 4DR3J 3GG1A 3RBEA 3MHYA 5HVGA 3LUYA 2XMVA 1KWMA 4KC5A 3MMBB 4P7TA 3TEGA 5HQMA 3EGZA 3FVVA 1QD1A 3RW6A 1WI8A 2OKQA 1REVA 2RQ4A 2ERRA 1G1XA 4WP3A 2OPPA 4DZDA 4I0WA 4AL7A 2R7TA 1CQNA 2CA9A 2R4FA 4ZKAA 1VBXA 2KN4A 1RT7A 2BW2A 3PYEA 3R2CJ 1S1XB 4WK1A 3HK2A 4G75A 3DU6A 3TNVA 4CO3A 2FC9A 1XTZA 2ZM6F 4DFPA 3D1OA 5LSLA 4JI2J 2POKA 2E9TA 1GK8A 3CJSA 3KK2A 1AFJA 3VALA 5IT9Y 1AXQA 4WKYA 2N3OA 1EHWA 1SPBP 5EWGA 4LF4F 4U7CA 3OJSA 2OSRA 1IKYA 1GMVA 2O01C 1NHVA 3DLKB 3L7PA 4PABA 1LK7A 4RBTA 2E5JA 3ZTSA 6FD1A 4GKJF 2OEJA 1SL0A 2R2RA 4A8QA 4NLDA 5T7LA 4DN9A 4FBUA 1GQEA 1OY9A 1RWPB 2BKNA 2H65B 2HS0A 1Z2LA 2IHR1 2B9XA 2J8AA 3H42A 3R6GB 3MMBA 4LVOP 1RADB 3ENWA 4YY3J 2W7OA 4F3MA 5B09A 4B3SJ 3DA4A 2AWZA 3BV8A 2VD3A 4DPOA 3PR5B 3HHEA 3VA9A 4NLUA 2OPSB 2Y0SD 1J5OB 1TVRA 3CNQP 4MIWA 4EYHB 3O1LA 4HR2A 3TZYA 2EXUA 1IXKA 3M6XA 3VWSA 2DNNA 4DQRA 4USHA 1Y5LB 3ILLA 2JB3A 2BE7D 2ZE2B 2HNYA 2Z58B 5BR8J 5DDPC 2F63A 3M30B 2KM8C 3CXCR 2HNZA 4KIAA 4DV6F 3M32B 4U95A 2EFOA 1U5KA 4DV1J 3AA8A 1AA1B 4XPCA 1X0FA 3M8PA 4K8RA 3G82B 1KKHA 4I2QB 1N0UA 1Y3KA 4X62F 3VQSA 4X4SA 4ECZA 4DFKA 2GAHC 3V6KA 1N4LA 4DSIA 2HHWA 1X4HA 1W26A 3VHQA 1KVJA 3IAM1 1HYSA 1RT2A 2JFKA 4MIBA 1JB0C 2BACA 2OGUA 2XMJA 2WSFC 1JLGB 3HSDA 4ZCMA 5FLXU 5GAHU 3KG1A 3J81Y 4QW9A 1U48A 4LFCJ 2J9CA 1PIEA 4HHUA 2EG1A 1QAXA 5D15A 3OVAA 1YITS 2K06A 2M3DA 5C7PA 1DTTA 3FFIB 2AHOB 4ICLB 4DR2F 3OL8A 4WU2A 2CQ1A 2ACMA 2ACYA 3T9ZA 2XI3A 1FTRA 2MGZB 2ZZNA 2JVRA 1C1BA 2KT5A 1R8PA 4OHZA 3W2WB 7FD1A 2WZ1A 2G0JA 3RAXA 1NH7A 1LKZA 2PD1A 3JSYA 1RUSA 3T1HF 1W7WA 2IFXA 3IRXB 4WE1B 1UPPA 2RU3A 3JYTB 4IR1A 4Q7AA 3GMGA 1RWKB 2G2YA 2J9DE 3O2IA 3P45B 4GVBB 4LR8A 1VMBA 1CS4A 3BM7A 1IR1A 3MCNA 2YPYA 4KO0A 4AYBD 1X4CA 3R1HA 4GKKF 3D7SB 1N34J 4DX5A 4J9SA 2AF6A 4HI2A 2VG6B 3MGJA 1NSQA 4OIXA 2B8QA 4X4TA 4IOAQ 4ER8A 1NPPA 2M88A 2XTJP 3OQ2A 3N79A 3FCVA 1Q95G 4DR1J 3TRGA 5BR8F 4OV6A 3HVWA 5IM0A 3ZTOA 4LF9F 3KMQA 4QU7A 2X1FA 4O3PA 4DV3J 2MLYA 4P73A 3G87A 3GYXB 5SZTA 1IR2A 2A2CA 2RDDA 4CO4A 1OWXA 4KR0B 1JMTA 1IM6A 5KG4A 4EEYA 2FGOA 1MG7A 2E5IA 2UXBJ 5DQIA 4MT1A 3HI9A 3DDKA 3NNHA 2VKZG 4NE9C 2XO6A 4RLEA 2UU9J 1WC0A 4F2RA 2YTCA 4Z2XA 4Y3CA 2DISA 4H4MB 1HQEB 5K8PA 4DV0J 4JV0A 4HH1A 1S57A 5RUBA 3GFYA 4ED4A 1SIWB 3G6YA 2C22A 2KXHA 4OJ3A 4JI7J 4YHHF 3CIZA 3I31A 3W9IA 5KTQA 2JEIA 2ALYB 2BKPA 2GJFA 3LGMA 1R0BG 1T9XA 2B5JA 2CPHA 4J5OA 2R8GA 2HAFA 2YNFA 2UZAA 3L4BC 4KKOA 3ZO7A 5IXUA 4Z7YA 1N56A 3CD0A 2E1PA 4KRWA 4C8YA 4G1PA 3AY0A 2JAEA 2LXUA 2ASYA 2HNYB 3DRYA 5EGYA 1SL2A 3CCRS 1TKXA 2QMWA 2HBQB 2R7WA 2AGOA 3H40A 4IQMA 3R9LA 5J2PB 2HFNA 1RAGB 4UQTA 1CJKA 1GNKA 3IMQJ 5F41A 3KUHA 2BYCA 3MCSA 5BYSA 4AL5A 5LNK1 3G8QA 2ABYA 3R5BA 3TP2A 3ZZPA 2W7AA 3DFEA 4MH8A 3TJAA 4CLUA 2DHHA 3OLAA 1N48A 4EWTA 2ASLA 2UUCJ 3M4XA 4PQUA 4RNNA 2GGPB 2F40A 2WVCA 4CM2A 2ROPA 1CJTB 2Q1LA 2R7SA 2RHSB 2BUNA 1RT2B 5DGBA 3H25A 3OUYA 2DNYA 4I1TA 3JQMA 4B3OA 1MW7A 3HHLB 1CPZA 3M8ZA 2D1CA 3OXGA 2GC8A 2Z2MA 3D68A 4HH0A 3PIOQ 2DCUB 4PG4A 5B0EA 4ZVSB 3CCJS 1XMQF 3W66A 2NLWA 5A0YB 4ZVPB 2RRAA 2HNZB 1VQNS 5K5MA 1GXLA 1L3KA 3NOCA 2QEXS 2HWHA 2HQDA 3RBDA 4LRDA 1RWWB 2J0XA 2GSCA 2FUG1 2LXIA 3DC2A 3EICA 3QBCA 1OQ3A 4FDFA 1VI7A 1S6PA 1TR0A 1TUGB 1X4BA 1IM4A 1JIHA 4K2JA 3CD7A 3TWZA 1MN9A 3OFEA 1FNOA 1K1SA 4P71A 4AXJA 3DLJA 4ZIVA 3M6VA 4RZRA 3DKDA 2HVEA 3DHWC 1S1UB 1SUQB 3G86A 3MM5A 3PTWA 3A3PB 4UOFA 3BN4A 3W7BA 5CAAA 2B6AA 1VHFA 2WBRA 2VASA 3O5TB 4Y34A 5I42A 1FNXH 1IQTA 3AQOA 3H2LA 4YZDA 4DDFA 2MKCA 4R8UA 3KLFA 2ZZMA 4CLSA 4C8KA 1HNZF 1HW9A 2W24A 2PA8D 2DNZA 2IBKA 1QY7A 4IO1A 2HZCA 2BE2B 5CYMA 2VBXA 3VAIA 1YTYA 1M5OC 1R8CA 1G4CA 4N7TA 4DR4J 1GEHA 2KXFA 2J7KA 1NDCA 1Q8IA 1NM2A 1HLWA 2DY1A 4ILMA 2QA1A 1FWPA 3ZZTA 4EZ6A 2B4PA 3LP2B 1FRJA 2C1EB 4NV5A 2OAUA 4NA1A 4J90A 4OAUC 2JDJA 2G1DA 1WKKA 2LMIA 3FDSA 4O0NA 1S72S 2XYHB 1RWMB 3TUJC 4X4PA 2BJDA 1IWGA 3K2YA 4GVLA 4F4XA 1BHNA 2V5HG 2Z30B 3OXLA 2HVHA 2KFYA 3RZAA 3HFVA 1SH2A 4Q8EA 3KLFB 4OZJA 3H90A 3G6VA 3D9BA 1SJRA 1BXNA 1UEVA 2IYIA 2IAJA 3GYGA 2AW0A 1S4FA 4OYOA 2Y3YA 1JLBB 1ZOTA 2B7BB 3CO9A 2OTLS 3DOMB 4NMLA 3U1NA 3BR9A 3B78A 2HQGA 3RR7A 3QQCD 3ZTQA 3G9CA 4QWCA 4YZ9A 2F3JA 2ZH7A 3HKZD 2DNLA 3US5A 2IM0A 4M5MA 3MURP 4C8ZA 3AD8C 1F5AA 4KGVB 4TY8A 3P3DA 4X4UA 1KN6A 1WELA 2VFRA 3CDEA 2R8JA 4FVCA 4BWMA 2ZW3A 3OTOJ 3B82A 2OD6A 2AV5A 1FX2A 1RTIA 3BGOP 3FZ2A 5KOXA 1GX5A 4CO5A 4Q43A 4IRKA 4NCAA 1WOOA 3WHIA 5DQHA 2I6WA 1DLOA 5C5JA 3TQ1A 3BDEA 3T9NA 3DOLB 3AXMA 4CZCA 1S12A 3FBVA 4RX6A 3JTOA 2ZBQA 5A8RB 2B5JB 3U27A 2HWTA 1IKVA 3R5AA 2CNKB 1N52B 2WVDA 3MEGB 2M2BA 3U02A 1LEOA 2B4OA 4J9MA 3M9OB 1VQ9S 2UVRA 5A8WB 2A0FB 5L1KA 3WQPA 2P6TA 3R7BB 2XMWA 4TLRA 2OPQA 2B4VA 2YNGA 2V50A 1XIQA 3QMQA 3QO9B 1KQKA 2DT9A 3DMJA 3S1TA 4XPEA 1UJ6A 1JLAB 4CTAB 4FYWB 1JX4A 5E7OB 5T7LB 4DZ6A 4W90B 3L09A 2MZ1A 2FLLA 1NSPA 3VGUA 2XMKA 1TDPA 4USIA 2JHEA 5KFVA 2ZRRA 3BGUA 2G0CA 3QFHA 2ZVSA 4YB7A 3CCQS 1SCJB 2VQEJ 3CTRA 4IYQA 3I96A 5IM0B 1IKWB 2EVZA 1V9OA 4RW7B 2ZKTA 4DPXA 1RTDA 2R42A 2HKEA 3CJ0A 4USVA 1EIYB 3CPWR 2E9RX 1T05A 2JNJA 3BZQA 2AJ1A 4L73A 1O8BA 1AROP 1Z1ZA 4C8NA 1LW0B 4FF3A 2YX1A 2HG4A 4P72A 2PMZD 2CAJA 2YH0A 1TK8A 3GPAA 1EAYC 2ZH6A 1N36J 3M1VA 2AT1B 3QT7A 2EPIA 3UR0A 3PW2A 1M0SA 2AJ2A 2EFQA 1U6BA 4JCVE 2BZ2A 3QSIA 4FN5A 4MKVA 2ZH9A 4NZ0A 3MECA 3MPWA 2NYHA 4BLGA 2E5HA 3ELHA 2ZWPA 1QTNB 2BVZA 2C2RA 2CPIA 3C3LA 2BBEA 1U8SA 3MM5B 3IS9B 4FNHA 5CYQB 2J6SA 8AT1B 1SC1B 2VODA 3NBPA 3KHGA 3BSNA 3HD2A 2MSSA 2H4YB 1S4EA 1Q53A 1JLCA 3TJ9A 1YZ6A 5G0RA 1T95A 2IC3A 1QE1A 1SC6A 2GV1A 3MDFA 3HSJA 3MAAA 1LFWA 2VPYB 3MAQA 1OY6A 2LKZA 1UWBA 5AXMA 4FBTA 1FRMA 4N8OA 3UDVA 4ECSA 2M52A 2RH3A 2AP6A 3OL6A 1FO1A 2Q3PA 3RG6A 4C0OC 2JJ4D 3Q24A 1A0OB 4DV3F 1JJ4A 1FX4A 3DRPB 2PI5A 4JI8J 4PUOA 2YQ3A 2R7UA 3PYDA 5J2QB 3JQKA 3OR2A 2L48A 2NYIA 3P4UB 3PO4A 2PI4A 3KNGA 2FLOA 3LP1A 4OI4A 1WG5A 5LSOA 2VA2A 3Q83A 2CJBA 1K0VA 4USTA 4EO8A 2H48B 3I5CA 2AEFA 2AJFE 3VVTA 4AE5A 2HHHJ 1Y5NB 1JLGA 4K4VA 2QGMA 2J6UA 3QRPA 4H4KC 2FDNA 1CLFA 4LREA 4OI2A 3VAJA 2QZGA 1QJHA 4DMZA 3S01A 3SMZA 1RA7A 3ISND 2V8GA 4G1QA 1YJUA 3TEHB 1RT1A 1VRTB 2V4RA 2CJAA 1WOPA 2MJUA 2DGVA 2MHEA 4ZCIA 1EB0A 3GV8B 1FFWB 1F9EB 1VRUB 4CNYA 3QJPA 2AMCB 4KSEB 4ZVQB 1GMWA 2BJ7A 5JJBA 1KTQA 2L1LB 1CJUB 1UJ5A 2XLIA 4DV5F 3R7SB 4A46A 4NV2A 4CLTA 4WFYA 2KHDA 2OPRB 3ZZYA 2PEHA 2PMHA 1SH3A 4ECWA 3T1YF 2ZH4A 3JB9k 4OQJA 2C2OB 2MJNA 3EGWB 4EGLA 1H7XA 2I2YA 1VK8A 2XTQA 3J7AN 2OPQB 3NCPA 3TAMA 3OTOF 4URGA 3OHAA 3KK2B 3HVRA 1TP7A 1UPMB 3H20A 3HZGA 3WZ0A 2QLFB 4RW8A 2EFNA 1RTZA 5KFNA 5LJ3Y 2J9EA 3G8SA 2GS8A 1SQFA 2X3GA 1MNEA 3ETOA 1GTHA 2DR5A 4NLOA 5C2CA 4TU8A 3C15A 3T1AA 2P5VA 3Q22A 1C0TA 4KH0B 3MR3A 1NK8A 2VBWA 1ZAXA 2P9EA 1DQAA 1B0PA 3GIRA 4N76A 1LXNA 2DK2A 2HEKA 4MYTA 3NAHA 4OX8A 3CCMS 2KT3A 1JLAA 4CTAA 3L95X 4H4OA 1PYSB 4KGZB 1YJNS 3NNAA 1UA1A 3AT1B 5B0CA 3BYPA 5IV3A 2MQOA 4DQSA 1HI0P 2MKSA 1TAUA 2F8HA 3IG1B 2DXFA 1S6QA 4Z37A 3LJ2A 1HYSB 3C8YA 1KFDA 2VFSA 4Y2CA 1TK5A 1QUPA 4QIGA 2CFXA 1VCTA 2PEBA 4LF4J 4UW2A 2E1MC 1R8HA 2GFFA 4LRBA 1WTFA 1YKWA 2B43A 2J0WA 1IWAA 3FJ2A 3N6MA 5KFXA 3DXBA 2OMLA 3QAEA 2MTLA 4Y6IA 1IBMJ 1FCAA 5KFJA 3FFIA 2ZDOA 3PACA 4ICLA 4HL9A 3V6DB 2UP1A 4IRDA 3KTQA 2H5IB 3AJ1A 3H4DA 4ECTA 1A9NB 3GONA 1MU2B 2UUAF 1M5SA 3IO1A 2HNDA 2XTRA 3GSIA 4NWBA 3A13A 3MR5A 3SXLA 4MK7A 2NREA 4RNOA 4J9KA 5HL7Q 4ZCLA 1RBLA 2CWXA 3BBFA 2HRTA 3EM1A 1PILA 4YP3A 2XMMA 2DJWA 1TTHB 3AD9C 2LQ9A 4PL3A 4P52A 2L9WA 4ZP9A 3KK1B 1N33F 1X0PA 3BGFA 4DL6A 3MUVP 1DQ8A 3MEGA 2QLXA 2UUTA 3POTB 3CCES 1V3ZA 3MEEA 1TMMA 2MQ8A 4TNOA 1O51A 4C3LA 3TAPA 1WG4A 1VQ4S 2UV8A 2HYIB 5J2NB 2N7CA 5LL6d 3KLIA 1TKTB 1S0MA 5KG5A 2B7CB 2E29A 4TLQA 4BC9A 1RCOB 2OIHA 4Q0BA 1NCLA 1K47A 3LGNA 5KFYA 5THWA 4DBQA 4TKTA 4CT9A 2GMJA 1R43A 1NJXA 3BH7B 1MN7A 4NYPA 4HKQA 1X9MA 1KVIA 4KH1B 1RT5B 1DBDA 5E41A 2CQ3A 4KAIA 4FF1A 3QPIA 3G4SS 1DHMA 2BQUA 2FJEB 3DRXA 1CJUA 1HNVB 5KG6A 2IY5B 2YKAA 4PWUA 1DY3A 1FESA 3DLEB 2BRLA 4ETZA 1FRHA 3R6LB 4OX6A 5DLFA 3D54A 2UUBJ 1LWFB 3W5ZA 3MM9A 4LSNA 4C7QA 3P49B 3Q8QB 2BX6A 2VPXB 1KHVA 4JYAF 2BJ1A 2M0GB 3DM2B 1JXEA 2OUGA 3QIPB 1VISA 4QBUA 2KTQA 3VZHA 2NXUA 3NLCA 2IMOA 4M1KA 2VJVA 3VAFA 1N88A 4DF8A 3N5FA 3UQSA 1T9WA 1QLNA 2CQ0A 2KM8B 3D3BJ 4QCLA 5K20B 3QRRA 1S1TB 2JZ5A 4NXNJ 2FY1A 2H54B 2J5AA 2OHDA 5AXKA 4V19J 2H51B 2Y0BB 3C2PA 1CG2A 2YKQA 3I0RB 4DL5A 2R9LA 1KFSA 1RT3A 4F36A 1ROFA 4F0KA 2OELA 1VIOA 1FKAF 2AYGA 3CSKA 3C15B 1RA6A 1B4SA 1UP1A 3L9ZA 4MTPA 2KXNB 1JXVA 3M8QA 3LJ1A 1FE4A 3ADAC 5DZ6A 5CCMA 2XI2A 5HROB 2Z4PA 2V4JA 3K57A 3T6BA 4B3OB 4LR9A 3TUIC 5H9FK 1H74A 1MMDA 2HHXA 1HA1A 3ITHB 3SBMA 2LFVA 1UWBB 4OX7A 1RBOB 1S9GB 5A0YA 1GXUA 5IT4A 4Q8FA 4TQSA 2V2KA 1JLCB 1HWLA 4PG5A 3TJ8A 4F67A 3ISZA 3HF5A 4ED6A 1HQ2A 5KT4A 4K5RA 1NEEA 4PYAA 3I9V1 3VQTA 5IWAJ 4JV2A 2CPJA 3D6FB 4DWIA 4G3IA 2YKOA 1ACMB 5ADZA 2EWHA 3PX4A 2LP4A 3E01A 4HHJA 2XMTA 3W5XA 5EWFA 1WD6A 2XGPA 1WWHA 3IAS9 2R7RA 4IG0A 4O44B 1QM9A 4K0KF 2ZD1A 4DL4A 2VOOA 1F60B 3EGNA 3J80U 5KFWA 1X5TA 1R27B 3E8OA 2XG8A 2BA9A 3GR1A 2R7QA 2KJVA 4ILRA 4W98A 2J0QD 1U1PA 3VAMA 3CJ3A 3BEGB 3H5SA 3D5MA 3QIDA 3M8RA 1ZH5A 2PGCA 1HNZJ 4ED0A 1VQ6S 3F44A 2BJ3A 1ZBTA 2BJ9A 1H6KX 3S6EA 5F9NA 3MFIA 2CDQA 1ZM3A 2OTJS 1SJ8A 3WC0A 4H4KA 2XWXA 1HD0A 1REGX 4ECQA 3F41A 2CQHA 3J7YI 4J9RA 3M05A 1U02A 4QWBA 1I1GA 5IC6B 4DV5J 5ETLA 2KRBA 1FJ7A 2MGZA 2VFTA 2GVDB 4P10A 4YB1P 1T9YA 1T9TA 3M6WA 4WWSA 3W61A 4X64F 4AL6A 3IWNC 4IG3B 3SDEA 2XSJA 1A6LA 3TI0A 3B4MA 4HHHA 2Z8QA 4K7QA 4CLWA 3NGRA 3TZZA 4HT7A 2LEAA 4JB8B 4XTTA 1U1QA 5CYQA 2OI2A 1J5EF 2A6OA 2PSZA 1S7IA 2LEPA 3LGHA 5F9LA 1S0NA 2QSBA 1Q16B 1NHUA 1G3OA 3DO9A 1WJ9A 1ZZFA 2LYVA 2NPFA 2CADA 4DXLA 2UUCF 2W2MP 2YNIA 4NYZA 4B3SF 3CMAS 2VKRA 1LWCB 2KG0A 3CMES 1CJVB 1YLXA 2XBPA 5D0HA 2OH2A 4CYUA 1OQ6A 4K4XA 3MM7B 2KHCA 1BQXA 5JXSA 3T19A 3ZNJ1 2RHQB 5I3PA 2CZ9A 4WTOB 4LF1A 2BW7A 1R0CB 1U0SA 3HCXA 5A8RA 4DG1B 2GHVC 3PW0A 4L75A 1H98A 2W4CA 3P8BB 3AOAA 2KH9A 2VICA 3B8HA 2V8PA 4NMXA 1HPZB 5I3QA 5BYRA 2IVYA 3HM9A 1KQSR 1URNA 3FKBA 4RJVA 1WEYA 3PJ9A 2LQ8A 3PCOB 4HEA1 4OJ1A 4OHWA 4RO0A 3HJVA 4MAKA 4ZP8A 5HI7A 2C2MB 2ZM6J 5H9EK 3PFEA 3UO0A 2BDPA 3LOUA 2N4CA 5D4OA 3CWJA 3LH2S 3CJRA 3FCWA 3PFOA 4OYIA 2D41A 4LF5J 2HMIA 3TOQA 2H1YA 3HZEA 4R0EA 1FXLA 2U1AA 1PJ5A 3VV2B 1VRTA 4RR5A 1HBUA 2WB1D 2E66A 1HQUB 4NLPA 2RJZA 4J9NA 2JEJA 1L3UA 4ZVUB 3MEKA 3RB6A 1JLQB 5A8WA 5U47A 1WHVA 1N6QA 1S77D 3GV5B 4QYZK 2E7WA 1U1RA 3PZPA 1X9WA 3O6QA 3KK3A 4OLPA 3LP0B 4FYXB 4M63A 1KEKA 2ATCB 2B9YA 4ZPVR 1KDNA 3FNBA 1Q8LA 1AZSA 3CIMA 2NXCA 2XWYA 3Q2SC 4NI2B 2OP5A 4ETXA 8RUCA 1K8AT 1BQNB 1N5QA 5H9EJ 3Q8YA 2JB2A 4OZ0A 4WXWA 5D77A 4I67A 2H4WB 1FD8A 4Y00A 4LBIA 2NQPA 3R3TA 4PXCA 1FXRA 3J7Z5 3MECB 3M8SA 1URRA 2RF2A 3MM8A 5LSRA 3SV4A 2Z2ZA 5GAGU 4A8KA 1JJHA 1YJTA 4I7FB 1LW0A 4O1PA 7AT1B 1S10A 1WF2A 2MZQA 3KP9A 1F0XA 2BV3A 4A4JA 4EBEA 2F9DA 4G65A 4O23A 1YG0A 2DVIA 1TUWA 2V94A 1C1CB 3UPFA 4LF8F 3MPVA 3QIPA 2JX2A 4JUZA 1FWKA 3QT8A 3FBEA 4HT5A 2DO0A 5AJ3J 1NJZA 1R8AA 1S1UA 4Z7HA 2YKMB 4NEYA 4A8OA 3I5BA 5G0RB 5GVQA 1FHTA 2MZRA 4LFAF 3FRYA 2HAIA 1NJWA 4N77A 1VQOS 4WPAA 4C8LA 5ETRA 5D3GB 1RGVA 1YBUA 1HHQA 4CI0B 1JJ2R 2GVZA 1S1WA 4KGMA 1XJWB 4A8SA 4DL3A 3CCUS 3CD6S 1KLNA 2JL9A 1X5OA 2QL7B 1E6VB 3HX9A 3ZFVA 3JAMY 2X1AA 2A10A 3EGVA 4DPTA 4ES3A 4F50A 3K59A 2DCLA 1EETB 1VIXA 4DL0C 4I56A 3EWGA 3TYTA 2BANA 3FGVA 2K3IA 3MEEB 3I0SA 3IR6B 1HL6A 2RAQA 3GYNA 5J2NA 3SDJA 1FK9A 4BDPA 2NZ4A 4OFZA 2FZGB 3DI6A 2MY8A 2VJUA 2ETDA 3MWBA 1IN0A 3ENVA 4PEOA 3SCJE 2MQPA 2V69A 2E7VA 2Y1RI 2IRYA 3RBXA 1R3NA 4ZK7M 2MZJA 1TZ0A 1QSLA 1VQMS 3DOKB 4JBCA 5D78A 1RT5A 2G1HA 2DNKA 4ZVTB 4I6YA 6AT1B 2BQRA 3H0PA 3UFCX 4PRFA 2RQMA 5KG2A 4PG7A 1NRKA 4B02A 4DN0A 2CUYA 5E2QA 5L1IA 1T94A 1I94J 2HVIA 2XLJA 2G9OA 3RRHA 5EN1A 4H54A 3W2WA 2BL7A 2X1BA 4DV4F 2XY7A 2B3TB 4DLGA 1W2IA 2XQCA 1TL3B 4MKYA 3EZ5A 3CB4A 2CPDA 3NMAA 1I3OB 2BANB 3IAM9 2E8GA 1Q4RA 3GTYX 4UUWA 3BSOA 2O5DA 4CLLA 3MCOA 2G0IA 2VPZB 2CDRB 1U1OA 2IJFA 5CZVA 3OTBA 1MMLA 3R97A 2BR0A 4M8LA 1R31A 1F1BB 1N5TA 4ZVRB 4QWEA 3HSGA 2IIHA 2YKPA 2DR9A 2KJWA 2YWGA 4A8MP 2H5EA 4ED3A 2QJ3A 5F0UA 4X2BA 1X7VA 1YJWS 8ATCB 1HWJA 4I68A 2I1RA 3M9NB 2CQIA 2DKOB 3W2VA 3DOMA 4JI5J 3FBBA 5LOQA 3KUGA 3ENAA 4A8XA 2FHJA 1GT8A 4B9NA 3NOGA 3PM9A 3ILJA 2V8HA 1BY9A 1LWFA 4OZLA 5DG9A 4F7VA 2B56A 4Y2MA 4NLGA 2RKIB 5IQQA 3QJJA 5DS7A 1C0TB 4E0DA 2DYAA 3DLGA 2DH8A 4B9TA 2F66B 2BJ8A 3PYFA 1JLFA 3ZZRA 4F26A 2XYGB 4B9MA 3BBBA 3I82A 4QR1A 1ZTTA 1APSA 4NCGA 3WIVA 4H4OB 1KLMB 1RBAA 2C2ZB 3SFGA 4RUBA 4WZQA 2G4BA 1U1NA 1VS3A 2GIFA 3DU5A 5KFLA 1P27B 4CWBA 4D3HA 4ZJQA 3QT6A 1NK5A 4DU7A 1N33J 2YH1A 2C2DA 1VQPS 1VQ8S 3KLVA 2VDHA 2M9KA 2GCFA 3D28A 2IVMA 2BE2A 2M5YA 1ZM9A 3CEDA 1M5KC 3M8PB 5AE2A 1KOHA 4P2FA 2DIUA 2H5JB 4FP9A 2UUAJ 2YKMA 3LJ0A 2HGNA 3UE2A 4UZBA 2OEMA 3PXGa 3FC9A 1DURA 1JKHB 1HKAA 2Q43A 3T5JA 5M2UA 4LT6A 1NKBA 2D3OR 4OYXA 3PO5A 2ZH5A 4FPRA 4G6VB 3W65A 2CPYA 4U7UK 3MD1A 2F9JA 2FJBB 1PG5B 2VL1A 1RT4A 3QLHA 4NLVA 1HI8A 4C2MA 2HVDA 4YFUA 2HBZB 3CMQA 2V8VA 2VG7A 2ZD1B 1OYEA 3M6UA 4U9RA 2DNGA 5L8RC 2L41A 1REVB 2K7KA 1YDLA 4KV8A 5C2GA 3HHLA 2GJ2A 4OZ2A 2PT0A 3N6NA 3PR4A 3GFZA 2MLZA 5DO2A 2P9GA 4WFXA 4DV0F 4U7UD 1D1UA 4LFBJ 4OJHA 3TVYA 2CRLA 1D8ZA 2FJAB 5HJXA 3GJRB 2WONB 3HULA 4XIUA 2UU9F 1FA0A 4C11A 2AD9A 4ZLJA 4DPWA 2CNOB 3UCZP 2QLWA 2GGPA 3U1LA 1VYAA 2DNHA 2PFFB 2KKMA 2W2OP 2HFUA 1VFJA 2FPHX 2NUHA 5HGIA 4G1IA 4NRTA 2WVBA 5HBMB 2DD8S 3CJ8A 2W9CB 4USJC 2FLPA 3UW1A 3K5PA 3KK3B 4N41A 2X7IA 3MPYA 2BE9B 4CDIA 2VPWB 3VVUA 1RB0A 4CNZA 3LTOA 3BO3A 2ZBIA 5HVFA 5I3UB 1XR7A 1U26A 1JLQA 3O3LA 5DZ7A 2M8HA 1TV6A 4NI2A 1BMQB 3TO8A 2W9AA 2AQ4A 3RB0A 4ZPTR 4LUBA 2RNEA 2KVQE 5ITHA 1UJ4A 4KGXB 1V5IB 2V8DA 5A8KB 1N34F 2IA6A 2R7VA 5IS2A 3N6LA 3ZNUA 3OW2R 1V3SA 4LFAJ 1EKSA 3UD5A 1AZSB 3SCIE 5KAKA 5KFHA 3MM6A 3UDLA 1V6HA 5F8HA 4KFBB 1RYRA 4DQPA 4CYUB 5GMEA 5L38A 4ED1A 4C4WA 2GVDA 4ED7A 3FNNA 5AJ3F 3JTPA 4AQYF 4JOUA 4L3KA 4ELVA 3BPSP 4JV5J 4DV2J 2YQ1A 1UFLA 3ZZ0A 2D9PA 3RJMB 3CJKA 3G8TA 2MKHA 3FBFA 1WHYA 4DG1A 4DR2J 4CM0A 4IR9A 1TVRB 4JI8F 1X5PA 4Q2MA 1BQMB 1HD1A 2W01A 4DL2A 2BOAA 4X4NA 2GQQA 5GADI 4MYUA 1SJ3P 4B3MF 4K0KJ 2FHKA 1NLKL 4O4GB 4KHPF 2HFOA 5J1NA 2MKYA 4U8VA 2KO1A 2LCWA 4IDKA 2DRAA 4KJIA 1C1CA 3OV7A 4L72B 1AT1B 2GA7A 2IA0A 3BDPA 4OYAA 4PWDA 3LWLA 3QJLA 4PG8A 1EX8A 1CSJA 1SJFA 1VBZA 3I55S 4AS3A 4JV1A 3K89A 2NXNA 3RW7A 4ZJOA 2UXDF 2ZC4A 3TW0A 3AB2B 4QWAA 2V4QA 1H2VZ 4Q2LA 5DRKA 4LF5F 4DUYJ 1U25A 3KJVB 4DV1F 4ED5A 2HW3A 3OFGA 1IJFB 4M5JA 3CW2C 2B4UA 2IMWP 1HR0F 4IQXA 2NPIA 3C16B 3JQJA 3NEKA 4IOCQ 3GZ7A 2N4DA 2DXEA 2UUWA 3UI3A 5GADU 1RAEB 3BQ1A 2OFGX 2R8IA 3W64A 3BO4A 1DTQB 1BQNA 1MROA 1SIZA 4WF9Q 3AB4B 5KG7A 1DTTB 1H0HB 5A6WA 4DJBA 4O1OA 4ZN1A 4YOEA 4XDCA 3ZXWA 2QFJA 1U6ZA 4WYLA 2IJNA 4X4VA 4QR2A 2RRNA 4ELTA 3LF0A 4IO9Q 2UXCF 3GE9A 5F8LA 1Y3JA 3CF5Q 3VCDA 3DN9A 3TQEA 1QSYA 2WONA 1GTEA 3GIIA 3DOLA 4B9VA 1Z4UA 1R6YA 1VHIA 4RNFA 4GMKA 3AA9A 4WK3A 5KFAA 2CNLB 1DRZA 2XMXA 2DNRA 3R5JB 5B08A 1TL7B 3Q8DA 2BRKA 2HK2A 5E0OA 3CULA 2KFZA 2MY7A 3IBCB 3O8WA 3W62A 1ULRA 3MUTP 2Y8WA 3K8VA 1NKEA 2OEKA 1UVNA 3SCLE 3I4HX 5HMWA 3DYAB 2VQEF 3E51A 2MZTA 1P9QC 2K1RB 2AEJA 2MQMA 3N28A 1SQGA 3OR1A 2CJQA 3I32A 3I87A 4I64A 1WSRA 4KV8B 4LRFA 2QA2A 1BUXA 1HW8A 4B17A 5HBMA 5IQ6A 2W9CA 1CQMA 3HHDA 1ZPWX 4JI4F 1KR4A 3EPGA 3Q86A 1SH0A 3RYLA 3CJ5A 4B08A 2N82B 3J81U 4DV4J 3TUPA 1WI6A 4YN3B 4QQBA 3RRKA 3Q8PB 2V34A 2F8MA 1XR5A 1SXLA 2QZ8A 2ZHOA 3ZTRA 1HWUA 4ED2A 3V6JA 1N8RT 3LP2A 1FRLA 4QOTA 3EXCX 4YDDB 4CIOA 2QYGA 1CULB 5B7WA 2XLKA 4B3RJ 1Q78A 3RR8A 3TARA 2MPUA 4ZVEA 2YWWA 1SJ1A 4OAVB 1UVJA 1U24A 1WORA 2HQCA 3I6PA 4ANDA 1HPZA 4U6PA 2GHWA 5IOLA 4YUDA 2W8KA 1D8YA 1ZS6A 4ID5A 3LPEA 1RI7A 2Y9HA 2RDIA 3MEDB 3TAMB 2KDOA 3QGIA 3Q2TC 4K4YA 4JI5F 4TY9A 1NDLA 1TQLA 3D1HA 4DR6J 1T0TV 4DSKA 2HIYA 1QVFR 2V6AA 3MCMA 1X4EA 5ETTA 2MKKA 1Q79A 4XO0A 4EBCA 1M1GA 1KLMA 3PHTA 3VGTA 4ECRA 3C46A 3G96A 1U7LA 5KFEA 4F4AA 5FLXY 2HSEB 2FJVA 3MD3A 3SFUA 2PIIA 1FDAA 2AGQA 3LAKA 2DHGA 5CZXA 3CC2S 1NK9A 1ZM2A 1XR6A 2O66A 3AJDA 4IFYA 4D3GA 4DQQA 2RT3A 3OHBA 3NXZA 4AD6A 1B7YB 2A2DA 4KHRA 3ZC4A 1Y9OA 2QA4G 3SEOA 4ID5B 5BJRA 2AJ4A 3VAGA 3SQGB 3PJXA 1QAIA 1B99A 3HT3A 3DLEA 1UFWA 2DNPA 5ETVA 1SC4B 3TVKA 1XBWA 2FVRA 2D3UA 4K4UA 3L7OA 1F3FA 3QWPA 1Q7LB 1S6PB 2G2OA 3EVMA 4NZ7A 3TX8A 1TL4A 1RAAB 2QV6A 3SSSA 2MQQA 1SKRA 3FEYB 4Z7GA 2Z2YB 1VBKA 5D6GA 1HMVB 9ATCB 4J9UE 1UWAA 4RNMA 1DFDA 2E1CA 4DR6F 2DEJA 2VHGA 1OS5A 1AFIA 4ZPWR 1RT1B 2ZOGA 3PNIA 5F3ZA 2QC3A 3GU0A 4HACB 2CJ9A 1S9EA 3RAMA 2WCXA 3FBCA 5M2RA 1IBCB 2BL8A 4NASA 3EE3A 4NLXA 1AW0A 1AUSL 4LQ9A 2KVIA 5KT2A 2QO3A 3RB4A 1EP4B 1YO7A 1HARA 1S6UA 2ZKUA 2XC9A 2XCAA 4FXWA 2UVVA 4CO0A 2FEFA 3IM8A 4LSLA 3GJTB 1N5YA 2LLZA 2XNRA 3PRBA 3L7UA 4I4BA 4UT4A 4WFAQ 2HIQA 4IG0B 4J9LA 4DS5A 3GLJA 3Q8VA 5CQGA 1DQ9A 2KRRA 4QW8A 3WDOA 5JUMA 3TAQA 1RACB 5CYJA 3KKFA 1BE4A 1CC8A 4MJKA 4LFBF 4WJBA 1NNDA 1PBUA 1TL1A 2WBMA 3C6TB 4LF6J 1FERA 1T3OA 2UVUA 4CRJA 1T02A 1E6VA 4MKBA 3TX0A 4GC7A 5D8HB 2A1BA 2DRDA 4DX7A 2X3DA 3BGRB 2EFGA 3CCZA 2JC1A 3UDEA 1IR0A 4BWJA 1X4GA 3K7RA 3M2RB 2KL8A 4RUHA 2ZITA 3PDNA 4E98A 5KFKA 2IC3B 4X4RA 5J1PA 2EC0A 1SC3B 4F2SA 4JI6J 2HHVA 2W25A 3BSCA 1HBUB 3HHNB 2EFPA 1S6QB 2VB6A 2CPXA 2HGKA 3UN5A 4EI2A 2A3JA 1XNRF 1X4FA 4IDKB 3QRQA 5AXNA 2LQJA 1S76D 4UQGA 2V2VA 1ZZNA 3IWXA 4PWDB 4O4GA 3FVYA 1UVMA
chains in the Genus database with same CATH topology
3PW4A 3E3XA 4A47A 1HBNB 2CIMA 3V5RA 4JI7F 4NOHA 1YJRA 5H9FJ 4A48A 2LECA 4NYOA 2R8HA 3IG1A 3ISNC 4Y65A 1H2UX 3QAUA 4URQU 3IGVA 4RBUA 2VG6A 1N6QB 5L1JA 2O67A 3N5BA 3BSAA 2LDIA 4PR6A 5KFQA 3LP1B 3VR1A 4FS1A 2IM3A 4IFVA 2YWEA 3X1LB 4EU0A 1TL5A 5T14A 1LV5A 3M2VA 4ZS6A 1IBLF 1UA0A 1X4AA 2DGUA 3SSRA 5DM7Q 2HLTA 5A8KA 3CDBA 2WK4A 3DMJB 4E8UA 5I3UA 2DNOA 2J7UA 4IKAA 4CH1A 3G71S 2AJQA 1TV6B 3Q8RB 4DFJA 4OL8A 1VGYA 5KFFA 1YJ9S 4K50A 2V9WA 3IN5A 3EYZA 5CH7B 4DR5F 2I38A 3UD3P 2FJXA 1HI1A 2WRMA 3BB5A 3N01A 4OX9F 1HBMA 2I5JA 1UETA 3KLIB 3UCUP 4MFBA 3LALA 3DXSX 2RB7A 1NK6A 2IRXA 3MZIA 1Y4ZB 1DARA 4EO6A 1WHXA 4OMFG 3BJYA 1PC4A 1KS2A 2KI2A 1U4BA 3OPKA 2E9ZA 2AX1A 3NGDA 2M4MA 1QE1B 1XERA 4Y28C 3AAWB 4YDXA 1IKYB 5HLFA 1F9FA 4OJGA 4GO7X 2LDYA 1U2RA 2MZSA 1SB6A 2DGOA 2FHMA 4X4QA 4QIEA 1S6OA 2VH7A 4U6RA 5B0BA 2MJFB 1JKHA 4ZA1A 5KFUA 1JLBA 5EX3A 3HHLC 4OI3A 5KFOA 2OPSA 5LXYA 3WC2A 3GIJA 2GO8A 3THPA 4G76A 1S97A 3V4MA 4LFCF 2JOQA 2X1FA 5E3CA 3P49B 1DTQA 3TR5A 1U1LA 4KB7A 1U49A 4IH5A 3PVXA 1FJEB 1YJVA 5AE1A 1GXTA 4DEZA 3DLKA 4R0JA 3VF0B 2L9NA 3FZBA 2GIQA 5KFBA 3PEHA 4QWDA 1KSPA 4O3OA 2D3ZA 2JLEA 2P22B 5KFIA 2YNHA 3MF5A 3IXQA 3HMJG 4A8YA 2QMXA 4DWLA 3H59A 2JB1A 1D3WA 2QT7A 4ES2A 1Q7YT 1KNZA 1IKVB 4I69A 4HFVA 2Q6BA 4TYAA 1RTDB 4I2QA 1QTMA 3MFHA 4YEAA 3M9MB 4DSLA 4N56A 1T03B 2QIFA 2HPUA 2ZDPA 5FJ4A 4K2XA 1C2PA 1DZ5A 2GMHA 4KHMA 5J2MB 3T3FA 1D9FA 3DLGB 2HNDB 2HS4A 4RW7A 2XS7A 3I5AA 2OPRA 5E5NA 3K5OA 2YX7A 1QVGR 4O3RA 4ECXA 2DPJA 5CA5A 1PC5A 3CJ2A 1HMVA 2ALZA 1L5UA 3AH6A 2NSCA 1QAYA 4NL5A 5E3PA 5IZHA 4ZPDA 2IAJB 2K19A 4GO5X 1YRTA 3BREA 4HEA9 4QR0A 4RW4B 4RW6A 3IA0A 1BQMA 1I6JA 1HBMB 2I5JB 3N4WA 2Q6CA 4KTQA 4RUAA 3C6UB 2JLGA 5C42B 2ATLA 2IP6A 2W8LA 4GXTA 3CGIA 4UY8T 2KU7A 2ZUGA 1UVLA 3HKWA 2CVEA 1DAXA 4C0HA 4IH7A 2HFZA 3OFHA 3TA1A 1OPIA 2VFUA 3NBPB 2VG5B 3JSMA 2IM1A 1DLOB 4O0IA 2HGLA 2AGPA 3IAS1 1RT3B 2EW9A 4DHVA 4NLQA 4WYWA 1BGXT 2YFBA 1C4CA 5I4MA 3SYZA 2ADCA 2X1GA 2DH7A 3DDNA 4U67Q 4OI0A 1MWYA 3DCAA 1ZPVA 2J7WA 3RB3A 4RUCA 1S1TA 4M95A 1FDNA 2EBEA 4IRCA 5KG0A 1W3SA 5K9FA 2R7XA 3M32A 3OTCA 4MKAA 1NK7A 4Q0BA 2DNQA 3SQGA 3DA3A 5AXLA 3P6YC 3M30A 5HROA 4EZ9A 1MU2A 3NG8A 5CCLA 5K14A 4OZ1A 4RU9A 3CE8A 3M8QB 5KFPA 4PG6A 5HMZA 1N54B 2HLUA 3D0GE 4DFMA 5F8MA 4B9LA 1JNRB 1X8DA 3I0RA 5KFSA 4FBTA 5KFDA 1HBNA 3NCRA 4Y2IA 1N0VC 4ZCKA 1E6YB 2WOMA 4PKDB 4C3MA 2RE1A 1GX6A 2LVWA 4QIFA 3BN7A 1HHTP 4PQUB 3QZ8A 2YKNA 2CG4A 4PXDA 4R5PB 3TARA 3MMAA 1F5BA 3S8SA 4LVNP 3BQ2A 1F5CA 1FJCA 3I4PA 2UXBF 2ZJQQ 3HPOA 2WW8A 3FEZA 5KFZA 2PC6A 4J9QA 3T5KA 1M5PC 4M5DA 2NR0A 2ZH8A 1VLYA 5A6PA 4Q0BB 1TKXB 1YGYA 3NAIA 4DX8H 1J2VA 3MR2A 2XEXA 1UVKA 4O3QA 3JYTA 3OUYB 2BM0A 3Q8SB 4F4WA 3Q23A 1FE0A 2OPPB 1YQHA 2KB2A 3DRSA 4PXEA 4IUFA 1UL3A 3KLGB 2CQGA 4DOZA 2K1RA 4J9OA 2Q66A 4Q44A 1VQLS 1UAWA 3I9V9 3PHEA 3EPIA 4FS2A 1MSWD 4KPYA 4OI1A 4NRUA 2C28A 1S99A 2V6EA 1P1TA 4HLBA 2IBOA 3DOKA 4YB5A 3LP0A 5B0FA 4N5SA 3JSRA 5DETA 3RAQA 3AHPA 4ITSA 4RW9B 2H9ZA 1Z2ZA 3MI7X 5EWEA 3H5YA 3EX7B 1U48A 4C11B 1LOUA 3UWTA 1XWLA 3P23A 2RDJA 2KZMA 4OHXA 4BC7A 4CO2A 3FSYA 1XEZA 4F8RA 4X84A 2P6SA 5IT0A 1KRPA 2CZ4A 4BBYA 1W25A 3KLGA 2E44A 2HWIA 3TANA 2FJDB 2GIRA 3BO2A 1HQEA 1MROB 4LF7F 2CZVC 2ZHAA 4ECVA 5DLGA 1WF1A 3NWGA 3MTJA 5HMXA 5L9NA 1X4DA 4KKOB 2V1CC 4J37A 4TU9A 4NLSA 3G6XA 2CAZB 1TK0A 2EFVA 2EK1A 3BS9A 3V6DA 2YNIB 2DBBA 4ZVHA 1NJYA 1G7CB 2CPFA 2NS1B 1NJIT 3OXFA 3I0SB 3CJKB 3N9UC 3FQKA 3LANA 1JWWA 5K8OA 2YNHB 1KD1T 5F8JA 5EX0A 3LPYA 1LW2A 2GX8A 1ZTWA 5D4NA 4YQWA 2XMUA 5H1SV 2E1AA 2RILA 4PQAA 3TA0A 1U45A 2JEGA 2KKHA 3C66A 1FJGF 2HHQA 3X3UA 4C97A 2ZJRQ 1CVJA 2JEFA 3NL0A 1TFYA 2DNMA 3OLBA 5LXRA 3MR6A 1PSDA 1FK9B 3H4BA 2BABA 2Z2LA 2HGMA 1YWXA 2QSFA 1G6BA 3LAMA 1GAOA 4AS2A 3HDSA 5E3AA 3T5LA 1TL3A 2SXLA 3V81B 2MQNA 3BGLA 4OLOA 3WBZA 4CH7A 3CUNA 1Q81T 3PY8A 4L6V3 4ZHRB 1FRXA 3NS6A 4YY3F 1A7GE 5GAEU 4DV7F 1SKWA 4MFBB 1K9MT 4ERDA 2YWHA 2OFHX 2GO9A 3C6TA 4NZ6A 1S49A 3H2VE 4ZLPA 2ZH1A 1FXDA 2MHNA 4MIAA 2DHXA 3KNAA 1H38A 1KC8T 4DR3F 2K7JA 4FVMA 4P6QA 2RVJA 2RF2B 3MM8B 5D4LA 5A2QY 2DH9A 2N3LA 2R2TA 2CJKA 4BCAA 3K58A 3GSDA 4DS4A 1FKPA 3S7RA 5J1EA 2FLNA 2OMOA 4O3SA 4DR1F 4RW9A 1TKZB 4OHVA 1LWEB 5F8NA 4PPZA 2RRBA 5GMKa 3L3CA 2MKIA 1RJJA 2R2UA 3L0IA 3OVSA 4GC6A 3OVBA 4HTIA 4PCQA 1FTCA 2JLFA 4X4OA 2I8EA 1WNEA 4F02A 3H98A 5E3RA 4KE5A 4X66F 1N36F 3OTEA 3RRGA 2JVOA 5E3QA 4ATNA 4EFAC 3QZ7A 2V4JB 4FF2A 4TYBA 4QJVA 5JVHQ 2LEBA 2M70A 1G2EA 4CQ1A 3FEXB 4LIRA 1D9DA 2M8DB 3IRWP 4F25A 1QSSA 2WSCC 3CCTA 4I6WA 4ES1A 5SUHA 1NK0A 1YI2S 5K14B 1VC0A 5C25B 2CVIA 3M1VB 2ZH2A 1VQSA 1YIJS 2MDAA 4WU3A 1QUVA 4QYZJ 1O5JA 1WG1A 1N6QA 5DGAA 1VC6A 6FDRA 1HQUA 1V3RA 1RT4B 1NK4A 4YR2A 4IOBA 2IRUA 2IYGA 1E6YA 3IS9A 5IWAF 3F56A 1RYSA 1SI9A 2IVFB 3KLEB 1IUJA 4CO1A 2FB0A 4HDGA 1UEUA 3HVTA 2W9BA 1Q82T 2I9SA 3KG0A 1RISA 2C3PA 3D0IE 1M5VC 2BJEA 1TL1B 2C3OA 4RW6B 4PXBA 3FQLA 2V9KA 3DRRA 1S0OA 1N5SA 2B6AB 2WOMB 3DGPA 3HLUA 1B0TA 5L9XA 5DG8A 1FRIA 1S7HA 3TA2A 2HQIA 2PN6A 2JC0A 5C24A 3EXYA 3A1YG 2HRYA 4ZPCA 3H5XA 2DR7A 4KBIA 4ZMMA 2DGXA 3THTA 5C42A 4ZP7A 1Y7PA 4NXNF 3OBIA 3N0VA 3LWMA 2MXYA 5B0AA 2DB1A 2YNGB 3QO9A 2HS3A 3CDWA 1PGZA 3H5UA 3DLLQ 1C4AA 1HHSA 4RW4A 3NKYA 1BLUA 3POTA 4RWXA 4JI2F 4CT8A 4F4KA 2FC8A 1WEXA 2XNQA 2AYBA 4ELUA 1CC7A 3C6UA 3V4IA 1XMBA 1S9GA 1U2FA 2CQDA 2K8GA 4DSEA 2FTRA 2HQ3A 1DJ0A 3D0HE 1PO6A 4A8FA 3K5MA 4J9PA 2DPIA 4LF6F 3DLBA 5MLCV 3RTVA 4LMZA 2HMIB 4HTJA 5F8IA 5HP1A 2MSTA 3OFFA 3R1LA 1MWZA 1T7PA 1N32F 2GQ2A 3OTDA 2RD5C 4TXSA 4DR4F 3MOZA 2QRRA 2O1PA 3SZ2A 2J6TA 3OL7A 3M2UA 4JI0F 2LA4A 5EUHA 1X9SA 3FRZA 3UR3C 4Y2AA 1FVSA 2CQBA 1FD2A 3KJVA 4DR7F 2ZNYA 3ZZUA 2LXFA 1RDRA 1NH8A 4PPDA 3WX4A 4TU7A 3J7ZT 3Q0AA 2FVSA 4HDHA 2YKNB 4R5PA 4QPTA 1H7WA 2XCPA 4V19X 1HWKA 1OO0B 2IM2A 1WF0A 3ZZOA 5I42B 2B51A 1RP5A 3MOJB 4B9SA 4QIVA 1UW4A 1SQEA 2C2EA 5HLFB 3ITHA 4H4MA 3FSIA 5LJ5Y 3NCQA 2E1RA 4UUXA 3P96A 1NB7A 2O3DA 2XO7A 2F8EX 4A8WA 3HO1A 3BR8A 2X51A 2RKIA 2KYXA 2XZWA 2ZNZA 3U7JA 3KYLA 5KFTA 2XY5A 3I56S 4K5SA 1VRUA 4WFBQ 5CD4H 2DITA 1XN9A 5F8GA 4G1QB 2DR8A 1FT8A 4AFFA 3FCHA 4WCEQ 1HNVA 4MK9A 1C0UA 4JI3F 3U1MA 5DM6Q 4C8MA 2C3YA 2Y1JA 2BOPA 2FD2A 1XNQF 5DQGA 3J7A1 4QZVB 5KFMA 2PDAA 4YR3A 4KFBA 3AQPA 3IC1A 2DTJA 4WKRA 3E2EA 1TUVA 1TKZA 4DUYF 1YRXA 4ZVGA 2B9WA 1FKPB 1FDDA 2D7SA 5J1EB 3GWCA 4NX9A 1WHWA 2E7XA 3HVAA 4WFZA 4Y0FA 5B0GA 2NSBA 5GAHI 3H8YA 2VOPA 3GQCA 5AE3A 4DV2F 2YWKA 1BD6A 1XK8A 1YHQS 1U47A 4LQ3A 3NNCA 1R0AA 3JTNA 4EBDA 2OLWA 5DJBA 2QSWA 3IR5B 1JNZB 3PJWA 4NLTA 4N47A 1T8EA 1S79A 2XSFA 4WTYA 2FVPA 5EHHA 1VQ7S 3MMAB 4HVZA 5CXTA 1K1QA 4OV1A 2APOA 3DM2A 1FKOB 4I6AA 2ZOMA 1SKSA 2GNKA 1BWEA 2RMLA 1S48A 4RNHA 5HMYA 5KG1A 3ZZZA 1LW2B 1FRKA 4IH6A 3V81A 3BGRA 1VQ5S 3F4MA 2HHHF 4WXOA 5D4PA 3HXMA 1W2BR 3GIMA 2FHOB 2ZE2A 1UMJA 1L3VA 1TFWA 4JI1F 2DGWA 2FUG9 3PV8A 2C3UA 4YMEA 3QYYA 2BM1A 2DO4A 2ZOFA 2ROEA 1S1VA 3OSPA 1RTJB 1IKWA 3M2UB 1JLFB 2GJIA 1Q86T 1RT6B 3R5DA 2Y1IA 4B3TF 5FDLB 3GG0A 3TUZC 2LA6A 2E5GA 5CHCB 5HQ8A 3NRBA 1L3SA 4YB6A 1HBOB 3LO3A 2UVWA 2RIOA 1IJEB 1YRUA 2VFVA 2LU1A 4RW8B 5JVGQ 3W2VB 4ECUA 1N5VA 3MMCA 2L9DA 5F3TA 4F4ZA 2FHJD 4RKUC 3HHLD 3I9ZA 5DDRC 1JK9B 1ELOA 2B0GA 3MMJA 1N5YB 2F7VA 3R5CA 5DG7A 2WHOA 3IWLA 3UNGC 3ICLA 3ENQA 1Y0HA 2VZ9A 1FEEA 3OR1B 5LT5A 4UOCA 2F6MB 5FD1A 2W7PA 2JRSA 3KFWX 2C42A 3V4IB 5HN0A 4FYDA 3HFKA 2LQBA 1RTHA 1LQ9A 4LSLB 2ILYA 4NLYA 3THVA 1IKXA 2XB2D 4LIWA 2PE8A 1UKUA 3EUNA 1HWIA 2D9OA 4NLRA 5KFGA 1VBYA 1SV5B 3NMRA 1P6TA 1AUDA 5HP1B 3K5NA 4C3KA 1H2TZ 4L3NA 4C98A 1KHWA 1Q1KA 4B3RF 2Z0GA 5KT5A 3KOAA 3A8EA 3CT9A 2CQCA 3TVZA 3MAHA 1VQYA 4O4RA 3J7YU 1T03A 1HFEL 2HRUA 1R0AB 3GV7B 2HHTA 1ZAWA 4FNIA 1J5OA 3VAHA 2N7YA 4F3QA 3FMBA 1U6FA 2MB0B 1KONA 3G6ES 3GR0A 3OR2B 3QLHB 4O3NA 2HHSA 4OI6A 3DRSB 3FSXA 1TKDA 1L3TA 4XDDA 3MEDA 4Y2KA 2CQ4A 2ZJPQ 3JSBA 1OSCA 3VZIA 3PRDA 2MKJA 5D3GA 4C8OA 2EKYA 4K4ZA 3DRRB 5CYMB 4Q45A 1LWCA 3J80Y 2VC1A 3K5LA 1YBAA 4KGKA 4ZPAA 1VK3A 3FMWA 1O0PA 5F0WA 5KFRA 5MAOA 4FZVA 4Q5VA 3IGNA 3KHRA 2HVZA 2XS5A 5K8MA 3D2WA 1YSJA 3CVKA 3GB0A 2COLA 1Y00A 4IFYB 4LSNB 3KHLA 3PKYA 1P8GA 2R2SA 1FNMA 2EI5A 4IFVB 4NCGB 2DIVA